5H80A

Biotin carboxylase domain of single-chain bacterial carboxylase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
463
structure length
430
Chain Sequence
TPRVLIANRGEVAVRIERAVSALGWQSVAVYAPDDAGSLHVRRADEAVALSGRGAAAYLDGAALLRVAQEHAATHVHPGYGFLSENADFARACAQAGLVFVGPDPDTLDLFGDKSRARGLAQRLGVPVIPGTDGATTLEEAAAFMQAQGGAPVMLRVVRQAGDLAAAFEQAYAERLIERARHIEVQVAGDGQSVTHLWERDCTVQRRHQKLLEFAPAPHLPQAVRTALIGAALQLAQEVKYRCLGTFEFLVTPGGDFYFIEANPRLQVEHTVTEEWCGTDLVTAQLRLAAGETLTAVGLATQPADAAPPPGQAVQARVNMEVGGGQVQTFTPPGGPGVRVDTFVTTGLTPSPQYDALLAKVVVHRRDAALPGLLRQAATALSEFQIAGVSTNLAFLQALLHHPDVQHYELSTHWLDERLPELVTQAAEYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylase
publication title Hybrid Structure of a Dynamic Single-Chain Carboxylase from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 139
structure length 430
sequence length 463
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain
A PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain
A PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5h80A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5h80A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h80A01
1Z2NX 1CS0A 5KKNB 3BFPA 4O84A 1Z2PX 3ETJA 3E5NA 4O4IF 1DV2A 4I55F 4YJ2F 2HJWA 3AW8A 3G8CA 2W70A 1C3OA 4FFNA 1IOVA 5BPHA 1PK8A 4QSHA 4O7NA 4HR7A 2YS7A 1ULZA 4O4HF 4M99A 4I50F 4MV1A 4MV4A 5JH7F 2YW2A 3BG5A 4TV8F 3OUUA 4O2AF 2R86A 3U54A 3BSWA 4E4TA 2GPWA 4HNTA 2W6ZA 2V59A 5HBRB 2ZDQA 3VPDA 2R87A 1OBDA 2NU6B 4HNUA 4TUYF 5BPFA 4ZOLF 5CB4F 2R85A 1I7NA 1UC8A 1B6RA 1KBLA 3ORRA 2SCUB 4YAJB 3U9SA 1PX2A 4O86A 2FPGB 5J2UF 3GIDA 4DLKA 3QFFA 1GSOA 4RZQA 3TIIA 5DMXA 4ZI7F 4DIMA 2V58A 2DWCA 4O4JF 2W6PA 2YYAA 4FFRA 3TIGA 2Z04A 3Q1KA 4O4LF 1AUXA 4IIJF 5JVLA 4O7ZA 3JZIA 2I87A 1Z2OX 1IOWA 3VA7A 4C5CA 4O7TA 1T36A 2R7MA 3R5XA 3NUAA 3BSYA 2ZDGA 4MA5A 4EA8A 4MA0A 4ZHQF 4YJ3F 4FFMA 2YRXA 2VPQA 2YZMA 4XYMB 2OLSA 3ETHA 1B6SA 2VQDA 3KREA 4O81A 3K3PA 3SE7A 2VHEA 4C5AA 4XYLB 3N8DA 4IZOA 3JRWA 3HBLA 5LYJF 1EUDB 4FGRA 3DF7A 2Z02A 3KAJA 4FFPA 2W6QA 4HQ6A 4XX0B 4M9CA 4FFOA 4EA7A 1GSHA 1VBHA 2NU7B 1M0TA 4FU0A 4O7WA 2NUAB 3VMMA 1KJ9A 2PBZA 1CQJB 2DIKA 1KJQA 4GGMX 1WR2A 3U55A 5LA6F 2CNVA 2CZGA 4EA9A 5FNVF 2DZDA 1A9XA 3UFXB 2FB9A 5EZYF 4ZQIA 2NU9B 4Y8VB 5JQGF 2I80A 2I8CA 1EYZA 5K2MA 4IHJF 3WNZA 3WO0A 1GLVA 1GSAA 1VBGA 4O82A 4O2BF 4XZ3B 2W6OA 1BNCA 3G8DA 3K5IA 2YL2A 3VPBA 2QK4A 4YBZB 2FP4B 3HO8A 2NU8B 5BMVF 2CNQA 1JLLB 3V4SA 4EGQA 2WYOA 2P0AA 1I7LA 2IP4A 5CA0F 1DV1A 1KJIA 1EHIA 3R5FA 2W6NA 3KAKA 4MAMA 1BXRA 1KJ8A 3VOTA 1KUTA 1AUVA 2YRWA 3MWDA 4O7LA 3LWBA 3WO1A 3OUZA 2J9GA 5LP6F 4MV8A 4NYEA 3R5HA 1M0WA 3LP8A 3R23A 3BSSA 1JKJB 2YZNA 1CE8A 2FPPB 3K5HA 3U9TA 2YWVA 4YAKB 5LOVF 2R84A 3N6RA 2R82A 3JRXA 3GLKA 4EGJA 4MV6A 3VPCA 4J6EA 4WBNF 2NPOA 4TV9F 3R9RA 5J2TF 1KEEA 4WD3A 5KX5F 3I12A 5C8YF 2XD4A 2GLTA 2YS6A 2C00A 1DIKA 4C5BA 2X0SA 2V5AA 2R7LA 3AX6A 2CNUA 4O7YA 1JDBB 5JQWA 1C30A 5CAEB 4FE2A 1KC7A 2GQSA 4EAAA 1KJJA 5CA1F 1CQIB 2R6FA 5GONF 2DLNA 5D8DA 2PVPA 2W6MA 4O7VA 5JVDF 5IYZF 4MV9A 2YZLA 2GQRA 4O7RA 4O83A 2QF7A 4IWYA 2R7NA 1GGOA 1EUCB 1OBGA 2XCLA 2ZDHA 5I47A 5C1PA 1EZ1A 1W96A 3V4ZA 1M6VA 2FPIB 4FFLA 3ORQA 2VR1A 4O7SA 5HV6A 3KALA 2PN1A 3Q2OA 3JZFA 4MV3A 2W71A 3MWEA 3RFCA 1VKZA 4IWXA 3TQTA 4YB8B 5C1OA 5LXTF 3TINA 3TW6A 1UC9A 1SCUB 3RV3A 4EABA 2GPSA 4ME6A 2YZGA 2R7KA 4I4TF 4M9UA 2HGSA 1E4EB 4EG0A 4MV7A 3HB9A 5H80A 1E4EA 1W93A 2CQYA 3MJFA 3RV4A 4M98A 4HNVA 1A48A 3RUPA 4L1KA 1JDEA
chains in the Genus database with same CATH superfamily
3E9MA 3L7KA 3M3HA 1YZYA 3JD0A 5EZSA 1L4GA 2QAGA 5TR9A 1M1UA 1XXLA 4Q6BA 3O4IA 3KLMX 2ODTX 2PSFA 5K3OA 1W73A 5H3HA 4LYFA 4BNXA 4HZUB 3VR6H 1CWUA 2AC2A 2HEGA 2B5OA 4OV6B 4KKVA 2AQ4A 1USIA 4OO3A 3T9AA 3P2MA 3WGHA 4LK3A 3UHFA 3R41A 5ICCA 4BGDA 3UUWA 1LPSA 1HFEL 1SB9A 3PUWA 1FB5A 4EO9A 5AKEA 3ENKA 3C3YA 3TRJA 3L8GA 2QQ5A 4J16A 1JLSA 2WBLC 3RSCA 5KYYA 4UEWA 3SXUA 1VMDA 2R87A 4D4IA 4HNSA 1Q22A 3S7TA 5L9XA 1A8UA 4V0LA 4AN4A 3R3JA 5JJKA 2OEPA 1LBEA 1AN9A 4ID3A 4F1JA 3WQHA 1Q7CA 3GPIA 1NONA 3VNQA 4LCJA 4ZRNA 3DR5A 2Q2OA 3M1AA 4PGGA 2W00A 4PCVA 4IGKA 5BNTA 4UTZA 4LHZA 2E2HA 3DEFA 4AZ3A 2FQXA 4TL8A 1X7YB 3ABZA 3OETA 4HLUC 4RPHA 3PQFA 4JVSB 3CZRA 4GP9A 3W8NA 3BZWA 1R5NA 5CLLA 5EE3A 4XUDA 5AT1A 4DWJA 2OQRA 1X3SA 1E1RD 3NGDA 2O7VA 3WBJA 5CVTA 4CEHA 3OAAD 1N0VC 1PK7A 2RSLA 4A2AA 3NNNA 3MFHA 3BXZA 4C76A 4JOBA 3AR9A 4BMYA 3Q3VA 2JD2A 2PD6A 3COSA 2AG1A 2PGNA 3HCCA 2OV2A 3FAZA 2EV9A 2DIKA 2P1ZA 3L0PA 3OTOB 4ZOEA 4K28A 1U1FA 