5H80A

Biotin carboxylase domain of single-chain bacterial carboxylase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
463
structure length
430
Chain Sequence
b'TPRVLIANRGEVAVRIERAVSALGWQSVAVYAPDDAGSLHVRRADEAVALSGRGAAAYLDGAALLRVAQEHAATHVHPGYGFLSENADFARACAQAGLVFVGPDPDTLDLFGDKSRARGLAQRLGVPVIPGTDGATTLEEAAAFMQAQGGAPVMLRVVRQAGDLAAAFEQAYAERLIERARHIEVQVAGDGQSVTHLWERDCTVQRRHQKLLEFAPAPHLPQAVRTALIGAALQLAQEVKYRCLGTFEFLVTPGGDFYFIEANPRLQVEHTVTEEWCGTDLVTAQLRLAAGETLTAVGLATQPADAAPPPGQAVQARVNMEVGGGQVQTFTPPGGPGVRVDTFVTTGLTPSPQYDALLAKVVVHRRDAALPGLLRQAATALSEFQIAGVSTNLAFLQALLHHPDVQHYELSTHWLDERLPELVTQAAEYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylase
publication title Hybrid Structure of a Dynamic Single-Chain Carboxylase from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 139
structure length 430
sequence length 463
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain
A PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain
A PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5h80A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5h80A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h80A01
2YZNA 3N6RA 4FFMA 4O7ZA 4HNTA 2R7KA 1E4EA 4J6EA 3TW6A 5JVLA 3R5FA 2I8CA 3BSSA 1JDBB 5CA0F 1UC9A 3AX6A 3K5IA 1KC7A 2R86A 3TQTA 3E5NA 1AUVA 3RV4A 1JKJB 2VPQA 4YJ3F 2NU8B 4O7LA 4WBNF 3KALA 4C5AA 3RV3A 4TUYF 1A9XA 1EYZA 2CNQA 1B6SA 3ETHA 4FFLA 1CQJB 1C3OA 4O7SA 2NU9B 2P0AA 2VR1A 3GLKA 4O7RA 4IWXA 4EAAA 4O4LF 4ME6A 1EZ1A 2X0SA 3JRWA 5HBRB 2GQRA 5LYJF 4XYMB 4WD3A 2V59A 3WNZA 2YRXA 5D8DA 4MV8A 5FNVF 1Z2NX 4MAMA 2NUAB 4DIMA 2V5AA 4IZOA 1PX2A 2DWCA 3VPDA 4M98A 5CAEB 1BNCA 5CB4F 1KJIA 1I7NA 4C5CA 2OLSA 4MV9A 3VA7A 2GLTA 4YJ2F 2Z02A 1KUTA 3K5HA 2CQYA 4GGMX 4EGQA 1EUDB 3QFFA 4O7NA 2VQDA 5LA6F 2WYOA 2SCUB 2R85A 2FPGB 2XCLA 4L1KA 1AUXA 4FFNA 4O2BF 1DV1A 2GPSA 2YYAA 3ORQA 5JQGF 3KREA 5I47A 3VOTA 3GIDA 3R23A 1KBLA 2CNUA 4O4HF 5C8YF 2PVPA 3G8CA 3MWEA 3U9TA 5C1PA 5JVDF 4I4TF 2HJWA 1C30A 4FE2A 4O7YA 2QK4A 2W71A 4IIJF 5CA1F 2J9GA 1B6RA 4MV7A 4YBZB 3BSWA 1ULZA 2NU6B 3U55A 1PK8A 4XYLB 1A48A 2YRWA 4I55F 3KAKA 4EA7A 2XD4A 1T36A 3I12A 5BPFA 2YL2A 2NPOA 4TV8F 2W6OA 4YB8B 3SE7A 2VHEA 4C5BA 1W96A 3JZIA 3VMMA 3KAJA 4FGRA 1GSAA 3Q1KA 2FPPB 1KJ9A 1EUCB 3MJFA 3V4ZA 4DLKA 3BG5A 1UC8A 5BPHA 1VKZA 2W6PA 3ORRA 5H80A 3RFCA 3JZFA 4IWYA 3BSYA 4HQ6A 4IHJF 3ETJA 4EABA 2PN1A 4HNVA 2DZDA 1IOWA 2C00A 4ZOLF 4MV4A 4MV6A 3RUPA 4O2AF 3LWBA 4TV9F 4O84A 2FP4B 2ZDGA 2YZGA 1Z2OX 2ZDHA 2I80A 2QF7A 1JDEA 3HBLA 2W6MA 5C1OA 4HR7A 2DLNA 5LP6F 4FFPA 3WO0A 2V58A 4QSHA 5LXTF 1OBGA 4O7VA 1EHIA 3V4SA 1SCUB 5J2TF 1VBGA 5BMVF 4EA8A 3TINA 2CNVA 3G8DA 3R5XA 2W6NA 2FB9A 3LP8A 2I87A 3VPBA 3U9SA 5IYZF 1KJJA 1CQIB 3TIIA 4EA9A 3UFXB 1IOVA 5KX5F 4E4TA 3U54A 4I50F 1KJQA 3K3PA 4O82A 5JQWA 1VBHA 4FU0A 1M6VA 4O81A 3TIGA 4ZQIA 3AW8A 4O7WA 2R7LA 2YWVA 4EGJA 4XZ3B 2W6ZA 3DF7A 2FPIB 4YAKB 4ZHQF 4XX0B 2R84A 3N8DA 4O83A 4O4JF 2Z04A 4RZQA 2IP4A 2DIKA 3JRXA 5EZYF 5KKNB 2R6FA 4YAJB 1GLVA 1GGOA 5HV6A 4Y8VB 5K2MA 1I7LA 1CS0A 1OBDA 2YS7A 3OUZA 1KEEA 4O4IF 3HO8A 1BXRA 2R7NA 4ZI7F 3BFPA 3OUUA 1E4EB 3R5HA 4EG0A 2HGSA 2GPWA 5JH7F 2ZDQA 2CZGA 5J2UF 4NYEA 1KJ8A 2W70A 2YS6A 3R9RA 2R82A 1WR2A 5GONF 1DIKA 5DMXA 2YZLA 4MV1A 4MV3A 1W93A 4HNUA 4O86A 3MWDA 3WO1A 2W6QA 2NU7B 2YW2A 3VPCA 1M0TA 4MA0A 3NUAA 1JLLB 2GQSA 2YZMA 2R87A 1Z2PX 3Q2OA 1GSOA 2PBZA 1GSHA 4FFOA 3HB9A 4M9UA 5LOVF 4M9CA 2R7MA 4FFRA 1M0WA 4O7TA 4M99A 1DV2A 4MA5A 1CE8A
chains in the Genus database with same CATH superfamily
4BJ3A 1ZUNA 4TMVA 1PQPA 2OHVA 2DPYA 1GGNA 1T0PA 1OXTA 1ULAA 2JBHA 1TF7A 3QJ5A 4JFAA 2C04A 1F2UA 1YBHA 2A7QA 3EVCA 4AJ9A 3I4LA 4DS3A 5HTOA 2ZR8A 4L8YA 2AFHB 2B21A 4I5EA 1BMDA 5T57A 4NY1A 4IIFA 3S8YA 3WLSA 2GLXA 5AOAA 2NNLD 1YU6A 3E3AA 13PKA 1HE1C 2XYGA 2OYRA 2C4KA 4BUCA 5KWIA 5BUCA 4XAQA 2WP8J 2OORA 3D6HA 1RWWA 3B8HA 2XKKA 3INRA 4IFTA 4IJKA 2JH8A 3RFUA 3GLFA 2BWJA 1CF2O 4UOEA 4PQYA 2ARKA 1YE8A 1ISGA 1FMLA 4HLCA 4B3HA 4JI0H 2ZJFA 4FGLA 1R1DA 4DFDA 2YMLA 4BC0A 2Z9CA 2O2HA 2MOKA 4OFBA 3OOWA 4UFNA 3F6YA 3ZCUA 1R12A 3D6VA 5AOVA 1M33A 5AUQA 3BKXA 3FBWA 1QMGA 1ZZGA 3LQSA 3G1WA 2CXPA 4AJIA 1E1DA 3M8KA 2GEKA 4PC2A 4ERNA 1QFZA 4X6LA 1QG0A 1OSNA 1FP4A 4CG0A 1JE1A 3OPYI 3OQ1A 1NN1A 2BEKA 2PSHA 3TD2A 4QU5A 3KQSA 2Z5LA 3VDRA 1Q95A 5LB4A 3PBKA 4GLLA 5E25A 3IJPA 3ZWBA 1ZK2A 4E4RA 4HH0A 3G2LA 2FZVA 1BMFD 4IUBS 3CKMA 2C83A 1WVGA 3HM9A 3FDFA 4MRAA 1C30B 3OZIA 2TYSB 4J16A 1N8TA 1P5FA 4U02A 3V55A 1I36A 2VWQA 3G2PA 2ZSJA 3ELWA 4O3SA 3NBMA 4LF4H 3JQFC 1FS4A 3DZFA 1R8YA 3D6MA 3LXMA 1UIMA 3JQGB 4Z0HO 3ZCQA 1MFZA 3DDUA 3ZU4A 4CMEC 5JIBA 4RA6A 3ZJUA 5GZ1A 3SKVA 3JALA 3MFIA 3T7SA 1GTG1 4YDHB 5L3RA 4HVLA 3BWDD 1XD2A 4DLTA 4PX2A 2HHHB 4JCOA 4CIAA 2Q3FA 1U1DA 2JJMA 4WOBA 2DR3A 5KPJA 3UUFA 2HA5A 2F1JA 2W6NA 3CFYA 3PXEA 4RTNA 1N4AA 4MRSA 1G1AA 4LQDA 1AH2A 3W3AH 1JFRA 1MO6A 1YVUA 2FZWA 1B00A 3KEQA 1UMCA 3BD6A 5AP9A 1SG9A 1E99A 5ALFA 4KIUA 5HCNA 1U99A 1Y9ZA 4Z7OB 5IWAH 3FGZA 1U3FA 3OZWA 1XMIA 1SGWA 3C43A 3ACBA 2EJVA 3PD0A 2GM4A 1NMQA 1TQ2A 2WA1A 4LSWA 4UHHA 4IXTA 5AKHA 1XJCA 4Y0NA 3R8FA 2X1MA 2UUBH 3TGPA 1G9TA 2J7PA 4XH9B 1EESA 1Q7BA 1Y3IA 