4B34A 1REQA 2VUSA 2CZGA 2X9LA 1SN7A 4GLXA 5B5SA 1QS0B 3PSHA 2ZRNA 1Q0QA 1Q0SA 5K0CA 1GLVA 3SCZA 5C7YA 1VBGA 4XOUA 4OQPA 4XGNA 2C2HA 4PNZA 1UF9A 2EKBA 3AONB 1NKTA 3FFWA 2W98A 3ONEA 4YBZB 3DQZA 2BGTA 3DTVD 3M6LA 4P5EA 3L8HA 3WTBA 4HGYA 2A4KA 5HJ2A 6YASA 4AT1A 5LUBA 2REQB 3DW1X 4EHIA 2FE1A 4S35A 3LQKA 3OU2A 3AHHA 5IC5A 4OBWA 4TQSA 3HXTA 1I6KA 4DRFA 5KZMB 3GTPA 1T10A 1Q95A 4J0FA 4CXMA 2YKGA 2Q3DA 1N5JA 5B6PA 3NHBA 4C07A 3JQEA 1B3BA 1TZJA 4GZLA 3P9CA 1JKMA 5KT2A 3OJXA 5FL7D 1U98A 2WV7A 1L5QA 1PTKA 3B5JA 2QUKA 4G56A 1I1KA 1C7RA 1MDBA 1T5SA 3K1AA 4DS3A 2QTWB 1IRXA 3BAZA 3JU3A 3A3KA 1CNFA 2XMBA 5CDGA 1EK1A 1DJLA 4NC9A 4BLWA 4JXZA 4ES6A 1VC2A 4AYXA 1SHUX 5CDUA 3PE6A 5LLDA 2HCFA 5K3DA 3WYCA 4F4FA 3HBAA 4LS3A 4RSGA 4E0BA 4AJ2A 5C3EG 1MFPA 4E6EA 1S3IA 2OZLA 2JS7A 5IN4A 2BFWA 1QGUA 3IEKA 1SCQA 4P3YA 3PYXA 1J0BA 5LLTA 4HQ0A 3FPEA 4A26A 2C4WA 4DCVA 2OSVA 4RY2A 3T1HH 4F06A 4CHTA 2GAAA 1G8FA 1GCUA 1T9ZA 3O1HB 4QGGA 3DAGA 1SHJA 2Z3WA 4ABTA 2A5YB 2JW5A 1LBIA 4MPDA 2BC9A 1A9SA 1GAJA 2VPSA 4KGZA 2VSXA 4EHNA 4V3CA 6REQA 1AGRA 4EQZA 3FKSD 1LVUA 3HCRA 2WOJA 5T4BA 2I2DA 4JGIA 1EDDA 2C9YA 1UFVA 3OKPA 3D3NA 1KI2A 5C2JB 2HC9A 3A1UA 2XBUA 3TJZA 3G6KA 3OQOA 5FBVB 1I5RA 4B71A 2J5QA 1PFQA 1E4VA 4QTTB 1HSZA 4GOLD 1QV9A 1GRQA 4GPIB 1HL7A 3E0XA 4J75A 4EYQA 3QI7A 3VJKA 4XASA 2QD3A 2Q49A 3PGLA 2AWNA 3WR5A 1XZQA 1FXUA 1ZJWA 1J9ZA 4FEGA 1UK9A 3C6YA 4LWOA 2AF4C 3VYSB 1Y89A 4LE0A 4KFTA 6PFKA 1BCRB 3ZHVA 3IE1A 2I1QA 2C4NA 1KOJA 3PKIA 2CJXA 3OMXA 4QUKA 5KTMA 3WXMA 2DH5A 2HBQA 3UJDA 4EI8A 4JI3B 3TUZC 3S27A 4PS1A 1A04A 1W9HA 3DDNA 2DHEA 5AESA 2YWDA 4KAAA 4MX8A 2J5RA 3JZIA 1AKEA 3K09C 5JNLA 3SHQA 4DR3B 5C5IA 1IPEA 3KXPA 2IEAA 3WISA 2Q3CA 5DBOA 4DDVA 4D0SA 4BWSC 1L7NA 4GXTA 3VKGA 1QFMA 2C1EA 2UVRA 4GE3A 2PFKA 2QR5A 2JCBA 3EIHA 4E5SA 3DXZA 3VR5A 3ZE1B 4E1AA 2GKGA 1AZTA 1NKVA 1UMDA 3LDGA 3BWBA 2MSEB 1W5FA 2ZR0A 3OE7D 1D2RA 1E3IA 2MSLA 3VH3A 4OQYA 1S4QA 4HDCA 1OU0A 2BIFA 3I09A 2G06A 2UYQA 4QOFA 3OX3A 2NVOA 3H2BA 2C58A 2V3WA 4Q7JB 1JE1A 3MEQA 5HKKA 4EG3A 3FD8A 5DV9A 2C2EA 1J7KA 1M73E 2KQUA 3L0CA 4LRSB 4D4LA 4DA7A 3DLAA 3KJXA 1M2OA 3UGQA 4WKNA 3MQ4A 5BNWA 2E55A 3G85A 2FF5A 5DOZA 5A9SB 5JNRA 2RKOA 3PW2A 1HFWA 2R6ZA 1ECJA 2WIDA 1GPH1 4A16A 1IM8A 3DEAA 3P9PA 2AR0A 4MRVA 2R82A 4IQGA 4JCOA 4R84A 2ES4A 3MR6A 1C0KA 4PTZA 3OZXA 2OHFA 4NHOA 1ONPA 3EAQA 3U7QB 5FI5A 1NVTA 4ZJPA 3ZD8A 1NP7A 4YJ2B 3FPBA 3TZKA 4KPUA 4KQ2A 2DSTA 4IX9A 2JIZD 3AHCA 2H1CA 2OV4A 3H6GA 1T15A 3M9MB 3PNSA 4DL7A 2G9ZA 1W2HA 3B1VA 4B45A 4L95C 2PRSA 4BAUA 3F5DA 3J80W 1V25A 2YWJA 1ITZA 8LDHA 1KVQA 3O31A 2FLNA 9LDTA 3OQ1A 1RHQA 4J4BA 1G59A 4PR0A 4MH0R 3CRNA 3BCSA 4IFBA 4X97A 3M1LA 4R2HA 4DTCA 1P8JA 4RA6B 1WKCA 3SBXA 1E2LA 3A1EA 1WLYA 5CB4A 2KPOA 5D85A 2H4WA 3RHFA 4R05A 5JZ9A 2IT1A 2G9NA 3H4BA 1X1CA 2QGNA 4MWBA 5LXTA 3HV0A 2QORA 3E22B 1LTKA 3N2IA 2NQ2C 4TLBA 2VPXA 1XBTA 5DG7A 6CHYA 1XAIA 3FJ1A 3PCXA 4RTLA 2WKQA 1AHNA 1JP7A 4ZA2A 3BWMA 2VP5A 3HJUA 3LXRA 3IAS1 1VI2A 3LLCA 3PJRA 3RTGA 1FSPA 1AZWA 4BNNA 1ZJYA 3L4EA 3L40A 2TECE 4Z1MD 4KX3A 1AQ6A 3HXKA 2GFQA 5JU6A 3BD8A 3Q72A 4OYRA 3DAFA 1XC7A 3RJTA 3LZDA 1CZKA 1Z0FA 2XB9A 1HT0A 3RIXA 2GUGA 3NAMA 2AQHA 1JAXA 2WZQA 4I36A 1KZ9A 3HFGA 2AUTA 1H42A 3JALB 1E2EA 3ZW9A 4EJSC 1Y9ZA 1I32A 3CPHA 1Q92A 1AKNA 4I4NA 2WDZA 1F0NA 3M4IA 4G5OA 5CDFA 3LULA 3OQIA 5H8WA 5F2NA 3OZBA 4RTNA 1SU7A 2CXSA 3OJEA 2PL9A 1Y34E 3A37A 3UJCA 4RQTA 4D44A 2C4KA 4GKVA 1ZMBA 1G66A 3FUWA 1NVFA 3IOYA 3MOSA 3K5PA 4MQMA 4X6LA 3QELB 4L08A 4ZI5A 2IY8A 2VNIA 4F4UA 2ERXA 3K0CA 2C2DA 5DE3A 2HRBA 3C7AA 1QOQB 3MLBA 4J9PA 4TWRA 4AG5A 5KKCA 5DNAA 3HA7A 1YZGA 4S1PA 3A9WA 3HJCA 3ILVA 3PHCA 4L4UA 1W581 2OM2A 4WN9A 3TY8A 3NTUA 4ISBA 1DRWA 5F9MA 4CMGA 3I6QA 3L5OA 4TKMA 5ALYA 3WRYC 1LPAB 1JAHA 1B8UA 2NV2B 1Y9DA 2PQ2A 3BDVA 3S2EA 2ZTLA 2JLZA 3OQVA 1Q3HA 1JQ5A 1RWVA 2XADA 3C7TA 1S0NA 2B1GA 4GLJA 4GFDA 5CIWA 3T3OA 4LH7A 1YE3A 3T9EA 3UJNA 4PANA 1FJXA 4RZ2A 4HV4A 4CKBB 2I80A 2YMMA 4D5GA 2VJYA 3FDZB 4KL8S 1R4NA 1PSWA 5U4XA 3IHTA 5IXYA 2ECQA 2XVXA 2G67A 4NBVA 3EHDA 1C3LA 3H1EA 4R83A 2O8BB 2OBBA 2WU1A 4GC7A 3IDZA 5BMVB 2HMUA 3LFHA 1KI4A 1DOHA 3V2GA 4XAQA 4PHTA 1M9NA 1WCXA 3QPWA 2XB8A 5L1IA 1F2VA 2QBYB 4URFA 4GMHA 1E64A 3I01A 1KTIA 5C4GB 1RXUA 3CE9A 4J3JA 2GEDA 1BA3A 1Y5RA 1ZM9A 1FFBA 1Z68A 2X2EA 3G3EA 1MO5A 2MU1A 3TIFA 1A7KA 2RBEA 4PPFA 1SXPA 1KDTA 2DG2A 3L1VA 1MOPA 1UPAA 1JIUA 3OT5A 5A4AA 2W2QA 3KJGA 2W11A 2C3YA 2R0QC 1ZL0A 4FK8A 4FYIA 3OCVA 1C41A 4EPVA 1RYEA 3ZWVA 2ZAMA 4C08A 2LVBA 3D8RA 4UBKA 2W0SA 4AYBA 3NC4A 3DZFA 2CEKA 3AF3A 2HRRA 3LCVB 1NMYA 2RKBA 4CIXA 4KQJA 4LXTA 1H6BA 3CPSA 5FUWA 1GPMA 4Q9JA 4EW3A 3FFXA 1JI0A 5D1NA 4X7MA 2DGDA 4EUEA 1VLJA 3M4NA 3U56A 4MGEA 5IAOA 1KMHA 4H6WA 3GVCA 4IZ6A 3W8EA 3RTDA 1HOXA 1A4UA 2XUAA 3WX0A 3KB8A 1GQRA 4DVGA 1I6LA 4YO8A 2BDUA 2OECA 2GJ8A 3F96A 4HXEB 2ZSDA 2WT8A 1PWXA 4NEHB 2Z9DA 4A0QA 4U02A 1EE1A 2PR2A 5EMJA 1T8PA 1T43A 4I4TB 3T5CA 3HXPA 2HXYA 1RAHA 2CDNA 5AKHA 4QASA 4DV4B 1HYEA 1HI9A 5CT5A 1CR1A 4JI0H 2WC1A 3J81k 2AN3A 5BW6B 2V3CC 1DVRA 1E2JA 1NR7A 2BFEB 4Y1FA 3ER8A 1VLMA 1M2GA 5AJHA 3OTQA 2JIBA 2FY8A 3ESBA 3KHLA 4LV6A 3W6OA 3L79A 1UWCA 4ZHQB 3ZQKA 1GGJA 4ESVA 4V0SA 2Y0BA 5BUZA 2W2LD 1H0RA 1GG8A 1P5ZB 2G88A 3KAQA 3DZBA 2VDLB 1Y5MA 2Q4TA 2ERYA 5TY0A 5INTA 2X4GA 1T3GA 3T5HA 4DL5A 2XRFA 2IPXA 3WMEA 4HXFB 1VJDA 4MTDA 4CPDA 3A2MA 1FXSA 4ZGBA 1QONA 1G2PA 1SXQA 1TLTA 3GAFA 4LBWA 3LPLA 4MJXA 4YRMA 5KFRA 2FPGA 3VVMA 4TTPA 1KVTA 4E4RA 4K0KH 3RJ0A 2R8HA 2ZYDA 3QVSA 4RZRA 4B5KA 3KS9A 1KAMA 2IU4A 2V6JA 1DAOA 4C20A 1FW8A 1ZD3A 1NAHA 1VPEA 5GIOE 3DA8A 3ABOB 4BZWA 3H9JA 1L5NA 2VUMG 1ZGBA 4IIBA 4V0QA 3Q7EA 5I4CA 2OZVA 4K8OA 4P7FA 4B79A 3JWEA 5LBIA 1WP4A 1OE0A 1SQ6A 3S1AB 5WRFA 3LVFO 4JI7H 1QUEA 3NG1A 4OB7A 1BN7A 2AMYA 3RK0A 1ELOA 2Z9BA 5E9QA 3L84A 1YE8A 3PI7A 1D9ZA 1JHZA 1ACLA 4AF7A 2UYGA 1C80A 4LJ7A 4QLAA 2YN4A 4P0QB 1ONOA 2YYZA 2P69A 4KE7A 2PBZA 1WXGA 1U3WA 4W5JA 3ZCSA 5AI0A 3ZKAA 2AWOA 1U0TA 1K5HA 1JDUA 3WOHA 3AWDA 4PSVA 4ZKEA 1MPTA 1ZHFA 4YLYA 4IIVA 1BJKA 2QUZA 2DPYA 1JDJA 3AT1A 4MIKA 2I2AA 3ECCA 2OQIA 3P32A 3ES9A 4RE5A 4O2BB 3D31A 4X45A 3FKJA 4LH6A 5IZ4A 2FRXA 1L3BA 4EGQA 1EFAA 3HJTA 2X2PA 3MXTA 4DLNA 3PXXA 4DG9A 1JJFA 2A5LA 3I2JA 4ND2A 3UK6A 4IICA 5JD4A 3DP7A 3BMCA 5BYAA 4OLBA 2RGVA 3SOPA 5L40A 5TXGA 1BQEA 4E5YA 3B38A 3IVGA 2YJ3A 4OL0A 1L5HA 3B1ZA 1QANA 3MCTA 2QTVB 5A6SA 3AEXA 1M2FA 1K7YA 5EFOA 5AJWA 1MO4A 5LP1A 1X19A 4KQGA 3DBIA 1BKSB 1Q2XA 2PLFA 4LHSA 3NWEA 4N9WA 1G6HA 3D3KA 1E9CA 2VJAA 4WNAA 1U2TA 1AKWA 5KFTA 5D5PA 1GFZA 2XKBA 3FUUA 1IZ9A 3UJ3X 2AX4A 4WESB 4LJYA 3ESQA 3FCYA 3P0JA 4XQ9A 5AVUA 1V1JA 3B6JA 3I9LA 2B78A 2ZIAA 2M1XA 2BOVA 3LUDA 1MO2A 4B3TB 2DPGA 3ZC3A 2W6MA 1EXNA 3DBHB 1NIPA 2ZM6H 1LPPA 2A33A 4BNDA 1XHLA 4JVOA 1TTTA 2QL9A 1QTIA 2HSWA 3TRDA 2GARA 3ZHQA 1RC8A 3CVZA 3J81A 1XWFA 1VLHA 1QHXA 1JR3A 1N3IA 4ETMA 4IJ5A 5CE8A 2FLWA 3AVQA 2WU8A 2PMEA 3AY6A 1QWSA 1L5LA 1FMFA 2Z6AA 1F12A 5D7BA 2P6MA 3NTQA 1V96A 3E23A 5DWDA 3IBFA 1R0RE 1KXZA 1YFLA 3PCTA 4TS4A 5CNIA 4XGKA 1JECA 1GU1A 4F11A 3UF0A 3OP1A 5TPZA 2PX3A 5BSMA 5JSQA 3ILSA 1DQZA 4O2RA 1M7JA 1P91A 3PDHA 1W85B 5F21A 3GUCA 1TC1A 2Q0SA 4PSUA 3QMPA 1IH8A 2ZSKA 4O84A 1ADYA 5HQTA 4TSRA 1IAQA 5I7UA 3BOSA 3GFRA 4DPLA 1DQSA 2ZI7A 5ALGA 2YC4C 1NG9A 2JA6G 3STVA 2HPAA 1IOVA 2LV8A 2OOSA 2ZBFA 5ALEA 3O4VA 4IIDA 1WMDA 4UARA 3SLRA 1BMQA 1LDGA 4RY0A 4S1VA 4O4HF 1T0HB 1FFXA 4GQBA 3O4RA 1PT9A 1TU3A 4G0OA 4J7CA 3UC5A 1HC7A 1F8YA 2EL9A 2IEZA 2ZCVA 3O8DA 4C1NA 1ADCA 4R1NA 4XM0A 4BVJA 4C89A 4IJUA 2IW1A 5COQA 4NX2A 1KAGA 4YMGA 1SD5A 5IP5A 1V6CA 3R3VA 3OTIA 3NEYA 1Z8FA 2XE7A 1OFUA 4KQCA 5B64A 1U8CB 4ACBA 3LLVA 5E1DA 1PS0A 4IINA 2DLCX 5JSZA 1DRKA 3DP9A 2WZCA 3K6KA 5D3MA 3AVOA 2XB6A 2YVQA 2C9ZA 1YI0A 4YGYA 1IL0A 4XOIA 1UWKA 1A8PA 3PUXA 3DTGA 4FNGA 1P2UA 4C6HA 4IIJF 3NYRA 2ZBRA 4TLAA 3HJHA 2GVZC 2XKAA 3GTJA 1GL7A 1YVPA 2EL7A 3Q0TA 3OTGA 1IE3A 4L78A 4J0DA 4QM6A 1CJBA 3IVXA 1L5GB 2WAAA 3JYQA 4ZICA 1UT6A 1MX3A 2AW3A 2HSZA 1XO1A 3M4XA 4L28A 3G9TA 2ZIWB 2VAMA 4QO7A 3X2EA 2HK8A 1JEYA 4MTCA 3VMMA 2YDYA 3E9ZA 1CQJA 4GGMX 1YC5A 2VQEH 1VJ0A 5A71A 5AVTA 4BNLA 5B1EA 2B6HA 1R5JA 3U5TA 3EDRA 4Q8EA 1DG9A 3Q6MA 2VDVE 2OYRA 4PZLA 4RJ2A 1IBKB 3GFGA 5DYIA 3RSSA 4OM8A 3D54D 4EG5A 2N1BA 5A2QA 4FHFA 4TL9A 5I5GA 4ZVKA 2JLRA 2XF8A 2GZAA 4MV8A 5E8JA 3KUKA 4TM5A 1GPAA 4QNNA 4D3SA 2H65A 2Y1CA 1N32H 3NRBA 3DMFA 1WW2A 5EHXA 3QNUA 4HQNA 5K3EA 1MV5A 1IHUA 3QK7A 4U63A 5FPHA 2O59A 2YWGA 4YFVA 5HF8A 2FTKE 5KYWB 4C14A 4KPGA 3PITA 2JAWA 3MGCA 3MAGA 3PF8A 1X1TA 5KX5B 3LUBA 2P9BA 1P7VA 2C2GA 2PMDA 5I5TA 4PIVA 1N34B 3GJ6A 3TR0A 8ADHA 1C0EA 1JPNA 3ICQB 3NUQA 2ILTA 5TF4A 1T9CA 3D3QA 1CQIB 4RETA 2PVPA 3A9RA 3ROMA 3HOYG 4U7PB 2AOTA 3RKSA 4I19A 3LT1A 1RYZA 4XXHA 3HDVA 4BVGA 4DYDA 4OGGA 1D2CA 2D5BA 4RCZA 1LK7A 4CC5A 3PW7A 3DEZA 1L5KA 4JX9A 5MFZA 5FD6A 1QU3A 3MWLA 1ZH4A 2H5EA 3BGSA 4Z53A 3LO8A 4A8TA 4DL4A 1HGXA 1KR5A 2EF0A 4RD6A 5EINA 4BNIA 1VE5A 4D4JA 3T4XA 3DL7A 1PK9A 1TJYA 2WDTA 3Q8QB 2YBDA 3UQ8A 2PSDA 4GW3A 4EP1A 2F3TA 1IOZA 1U28C 5EJIA 4RTSA 3WWEA 1TRHA 3BFPA 3RWOA 4HFMA 3UJ6A 2JBWA 