5IW8A 1JLLA 4M88A 3RUFA 3S2UA 4RV5A 4EG0A 4I55B 4Q1FA 2V7QD 4DUPA 5JH7F 5JJ5A 5J2UF 4D4JA 2Z2YA 2PMWB 5CHYA 4MWGA 3FUTA 4J0GA 3H11A 5DI9A 3U49A 1P1IA 3JD0A 3EXG1 1ENPA 5I5VA 2CLEB 1EFTA 2I4MA 4LJ7A 3WRWA 3MOSA 3IKJA 4YCAA 3WO1A 1IPEA 2A0KA 4IF4A 3QFSA 4I5FA 5I9IA 3LT5A 1CIPA 3NCTA 4EF6A 2YZMA 2F17A 5AJZA 3B82A 3NHSA 4YNBA 5ALVA 3TFWA 1D7OA 2F55A 1NRXA 5DHTA 5IAAA 1HE2A 3GGGA 5ALQA 3TSYA 3GXOA 1ORVA 1GCUA 2VJLA 4PXAA 2C77A 1I50A 4PR0A 4HDNA 3V6JA 1A69A 3RO7A 1KKLA 1A8PA 3CLTD 2IX3A 2PGOA 3PV0A 2JFFA 2XB8A 1AUVA 5AH0A 4ZJPA 2I5PO 4A73A 5JEEA 5ICCA 1OV4A 1J9EA 2WM3A 1X7GA 4CDMA 4NU5A 1HYBA 1O58A 2BUCA 1WQ3A 1F17A 4B71A 3PCTA 2SCUA 3IHWA 3KZXA 4OG2A 1D2CA 1SXJC 5TQ2B 3AFGA 3G0BA 5EHXA 2O23A 4X93A 4EAQA 1GYFA 4BGEA 2IYVA 3GUHA 5FV4A 3BDVA 1ZGJA 2B7LA 4KSBA 5KJEA 4ZT3A 3HN6A 1H4VB 2ZAYA 1A4IA 1Y6ZA 1ENZA 3HCCA 1SKQA 2Z02A 2X4LA 5BQFA 3TY5A 1XCLA 3I5UA 9ATCA 4BXOA 3N2GA 3UV7A 1XJWA 5BV1A 5HF6A 1AKVA 2OCPA 2PZ8A 3KLPX 4MW4A 5GADl 1RRVA 4LZJA 4RACA 3LM8A 1H9CA 1KMQA 3DEZA 2B2CA 1CKNB 4AUEA 4MLDA 4BLWA 3PW7A 4PRYA 3W3AD 4GUAA 3BGVA 3UCXA 4L7QA 4FMPA 3VZQA 4AY6A 1SR8A 1E77A 3NB0A 1F3OA 1UXKA 2W6JD 4CKXA 5HM6A 1JIHA 3CX7A 4Z2YA 4CEIA 2W4MA 4YB8B 4X44A 1O75A 4C5BA 4LMBA 4TKVA 5KFUA 1FTGA 4TSRA 3L0YA 5EIHA 3F5DA 1G5PA 1J97A 3FLAA 5FBLB 3OZAA 6REQB 3LAWA 5EMNA 1Z0KA 2HIVA 3BBPA 1LTQA 3FUVA 5ED0A 2PN1A 4I9HA 4M1YA 2JNWA 1I2AA 3ZHRA 4CNBA 1O2DA 4M38A 2E6KA 3KZOA 3C6ZA 4GO1A 3DWIA 3HB1A 3TDNA 2FU5C 2LP4Y 2OBNA 4FE4A 2WSLA 4JQCA 5KQRA 1E1QD 3I53A 4C89A 1ECPA 3E5HA 1QO9A 2NPIA 5LXTF 4JB8A 3DUFA 4ABYA 2ID4A 4HXGA 4O4LB 1QZ3A 3LCVB 1VI2A 5EE9A 2HFJA 1D9XA 1FLDA 1VXOA 4ZVNA 4O4HA 5HOEA 4HUQA 2YOGA 1VJ0A 3ESAA 5I7VA 1UMBA 5CE8A 2ZZNA 3K9HA 3DO8A 4Y6QA 3M4XA 2GSWA 1TM3E 3ITDA 3PNLA 5TPWA 2CXQA 3OTQA 3DYVA 3PS9A 2GBLC 4KP7A 1RAIA 3KQHA 2D7DA 1K1SA 1K6MA 4LFAB 1U0EA 3GVXA 2HYIC 5JWOA 2WU8A 2O8CB 2HRQA 3PUJA 3MXTA 3IBCA 5KNCD 2ZTHA 3RGZA 3B36A 2JARA 2P8JA 5KFPA 4UZFA 2L42A 2YS7A 1EXNA 2WP0A 3I09A 2A1UB 5WRFA 1T43A 1G5RA 4N3GA 3WGTA 3H5IA 2YBEA 2GMWA 2I22A 4D6PA 2VHWA 4CL3A 1B6GA 2VHYA 3QBJA 1ODJA 2XYQA 2PX2A 2D1SA 2D5CA 3WK7A 3KQOA 3PEWA 1IN4A 5KT6A 3GAZA 3RABA 3FPAA 4MRVA 1ZR2A 2R3SA 3R7FA 5BWVA 4QU8A 5G0VA 1M1UA 3BD8A 1TM1E 1RC8A 1QP8A 1P9LA 1E5TA 3C5HA 3HKBB 2QTVA 3ZCXA 3W5IA 3FMAA 4L95C 2JASA 5HR5A 5BOVA 2CSXA 5JFOA 4ECWA 2FRXA 4UDXX 2PZFA 2P90A 3V4OA 3BF8A 2H52A 2FZ4A 2PKCA 4O7TA 1ZHOA 2Q3CA 2LDBA 1VE7A 2Q9BA 3F5SA 2YZNA 5EQFA 1K68A 4BEWA 2JEOA 4WFKA 1CUUA 3MBOA 3DW1X 1L7VC 3RHSA 1IMJA 3E6AA 5JAIA 4HS9A 4ZYTA 2WPNA 1VSUA 4PGGA 2CL6X 2B25A 1YTUA 5KFBA 4OX9H 3K72B 4KWHA 4FFLA 3NEPX 3BWMA 4JL5A 1CE8B 4N65A 2H57A 3G9QA 1FTNA 4AXBA 3U7FB 1A8SA 5AK6A 1P9RA 3ZKAA 4XVUA 4CQLA 5G3ZA 4B5LA 3DLBA 2BEWA 4PLCA 3I2KA 3ZWWA 2YMQA 1NQWA 1PVDA 2PGJA 3ED1A 4KK3A 2QL6A 4GXNA 3WA6A 4WKNA 2YJ6A 3IERA 3E9MA 2YV5A 3M6MD 4O2BF 4MDFA 4B3RB 4LF8H 3NALA 5DP1A 1OFUX 3VH3A 1UC5B 3UAXA 4TLCA 4IUYA 1EFCA 4B3TH 4QSMA 1GEGA 1MEOA 5FD6A 3C39A 3LKVA 2SHKA 1WTAA 2XZOA 5REQB 1O95C 1UBJS 5I9NA 1R4MA 3IR5A 1K5DA 3H87A 4YIKA 4IP0A 2C4UA 4KRFA 4BNFA 3DG9A 4TKMA 5LL6b 3CRZA 1N5RA 4IHKA 4RWZA 5ALSA 1Z25A 3MXOA 4CV1A 1AKQA 3IHLA 5BOSB 1B74A 4Y7DA 3W4JA 2E5LH 3PVZA 4X1KB 4G4SO 5FAKA 3CF0A 1VBFA 3BRSA 3R3YA 4GPTA 1AGYA 4GECA 5E1BA 4WAUA 5CJPA 3KPVA 2BKVA 3OTHA 3AERA 4ERXA 1EP9A 2HEGA 2BDEA 1XTPA 4UAGA 2XD9A 2FUKA 3BBLA 1BVHA 1CUHA 3PQCA 2CJWB 2C5AA 1AZWA 3SZGA 3P7MA 1GD1O 4FX2A 3NANA 3UWSA 1JQDA 4G1FA 4D3YA 3IT1A 3VI4B 3QZ8A 3ELDA 2QUZA 4MS3A 4DNXA 2V0GA 3NHRA 1F0NA 2CDBA 3U37A 4F2WA 2PM8A 3VV3A 5DFAA 3RAJA 1CULC 2E4YA 1R7RA 5KX5F 2QAGA 3FB4A 3A2KA 4C6SA 2B6NA 1PJLA 3E3LA 4NENA 1R6AA 3GBPA 4JI0B 5F52A 1F9EA 2FXVA 1II9A 3L1IA 3NKFA 4UMVA 2QLMA 2YV2A 3QEKA 1L5NA 3E4CA 4LX0A 3HBFA 1A9SA 3AM4A 4D5EA 4IDAA 3QTTA 2XXBA 3OUZA 2JVKA 1Y42X 4BTEA 4GHWA 1Z63A 3HDVA 1FY2A 4D92A 2HWXA 2P68A 4GLFA 4DB2A 3A10A 3DE4X 2WK1A 5EP3A 3UJ9A 4PQRA 1WLSA 4ZN6A 4BNMA 4P32A 2YS6A 2IXAA 1G20A 2BE9A 4HB4A 4HGQA 1RACA 1AXRA 3EF0A 1WW8A 1A27A 1BKYA 2W8LA 2A57A 4QTUB 2UUAH 1U3GA 2Q6IA 2VPWA 4DNOA 2GASA 3MCZA 3RYFB 1KEEB 1MXFA 1XSEA 2DBRA 4R8LA 1AMOA 3WOVA 4RU1A 4L9SA 1DWPA 3F5MA 4NBKA 3J81A 4OI2A 2VH5R 1ZJWA 1N5MA 3FN4A 3ZDFA 4DNQA 1N8SA 1DV2A 2WM8A 1HLFA 2HU7A 1E1QA 4LF4B 1LC3A 1Y4AE 2EBHX 1E3QA 4CMIA 1T9KA 2ZWIA 1WDKA 3F9RA 1FQKA 3AF5A 3KXPA 1X80B 2PE5A 1AKYA 4V0QA 4DZRA 5JSKA 4R1UA 2K2WA 3D5EA 5KT7A 4ZMSA 4P3XA 3ZQ4A 1ZMXA 4O5AA 2HWWA 3NI2A 4UVDA 4ZV7A 2IYXA 2FWPA 3PRHA 5BR8B 1E7QA 1ULSA 3QKUA 4OXKA 1FJHA 4RSRA 4YMWA 4BBAA 1TQ8A 4O3MA 1KU0A 4MULA 1IXYA 1TO2E 1Q3KA 4UM5A 4H7EA 4DBVO 2V59A 2O3UA 4HDMA 4NOMA 1JT2A 4G5GA 2C9YA 2BTQA 2QE6A 3NWJA 4LJYA 5JG7A 5FDFA 1NZDA 1NFQA 1X1DA 5FBQB 5G53C 3RARA 1JEDA 2AKAB 1N75A 3FR7A 3KHGA 5EYPB 5IWAB 1J20A 3GEBA 5F4BA 2X2OA 4DQLA 4WV3A 2HIGA 2ZIEA 3Q5GA 1UH5A 2K2QB 1Z2DA 1N9ZA 1BA2A 4C3UA 5JMTA 3L6DA 3RASA 1R50A 2UUBB 1EQ2A 5B57C 2I99A 1HT0A 4PYNA 1DS6A 1FNDA 2BM9A 2ZUWA 2FW0A 3NWPA 2W48A 2WBLC 1K9SA 2A88A 2YJTD 2VCEA 5JXWA 5CR5A 3D0QA 4EL0A 3QQMA 3OEHD 5KI6A 4LISA 1SUBA 3Q8XB 4CM9A 3G6WA 5IH7A 2XWPA 3VPHA 1YQGA 4NTZA 2OD7A 3E2IA 1HSOA 2L0XA 5C5CA 2P9EA 4O2RA 2BFOA 4I4CA 3Q8RB 1UMKA 3TD6A 5LWQA 3GVIA 3J7AC 1YA6A 3JZFA 4COOA 3QWAA 4HAXA 2W2OA 2GXAA 1AS2A 3C87A 3ESBA 2IX9A 2LW7A 4YH1A 3LZ6A 4C4RA 3LKZA 2NTVA 3NEAA 2ZAOA 4MR9A 3ZE9A 1ISJA 1G7CA 1J7KA 4P7BA 4HG2A 3K0AA 1AUOA 2EBUA 1PZHA 4HRXA 2JKVA 2IDZA 4C0LA 2HQRA 4F93B 3CUVA 4LRTB 3RFVA 4BRSA 1J09A 4PR3A 1H9AA 1Z6XA 2DQZA 1GPMA 4HQNA 1OVMA 1A5TA 4CNQA 3TI7A 1UBHS 1D6MA 1K4KA 2IWHA 5EJMA 3B5EA 3L0BA 3SU8A 3T06B 1L5KA 3VI3B 3DBHA 2IH4A 1M66A 3KKQA 4ZPXA 1YVRA 3LNCA 1L3BA 1W6UA 1ZU4A 3QNMA 5KU1A 4IJWA 4EEKA 3HA2A 4OA8A 1GAEO 2G8NA 2B2NA 4S1WA 2R8IA 1T6ZA 1EG2A 2VBCA 5IP9G 5DM60 2REQA 1R5BA 4P7KA 4ZAGA 4I1OA 5EKDA 4IIUA 5BW4A 2FUG1 2BBTA 4V0MA 4S1VA 4UAJA 1C8BA 3IPCA 2O8NA 1JSLA 3HCWA 3QZ7A 3CEMA 2QMEA 4HAVA 1YSCA 1Y1WG 1V48A 2O54A 3M4YA 4K0RA 1E69A 4ODIA 1N0WA 3TR0A 1JXOA 2EHDA 421PA 3HEMA 5FWXA 3ZD8A 2P9YA 5BVHB 1ZSNA 5JD4A 4RMJA 3RPEA 4PDBA 2IEAA 1JHYA 4A10A 4OBBA 2NXJA 2OQIA 1AKWA 1XEXA 3FLBA 3R9KA 5MDHA 1WXHA 4A0GA 4LJ6A 1LI5A 4Z5XA 4EO4A 3SYNA 4NG4A 3S1SA 4ZK6A 1J06A 1K8YB 3M9LA 2G0TA 5DTEA 4C2BA 2ISCA 2XMSA 2B4RO 5I5WA 2AFIE 3UAWA 5ELXA 1MO4A 5K3DA 3FF1A 2NAFA 2Z09A 4RPJA 5M2QA 1OH8A 2EAUA 1RM4A 2PT6A 2R86A 1WU7A 1JDZA 3JU3A 3DT6A 3MLEA 4O3FA 3WDKA 3U56A 3UWOA 1DAGA 1PW7A 3SG0A 4WNYA 3BMQA 1BHQ1 5C31A 3WGNA 2FW8A 2PA3A 2M32A 4DF3A 5B3LA 1O5IA 3QKTA 4KJZA 3SSMA 2IYAA 2FJZA 3LIIA 4C0WA 5HBRB 5IT5A 3N0WA 3IR6A 3GGPA 1KAEA 2FSUA 2NO1A 3CPEA 4JLMA 3UHJA 2XT9A 4TT8A 1CUYA 3WL6A 4ECZA 4HPJB 2PMEA 3R0XA 4D6YA 5JH7A 3B6KA 5J2UA 1U80A 2IUEA 2ZRMA 1W44A 3V2UA 1HDGO 4II7A 2GEDA 1V5EA 3LRTA 2X8LA 2RONA 4D9FA 4JP3A 3OOEA 4PAMA 3PWTA 1WBJB 2JD1A 1WBDA 4UD6A 1I3QA 4ZARA 4U1RA 4ZI5A 4Q4HA 2FK7A 3MCUA 4CLRA 3MJHA 3G7NA 1QS0A 4DG9A 3D6NB 4HBGA 3RRFA 2JGAA 3RI3A 3MGBA 2C92A 2E18A 1XVLA 4IR7A 3KCQA 4ZGGA 1AKMA 1WY5A 2JGDB 5I9LA 1FDOA 3UENA 4GKVA 1WCMA 4BO0A 4FNAA 5G4KA 2VDOB 1VMEA 3ABIA 3FBTA 4KE6A 4XFDA 2LTAA 4BWVA 4QHYA 2ZBUA 1QTNA 2M05A 1ATIA 4MW0A 1PJ8A 1U2EA 3JXEA 3BMOB 4Z0NA 4KXNA 2IA5A 2WAYA 2B9EA 2RIRA 2PKYX 4LBWA 3EXEB 4AVYA 1JL3A 4RCYA 4CMCA 2SKDA 3P0FA 3Q1LA 5AI8A 4TL7A 3BIOA 5DWQA 1YIAA 4L8FA 1MRSA 1GAXA 4JV1A 5JNTA 3CR3C 5FPHA 4DLYA 2ZSKA 2HU8A 2FP4B 1KE2A 1SWWA 3O93A 4JXJA 3TR6A 1M1YE 2I71A 4EHHA 1KETA 1JHRA 3H2GA 4C6RA 1QV7A 3OLYA 4NBLA 3FRHA 1IN6A 3MJVA 1AS0A 1QJCA 2YWDA 2IV2X 5CP8A 4OX9B 3JQ7A 2WRZA 5J23A 3KQMA 3GA5A 5HKLA 1S01A 4X3PA 1BW9B 4IHJB 2ZANA 3UHAA 3GT3A 3LQRA 3G1UA 2EF0A 4CMFA 4XIGS 4YGXB 4A3SA 1KVSA 1Q84A 4ZK2A 4US1R 1AF4A 3NHYA 3S1AB 5CJ2A 1LX6A 1Y1QA 4B43A 1BWSA 1J07A 1XRSB 3D31A 5K0JA 3AF2A 3PVSA 2OO5A 4HWTA 1KL7A 4MR7A 4YRPA 1KYTA 4D9HA 3NHAA 3D4OA 3E81A 3UMJA 4LF8B 4I4TB 3AILA 1NW8A 3BGIA 3N07A 4B3TB 1C9MA 5AT1A 1I32A 4CM4A 1MX1A 2WWHA 1IG0A 5GGXA 4TYPA 4JCCA 4KXYA 1OZGA 3O8QB 3RC3A 4HZUA 2VDVE 4Z53A 3H13A 3OJ0A 2O20A 1Z5UA 4Q4JB 2I9PA 1DADA 5CFLA 4AJLA 3IBSA 3AIMA 3QVTA 4MH0R 2HQBA 3CZPA 2ZR0A 1OU0A 3E8XA 1RJRA 2AUMA 2VO1A 5LXTA 4IIGA 2E5FA 3FCXA 2Z1NA 4BFUA 1RCFA 3RIZA 3G2HA 3RTDA 2QD4A 5E6SA 2C4HA 4RKRA 4L5BA 4M99A 3H97A 1T13A 4O2AB 3EZ6A 4DKJA 1VRWA 2IPMA 3RYCB 4UHKA 3H65A 2OHGA 2ROQA 1GZ6A 7ADHA 3OPMA 3C0FB 2R6R1 4M0KA 1U0BB 2FX3A 3PDIB 3K96A 4URFA 4TL6A 5HF8A 3WJ1A 5KJCA 2VLBA 4WY8A 4P36A 1O9HA 1XP8A 2BZSA 4XXHA 2WAOA 3EXFA 1CUEA 2XZDA 4AC9A 1E58A 5LN1A 3DWEX 4U7CA 1AHPA 4BWSC 3FPEA 4PNHA 2WWIA 1OXUA 5SV2A 2HN9A 5K01A 1EM8B 2FAXA 3DXFA 1NBWB 4L7VA 2XB6A 3Q3GE 2JLUA 1LLDA 3KPYA 3REQB 1TM5E 3T1NA 3KOXA 4AULA 2ZJAA 4LF6H 3BHMA 4P22A 3D0RA 4JB2A 1EJ0A 1CJTC 3P5SA 3TECE 3ZN2A 1AUXA 2QSZA 5T5QA 1TU3A 2RBEA 2UKDA 5IMSA 3OFNA 4R6WA 3HBMA 2P2YA 3G2JA 1N1GA 4A8PA 1KBLA 1DKUA 3DAPA 3HU2A 2XBMA 3U9TA 1BVRA 3I76A 1U4SA 5FIUA 3IEMA 2A9RA 5BR1A 2IHZA 4FT2A 1NY5A 1Q12A 3VSBA 5KREA 5C7OO 3I64A 3ROQA 2C9MA 3WGVA 1E0AA 4RYLA 3HKCA 4YRKA 3L3BA 1CZLA 2OXEA 3IJRA 2IHJA 4FKMA 4V0ME 2ETVA 4KE8A 5B6IA 3AV3A 2UUAB 5HPYB 2D3WA 2MT9A 5K0LA 3FRJA 1Z26A 3BTVA 1H0HA 1V4NA 2EIYA 1OHHA 3B6EA 3HU1A 5LIPA 1YDEA 5CLHA 4R1MA 1JEOA 5E7JA 1J0DA 3UW3A 4LH6A 4M83A 4GKAA 3H7IA 3HJNA 1IBLH 4H7KA 4ZOLF 2IF0A 4PG5A 3LWBA 1OPXA 2FMAA 3I6YA 4PQEA 1EP1B 2Y1CA 2QQEA 1PS8A 5HDBB 1FDTA 3RB3A 2Y9PB 2JA7G 1J39A 2H4WA 4HVAA 5KTSA 4DWJA 2W83A 3PUIA 3KFXA 1X2BA 4G26A 3ZY3A 1CSEE 3L6RA 3PEVA 4P35A 4TWIA 5CIWA 2CLHB 4O2BA 2Q3JA 4LXGA 3PQ6A 4YFYA 4XTRA 5BYJA 1E5QA 3UHPA 3INYA 3F49S 3PC2A 1UDBA 2ZG6A 4DJEC 1V4BA 3L7DA 5FWAA 4TKLA 2Q5CA 4GG1A 3CX4A 3S70A 2NXCA 1XZEA 2AA3A 3I5AA 5KYKA 1WMEA 3W2HA 1CRQA 1CR1A 3JVEA 1YZLA 2Z83A 3FKIG 3RIXA 1EBFA 1IB6A 4UW9A 4HADA 3PT5A 4U6SA 1DINA 2NVBA 3W8RA 3N2IA 2XE6A 1T9GR 1VB5A 1PT5A 3QF7A 1KPIA 1D0IA 1GVHA 1Z9BA 4YRMA 4N3AA 3U4AA 3W1GA 2IC5A 2ES4A 3UW1A 1WB6A 4IYRA 2V97A 4XX1A 1NMXA 3BE8A 4E5UA 4HEHA 1T5DX 5ALRA 3GOQA 3ZD9A 3A37A 3C5CA 1NWCA 2VJDA 1MHTA 1QRTA 2YWFA 3L8MA 2YZLA 2ZLBA 3I8XA 4RD4A 2RHWA 3EC2A 1CUCA 1WOMA 4YWJA 5FR9A 2JLSA 5J63A 1VP9A 2UVDA 2C5GA 2H08A 4DWVA 5CVUA 3P9IA 4YT4A 3NUAA 4FEEA 1MDFA 5LDHA 2ZBFA 3HOUG 4RWEA 2ESRA 3NHBA 2V4MA 1T3ZA 2I2XB 1RAHA 2JJ1A 5J9FA 3HSKA 5KX5A 3FM9A 4EHBA 3KTAB 1BTOA 5E1MA 5FLEX 5DAAA 3DVAA 3K5IA 3TQHA 2VHJA 4QNRA 2BMJA 3D8SA 4I3HA 2J7PD 3LX6A 