4HPWA 2W2VA 3F4LA 3FHJA 1JXQA 4CCWA 2WJGA 5LBTA 2E9SA 2FEOA 4E7PA 4RKEA 2GCNA 1JV2B 4DUPA 5IAAA 1KRHA 1D3AA 1IXKA 1EM8A 4NOJA 1ZCBA 4OXRA 4NZPA 1S96A 1P5FA 2NZVG 2WU4A 3DHYA 1FSSA 1I9GA 4QYTA 2ZRLA 1RBMA 4IV0A 1SVSA 3CG0A 1J20A 4OOEA 3ECAA 1CFJA 1VYTA 1KH1A 5IKEA 1FA9A 3DE0X 2Q4RA 2ANCA 3ROTA 1ODLA 2R1VB 5BPFA 3TEKA 1TUEA 1WM1A 3GNSA 3II6X 4PY2A 4RNDB 3D3JA 2PCLA 1ZK0A 4CKYA 1DE0A 3GK3A 4MHTA 4GNRA 1Q6YA 1WETA 4RZUA 4W9NA 4IH4A 1D0SA 5FPOA 4Q7MB 3ZDZB 2HHFB 1OREA 5M7EA 4JKYA 2VWPA 5C8VA 4DLLA 4FFRA 3ZZUA 3UW3A 5EXSA 4Y6LA 2V5VA 4WJKB 3WWZA 1NUPA 2IZOA 1N1GA 2O2EA 3IQIX 3KOYA 3VSBA 1YDWA 1NW9B 1SHZA 1YRLA 4Y6QA 3MLAA 3PJEA 2P4SA 3BH6A 3Q2KA 4C4RA 4DN6A 2OXCA 3SNHA 1WY5A 4YJ3F 2ARKA 1FDRA 2PZLA 5F3WB 1OKKA 1Y7TA 4PINA 1SBCA 3QOFA 4GT1A 4QWEA 4HZGA 1ZX1A 4YAUA 4UXJA 4XYLA 3HBLA 5I6DA 1GT6A 4IS2A 1UMCA 2OCAA 3GNQA 4Q1CA 2FV8A 4YA6A 2WSMA 1PYOA 3ZV6A 4BKOA 4NCHA 4M0JA 1QLWA 4RH3A 3K9FC 3DF9A 2ODPA 2BM1A 5CT6A 4O0MA 1AA6A 2V98A 4I81A 1KS2A 1SPXA 5C4MA 5FP0A 2X8BA 3VO9A 4XZ3A 2JGAA 1N9ZA 4F4HA 4IXMA 2SKEA 2B69A 5BYKA 5LZ7A 1C9MA 3RVSA 2FLKA 3G23A 4QXQA 2Y9PB 3B89A 3C8MA 2UYOA 1N2OA 4P36A 4Q82A 4N5NA 3LUCA 4D56A 2HJ9A 3JTEA 3J7AC 1WDKA 3COPA 4KO3S 5IT9W 1OU4A 4CT4B 4KIFA 1JKJA 4ZU3A 3MWGA 4MVYA 2G36A 4EGJA 3RS0A 3D7KA 2FEAA 1N2GA 3UHOA 1PLKA 3V48A 3PDJA 4YPOA 5IVDA 2NXJA 3CSUA 1XTZA 5GVSA 4PRYA 1GVNB 3AFIA 3H7IA 4H18A 1FFDA 5AKJA 4RB2C 2QLFA 1DO0A 2VUMA 1N0UA 3KOXA 1G19A 3V33A 3HM9A 1P7YA 4RY8A 5DO9A 4MWGA 3OCYA 5CAEA 5ALXA 3IQHX 2ZUUA 4YJKA 3GIKA 4GYJA 2JIMA 3R0ZA 4D80A 3TQ1A 1ZAKA 4M9QA 4PDBA 2FUEA 1S8OA 5AP9A 1NR1A 2DECA 1H9AA 1W2WB 3IBYA 4O83A 3CF6R 5HM6A 2DEUA 1W34A 2QD1A 4DNQA 3I9OA 3NGXA 4JZKA 1W1UA 1I3QA 2DAPA 3TE7A 4D97A 2JHCA 4OQQA 1QG4A 2C98A 3DXFA 1GL6A 3TD9A 4A15A 1IZ0A 1LI7A 1MTZA 2I6QA 4YLGA 1JWAB 1N1DA 5AKXA 2IA5A 3HYLA 2H11A 4RXTA 4KFSA 4MDHA 4OSEA 4Z51A 5LDHA 1GFWA 2IP2A 3FB4A 1RHRA 3PFFA 2DJ5A 2GWHA 1PJ2A 1O08A 3WLRA 3CZPA 2OK8A 4RVGA 3W5IA 1KJZA 1H22A 2OBXA 4YT5A 4WKPA 2VHVA 4UBLA 1AF4A 5DWVA 1OX6A 2X4LA 4EB3A 2QYHA 1R64A 4D3YA 1MEEA 2P9QA 1RFGE 3F67A 4O7NA 2BUBA 4J7AA 4MLDA 1DKOA 4BKPA 5CRIA 1RAGA 1VJCA 1YA6A 4LN1A 4UNPA 1NBHA 5AOAA 5IJAA 5IKXA 3P9RA 3NHKA 1DWPA 2YWRA 2IWRA 3I4MG 3PQ3A 4B3BA 3OICA 4L5JA 1E3JA 4TMZA 3NASA 1ADFA 5FNZA 2RHMA 3Q85A 4JCCA 3P4YA 3T3MB 4C7MA 4M1EA 1C0IA 2WP8J 1CUWA 3DDZX 4BO2A 3EGXB 7YASA 2HWKA 2SCUB 1TA9A 1YFJA 3UJ8A 4UMEA 4JNKA 3LUPA 3LNTA 2B3DA 4GNKA 3ZLBA 3A4YA 3T15A 3OQMA 4QJIA 1QYWA 4JXKA 4CNBA 3AEUB 4UEOA 2W6PA 2YYAA 2GJKA 1W8IA 2W9BA 3TIGA 2BQRA 3UOGA 6LDHA 2Q1XA 4MGYR 2PZMA 2I55A 1T4CB 2D06A 4WVFA 1O03A 1WPGA 3GN2A 3RG2A 1YK1A 4DQNA 1YVUA 5TGZA 1H1LB 4KVFA 1BEUB 2UVPB 3DHVA 4RGVA 5DN6A 3EMDA 3A1SA 3QA3E 4ALJA 2JDIA 5ARCA 3BYZA 4QFMA 3O38A 2ISCA 1YOVA 3OEED 5IAGA 1OWOA 1YIOA 5H1YA 1U8UA 1O97D 3BHJA 4C0LA 1CUBA 1E77A 1LC0A 3KJIA 2ADMA 1PZGA 4EA7A 1MC1A 4RQUA 2F59A 2O48X 4E08A 4NYMQ 2B1QA 1L7VC 2YZ7A 1RRPA 1WNFA 3IJPA 2JA6A 5H7XA 3OA2A 2AJDA 3D4LA 5KVQA 4ZAFA 2Z3ZA 3BMNB 3BZBA 2AJ8A 3QY0A 4I9GA 2AUMA 1Q83A 1PNRA 3N3BC 1NMQA 1SRRA 1F2DA 2JHGA 1ZW6A 1ZOIA 5CUQA 2G9VA 2X1HA 1E1CA 2Q1TA 2JBAB 3ZVRA 2PUCA 4LF6H 1HZJA 2BGRA 2J3JA 3F8TA 4F38A 2NUPB 5JXIA 3G9QA 3CKLA 2YRWA 1XF9A 2AEFA 1NP6A 3UIEA 2FWIA 2ZTSA 5ENVA 5B37A 3GR6A 3GLIB 2X7HA 3MOGA 3IT2A 3KHTA 2E5LB 3QBVA 3SYNA 4ZXPA 1HDYA 4A6DA 5ALHA 4TRMA 2F4VB 1WWKA 1YRQA 4CG2A 1BFKA 3H75A 5IKOA 4Q34A 3GMSA 3TQSA 1O2DA 2DKOA 1KU0A 5ITZA 2VYFA 3HKEB 2HWUA 4L6IA 1UBLS 3BXFA 1TAHA 1GQ2A 3RU9A 2PJUA 1SUEA 2FLVA 1FU8A 4OX9B 2CNUA 4GU5A 1VQ1A 2FUKA 3UG6A 3U7RA 4C0QC 4ZCPA 5EHQA 3WL8A 2R92G 2NXEA 1JQJC 2IZZA 2NLOA 1C4KA 4RKFA 1P4HA 2ECFA 3TOXA 2IHUA 1WXEA 4FGKA 1YQEA 3M89A 1M2HA 1R4AA 2VDPB 3T7AA 5GPBA 4JD5A 3BL6A 4QDOA 5H9VA 4LE2A 4WLUA 2JEYA 3EZXA 4Z9BA 1OUMA 2NV6A 1U0NA 1J25A 4QTXA 4NFSA 3TLXA 4E5MA 1WB5A 4QWDA 3DT9A 5M04A 4D9KA 1JHAA 3VZBA 3C1OA 2ZYGA 3E1KA 4YMIA 1M1XB 1PEDA 2KSQA 4E2ZA 3DAOA 1GTVA 4HLUA 5TPWA 1JDPA 2JEOA 1J8VA 4GQIA 5K8UA 4G0WA 4GLLA 3LUHA 4QYMA 3DLPX 1M6WA 4S24A 4J07A 4KR2A 3W1BA 2W4MA 5FFNA 3B3JA 3KWFA 2GSDA 3E18A 2UXDH 1H6DA 4YAOA 3ZGVA 4OAQA 4DSOA 4O4IF 2ZTMA 3QSYA 3BXEA 4K9MA 3E35A 1ZEJA 5CHYA 5KQPA 4MUFA 1U5BB 3TVTA 4AS3A 2FDRA 1X1EA 3WHLA 5FPKA 5HRUA 3FLMA 4XSGA 5DHAA 1T5IA 1K6EA 2PH1A 1S4MA 2OENG 3LKZA 1J2UA 1E9EA 4LY0A 3K1ZA 4CLHA 4TV8A 3SN6A 3EAFA 2G5TA 2JIDA 1KWGA 5H3CA 3NOXA 2ZDQA 5JCZA 3WYAA 3ZDAA 1C1DA 1K27A 2YUIA 4FC7A 4Q3BA 1QK3A 1W1IA 1X42A 3NWOA 3ESDA 4G89A 3MM4A 3I2HA 5IKMA 4KO1S 2NO9A 4UUAA 1ULAA 1GNPA 3L6DA 4YNBA 4PN3A 1I0ZA 2QT0A 3GD7A 1ZVKA 2WRZA 2WWTA 3QFFA 5BV1A 3GAZA 2BTEA 1I3CA 3N6XA 3IP5A 3WYEA 3B60A 1Q91A 1S2NA 3C45A 4IV5A 1WB9A 2UUCH 1ORIA 2WY2D 5DCLA 4ND7A 2XMCA 4EH1A 1Y48E 5SZKB 4WZAB 2FP3A 4KNWA 3PR1A 1NWHA 4CLRA 1G0OA 3MGAA 1EB8A 4QWMA 4YR9A 2HV8A 5ALLA 4M2LA 2WB4A 4FYMA 4NBUA 1Y9JA 3ML1A 4P92A 1G5IA 2YZMA 1OYYA 4OTZA 1XMOH 1JI3A 1XQ6A 1VCMA 4EGSA 5ELMA 3F2IA 3FBWA 2P6OA 2C5SA 4O3QA 3I5XA 5ALZA 3O7WA 5FFMA 3UK0A 2DBQA 4YRRA 3SMVA 1VZ2A 4QBIA 3DULA 3PC4A 1ZIPA 1QO0A 1OCEA 3IHWA 3L2OB 1Z5GA 3DVLA 2G0AA 3VV3A 4W5NA 3W9SA 4HH4A 1M8JA 3F74A 2HCRA 1U9ZA 4DR1B 1GQSA 5DXJA 4GWLA 4B81A 2Q6OA 3HOVG 2A1IA 4GD3Q 1GILA 3GJ0A 3NP7A 5TRTA 1YZKA 1PVDA 1THTA 1TA4A 1P17A 2WUDA 1M75A 1AM4D 4E5NA 5TLSA 5D01A 1P6QA 2FPKA 2PEYA 1SVIA 4FTWA 4QHSA 2PFSA 3LK7A 4JWKA 4XUGB 4GMKA 4BO3A 2F1KA 3B1KA 2XCOA 3E5RA 5LIPA 2AR9A 3B1XA 5LP6F 1QVVA 4G9BA 2JNWA 4GE0A 4DJ5X 2E21A 5KBYA 5K0JA 3TNJA 1QH1B 4DMMA 1TVKB 5EWFA 3BJYA 3N6RA 4X60A 1JSXA 2MMGA 3ZY3A 1E0KA 2BD0A 3FTDA 2YX1A 4OI1A 4ND8A 1A9RA 2VPYA 3CZ5A 4C2TA 5BT8A 1HQYE 3MZ0A 5CXXA 1Z26A 4UVHA 1YMUA 5LCXA 3WGJA 3QM1A 2BFCA 4A6PA 3GCDA 4TYQA 1XCMA 1Q6ZA 2P6PA 4JEMA 1HLPA 3AF5A 3FTQA 1ODTC 1OXXK 5JAUA 1QOPB 4AYWA 4YI5A 1G17A 5CA1F 4G85A 4NULA 2KHZA 3V2HA 2XQVA 1RFLA 4U2FA 4U7FA 4F91B 4PLTA 3L1JA 5J5VA 2R1TA 1FK8A 3A1DA 4W8HA 4R68A 3N7AA 3NIBA 3EGOA 3OURA 1SOAA 4U8GA 4Q47A 5I7AA 3TAHA 2CSXA 3MUNA 4BQFA 4IJVA 2WR8A 4LGMA 1DKPA 2ZT8A 2QYOA 1RE0A 1MGPA 1W0JD 3BHMA 3PFNA 1G18A 4WNIA 5KFYA 3O03A 4RTOA 3QF4A 3K09A 4DL3A 1YUNA 3BTVA 5HTOA 3IT1A 4FE3A 4H6PA 3U17A 3B53X 1NBMA 2IV3A 2JG3A 3VKWA 4IS3A 1NBEA 3WRXC 1A76A 4F6LA 1K63A 4ESEA 3A2KA 3C70A 1LPNA 3D6FA 3T52A 4QQFA 3ZLJA 5G53C 2YJNA 4EGAA 4JL5A 2XT0A 5HIIA 4EI2A 3GUHA 5DLFA 2RI0A 4RHUA 4L5CA 3O4HA 3PNQA 3V1YA 2QT9A 3K9GA 4JLNA 2ZZKA 3VHLB 4H1HA 3KVOA 2GCEA 1IBCA 3SKYA 3R6WA 3GBPA 1SCKA 2D0OB 2AG8A 4J9MA 1AE1A 4KSCA 4LSMA 3RB3A 4B6OA 5ALVA 4G1CA 5CD9A 1PT6A 1XRJA 5F3DA 2XMRA 1DX9A 4R1OA 4HDAA 4DABA 1A9TA 1PHRA 3M4ZA 2PGXA 5JMOA 2P9TA 3QEOA 2WVHA 4GOXA 4OGKA 5FQNA 2YN2A 4BNHA 2QUIA 2GCOB 1P6XA 1QXSA 3CLHA 1SCJA 2PX8A 2IXFA 4AMVA 1OGYA 2QVCA 1FP7A 4Y6PA 3NYQA 1P0IA 4DR6B 2BEVB 2XCRB 3ZJVA 4OGFA 3HXMA 4NHEA 3FJYA 1BS2A 3UOWA 1MKYA 4WIAA 2CNDA 1QIKA 3I28A 4JLMA 2HSGA 4QPPA 1BE0A 3NOQA 4MVJM 1VA5A 2GCPA 2TS1A 2RC6A 4AX8A 2AGPA 5B58T 3FWHA 1MO3A 2QN7A 4TM7A 2ZU6A 4I1PA 2BYTA 1P31A 5GJCA 3HDQA 3RVDA 4OYHA 5KFEA 2VNAA 2VN8A 3JPWA 4AJNA 5AXAA 4UMDA 3AU8A 3HGTA 3LYUA 1C81A 4S04A 2QX9A 4DCGA 4YCJA 2G40A 2V7UA 2FN9A 1O3YA 4TVSA 4MA4A 1Y6RA 3B82A 4KNVA 5EPUA 1QO9A 5BOSB 1QS0A 5IDQA 1IY0A 5E3HA 1JTFA 2G82A 3WTCA 3GPBA 2G4VA 2EIYA 3QU2A 1YZVA 2M1ZA 3FWZA 3K0EA 4WXYB 3EQZA 1YR1A 4DW8A 4FNMA 2BEUB 3V4SA 4YBZA 1HNNA 1DNPA 1WVMA 2MWMA 3PUKA 4WX2B 2PANA 2E5FA 1CNEA 1HDCA 3OPXA 4Z86A 3PLNA 2REQA 1Y3HA 4OFBA 5JADA 1FW6A 1QHGA 2YXNA 3IA2A 3O4FA 2HWYA 3MOIA 1N2SA 4BN4A 1QHSA 3VAAA 4Z7NB 1LPBB 3F4BA 4IVRA 3ZHTA 1DTEA 4YCBA 1JQDA 2J0QA 5KDDA 2UYCA 2P41A 1ULBA 1ECCA 4KK3A 3EXAA 2R6CA 5TSDA 3PICA 3IEMA 1SNYA 3GJTA 3IDQA 4DB2A 4QJ5A 2PUHA 1ST2A 5ITWA 3QH4A 1YRYE 2RJ3A 1XYGA 2QTFA 4CQMD 4E15A 2AFRA 5GONB 2COIA 3RVKA 4EJSA 4AJLA 5C5DA 1BHO1 1NI5A 1KMMA 2Q9CA 3MBOA 3BTSA 3BX1A 3PPYA 1G9XA 4MLZA 3KSUA 3COZA 1A7UA 4M1ZA 2CK3D 1EHCA 3MCZA 1T1EA 1QHNA 1J07A 1RJWA 1TMYA 1QLJA 1LLDA 2B4RO 5ALRA 4IY1A 3ANMA 1WPRA 1UAAA 1Q1QA 1CEQA 3B6ZA 4AKIA 2ATIA 5FDFA 3TTTA 3HCBA 3KT6A 1XQWA 3B52X 2I2FA 1HV8A 3FPFA 3IVMA 1N7IA 2R2AA 4RD0A 4WADA 5KNDA 1CEYA 4C01A 3BCRA 3N2KB 5IULC 2I6FA 1JQKA 1LFAA 1XCLA 2SHKA 3KL4A 1E4FT 4AWBA 3G89A 3GFSA 4OKSA 4OX9Y 1TKBA 4M89A 4IR9A 4G26A 1T2DA 1DAAA 3WRYA 3DBVO 3WWDA 1RPTA 1TT5B 2JANA 5GGXA 3EXFB 3FZEA 4D02A 2X7XA 3Q8XB 1KZ4A 5BSHA 3W7VA 5EDWA 1NJ2A 3O82A 2HDKA 4Y2HA 1JJBA 1Y9EA 4L27A 3GLFB 3S1SA 1VLVA 4GR4A 3OIFA 1QORA 4ZV9A 1U0OC 2V1UA 2XMGA 3K9WA 4G25A 1MOQA 4ZIRB 3LHFA 4WNYA 2GXAA 4ZV4A 3RW9A 3ZZNA 3M6WA 3HI6A 2BF7A 4CIVA 4ECRA 1BCRA 1E5TA 2P2CA 3R5TA 1QGZA 2PZBA 2KSWA 3TL6A 3FHCB 4EHHA 2R92A 4LFBB 4JI6B 1PQWA 2PGAA 5KFQA 4ED1A 2DWCA 3QV1A 3WXBA 1VTKA 4LKOA 3WG9A 5CK5A 1UKAA 1YS4A 5E38A 4M9SA 4MYDA 3PIIA 3OJWA 5CHEA 1O4VA 4Z3OA 4KWCA 1E6MA 5IYCG 1KIAA 1L7XA 2WABA 2O1WA 3SFVA 1E2BA 2YVKA 5C5EA 4AJEA 1PFVA 2ECKA 2VQDA 3RIYA 1SZJG 2X9GA 5ALMA 4Y7CA 3LFUA 1JH9A 5AW5A 3LYHA 3VR5H 2FWNA 3X2FA 2WAQE 3SM9A 4FFPA 5IK2A 1KGSA 3WJ1A 3G1TA 3OFND 1D2EA 4KBGA 3LI2A 2B7CA 4EHFA 2QRLA 3FTNA 1B16A 4J91A 5BUQA 2W4QA 