3TBHA 1XMQH 3ETHA 4TS4A 1LTHR 4F86A 1OMOA 2VTEA 5AVTA 1GGHA 2P0AA 3KS9A 3KXIA 3I6BA 4Z0TA 2GFHA 1Z0FA 3RD5A 4KHPH 3MC1A 5ARCA 4ZMRA 1ZOOA 2M9MA 2JK0A 3N7TA 1UBMS 3DV0B 4IS2A 5IDVA 2QPTA 4AU1A 1REQB 3GPLA 1C7RA 1VCMA 2MHCA 5HP4A 1GG8A 2A5YB 1BNCA 5A4IS 5BO5A 3I4NG 4F4IA 2ONZA 4IR1A 3OA2A 1ZSVA 2GLTA 5G0WA 5KYWA 3H2HA 4RF5A 4H31A 3NHUA 5DISC 3OLVA 1HRKA 6GPBA 1ZN2A 4MYDA 3FVVA 1HE3A 3IBGA 3RIGA 1CUVA 3TSAA 4FNOA 3G2NA 3W6NA 2FZ5A 3LQ1A 1DZIA 4ENQA 1ES9A 4QLOA 2Q28A 1WP9A 2Q5OA 3NTOA 1KY3A 3KCNA 4J1NA 1N6PA 1U5BB 3C1AA 2OV4A 3E9EA 3GD7A 1DGSA 4I6JA 3JPYA 4M22A 3ZDBA 3HOZG 3WL3A 4G23A 1M1NB 3W79A 3W5HA 4OU5A 2B0JA 3KQPA 2B5WA 4C1NA 4FHZA 1IVNA 1K92A 1JEQB 4C21A 1NFFA 4NYIQ 4MRMB 1IHOA 2ZYHA 4MR8B 2J41A 1KC3A 5DG8A 3AF4A 5C3EG 2OWEA 2OHFA 3SP1A 3RFCA 2JZCA 1J00A 3ZS9A 2BELA 2GWHA 3I0ZA 1SCUA 4BKPA 4IQGA 3A28A 1PZNA 1A9OA 4MAFA 2AOUA 4ZO6A 3R3UA 4KXQA 3MPUA 4ER7A 1N7IA 2VT6A 4O84A 1Y82A 3DMGA 4F8EA 4TM8A 5DE3A 3P8ZA 4S24A 1XU4A 4IMIB 2EG5A 3DFZA 1D3AA 2WUEA 4BLOA 1NHGA 4OHFA 4DL4A 4LY6A 4WMLA 5FPTA 4MPTA 5A7GA 3O4IA 4LGMA 5EE3A 4J1SA 3QHAA 3SF8A 1YJQA 1A5AB 1KGDA 3FKJA 3VO2A 1XNHA 5FHQA 1JQKA 2VSOA 1E3JA 2NZYA 1VMDA 3IOMA 4UE3S 2Y8EA 5TF4A 1KYZA 1IRXA 2H06A 5K1ZA 3GAAA 3E7XA 1A7KA 3BA9A 4KMOA 2DYKA 3HP4A 4RF4A 5LZ8A 5LBTA 4LDPA 1WW2A 5HNEA 3O75A 1DBRA 1WRVA 1UMDB 4DRYA 2YYYA 3H6HA 5BWCA 1A2OA 3V34A 3DGEC 2BH9A 4UBMA 3ZEIA 4EHDA 3DFKA 4NZPA 1JJAA 2XOXA 4Z86A 2ACVA 4XD7A 1CU1A 1IQPA 4FE3A 3LVQE 1CQZA 2VWHA 3M6VA 4MJ7A 4RPIA 4Y1RA 4WW0A 4ESEA 4FSDA 1NXOA 2ZB8A 4G0WA 1K8XB 2IFTA 4P34A 4A27A 4G4SP 1BWRA 2R8YA 4CMBA 2ZQZA 4IGAA 3H9EO 1PD1A 2WJVA 5AUPB 3IDAA 4WWHA 5H3HA 5HVNA 1XYVA 4AMBA 4UCFA 4POOA 4QXQA 1GP2A 1Q0ZA 2G67A 1ESZA 1MVLA 4UHEA 3GGSA 3ENVA 4Z1MA 2Q27A 3OOYA 1PV4A 3F6RA 5EINA 2OQVA 1VHJA 1SUPA 4LHWA 3UATA 5SZHB 1DFHA 1QZUA 1UBEA 1UWLA 2QBYB 2V3CC 1NZJA 4PYKA 2O2GA 1GG9A 3EMDA 4RO0A 4CM8B 5DLGA 3JQ6A 4E2XA 4E6EA 2BFCB 1J0EA 3KEGA 5H3LA 4L78A 1W5EA 1NQVA 3E8MA 3SLKA 2AQKA 5IVHA 4ITUA 4FIDA 3RVDA 5IYCG 2BVNA 3A6FA 2R6DA 2MU1A 3RQIA 2FHPA 2NZ2A 2XB2A 1C3XA 4ZO4A 3WMWA 3NJ4A 3UJNA 3LCUA 2QUHA 2C61A 1ZUNB 4NICA 3MR5A 3BTSA 4J1TC 3AUTA 1U04A 3FTCA 5D01A 1U11A 2E4ZA 1BZYA 4EG5A 4DIMA 3H2KA 4HGZA 3IKTA 1FSGA 4J3NA 4FWTA 1NGSA 3LNTA 2F3RA 2RJOA 2I78A 1RP1A 5D1HA 4Y9TA 4MV9A 4MO9A 5I7RA 3W2FA 4I1VA 3SXUA 3OHPA 4LCEA 5TXGA 3LTEA 4BNJA 2FKNA 4R8UA 3BULA 3WK4A 4CUJA 5BR8H 3GLFB 5KFVA 3KTDA 2Q9CA 4K6MA 5FPPA 4F11A 3CH7A 1UQRA 1LXCA 4V0RA 4UM9D 2O6HA 2ODAA 5DGAA 3FOFC 3BJZA 2W4IA 2W71A 1WZEA 2BRUC 3PL1A 2D0IA 1BOFA 3NXSA 3WLNA 1GNLA 1TM4E 4PN3A 2X5JO 2B3DA 1THGA 4US2R 3ZWAA 3GLQA 3AVTA 3JZIA 1IHYA 2OB2A 1NLZA 4HZGA 4F45A 1ONOA 3KUDA 1PFWA 1FP4B 4ND6A 1X1TA 2NZUG 2LKDA 3CVJA 3QU7A 1KZ7B 5SICE 2RGWA 2GR9A 4CQNA 5CX1A 4KXFB 1JVSA 4ZOQI 4HNVA 4LV5B 1QYWA 2EQBA 5FL7A 5E4YA 2CMDA 3ZE6A 5JDIC 2AJCA 4HEA6 3EDMA 4Y1GA 3C6BA 3GPCA 4ZA2A 2GPAA 4MP3A 1LS6A 4TRJA 1YASA 2XCAA 4UCTA 1T0UA 5AM0A 5B30A 1GRNA 4BV2A 5C8VA 2HJRA 3QPCA 3NNNA 2RGUA 4ZCPA 2JAUA 1NYLA 2V3WA 3AVXA 1G8FA 1FXSA 3CVZA 4BKOA 2ODEA 5GINE 3WKCA 4DIUA 1D2AA 4OQLA 3FWKA 1ZQ1A 3VPBA 3HO6A 4KEAA 3N75A 4EGSA 1N7HA 4D9EA 4LYGA 3L6UA 4NE9A 2W7OA 4RA6B 4OYHA 4BPRA 3T1VA 2G88A 3JALB 2GSDA 4HAZA 4A9AA 4DA4A 1UR5A 4G56A 1XD2B 3AVWA 2JC3A 1JXAA 1NQAO 4R9NA 4RESA 1PTJA 2QORA 1D1QA 1RJ9A 1T5OA 3ZZ1A 1UZMA 2PL9A 2JFOA 4A2WA 4LF6B 3W04A 4EK9A 1BU8A 4PSUA 3MTJA 3LPAA 2LNDA 2IPOA 3ABZA 3SAJA 1R9TA 2LCFA 4BV9A 5FPQA 3NBXX 1U7DA 2FN8A 3AR9A 3K0BA 3RUDA 5BSVA 3DV9A 4E0BA 5TQJA 3A6GA 5KNCH 4YDRA 1UMCB 3CT4A 4TYWA 4PPYA 3RWOA 5JHGB 2GZ3A 1SXQA 4GMDA 4F04A 1XXLA 3DJFA 4INZA 4QBTA 4KRXA 2HO4A 3PTZA 2C2RA 3KQUA 3RC9A 4FQ8A 4B3XA 3QTBA 1GKYA 5EZYB 2C94A 5C4IA 2W8ZA 3WAJA 3IV6A 3PTAA 2QIOA 3RLFA 1JLLB 3MSXA 3PPWA 3Q3JB 1ZNXA 1Y8QA 3PQ7A 3LC7O 4D98A 3HCBA 4X8HA 3PQ4A 2NTNA 3H11B 3VYWA 4YDSA 4Q3KA 1N0UA 3FNHA 4RA9A 1KBZA 4IDOA 1Z4KA 1IBLB 4MW6A 5A3QA 1Z73A 1C1HA 1TQDA 2C5FA 1M8KA 5HEKA 3THOA 2WJJA 4HAOA 1HDXA 5JMOA 3BIXA 3I8SA 3NYWA 4K1LA 1XZHA 5PGMA 4LBYA 1K7CA 4ECEA 1GKLA 1TEHA 1WCIA 2XWSA 1YFZA 3FIJA 3FOWA 3FYUC 4JLDA 4XUDA 4Z9BA 1E5XA 3CW2A 3R74A 1X8KA 4HDNB 4DLPA 1GXSB 1FCJA 4HDSA 4KKXB 4PAQA 3MFQA 5GY7A 4HOYA 1GKIA 4MV8A 1N6IA 1MEJA 3ZU3A 4LF9H 1ZNQO 2Z9DA 4DDHA 1A1VA 3U61B 2K4MA 3T54A 1MAVA 5B3AA 2JCXA 2PUEA 3UXYA 4L85A 3LXRA 2PUAA 4Y2JA 3CTMA 1NXQA 1WU8A 1ZLYA 2VYCA 1N5DA 2Q2NA 2SCUB 3M6FA 5H0IA 1U02A 2YJ5A 1SMKA 1SCJA 1ZOSA 3MMSA 1P2BA 2XH8A 1DV1A 2X42A 3ZV3A 3QPBA 2QW8A 2AUTA 3V3TA 2XC9A 1PV1A 1Y7TA 1DB3A 2GEBA 5MN6A 3L0OA 3BXFA 4IIJF 3IAAA 2AKYA 2EKDA 2X4DA 3IKVA 2JHCA 2I3GA 4C43A 2WILA 1WZIA 1OWOA 3RWMB 3SDSA 3N2GB 3L01A 1HZJA 1QE0A 4AY4A 1SHKA 1UPAA 4LWOA 5I7HA 3HPRA 2AQ4A 4FPXA 4BX8A 3TPCA 1AF7A 1GL7A 4Y30A 2C3MA 4AMYA 3B9PA 2AW3A 3UUGA 1VL5A 5B2ZA 4L8LA 1EUYA 3HXTA 4IKEA 4DLWA 2WE6A 3D4IA 2XKAA 3ADKA 5JNLA 1QZXA 2GA9A 1HMPA 4CEIB 1K89A 1GO2A 1TMOA 3HI6A 3HRKA 5B6JA 3SNHA 4TKVB 4QPPA 3KWMA 1ODIA 4RD2A 5I7FA 2AK3A 2BGKA 1ONNA 1I9GA 4DOMA 5LVAA 3KQTA 1B3RA 1HFKA 2ST1A 4FT4A 3UMFA 1M7BA 5SY9A 2ADOA 3WO0A 1PGPA 3VDXA 1JI0A 4EKNB 2O2JA 1XMQB 2ACWA 4JS0A 3V5NA 4QJIA 1Y48E 