2A14A 1MG0A 1Z4OA 3IS3A 2CHUA 3JRNA 5G0SA 4LQ4A 1Y80A 3G0HA 2XCIA 4I5DA 4MVJI 1Z28A 1BDHA 1RVDA 2CBZA 3VKVA 1OYVA 2NU8B 1L4NA 3RB0A 5GAJA 1DFGA 4JP5A 4CLEA 3C15C 4RPLA 1PW5A 2LRHA 1E79D 2CV0A 1PJAA 4A2BA 1NIJA 3W2GA 1UFQA 5J1SB 4IYJA 5A9SA 5ES4B 3ZNQA 1FP4B 1DP4A 1QRRA 4MDEA 3B36A 5DNVA 3DZDA 1OAAA 2Q8NA 3BXXA 2YV3A 4V1CB 1K5PA 1YZFA 2GXSA 2AH5A 3T5KA 1QP8A 3R9RA 5IZCC 1NN3A 2B2CA 4QPNA 3U7QA 4FZ3A 4DQLA 3TWOA 1B26A 2FEMA 2ZXEA 3RC2A 4DA8A 1ZRSA 4BFZA 4YJ2A 1UKBA 2ZP1A 1JDBB 4R7RA 1OH5A 5JZSA 4K7JA 4UE6A 5G0VA 3RD5A 1DDIA 3GUYA 4IR7A 3H9UA 4N12A 1I36A 1KI9A 4FKZA 5KC9A 4MS1B 1VFPA 3HN7A 3IIMA 1NQWA 3OIWA 4RA9B 1QQBA 2WV9A 4K46A 3ZWWA 1W88B 1NW4A 4N8EA 2PR7A 2XNCA 3OSUA 4AD8A 5C9ZA 4LYJA 4RA6A 5SZJA 4ZAWA 4IUBS 3IO3A 4QU0A 4PHFA 3KZXA 1MHPA 4I08A 1XZHA 1ZIOA 1L4MA 3OIUA 1TM7E 3PWKA 2GAFA 2HHLA 2DABA 1I50A 3HRHA 4J7UA 2IZ1A 2R48A 2DFNA 1FSGA 2I3GA 1S2OA 2AEJA 5CGZA 4YJHB 1LBTA 5K8CA 4MV7A 3A06A 4E14A 2QQGA 4GVXA 3BIJA 3MC1A 4V0OA 1YB4A 1DIHA 3MD0A 3ZHCA 5JAQA 5THKA 1WPXA 5IC6A 4ZT4A 3OTHA 2EG9A 4ZT7A 1B6GA 3L5KA 1K86A 2QTGA 4ZV7A 2H4XA 3OD1A 2HM7A 4P84A 4ZPXA 1NRJB 5CJPA 4PZ0A 4IDHA 1FPMA 2FKLA 3CURA 4KR0A 4WBSA 5BORA 4P5DA 1KYWA 2FMXA 1ZNQO 4V38A 2JKYA 2ZSFA 1RRCA 3NOOA 3LHDA 5F2KA 2B4AA 1MQSA 1VL8A 2FPWA 4OXKA 3P2JA 3LC0A 1F9AA 3R9WA 4I2VA 5TC4A 3H97A 2PSJA 4RZHA 2JFGA 4CM8B 3BDAA 5DP2A 2GPBA 4B31A 4EGFA 5DSZA 1NHWA 3MYYA 2ZRMA 2VF5X 5KWIA 1U0BB 1A7AA 2TMDA 5A9TA 3AI7A 1SOWA 1JDZA 3PQ4A 3H2JA 1GITA 5BNFA 4R8UB 1UBEA 2I4TA 2O2IA 1UFRA 3A7DA 4CL2A 3G8YA 3C5WP 1I9CA 3PRJA 1RWOA 3QELA 4K6NA 1E4YA 1LFDB 3F8NA 2QG9A 4NYIQ 3H2IA 3VA7A 4BNUA 1PJQA 1N2CE 1UP4A 4DWOA 2ZDGA 1JUDA 4H6VA 4WVLA 1U8ZA 2QMQA 2I2BA 3ABSB 3RF6A 3ICWA 1GG2A 1Z75A 2J3DA 1MNQA 3A6KA 4C5AA 4OJQA 1G6KA 4YT2A 2I4LA 2ZTHA 4E70A 1YJ5A 3GGSA 2HWWA 3E9RA 2D7DA 4RABA 5HA5A 4IDNA 1W36B 3JV7A 1YRBA 1UBCA 1UZMA 4NMMA 2BEKA 2P3SA 1H4VB 3N70A 2ALJA 3K0HA 3B20A 4C2MA 2A6PA 5TMPA 5HUJA 4AKGA 4BYGA 1G21A 4CKBA 4YRQA 3EBOA 3KB6A 3RHTA 4L9WA 4CTNA 3E61A 1NBIA 4GPEA 1V51A 4H3SA 3O75A 1V48A 5DLQC 2XAUA 2O8BA 5BMVA 5LDGA 4EUHA 4LXGA 3CLRD 4X44A 4IP0A 2INGX 3QU7A 4PLHA 5CG1A 3MWDB 4U39A 4FR0A 3LL7A 3LFTA 5KQLA 4L22A 2QBYA 1SXJD 3WNQA 4ZTBA 2V7WA 3J7TA 2IS6A 1R27A 2XZOA 3MMPA 2QLTA 4D98A 5F5LA 1SO8A 1J5EH 4EUSA 5GWXA 1S68A 5F4ZA 2VBGA 1TLFA 3COJA 5KYUB 2NSJA 5J2TF 1IB6A 3F6SA 5HHTA 5A1TA 4H0CA 4PXYA 4BDSA 4DLUA 5FTJA 1KBOA 3AO0B 5HE8A 3I8OA 4Y1RA 5A4FS 1LGYA 1P18A 1KZ6A 4G0QA 4C9BA 2X5KO 3SSMA 1IVYA 3FSGD 3TTVA 5E0KB 5HIJA 5TVGA 1RK6A 5IRCD 2EXXA 2ZDHA 2X9NA 4JUZA 1N36B 1A5ZA 1N48A 4LF9H 2PXXA 3D3EA 1A27A 1XI2A 2ZULA 3WZLA 4A2PA 1GGNA 4J0JA 7ABPA 1YH3A 4X1KB 3M49A 4JLOA 3M1IA 4OLFA 5ARBA 3FUCA 4IVNA 4GI5A 4NU0A 1QIEA 3PUJA 4QUAA 3VC2A 1VE9A 2E3JA 4I4TA 1QR2A 3FOCA 5L4NA 3CUWA 2DETA 1ONNA 4NG4A 4BNJA 4XD7A 4ZI3A 1WO8A 2R8EA 3R3YA 3CKKA 3ZBPA 3HZHA 2BFEA 1S2MA 4JX8A 4LDJA 3CF4G 2BHLA 2OCBA 4X85A 4ZHQA 1NVWQ 3ISVA 4AKTA 1XD8A 3DOEA 4L8GA 5H82A 4WZZA 5FBWB 3EZNA 2JCVA 1JDBC 4IM7A 3TPCA 1SUAA 5KFFA 2H54A 4Q1DA 3SYKA 2C2OA 2PSSA 4W6ZA 1R8SA 1OAOC 2GPWA 3N0VA 3W7BA 3PLRA 1YQTA 4M87A 3LHIA 3PTAA 1KH2A 3K96A 2WU0A 3HYRA 4EG1A 4X20B 4GLBA 4W5HA 2EW2A 4U7WA 4FYWA 1U7DA 3PHJA 3ZW7A 3PDUA 4DR4H 4M1TA 2WG1A 3FYTA 5AVYA 3WIVA 3T5AA 3EFBA 3G0GA 3ZH9B 5G2OA 3IERA 3NIFB 4A3GG 3DCJA 2Y0DA 3AYZB 4UE2A 2AC7A 4DC0A 2JCYA 1G9TA 1MZPA 4DBLC 2VTEA 3QOYA 4TMWA 5EKDA 1LW7A 4GBMA 4RD4A 3GN1A 2PZ8A 3S1AA 3OLXA 3GRKA 1KOLA 3R7LA 5K0FA 1HFJA 1MB9A 5EE0A 3RARA 3BD9A 4MQBA 3B9BA 3ZGOA 4ASUA 3SQXA 5F9HA 1SJ9A 4G24A 1J0AA 4PG7A 1FVIA 1NZFA 3EEYA 1YU9A 2B34A 5ENZA 5CIYA 1I3NA 4P53A 2EDCA 3GLGE 1HNZB 4BVEA 2OZEA 4F45A 4GBED 2QTHA 1YQWA 1VHTA 5KYNA 5DTRA 3EC2A 4EBFA 3WA7A 4DLTA 4E03A 1PEYA 4C30A 1KDZA 4ALLA 2PZJA 1W5TA 4IHJF 1OH8A 3A8TA 3OH8A 1CY4A 3BE4A 5ECWA 4I6JA 4PPYA 1T26A 2HUNA 4FZVA 2PMZA 4F3KA 1H4TA 1UDWA 2FX2A 5KFUA 3MUEA 4PZAA 4V02A 3LBFA 4C3VA 1N2EA 4OJKA 2BONA 1BXRB 3PZPA 5HMLA 2HDWA 5NLLA 3NH9A 1U28A 4UAVA 1E2KA 2DFVA 4D26A 2P5TB 2XE6A 3DV9A 2QTVA 5CYOA 5L1JA 3ANSA 3ZZTA 2W0MA 2NM0A 4HB3A 4WLVA 2WTMA 4O1IA 5CMLA 1UKVY 3G2IA 1IULA 2ZBQA 5B1DA 4WBNF 3COYA 3G2HA 4JWTA 3AI3A 4HVLA 1ECFA 2ZRGA 4HAUA 1TVMA 4UATA 2E1RA 1QFXA 2YFKA 3FDJA 1OBHA 3DHEA 5B7NA 1KTVA 4B82A 2A9FA 1AZLA 1B3RA 4WESA 3KQNA 3PE4A 3H3VH 4KVGA 3ZTTA 3OF5A 5JVDF 5J58A 1YS6A 1O1YA 3DBHA 1FY2A 1W36C 3MT9A 5FLXA 1EH5A 5KG6A 2PUJA 1W47A 4BMCA 4YV7A 3WK5A 5SY9A 1FYVA 3I4FA 2PUBA 4J3FA 5AI5A 4NZZA 4Y18A 5ESDA 1VKNA 4ZU6X 5LZ9A 2OA0A 1NFRA 3NZEA 1Q3KA 5T4EA 1Q0PA 4W5WA 4XWAA 5C32A 3MS7A 4WKCA 1OXKB 1TC2A 4JITA 2XA1A 1F48A 2BGNA 4M1SA 3VXKA 4PCUA 1CP3A 5SY6A 4ZOQI 2PZGA 5BWMA 3DYBA 5DM1A 1M6HA 3DEHA 3KYJB 2RAFA 1W85A 3WOVA 2GD2A 2IUSA 4D9IA 3SDBA 3RF7A 2FUG6 3KX2A 4X8OA 1DKRA 2Q5OA 3ND9A 5C1DA 3ETJA 1G60A 1I2MA 3AJ8A 1RXYA 2F55A 1IHYA 4CL0A 3BBLA 3NVKI 3FDSA 1U3GA 3L0BA 5CM2Z 4BEVA 1V7QA 1SU4A 2BZ1A 1X7GA 2J7KA 3TLMA 2HU5A 4V03A 4B73A 4UTVA 1G0NA 3W3AA 2GRJA 2FPOA 4D0NA 4ZC8A 4GP7A 1HDXA 1UM8A 1Y3BE 4IQ4A 5T57A 1IEVA 3ANNA 5LKAA 1ZHHA 3GFQA 3NV9A 3HP4A 2WJJA 3ORHA 1CT9A 4IZIA 4D81A 1TM1E 4PIMA 3IEVA 4B44A 2BMWA 3AW9A 3C3MA 4WTOA 1GV0A 2I71A 4GYWA 3EZ2A 3WLMA 3JY6A 2QJTA 4KN6A 2HPVA 3HFJA 2Z2KA 4DL6A 3I01M 1KERA 3ABIA 2WWIA 3GO4A 5C3UA 2CMGA 4W63A 2WSSD 4ESHA 4XFDA 4LZAA 4ZPJA 4KPFC 1F8FA 3NUAA 1ZIXA 3P2EA 4WWHA 1ODSA 1I1LA 1GQOA 4GMGA 1D6JA 4LJAA 3IKLA 4L7VA 3HJFA 1QDLB 1TQHA 2XZTA 2ABJA 1YNOA 3GG9A 4B3RB 5LYJF 4UJ3A 4HDRB 2L2QA 5TMDA 3NFYA 5FOUA 4EB8A 5BWUA 4RCVA 4B85A 2IV7A 5BWLA 4AQ7A 3OEHA 1HYBA 4KUGA 4G0ZA 3CINA 3KLNA 3BH0A 4KRGA 4NK4A 2R751 4H77A 2P4EA 1O5IA 1CDDA 3CC8A 5AK4A 4BVLA 3AHJA 4BMXA 1H5UA 2O52A 1XMXA 1AS0A 2Y0CA 3ZBUA 4TYWA 2R5FA 1TKRA 1JLLB 4CF4A 1XVVA 1I7LA 1QQ7A 3E2PA 2BBWA 4LVOA 2V9WA 1ZVJA 1WCMG 1Y3FE 4ZRMA 5IAJA 1YZHA 2HA7A 1NXWA 1P3Y1 1X1SA 4O8CA 3LWZA 1QIGA 4IRCA 1A8HA 1EXDA 3CUUA 1FFCA 3SEFA 4RULA 1B1AA 2QKYA 5CTJA 2K6GA 4Q02A 2QM7A 5ANRB 3RI3A 2Z57A 2BEWB 1I2ZA 2V7QA 4JV5B 3EXIB 2R97A 1EU1A 4JIMA 4BDTA 1CEXA 5KYWA 4Q3DA 5C8YF 3EW9A 5H3LA 1DIKA 5KX5A 1T25A 5HJEA 4HYYA 1C8BA 4AQYB 3DYIA 1ABFA 2ETVA 1G7RA 5JUWA 2YHBA 4NVRA 5K0EA 3RBEA 3K0AA 5IDWA 1CQIA 1TRKA 1YDMA 2RHHA 2CXPA 1N0IA 1VSUA 2XW6A 2KBFA 5HKBA 4CDNA 2J33A 4HVTA 3A05A 3OKFA 3GZNB 1NYLA 1VJ1A 1KEPA 2OFFA 1IJKA 2ORIA 4XD2A 1H2FA 4WCVA 3ZKWB 5FR1A 2G9QA 3FGPA 4RACA 1NE7A 2ZT6A 4UTNA 3R7SA 4PZPA 3DUFB 4ME6A 1LSSA 4K6KA 5EXEA 4LMRA 1BCSB 3FZQA 1Y1QA 5M34A 1W6RA 2RD2A 3O7MA 3TDNA 2W90A 2R8PA 4XB2A 4NE9A 1QZ3A 3WRWA 3KAPA 4XDYA 1T2CA 1JFSA 5H70A 1U6JA 1X3LA 3CWZA 3R76A 1V37A 4YV2A 4B8YA 2XF2A 1V9PA 4GUAA 1FDIA 3TFWA 2O3JA 5ALDA 4EEKA 1N8NA 3EH2A 5LMNH 3WHPA 3VO1A 1H94A 3KKPA 4M99A 1KU6A 1P5JA 4DV2B 3FN4A 4F9GA 3HDYA 2CC2A 3CQ9A 1N1EA 1F5NA 3WGOA 2QX4A 4BP8A 1VP3A 3ZDQA 2X3FA 3ZWAA 3OIYA 3CM0A 2V96A 3ZDXB 1J8QA 4EATA 1R9GA 2R1VA 3THOA 2HJSA 4NOMA 2ZG6A 4BLSA 1JVBA 4F6RA 2Q62A 1NFQA 3CRW1 2NSLA 1Y1PA 3IP8A 3C14C 3QUAA 4DIMA 2C7BA 3NMUF 3ZY4A 5KVSA 2HHFA 5I7FA 2CXQA 2PRYA 1CZNA 2XGQA 4U7DA 3VR4D 4F4JA 2LNDA 4DR5B 4FYHA 2BGKA 5FBLB 4PC3A 2XC9A 4JBYA 3KUCA 1Q74A 2G5CA 4LBZA 1KVSA 1GWNA 1UP6A 2PKWA 4B4WA 4UD2A 3UV3A 1VSBA 2GHQA 3PB3A 3HYTA 4WFJA 3ELBA 2Q1YA 2JHAA 3H2HA 5IPFA 2ZITA 1MIOB 2OBLA 4WI1A 1K4MA 3RC8A 5E6RB 3DEKA 3EG5A 4DV1H 1C14A 3ZD9A 2GXUA 1BZYA 3EA5A 4MVJH 3SR4A 3FTCA 4DV3H 1J7JA 1D6MA 3PQ8A 4MUEA 3UMBA 1PFUA 4YN3A 4G86A 3JCZA 4MLPA 1LRJA 5HNEA 1W35A 1CKOA 1M3SA 3CF4A 3O94A 3I4LA 5AM1A 3WL5A 4D43A 5FEMA 1Q12A 4X93A 5SZHB 3RFUA 5JQGF 2XMSA 3PI6A 5EEGA 1IBMB 3VDRA 3WDMA 5AOCA 3K9LA 4ZN6A 2G76A 2PKRA 4EYKA 2R1UA 1EKFA 1J21A 2WJWA 4D25A 4PLGA 3R0XA 3R4VA 3GUZA 4QBKA 1DADA 1Z4MA 5D7NA 2ZW9A 3MAAC 2CV1A 2CL0X 4LHYA 3KO8A 4M49A 3NBFA 1ZYUA 2NYUA 3D2AA 1L7OA 2EU8A 4HMOA 2VWGA 1RYMA 3L0SA 5FJJA 1YGYA 4P4SB 4DJFC 1LEHA 1NY6A 1E96A 3VO2A 1YDFA 5G0UA 2BN4A 1SXIA 3V4FA 3I4CA 4YRSA 4BO7A 4MARA 1SXJE 1ZKMA 1YZTA 3BIOA 1P60A 3AFHA 3H2ZA 2P4UA 1VG1A 4PLYA 1NC3A 3BA1A 5JXJA 1ZETA 1JR6A 1F6WA 1T9DA 2BBSA 4RORA 3HACA 4B6RA 1U81A 3C5EA 3PEYA 2Z2IA 1Z45A 3TFQA 1QH9A 1T91A 1Z6AA 3E8XA 2N9UA 1FXWF 1WV1A 1YL5A 1NAIA 2XWBF 1T0JB 1TCCA 4WPGA 5D87A 1OV4A 4L4XA 3NP9A 3V7NA 3JW8A 1I4WA 1XA3A 5B6JA 1QBKC 2C1XA 4IWYA 2P9CA 2O20A 4CMHA 3HA2A 5ESXA 1N5MA 3ONWA 3FRJA 2X0JA 1RJQA 4EJ2A 1GGFA 3PC2A 4JR1A 1KO1A 3EVBA 2YWFA 2C07A 2RGEA 3UWOA 1BHSA 1U6IA 4YT8A 2IGTA 1NYQA 1SPBS 2GO7A 2WIAA 3O9ZA 3IAEA 2JGLA 2MYPA 4LJRA 1L1RA 3MJFA 3K8OE 3ESZA 1Z5NA 4YR2A 5E9JA 1W6UA 4XB1A 1A48A 3LXUX 2RCYA 2BMDA 3QI2A 4F9EA 3KSBC 3IUYA 3RRFA 4PX9A 4B6SA 2Q4BA 4U2CA 2GJ9A 2IU0A 1SKYE 4EQ6B 3LPNA 4J9KA 4I55F 2CVHA 4XIIA 2Z9CA 2OXFA 3DCNA 3RFVA 3LQ4A 4IUCS 1PYDA 1IMJA 3AJAA 2MIIA 3KV1A 1H69A 5JSHA 1RZVA 3AESB 1KK1A 3FWYA 4E21A 2C2MA 3IG0A 2COGA 5T4HA 3V4VB 3AB7A 3EPPA 3AR7A 5I5XA 4BNFA 4Y2SA 3F6BX 4ZQFA 4QODA 3H5VA 1NYTA 3EGXA 1LWOA 3DHWC 2SCUA 3ENWA 1XHEA 3E82A 4U9UA 1FYFA 3LGAA 5EVJA 5KHOC 3HP1A 3KNZA 4XYGA 3NHYA 3RIMA 3JVUA 1C50A 5K4HA 1WEHA 3G2MA 3A1NA 4FN5A 4OI0A 2WYIA 1SCDA 1J06A 