3TINA 1XZNA 2V9ZA 2YJNA 4MW7A 1HQKA 3DPIA 2P9HA 1JG6A 4HFMA 4MNTA 4KHPB 1C1XB 4CM9D 5CHEA 3A6LA 3BAFA 1XGKA 4EFBA 1I3NA 1TWCA 1EFRA 3U44A 3GPBA 2I29A 3GUVA 3NVKI 5JANA 3NDPA 3FMFA 1R10A 3MS2A 4IZ6A 1NTRA 3FPSA 5JCPA 4YP7A 2AYZA 3W5DA 1BDBA 3DUFB 1S8FA 3GNQA 1LJLA 3PL5A 1UDAA 1R4NA 1EGVB 4OAPA 5A4KA 4MWBA 1TW3A 3L6EA 4G8CA 1NJ1A 3S2FA 2XGMA 3CKLA 1P3DA 3O4GA 1JZTA 4O4HB 4MDEA 2W7PA 4HUQB 1FIUA 1FQOA 2XVZA 4U7HA 3JYLA 5BNTA 4XUCA 4OTZA 2PXCA 3PZRA 3TNJA 1XWWA 5ICEA 1JKIA 4MS1B 4ZQCB 1U0NA 5I5SA 4K2HA 4KLCA 1EWRA 4J4BA 5TPWB 1OB5A 1IN7A 1TCAA 2DKNA 4CMJA 4ZKEA 4GM0A 4R1QA 4ZOLA 1WVIA 4W7HA 1NYQA 2GK3A 4P86A 5F78A 1H0SA 3DS8A 4LOJA 2P69A 1WR8A 1EUQA 4FDLA 1XTZA 2ZR7A 4QG3A 3CZRA 2G9VA 2CF5A 2YW2A 2CD7A 3WLMA 4MQ6A 1K7FB 3C45A 4AUNA 3N0VA 4PAWA 2Q62A 2I2DA 4NJOA 3H4VA 1UZUA 1AO3A 2NSHA 2XJ4A 4KJXA 4C7MA 1KYVA 4PVDA 2ZP1A 5B58T 4YBRA 2F1RA 2UUPA 3A1EA 3FMPB 4WESA 1HDRA 1X6VA 4QICA 1XZFA 2AFIA 4ZRMA 5KWEA 1X3SA 4WBNF 5CPBA 1ONSA 4QBIA 1I7SB 1RBMA 1XMVA 1LDEA 4C4TA 4U0JA 1RWBA 3NCHA 4FCTA 3L8CA 3JRWA 4ND8A 2O14A 2QU8A 4XYMB 1GT91 5G0SA 2WUVA 1VJ1A 3EJWA 4YRJA 1IEXA 2EJCA 5CITA 2NQ8A 1CVLA 4GM1A 1HETA 4DLLA 5K3AA 1YMQA 4A5SA 5SZKB 4PLGA 3INGA 4O1IA 4O7NA 4QVGA 1VKNA 2R85A 2OV1A 2WNIA 3PEEA 2CFOA 4ZQGA 3JR3A 1Q1GA 2QR2A 2Z5GA 1N9GA 3VKFA 2VXBA 3GGCA 1T5TA 4CQLB 5C35A 2BEWB 2JLWA 2HJWA 4F85A 1IEWA 1HL7A 2GK7A 2QJTA 2DTEA 2A9PA 1CUBA 5CD1A 4I5GA 5JTTA 3OHAA 4WLFA 1J1ZA 4ZQEA 4P31A 4I9GA 4P2GA 2JGEA 1JJIA 4RF2A 3FNQA 5GZ3A 2Z9BA 1SUIA 1IOZA 2PDAA 5I5UA 5KS2A 2DFDA 1P2UA 5T8KA 1G8KA 3ICQB 5LKAA 3GFRA 4Z2AA 2QD1A 2AGVA 4NZMA 3ORRA 1VKHA 3Q0TA 4JYZA 5K3EA 2BY4A 1YB6A 2O5RA 3CRVA 3N42B 1RQ2A 1F8GA 4CPDA 1WKVA 3AHJA 4O8ZA 4JBYA 4BDTA 2QUAA 2NQ2C 2A92A 2VYVA 3NYRA 1OH7A 1R4MB 5DM4A 3FTPA 4RUCA 4Q48A 4YP3A 1SB8A 4PICA 3GILA 4JV2A 1DDOA 1E1LA 4DA7A 4V03A 4AS3A 2JA6A 2BTOA 4B3DA 5KWJA 2IRWA 5ADUS 5L6MB 2FPIA 2GYVA 4O7VA 5DTRA 2IHNA 4QBHA 1Z74A 3IUYA 1V7ZA 4BJ1A 4AICA 4R3WA 4N76A 1M1YA 1Y7LA 1T9CA 3IUQA 3AERB 3FIUA 1NVGA 2VUHB 3EMKA 2F00A 2VUTA 4E4TA 5CFMA 3UHFA 1NBHA 4FXPA 3IMEA 4JX8A 3MCTA 2CMGA 3UQ8A 3RF2A 4B7UA 1XXHE 1WZUA 2YVKA 3W9SA 1X7YA 1NHWA 4GWGA 1M3SA 4XX0B 4FN5A 3OQIA 2A3RA 4YRCA 4P3YA 3UIEA 1YC5A 4PC6A 4WKPA 4DE5A 2NPFA 4B0OA 3IKLA 3PGVA 3EVFA 4UDYX 3U6KA 2QAGB 1C1DA 4PG7A 1NW3A 1DKNA 4NENB 2ZBGA 3QNWA 3JD1A 4MWSA 2HJVA 5IKXA 1P31A 5IASA 2JHAA 1P17A 2DVMA 2VWGA 3S5UA 2WTAA 3NP9A 4F3KA 3ZXYA 1Z4PX 3DA8A 1NE7A 2XSZA 1XZMA 2D1QA 3GTQA 3KB8A 1MC5A 3G8AA 4GOJA 2JZNA 4G5OA 2P9ZA 4X9XA 5AHOA 2TMKA 1R66A 4EG3A 2X5RA 5I4IA 2XQVA 4M55A 4MA0A 1OI7A 4D96A 5D1PA 4COKA 5A4FS 4NH4A 4E1AA 5JRDS 5BV7A 4EBFA 4HJRA 2XB4A 4FDVA 3MFHA 1G20B 3VKUA 4OBXA 3SK0A 1PL6A 3WYAA 3HNOA 4MKXA 2O03A 3O74A 5IAOA 2P79A 3SJAA 1MIHA 2JLBA 1GA6A 3R4VA 2BGWA 1Y63A 3TRKA 4DCCA 3EZ7A 5FTLA 2REOA 2LDXA 1G98A 2F8TA 2VAXA 1Z13A 3K2BA 5DLFA 2IYFA 4D4IA 2VF8A 5GZ6A 1FEZA 3KVRA 4OXNA 3EYWA 5BN4A 1CY8A 3F2IA 2ZTMA 1QONA 4FHEA 4A2AA 4IKOA 4RPLA 1O6BA 4CMIB 3AR4A 2VJKA 4EKIA 2I1LA 5HG0A 4EY6A 4MAMA 3GDFA 2XA9A 4KR0A 5K0EA 3NC4A 4N5LA 4PZ9A 3VPDA 1Y5LA 1OIWA 3LG2A 2I6GA 3H2YA 3WZMA 2X0FA 4BLTA 5CFQA 3DT8A 3AIKA 4PG4A 4G01B 3B53X 3D6TB 4PLTA 3EPGA 5FHRA 3SC2A 1WS6A 4HDMB 3L0ZA 4RVDA 5FTMA 4WACA 2VQSA 2AU0A 2DPGA 2BTQB 5JOQA 4M9QA 4DV1H 1BSVA 1NLYA 5D3MA 4A4DA 4YN3A 2FPPA 4RGBA 4UFZA 5KQLA 5EMHA 1JHOA 2QRUA 1L7AA 2OFXA 2I7CA 1K1QA 1VCOA 2PX3A 3K8OE 3GLVA 5CIQA 5AIBA 1Z06A 2OILA 4NSNA 3WISA 2Q6VA 2Z4SA 1RMQA 3CC8A 4FHGA 4ZYVA 1W36C 1BAPA 4NC9A 1SXIA 3MUFA 4OVKA 4IIHA 1P5RA 4BJ5A 3A1UA 3O0DA 5C53B 3FCCA 3UN1A 2FN4A 1FB5A 2H2GA 1D2HA 1E20A 4UTXA 1ISMA 1JG7A 1HX7A 3F2VA 3IOBA 3KXKA 1XQ1A 2PBRA 3STWA 3KKEA 2QLBA 1GPLA 4QUDA 4YR2A 1IUKA 1BQ3A 3A6EA 4NABA 4UXHA 4QTYA 3A3NA 3ZDAA 2N0SA 4L6CA 3G2KA 5H9VA 1YS2X 4ARCA 2ZU6A 4YYEA 2J32A 3E5RA 3WYGA 3OFND 3EIEA 2BW0A 3CWZA 4AX8A 3CH4B 4QWDA 3B1ZA 3K09C 1U3VA 1CCWA 2WJ4A 3PNKA 4UATA 1U65A 5KCMA 4RKYA 1U0TA 4DGSA 2VP6A 2GFIA 4JIGA 3BAAA 4U39A 1ZRNA 3BQMB 1LPBB 1CQWA 4OIMA 2W2QA 2HHFB 1D2RA 2IZ0A 2O3TA 3UMMA 4YAFA 2ZIXA 5SY6A 2GN1A 3KHSA 2DBYA 3Q15C 2O7RA 2BGRA 1FDIA 3FDZA 1YB7A 3T3MB 4AI6A 3T7EA 1LWNA 5AKZA 2BGMA 4F1KA 5FKJA 4EJ2A 4YUAA 3C6YA 1X77A 4MR9B 3UGKA 4LF9B 2WJHA 4QEZA 3K0AB 1MQ8B 3ZV5A 2IXBA 1T9GS 3GZNA 3JARA 3VV2A 1JJBA 4YCBA 1OHHD 3TLAA 3I9LA 2OB1A 1IQUA 2Z95A 3V2HA 2WB4A 4I7EA 4JU8A 4QT0A 5EFOA 3UWPA 2EWVA 3GV5B 4ED7A 3AXTA 1BWQA 3DBHB 1NRIA 3BFPA 3L1JA 1W94A 1ABEA 4L8WB 5FCDA 3OE5A 4F5WA 5AXBA 3GA7A 4FS1A 1HY3A 4MDYA 1DKLA 4KQIA 4JC0A 2AFRA 4I5DA 3OJOA 1XLWA 1HDCA 4RIHA 1XKXA 1XZQA 5KSWB 1QZTA 4BKMA 1GPDG 1FTQA 5IKMA 1G2PA 3PN1A 1JKFA 4RAQA 1C9YA 4FR5A 1OFUA 3WHLA 1JKJA 1CRWG 1RC0A 4HNAA 3K0CC 1OBOA 1U3CA 2DT8A 3AY3A 1RRGA 3U3KA 1GYPA 3PC4A 1UAYA 3VU9B 4MVJI 4G5RA 3HG7A 3LLCA 3EBOA 3INTA 4LZPA 1Z6TA 3PGXA 4O7ZA 3EPKA 1XMSA 5FWXB 1QTRA 2I8CA 3OZXA 1A82A 2P62A 3IE0A 1XEXB 4L27A 3DDHA 1EJ2A 2DUMA 2Y1EA 3U7IA 4B45A 3BA1A 2UVPA 3C3EA 3PWSA 5AI9A 1P74A 3PGMA 3FWZA 3ZH9B 4FYKA 2G9ZA 1N6RA 4XSGA 3WRXC 3AL0C 3HXOA 3CEBA 2IT1A 1V7CA 1OZFA 4OLAA 1KOJA 2WDTA 3TZEA 2NXWA 4QLBA 3BMQB 3E8SA 4IOKA 3KTMA 2MINA 1M2NA 3K9CA 3G0GA 3H3JA 4PEVA 5I5YA 2BUBA 3GV0A 3N59A 1ELOA 4PIMA 2RKOA 4CM3A 4EJSA 3PA6A 3U7QA 1YV9A 2CFRA 2CL5A 3FMGA 4DABA 3GL9A 1Z2AA 2JJ1D 4XA8A 1HBJA 4GRDA 4AM8A 4H1HA 1WE2A 3IAM1 4PE5B 5DNEA 4MHTA 3FLEA 4EY8A 3MWEA 5JH7B 5J2UB 3MLAA 2NP6A 4RUKA 4FGKA 2VJMA 1N0IA 4ZQBA 5LQMA 3O4HA 1H2RS 1DUSA 3MWLA 2JAOA 4NPCA 2ZSAA 5CVDA 3DXZA 2ZVDA 4DM4A 5KT4A 1TWHA 4KVZA 4Q4HB 2WE8A 4F5ZA 3VMMA 4DEYA 1EDOA 3AVVA 1QS0B 4JQOA 1IY8A 4HEQA 3WKDA 3K5PA 3RHFA 6ADHA 2Y6VA 1SXGA 1KK1A 5AHXA 2AG6A 2I8LA 1TGVA 4DCPA 5G4KB 4XWTA 3RG2A 1IBCA 2XIJA 1Q1QA 4D46A 1TIBA 4M7OA 3C6MA 4KPFC 1SVWA 1R6UA 1EWQA 3WR5A 1HNZH 3N3BC 5CG2A 1I4OA 3AUSA 1OJ7A 4CR6A 1MP0A 3DDWA 3KYCA 5KTOA 1SG6A 2GARA 4C76A 1ADGA 3LIPA 1VA5A 2WI8A 5DNWA 2VJAA 2OENG 3ZZUA 3ZHVA 3HGQA 3MK31 3ESRA 4HAUA 3BRQA 4K9OA 3WNQA 4DIBA 4QBGB 1WV0A 4IIJA 1DJPA 2BGNA 2ODBA 4DANA 4DJTA 3M34A 2H0AA 3TX6A 3CF4G 3EBPA 2R7LA 4FBMA 3DZIA 5ED4A 5KFSA 4NKRA 5FUQA 2H54A 3K6KA 2XEDA 2O3JA 2PV0A 2YWBA 4NECA 2R6JA 2UZ4A 3JQ7B 5JNUA 5BWTA 4AO6A 2H9YA 4LWPA 3PI7A 2CJYA 1X1RA 3A11A 3K1ZA 1LRLA 1QGUA 5F64A 3C5VA 5J4KA 3AF6A 2UZ3A 3GXBA 5DT2A 3WBFA 4C29A 4KBGA 1A9QA 2CUTA 2HCJB 4PX9A 3ZI0A 4I0WB 1IJBA 2RB4A 3RB4A 1LSUA 3L4BC 3C5WP 4JL8A 3Q3IA 3P0JA 3UOGA 4Z4IA 1KDZA 4CDNA 4RZ3A 4XWKA 1MB3A 4UXJA 4M1ZA 2AVDA 1CHNA 3NC1C 5L51A 1SBQA 4NDZA 4PLZA 4PZ0A 3BGOS 3IQEA 1Z83A 4M1KA 2PD4A 1TDJA 3EIUA 5AKGA 1X92A 4L57A 3QVSA 1EKFA 4IJ6A 2W6QA 4MMXB 3GWZA 1A2QA 2NYRA 2PNFA 4MTCA 2VWPA 2H1WA 3DVSX 4YXFA 4NXMH 3CKYA 5DHUA 1RTKA 1PJ3A 2WM9B 4MKIA 3DEAA 2IUFA 5AM5A 4CM4B 1YDWA 2G28A 3KYBA 1NVDA 2A30A 2YXLA 3TMYA 4B79A 2O2YA 1RXSA 4HZUB 2ZJBA 3PX2A 1JS1X 4G25A 1GAJA 4H4DA 3OQOA 3HGTA 3BXOA 4P4SA 2PWBA 3C1OA 3NOVA 1Y9AA 4TXNA 3SE0A 4I1UA 2XAUA 1NDQA 3GRUA 3GC6A 1BHJA 4XD7D 2QVYX 3AI1A 2CY0A 1I6LA 1RQGA 4NOJA 2O3RA 1SIOA 4KIJA 1R4ZA 2FUEA 4KE7A 1H2ZA 1GPUA 4Q19A 3A70A 1NBME 1MOPA 2WSMA 5AD1A 5DNVA 1Z6QA 2YHIB 2O2SA 2HHCA 2VQFB 1ZHSA 3BE5A 5JRZA 3B3QA 2P9QA 1CUAA 5EJIA 4R8KA 1NZFA 5L1IA 2EFHB 1OOEA 3F5FA 4IO1A 4IHAA 2EF1A 5AYVA 1ML3A 1ISRA 2E89A 3UOWA 1CJUC 2EP8A 1P1HA 4Z1MD 1MO5A 3EXFB 3G9XA 2YH2A 5JT1A 4CG2A 3CVWA 3ZIDA 1YGYA 2A9FA 2Q0QA 4WOPA 4QYMA 4JASB 2RJNA 1D1TA 1FTWA 4G1CA 2D2EA 5EEHA 2QJRA 3ZHZA 1E9FA 2WIKA 3A27A 3NOQA 2CNUA 1UOOA 1DAIA 4MGIR 3SHTA 3FMOB 2UV8A 4TTVA 5EAIA 3PW4A 4QDTA 5HK9A 3NBZC 3BCRA 2BPOA 1L5MA 2IOQA 1NT2A 3VNNA 2ODTX 3QFHA 1UJMA 2G09A 4IQ8A 2W6OA 4TGLA 2LVBA 2OXTA 1HLGA 2J3HA 1EFAA 2FG5A 4WBNA 4BWYA 1YUMA 1ZAKA 3A06A 4WK6A 3VR4A 1KA9H 3EAQA 4UUAA 3KT8A 5HZKA 2AC2A 3UYLA 4J4TA 4ED8A 3PHBE 3RVLA 4G81A 3TTTA 3HA3A 3DTNA 3HKCB 1GLNA 3RRZA 4NBWA 1KMMA 2CF6A 1PNTA 1YOBA 3JY6A 4KUEA 1X9HA 4OK3A 1PKEA 3SVLA 2APJA 4LGCA 2OV6A 2DLNA 5BSKA 4OHCA 4XZ3A 4J0CA 1Z22A 1ZL0A 1E96A 4EA8A 2C2EA 1MH1A 1E32A 5K9ZA 3X1DA 4HWGA 4BLRA 2YZKA 1S1CA 4UBOA 4H4EA 4N3BA 1RCUA 2AMVA 2G4LA 2F59A 4FX5A 2RH9B 3K2EA 1A98A 4P4GA 1P91A 4IUCS 1JIVA 4FCCA 1RE0A 3K0HA 4HH1A 4DIDA 2NG1A 1LDNA 5EIBD 1FFGA 2O8FA 4BRUA 4DMLA 3OX3A 3M70A 1S3GA 4O2BB 2J0EA 3RUHA 1CXZA 4B7ZA 5B58C 3LU1A 3BWBA 1WPXA 2PLRA 2OY0A 5FL7D 1V1MA 4D0GA 2C59A 3RBXA 2WWXA 3BJYA 2FOLA 4MKZA 1I3LA 3NV9A 2PKRA 4Q12A 4DV1B 2H1RA 3V8NA 1FRVA 1OBHA 4RJTA 4KAXA 2RE8A 1CY6A 3S4YA 1NG1A 4IDPA 4CKEA 2XUHA 1L5FA 3PG5A 5JAMA 1CKOA 1ARZA 4DYHA 1DKOA 3M0EA 2OHXA 3VDNB 2O3SA 3RJTA 1A88A 3COJA 2BZ0A 5FUBA 2BFMA 2HPAA 2Z2XA 2HK8A 2HPVA 5KFTA 4CC5A 3OETA 1KI9A 1P3JA 3J7TA 3Q2OA 2I2AA 1VE3A 5KNBD 3MMZA 2DB3A 5EKXA 1SKBA 1CLUA 1Z0SA 1UJNA 1DMSA 3KBOA 4F5DA 5TV2A 1TAEA 2HPZA 3UG6A 3LCJA 4ED0A 3HWRA 2DKOA 1Y6JA 2D2VA 3C3MA 3ZKWA 1A9PA 4EKDA 5BN3A 1RE1A 3E9DA 2JFPA 3SQXA 5ALNA 3WGQA 4LRSB 2ZSEA 1YBAA 3HKEA 3NIGB 5DDIP 2ZCVA 3H2SA 1AQNA 2VK4A 1RXEA 5CPFA 1BCRA 1E2QA 1Z4LA 1KXZA 2YV3A 3OD5A 2J6SA 2IUYA 1EZ1A 1D9ZA 2OAEA 5KX5B 3ZGVA 2IPXA 4B6OA 5F73A 1FNMA 2GOYA 4Q6BA 3DVAB 5K8LA 2WHPA 5L3SB 4BN4A 4U9HS 2QG4A 4KQKA 4D25A 2WAAA 1H22A 1WLYA 3TB4A 2O9JA 4E08A 2RBKA 4X1OA 1K1EA 1VSBA 2NU6A 5KFXA 1X8LA 3A26A 2O5VA 2H29A 4XGNA 5DI3A 1JLKA 2QD5A 3PLAE 2NSLA 1NJ6A 2A1TS 2A86A 4F4CA 4HMQA 2NACA 4RLQA 4MHSA 1A7JA 3PC8A 4YP5A 4JENA 3MW8A 2ZCJA 2GH1A 1FBTA 1T4DA 3OZGA 4IDBA 5IBRA 5KYWB 4L9RA 4PRKA 3EPLA 4TLLB 3HC7A 3DL2A 3AY6A 3T7IA 4P3OA 1VSVA 1L7RA 2XCSB 1VMIA 3W1BA 2V54A 5K3OA 3OPNA 2RGYA 1H94A 4LOAA 2JLVA 5JI3E 3P52A 1NXVA 3SHFA 3K94A 1AMUA 4XASA 5B3JC 3W5UA 1Q1AA 2JLZA 3A25A 1VLVA 3SZUA 3G3EA 4WK0B 2C1EA 2ZAGA 5ANRB 3D0KA 4W9NC 1ZK3A 4U0KA 2V7EA 2JEFA 4X85A 1YBFA 4I4IA 3AH8A 5DNUA 1SA0A 1ESCA 3RUAA 3MJRA 3R7LA 5JD3A 3ZBQA 3HXPA 1H3EA 4UUBA 2QTTA 3N40P 2RCNA 2G25A 1XRQA 4PPGA 2R00A 3GEPA 4IAOA 1DQYA 4QX6A 5G0UA 4QYTA 5EOVA 4J3FA 2J3KA 3QFTA 1SCUB 1SC4A 2GEFA 1P1RA 4R01A 2D0OB 3PNMA 4CMKA 2XE4A 3IUNA 3WSWA 2AOUB 3CLKA 3I6MA 2VHUA 4V1CI 1WB9A 1ZI9A 1L1FA 3YASA 4Q37A 3EZ2A 4EUFA 1DCMA 3RVRA 3REOA 2UUCH 5A6SA 2XNKA 1LCIA 2EGHA 3DB1A 2Q4TA 2B1JA 4IDFA 4O4JF 1ZYUA 4A3IG 3FHOA 3N74A 5KFHA 4QWBA 3SF8B 4MQFA 1K88A 2O0KA 3ZWNA 5BMVB 5A02A 1IZ0A 1J2TA 5KYYA 4BFZA 2EG9A 5C51B 4QGAA 1YHYA 4FGJA 5IYZB 2OR3A 5JAZA 3K0FA 4LSAA 1G7RA 4PZCA 3OEEA 2MDTA 5ITSA 2Y1KA 2YXNA 2O2CA 4WXEA 4HAWA 2W58A 2GPWA 1Y8AA 5U4QA 3DKPA 1F2UB 4OGFA 1G8GA 4IRMA 1U8YA 5K0NA 5BN1A 1MD9A 3Q9LA 1YGPA 4QDZA 3HBAA 3I04M 1M5RA 4NK5A 5K8IA 1S96A 2HRCA 4UM7A 5DNYB 2I4LA 1QU2A 4ARAA 1KDVA 3WKBA 4CGYA 3L7IA 5BSFA 3PWZA 2AR9A 1XZIA 3WQBA 1EFRD 2EFCB 3OD1A 3WLLA 1QIDA 2ID9A 1I6UA 3I52A 2AFVA 3SSNA 3ZBTA 3KNZA 3GU3A 2AF3C 9LDBA 3GVCA 4EYKA 3F6CA 5BMOA 4L5YA 1WCYA 2ZIWB 3OKFA 2FX2A 3AK4A 2WVHA 2IS4A 4C0QC 1RYEA 3HLKA 3N7AA 5KEIA 1GARA 3SQWA 5LIRA 1T3SA 1N56A 2ZGIA 2OCLA 2YFHA 5B7QA 2GJSA 1TYCA 2JAXA 2JVIA 3IVRA 2ZM5A 4ZTUB 4LE0A 1HNZB 4PHFA 1G42A 5HKKA 2ZSDA 1N5OX 3K35A 1JSXA 4NS4A 2O8EA 1DDGA 4EP1A 4X20A 1EVIA 4JUFA 1JDJA 1NF3A 3EPRA 1O87A 3P2OA 1PEDA 3EMBA 3WMGA 5HQ3A 2HUPA 1KJWA 4L75A 4CEJA 1MX5A 3QYFA 4CIWA 2IDKA 1K8ZB 3KOMA 10MHA 4M49A 4IMPA 3MB5A 5IARA 4G5XA 2BE7A 4WN3A 2HDOA 3OT4A 3H2BA 3W1EA 4IMJB 1CR2A 3EVNA 4P7GA 3N8KA 3U3MA 4ALNA 4QO8A 5CIYA 4KWCA 5T6BA 1PP4A 4KO8A 4JUIA 2CLSA 4QHSA 5E2IA 1GILA 5DEOA 1FSPA 1KARA 3RUEA 5BY2A 1ZCAA 2AJBA 2GO1A 2QK4A 2ZRAA 4YRGA 5TDHA 1KI3A 4J4HA 4CLHA 3LWZA 3SXUB 5CLGA 5KNBA 1IM5A 3DVQX 3ZDXB 1TXGA 1CYEA 8OHMA 4C3VA 1UPCA 3HA7A 3ZDZB 3AF0A 1SEPA 3EB9A 1IU9A 2BHNA 1D4AA 1CYDA 5B5SA 3JAWA 2O2XA 1UAGA 3ZVMA 3B6IA 2OFWA 3Q0EA 1K7EB 2X5XA 2RGRA 4NXMB 2N3ZA 5EIXA 1SCKA 3WDSA 4BV3A 4ED9A 5HX7A 3ADOA 3TXXA 2X6RA 1PRYA 1Y98A 4GXRA 3E7DA 1L5GB 4LY0A 1Q11A 3BVPA 2IIQA 4JBWA 4WJZA 1T2UA 3W8DA 2GFQA 4OGKA 4N82A 3UFXA 3DCJA 4WADA 4RF3A 1PZMA 2Z1MA 4G07A 2EVWX 4OQYA 3OTWA 1I9CA 1AUQA 4CKZA 4HR7A 4HXEB 5KDDA 4XJSA 3I61A 1U2TA 4FFPA 2OP0A 4DSZA 3ELBA 5CX1B 1K86A 1UKCA 3N39C 4JHLA 5EMJA 4KSCA 1KRWA 1H5NA 2X9QA 3H9BA 1ZA2A 2GCGA 4OQEA 1C9EA 4H6XA 2BEJA 4U7PB 2J3QA 4D3XA 1ZD3A 4PCVA 2DEUA 2JEGA 4LIPD 4Q1VA 4II2A 4BFLA 1LBIA 1XF9A 1CUDA 3S27A 2G4VA 4HPXB 4G1VA 2VYVD 3NJRA 1XXHA 3I04A 4YV0A 1LW6E 4N39A 2C9BA 3LO5A 5F23A 4G1MB 2WU4A 1Q0QA 4EEXA 2B7BA 3R5HA 1UBCA 3WDLA 1RJ9B 4NONA 4DL3A 1NNUA 1E6KA 3TRIA 1TMKA 3QYPA 3V4FA 4XR9A 3GNSA 3WLQA 5KVCA 2GBPA 1KAGA 1GPBA 1MN6A 4R54A 2JD2A 3W1WA 4U7TB 1Z3CA 2ZJ6A 3OKAA 4DRFA 4Q00A 4KVFA 4LXQA 1OILA 1RYYA 3Q7SA 1G8YA 1L7PA 5K6AC 3OIUA 4GRIA 4ZYUA 4DNFA 3H9QA 3JSXA 3S8EA 3L05A 4RGVA 1RJPA 3S68A 1R5NA 3V42A 4KX3A 4MIOA 4U7DA 1CUJA 4RCNA 4NRDA 1E9BA 2GCOA 3F73A 2CLDX 5G2OA 1VL8A 1CR4A 1D2GA 1IZ9A 4LXIA 5LL6P 2GILA 4OMUA 1Y1WA 3FSEA 2A1TR 1EU1A 3NT4A 4LJKA 2ERYA 2EU8A 1XCPA 3AB7A 3WYNA 4BE7B 4BXOB 4C5AA 1YDMA 1F12A 4U5XA 1MAWA 4G9EA 2PX4A 4F0JA 2K7FA 3ASZA 5ISMA 3DZCA 4NP6A 2HF2A 4W8OA 4S12A 4JEIA 4RA9B 1H2FA 3DFMA 5KG4A 3MERA 2XSZD 1Y3DE 3ZEAA 2UZ1A 1FDWA 4OYYA 1YF3A 3ZBPA 2NO4A 1ACJA 1ZEMA 3IPYA 3M1AA 2PUHA 2DWCA 2X13A 4IGIA 1MORA 3BXGA 1WCIB 1ZGGA 4PRLA 4UEKA 3TY9A 1MPTA 1DO2A 1EE1A 2QN7A 3Q9UA 1ZBQA 1NURA 4HDSB 4WQMA 4ED6A 1Z37A 2Q4EA 3HMQA 4XARA 1GG2A 5B1SA 2N75A 3ZCVA 4W6QA 2F8SA 2POCA 1V2HE 1STOA 1FVIA 2AXNA 3I9V1 3JZDA 3R3JA 1L7DA 1A0IA 4RTOA 1QR6A 2WHYA 3L07A 1SUDA 4ARUA 1T5LA 5DCWA 3ZWQA 1FSZA 3KL4A 3REFA 1D2NA 3CTPA 1LVHA 4UE2A 3THWA 5A5EA 2FPXA 5AOBA 1NN0A 4F7WA 2QQGA 3DHVA 3W8FA 2VPPA 3QOWA 2QTMA 4FOSA 3WLHA 1JHPA 5L95A 1KVTA 3L7JA 3V80A 3MJFA 4J8PA 1BHO1 2DQKA 2DF8A 3VTFA 4A2CA 4NU8X 4M4SA 1SXPA 5IKOA 1SUFA 3U26A 4HQ6A 2BM1A 4A3EG 1YVDA 1UMBB 3CLRD 4EABA 4OHMA 4AJ1A 1I8TA 2WF8A 2EQAA 3G85A 1H05A 3ETEA 3RUPA 2J9FA 3EWNA 3OCVA 2R8EA 4DBZA 4R2MA 3IQIX 1GUBA 4WXMA 2ZDHA 1W4LA 3QUCA 3CQZA 1KAQA 3VHRA 4F4XA 4N40A 2EP7A 3FJYA 5A5VA 4BMNA 4FNMA 4B7CA 3BQ2A 2F3TA 4XJVA 4QPNA 4IX1A 5AVJA 1JFTA 3OKPA 1M2HA 1ZM9A 4KDFA 3F9IA 5ADWA 3GFSA 4GC9A 5EJ9A 3LVFO 3HPQA 3IH5A 3IAS1 2EKPA 4ZT4A 1PYDA 3V2GA 4GL2A 3U54A 4QOIA 4INOA 3IAXA 3DTVA 3NDJA 1T6YA 4Q9NA 5F3RA 2AMFA 2JHGA 2QX8A 1J8FA 2QTVB 1SH7A 4V38A 5BYAA 2C3PA 1I14A 4KIGA 2FMUA 3O1IC 4DBLC 3E3OA 4APMA 1WUKS 1X94A 2IU3A 3U44B 3VX3A 1SFRA 5FX2A 3UGQA 2PR2A 3BXPA 3QGMA 1NBMD 1V96A 1YR2A 3SYLA 3MR2A 4KV7A 4CIXA 1U7TA 2BFNA 4PX3A 2QE7A 3OM0A 4UM9B 4Q9LA 4EMBA 2X6QA 2GTHA 1R4NB 1Y1TA 4H1TA 1WSDA 1THMA 4ACAA 2R82A 3HVJA 3EFBA 1DQRA 1BEUB 1RNLA 4PNZA 2ADFA 2AG5A 5BT9A 2PMCA 2FK1A 1J2UA 5CG1A 3L41A 3GCGA 1UWVA 1JDSA 2ZYUX 3ZYZA 4EHJA 2C7BA 2PPVA 1P4RA 1DIRA 3WI7A 1I3MA 3PQFA 2DPHA 5AW9A 3ETCA 3TQQA 2XJ9A 4ML3A 4B6RA 4ZOLB 1IMOA 3MHPA 3KOUA 3NM6B 3HJBA 4WVLA 1BDIA 1U2PA 3FUXA 3R20A 1JA0A 1KT8A 4Q02A 5B7PA 2GN2A 1E7SA 3R0ZA 4XWAA 4PM4A 1QRDA 2V7VA 1SM4A 1FYEA 5AK0A 1ZZEA 4ILEA 1DC3A 3ROEA 2PFKA 2C0CA 1RJFA 7GPBA 3T9AA 2ZI3A 5M34A 2YYZA 2IYNA 2WTUA 4BQOA 4JC4A 4WD3A 3L0IB 3H5RA 1KE1A 5LJLA 1XLVA 4FWBA 1YA8A 3K4QA 4WESB 1OAOA 4NLGA 4ND1A 1QIFA 3LLMA 4S1TA 1P6XA 2AFIB 2IITA 5FI1B 2UUCB 1WH2A 2R1ZA 2QTWB 3FYSA 4YMLA 1YR6A 3L7KA 2W57A 4C2MA 4Q4AA 1VPLA 4Y9RA 5CBKA 4FMCF 4QGFA 1M2WA 4UFOA 3PO3G 4WPGA 5CB0A 4JDUA 2TS1A 1DKMA 1GQYA 3ANYB 3RU2A 1A95A 2VZEA 3LQYA 4HI0E 2O2DA 2PZAA 4A2PA 3GD5A 1D2MA 2WICA 4AJ2A 1ANKA 1NI3A 1UFKA 2OK7A 3MT7A 2Y76A 2IUTA 4YP1A 3H9GA 2VQFH 4JKOA 3COWA 4BTLA 3QELA 2VJNA 5FPOA 1RDFA 1IM2A 2QG9A 4OKNA 1VE1A 1IY2A 1LLFA 2WKSA 2Q0HA 3OCUA 4BAGA 3IDZA 1SVIA 1MEEA 4MUBA 4IH9A 2C5EA 1N9GB 3AONB 4W5HA 1VPEA 4MS3B 3IVGA 1WXGA 4LC9A 4JLAA 5BSHA 1IHXA 1P7ZA 2EJ2A 3ACCA 3QLVA 4Q4CA 2VL7A 4TMWA 5CLLA 1TI7A 1YDHA 3DL0A 4XB6B 3VNRA 1ZOPA 4DHEA 4YRDA 1H65A 1D6JA 1O9GA 1TEZA 1XIVA 1KMCA 2EFEB 2NSJA 2BGIA 1URPA 4US0R 1XZPA 1Y81A 3OSUA 1FDVA 3BL6A 1QHFA 5AQ1A 1D03A 2HBYA 4W6ZA 2DY0A 4WOKA 4C78A 4D9NA 2PUFA 2YXDA 3BL5A 2A3NA 4N7JA 4FFSA 2AN3A 5I9BA 1DAPA 2QW1A 3NXKA 4JB3A 4PBSA 3EC7A 2GKOA 3ORHA 2DRIA 3GJYA 2VP5A 1VHTA 1R0WA 1S5PA 1SOAA 3PXGA 4RIGA 1QIEA 3TLBA 4EY7A 4K9DA 2JAWA 1Q21A 3L84A 3ODPA 4GL4A 4AF6A 2FPIB 4LZOA 1QFYA 1ZM3A 2QW0X 3CRRA 2JA7A 1EDZA 1ITZA 2ZVQX 5EIFA 4RZHA 1M1YB 3VAYA 1IXRC 2R6FA 2HBRA 4QFBA 2MR6A 3Q3VA 5KG7A 3BMNA 4C9BA 4RQAA 3GAMA 1HNXH 4JSYA 2ZIAA 2FXIA 3LGXA 1BH2A 3VR2A 2ZPAA 1X7YB 1G6KA 1K0UA 2PG3A 1UFRA 3TG2A 2I62A 2ZI7A 2FJUA 3IB6A 3RU3A 4WCVA 3CN7A 2NTYC 4CU2A 2F9MA 5FUVA 5DMXA 3R5JA 1C9DB 2PYIA 3GMSA 3PR5B 4ECQA 5EQDA 1C1DB 2EHJA 1HK7A 5KVVA 4BFTA 3FKIA 3QUTA 2ONYA 4AMVA 1IBSA 3HEBA 3HWWA 2IP2A 1G9SA 1QH0A 1CQJA 4MTLA 4V0LA 1QDUA 3FFTA 3BXZA 4JI6B 4KQ9A 3T7RA 3KDPA 1LQ2A 1FC0A 3DOIA 3ICWA 5KG6A 2YHSA 3EWIA 3IO5A 1SKMA 1F14A 4OK5A 2ZS8A 2H1VA 1U8XX 3DE6X 3VR4H 4O4JA 4JBXA 4FYJA 4X1YA 2O4UX 4OKSA 3RS5A 4CF6A 5JD6A 3NONA 2XRYA 1CX9B 2EYQA 1IZYA 5FWDA 1JU4A 2WVJA 5LFAA 1R00A 1PHPA 4D9CA 1JMVA 1ZAUA 1DELA 3JQRA 3ZCSA 4QJ3A 1WF3A 1HFJA 1GGJA 3SVTA 3DMFA 3O8CA 1AKEA 4AO7A 5EE0A 1ZJYA 2FETA 2RHRA 5JDCA 4WLUA 3AC0A 4EHIA 6AT1A 4QWWA 4FVTA 1NBMA 1A9ZA 5BN4B 1KS2A 4BNZA 2WTMA 4CTKA 4TN1A 2V6FA 4KV9A 3W9YA 2JCSA 3GRPA 1W2HA 3CVOA 3HVUA 1B1CA 4HQFA 3WQSB 2XVAA 1NNI1 1GSIA 3H19A 4S0ZA 3EIHA 4R7ZA 4TL9A 3U3ZA 3AOEC 5JS1A 2C58A 2WMDA 3BSWA 1YULA 3W78A 5HM8A 5BW5A 3UA4A 4PCUA 2YZ2A 5BW8A 1GPJA 3SC2B 5EOYA 5LNK1 2WYVA 1W96A 2Q50A 1JFSA 3IULA 1JR3E 5D3MB 2FPPB 1KJ9A 2C1XA 5IJZA 2WF9A 4D0NA 3U1VA 5CVTA 2GVNA 5C34B 1ISIA 2E82A 2W9BA 3DMDA 3U7GA 5T4HA 5KQSA 4HHEA 2CDNA 2K87A 2BI4A 2GLUA 4QKQA 3PR1A 5T3YA 4E13A 1JG4A 2V9PA 2JGIA 1QOPB 4DY4A 3LD9A 1CQIA 2K6GA 3HFRA 1EH5A 4A3GG 4WASA 4M1EA 3TKAA 1UF9A 1JDNA 3LTNC 5AR1A 4QNMA 2G82A 2REQB 3O82A 3FCYA 2J48A 4LDAA 4K26A 4L4XA 3DDOA 3BFJA 1S10A 3L8HA 4DMMA 1FJGH 1NX9A 4P33A 2I87A 4Y2VA 2PL3A 2I1VB 3AKDA 3RF6A 1U9CA 5C7IO 3KYJB 3PXAA 2I6TA 3SSAA 2LD4A 4DILA 3ZOZA 2IH2A 2H8KA 4FU0A 1KFBB 1RBQA 3AW8A 3A9TA 4CQJA 1KFEB 1K98A 3QKIA 1KVUA 4Z4QA 3OH8A 3ZK8A 3VR4D 2W93A 2NP7A 4JXZA 1AX9A 2ZIXB 3M7IA 2OBFA 1EX9A 1ZKMA 3HP7A 5CVCA 3RJ9A 3OX1A 2PY6A 2OHOA 3FDZB 4URHA 3W8EA 3MGKA 1GVNB 3NTXA 2GERA 4CLOA 4Q9JA 1S2NA 4M1WA 2JIZA 1XB2A 1BXRA 5KTTA 5KYXA 3A4VA 4IV0A 3QOFA 3JARB 3DR3A 3I2HA 2OEPA 4JZYA 2ZJTA 3QLUA 4TMFA 1NSFA 3D4PA 4BVLA 2WSIA 3TB6A 1AO0A 3EQ2A 1CC1S 2E2IA 5DSXA 1SOMA 1JXQA 1PUXA 2JL1A 1VLMA 3MAAC 2AZTA 3MWDA 1GA4A 1KSHA 4OJTA 4EY4A 4K6HA 2XMGA 2YNMA 4KX5A 4K8OA 1Q14A 4K9QA 1GZVA 1U7UA 4CKBA 3HU3A 3ETGA 1VKOA 2YJ3A 4I6EA 3AUKA 4PF1A 3N6XA 4C01A 1FW6A 2WYUA 3UYKA 2AI2A 3DWGA 2J08A 4H0CA 3REGA 4JJKA 1VE6A 2H1SA 4Y2HA 4Z9FA 5LQUA 1N2IA 3RW9A 4Q3BA 5TR9A 4HLNA 1JHAA 1JKJB 1VBKA 5AKXA 1PSWA 3UKOA 1Y3CE 4Q66C 2ZWPA 1EYZA 5A0VA 3W5AA 1BC5A 4CLRB 3K9BA 1L2TA 5JWHA 5DYTA 5I5GA 1KHTA 4BBRG 4MYRA 1QFXA 2SBTA 4P82A 3CJRA 3O92A 3T61A 4XDYA 4CE6A 2I9KA 4DL7A 3U0BA 5FNVF 1X1BA 1PL7A 3PJGA 4ITRC 4Q8FA 1XZGA 5BUSA 3UMYA 3WKEA 1KRXA 1CD5A 4NMHA 1Z38A 1ISFA 3R1IA 2UVPB 4CN9A 4QWAA 1XDUA 5JFGA 1E9DA 4HKTA 2WM2A 3P9SA 3RJ5A 3OY7A 2R1VA 3NWBA 2NMVA 3WB9A 1OFGA 3NTQA 2DY1A 3OQ6A 3GIDA 3DL7A 4ND4A 1W5FA 3ZY4A 3QVVA 5BVGA 1ZX1A 3H5OA 1R0ZA 2EIHA 3T3PB 4CF3A 4KW7A 4L5IA 2MINB 4TMKA 4EI7A 3E58A 3FCUB 1OA0A 5L8VA 4EJSB 3U7QB 2VTBA 1OXKB 3LDHA 1XPOA 1A2BA 2O6LA 4NE2A 2YFQA 5ALLA 3B85A 4BECA 1FYDA 2AHOA 3RDPA 1TYAE 2VUMG 2ZOSA 1VE9A 3D3WA 4B33A 1LBSA 1ZVQA 3MWEB 4CHGA 1RABA 3D7RA 3MWKA 3WWYA 2NADA 3QWFA 2VJMB 2CHUA 3CLSC 1B04A 3MJCA 3NC0C 1K7YA 1ESNA 1OYVA 1L5RA 4A0FA 3OIWA 4MPRA 3TTXA 4GVXA 4Q7MB 1JNXX 2I65A 4HDKA 2BJVA 4N54A 3QYAA 2MYUA 4HGNA 2WB2A 4LI3X 4AURA 4F56A 1DG3A 1BEZA 4IUDS 1JX4A 4B3BA 2AL7A 4PGHA 4MR7B 4UAUA 1JLRA 4RJJA 2FUCA 3U60B 1TA0A 4J7CA 4IBOA 2VUGA 3UK0A 1WEKA 1YD7A 2BEVA 1JHDA 1QYIA 4KXMA 2R8RA 3T8YA 4L3WA 4UNIA 1XD9A 2VSFA 2FEWB 2P0YA 4DMCA 3T3HA 2C2GA 1RLIA 4MS4A 1DRKA 3IL2A 1JE0A 1V8OA 1K63A 4GIBA 1MQ9A 1I80A 4MXDA 2H92A 2GAJA 4ZCRA 4YO7A 2QB5A 4DC0A 5ALUA 4YDQA 5FRDA 3IUMA 1ZUIA 4GI7A 1VYTA 1CEYA 3BUSA 1GUDA 3A9SA 5KOYA 5K20A 4L0MA 4A0QA 4JT4A 3FDXA 1CDDA 4DMHA 4DQVA 5LXTB 4CLDA 1Z6PA 5D6NA 3BMCA 4EZIA 3PHHA 1LBEA 5E6SB 3NBYB 3U48A 1MG5A 1OBDA 3GLRA 1SVMA 1G17A 4BMDA 4IIJB 3HO8A 3M5CA 4E5NA 1ZUWA 3D1JA 3OM9A 3NP7A 3ESDA 1GQFA 5LCXA 3JZAA 2RC6A 2GZSA 4KYUA 3QHQA 4NYEA 3KQYA 3GEDA 3HBJA 3AETA 1OI4A 4U5QA 5C37A 2P1DA 4OOFA 5LMZA 1Q7TA 1QGUB 3RR5A 3LT1A 2HSGA 1VOTA 1Z62A 1YZVA 5FWNA 4NJEA 3Q12A 1W35A 4KOEC 3VUFA 5IAGA 4H9GA 4S1PA 4CM1A 4MLPA 3H1FA 1QAQA 4IVRA 4MWCA 1T5IA 2NU8A 1SYXB 1ZRMA 1OYYA 3F6SA 2V7BA 4X0EA 3LDUA 2H0RA 5K2OA 3TKYA 5KNBH 2V7WA 4YC7A 1ID8A 2JLQA 5EJ4A 5CMLA 2J5QA 2HCTA 2PGLA 3I2GA 4M7EA 4ZVLA 3D2CA 3K9QO 1M0EA 2UUOA 3R3VA 3IURA 3BQNB 3ELUA 4OM8A 2CMKA 1AQUA 3ABRB 5AJTA 3KOOA 5KIAA 3SC4A 2ZS9A 4N5NA 1ZQ7A 2YFYA 3IBYA 3OEED 4R9UC 3QUBA 3KKZA 5EJGA 1KR2A 4UUMA 4LHVA 4O7RA 2ICAA 3WLRA 1Y6QA 4ADSG 1N2SA 3QPDA 4P4SB 2YRXA 4EVRA 1Z0AA 2BFAA 2YN2A 3OFSA 2BHRA <