2C99A 5I7WA 4DKJA 1LLFA 1TVCA 2N3ZA 5LC1A 1IOWA 1T4CA 4BASA 4KR7A 2FK8A 3V8PA 1EGVB 4Q4DA 3K05A 1CUCA 5DNEA 2X5NA 4C0WA 4EA8A 1H1LA 2UVPA 4C88A 3W6PA 3TM5A 4YCLA 1UJ2A 2IYLD 3HRIA 2A5FA 1NMXA 4F2PA 2JL1A 4TXJA 3E2IA 3WYBA 4AW9A 2PK3A 1KK3A 3NTRA 2D5AA 2FW8A 2EHDA 2F1JA 3CUTA 1JPVA 5JC8A 1YGPA 1TYEB 1PX0A 1NXTA 4Q7LA 4XX0B 3AEZA 4IH1A 1VIMA 4N5LA 1FRZA 2I29A 3ESCA 3I04A 2ZJAA 3H5WA 5LA6F 2J7PD 5B55A 3W1VA 3GLHB 4TN1A 4G63A 1K9VF 5AIAA 5KTPA 2NU9B 4NKRA 4CLDA 3ZV4A 3BMNA 1Q0LA 5CT8A 3DYVA 3RVOA 2QUHA 3EBPA 3JAMW 1A71A 4ZCRA 1VRCA 3E9YA 2L69A 1ZN7A 5IT5A 1HMPA 1F5SA 2JBAA 4D57A 4M0CA 1YRHA 1XD9A 3W8DA 2NUPA 3G5AA 1OPRA 3S24A 4LC9A 1XUOA 3ZWMA 4G2NA 3OY7A 3GWZA 4L75A 4ICIA 4P4NA 2B4YA 3GLIA 2OYCA 3WRXA 1I30A 1L7QA 2FQYA 3UAWA 3GGGA 1ESNA 2PBLA 4WXEA 2DFPA 2IEDA 4MV6A 1M2WA 1VE6A 4CG0A 2DP4E 2H16A 5I4BA 1BSVA 2OUIA 2YINC 1E60A 5IXJA 4ALMA 3W1WA 1S3SA 1A50B 4AWAA 4HZUA 4L0DA 1DEXA 4P31A 5K0BA 3LH5A 5EG5A 9GPBA 4RAOA 2I1WA 2FR1A 1H0KA 4B7AA 1AV7A 2HPHA 3OFJA 1KJWA 1VXRA 3FR8A 1BYIA 4TVKA 5ISMA 2PMFA 4MVXA 2PGLA 3CR7A 5JH7B 3V1KA 4AY2A 1C9EA 5LQSA 421PA 2GQRA 2JARA 2IPMA 1E2PA 1JBQA 3GV8B 2VUIB 3GJ8A 1E66A 1LBQA 5A0TA 2X2FA 3ZEAA 4E46A 3I2FA 2OAQ1 1UZLA 4WACA 4DEYA 5KYTA 4DMFA 2JK0A 1NVBA 2PJDA 2J9XB 1F14A 1Z6GA 4X7RA 3ZK7A 3L6EA 4CM9D 4WCFB 3IQXA 1FUIA 4BIIA 3KALA 3CLTC 4ZJUA 4ZVSA 2A0XA 3K94A 2PZKA 5F73A 1Z0UA 1VECA 5AVQA 5FOVA 3VBEA 2NTVA 4LOKA 2HEIA 1JQ3A 1O9BA 3OKAA 4LDQA 3F71A 2W8LA 3CSSA 5JFOA 1BD4A 1M72A 2V54A 5DYYA 5FBHA 1X7YA 1T9GS 4O1MA 4BNMA 1JDSA 1A1SA 4H7DA 2XTJA 4HAVA 1U3VA 1FYDA 3D2CA 4CIWA 5EZ6B 4WA8A 1WCMA 1AHPA 2EWVA 3CYFA 1CSEE 1G64A 1U0HC 3MJTA 3GTKA 4LTMA 4OKNA 1Z25A 1VB5A 2PY6A 1U5BA 3EOZA 3AKEA 4ZMSA 1U1DA 3CH4B 4M76B 4LJLA 3TZHA 4Y0NA 4FBUA 3AY0A 3MJEA 1JS1X 3HFRA 3EBLA 5JWHA 4DQDA 2WD7B 3TLGB 5AYVA 4TUYF 3RGXA 3M0EA 1J2TA 3HGQA 5BV0A 4XTCS 3L3BA 1MG5A 4EEXA 5DBIA 4DLKA 1GCIA 3I52A 4LDZA 1AK2A 5AVXA 2VYNA 5BRNA 1R37A 2DBRA 2EGHA 3D2LA 4NAUA 4WZAA 5MF6A 2WJYA 4U0JA 3TX2A 5AJYA 1ZQ9A 4RX1A 2AJCA 1FOEB 1TK2A 1GP2A 4QOJA 3A0UA 3BA9A 2B98A 2G7MC 2LBPA 2J31A 5DEOA 2H1HA 1SBNE 1ZZEA 1ZOOA 2A30A 1W59A 5A0FA 5JAIA 3M6UA 3GZTB 3TLJA 5BV7A 3AR6A 3LVRE 4IOJA 2C3PA 2CXNA 3FPLA 2IF0A 3VDQA 3ASYA 2FF7A 5MN5A 2ZUDA 4DIDA 4RSMA 2QMOA 2ZJ4A 1FMJA 4B84A 1ISIA 3F3KA 1QG2A 1QE5A 2P91A 4ATNA 1X80B 2O7RA 4GHWA 3PNMA 2R6HA 2X6TA 5KNBD 3OX4A 2IKSA 4OHKA 1TWCA 2V6GA 1K6MA 4G6ZA 3UZBA 5EE9A 3EMBA 3TEMA 4HGNA 1SZDA 2BQUA 1KS9A 5CPFA 3IHKA 3LZ6A 5KFAA 1ZM7A 3DOOA 1JG2A 4ZVNA 2R8GA 3W7AA 3M6XA 5I7VA 2RHRA 3A1TA 4UKDA 3KKEA 1WCIB 4NYEA 4B74A 1JX4A 4EK9A 4TMVA 1BH6A 2O3UA 2ZKLA 5JJIA 4D9JA 2WZBA 3ZGYA 5EVCA 2QS9A 2UKDA 2EC5A 4FOLA 5JXHA 3RC9A 3N0RA 3UWKA 4D9BA 1MRZA 4JI1H 3CX3A 3U26A 4L57A 4RZIA 4J9RA 1ISGA 4OA8A 2A57A 1M66A 4GAEA 2W8KA 2VJCA 1J8FA 5H4HA 3ZHUA 2PH5A 3WDKA 4PPGA 2IYZA 2E4ZA 2R4TA 4P34A 3WBFA 2CE7A 3A11A 5G1PA 1R15A 3NV7A 2JJ1A 4EAAA 4O33A 2XVAA 5DGDA 2X42A 4DAEA 4KOAA 3NEJA 4HF7A 4M21A 3X1YA 3MELA 4KK4A 4OYYA 2RGAA 3B1WA 2FCRA 4RZ3A 4JR0A 3LL4A 4X00A 3L8FA 4MQ5A 1KYTA 3WIOA 2I4IA 4ZOCA 2G6BA 4QG3A 5EEHA 1P4JA 2Y2VA 1JN0A 3X1ZA 3KYDB 1D4OA 2I6SA 3WLOA 1TYAE 1P1KA 1WDTA 5SV2A 4N6NA 4URVR 2COUA 2CEAA 3SQWA 3VH2A 1YR8A 2EFHB 1G2QA 4WXPA 3KR0A 3FDIA 2BR0A 3FYSA 2WILA 4NCKA 2ZWOA 3WE7A 3GIMA 2Y0SE 2OHXA 2QROA 2PKQP 5A02A 2LP4Y 3ORSA 1CXZA 2PM8A 1NTRA 2VBFA 2I66A 4YRFA 1CRWG 5L51A 4EY3A 2AG5A 2WM2A 5BWWA 4R9RA 3UT5B 3SE0A 3N2NA 1ZD1A 5B7PA 1L3IA 4M7OA 4AZVA 2V9CA 3F6CA 2WIGA 2PS3A 5BPHA 3LVBA 5KPDA 2WIKA 1GYFA 4W1RA 1T8WA 4WUTA 1M34B 1AC5A 3FYCA 3GAAA 2PRKA 1YDEA 2WTXA 3DC7A 4IGAA 2JJYA 4ZD6A 2EVWX 3U54A 4XUEA 1M0EA 1XJCA 1DUSA 4F96A 1YU6A 4YONB 1XPUA 3ZCVA 5IJ0B 3AIOA 1KF0A 1T0PA 3GRVA 2P4HX 3I64A 3WNBA 3QRWA 1E9DA 4C4ZA 1RQ7A 2VKTA 4YJDA 5E2IA 3KELA 4LNAA 4GG1A 5K8TA 1R16A 4WCFC 1QF9A 3GMTA 2OGWA 2GCOA 2GFHA 5HILA 2J0VA 2O4UX 2JFNA 4UHBA 3WKDA 2P8SA 2BGJA 2GZHA 1H2AS 1FJGH 4YAEA 5KCZA 8OHMA 3WZ2A 4G5XA 2HCJB 3PNLA 3UAYA 2BEVA 4K9OA 3C0FB 2I5PO 4UD6A 4MA5A 5IZCA 3S2FA 4NMXB 1EVEA 4YJ3B 3C98A 4U0KA 1Q57A 1QRAA 4ZEWA 3KZCA 2NGRA 2RGNC 2X1LA 3Q2IA 4F3RA 1IDOA 2VUTA 2X0FA 2UVWA 3V46A 4CODB 2K2QB 4NBLA 3JD3A 2JCSA 1ESCA 3HRKA 1H65A 3M82A 3TSOA 3R6DA 1J2JA 3IXQA 1S2LA 2FU5C 3ZGNA 4HEHA 3GT0A 1V11B 5CFZA 1E1QA 1T8YA 4HUJA 5CVCA 2XSZD 4LJ9A 4L3OA 4TMYA 4OBXA 2ZI6A 3OTOH 4YUVA 2GX6A 2M98A 3DLTA 4AO6A 3M6VA 1UINA 4MRSA 5BOSA 5EOYA 1RRVA 5AVSA 3UGJA 3NC1C 3OQNA 4V39A 3N9IA 2HRZA 1V4VA 5CURA 1Z39A 2LW7A 3HXQA 1HWYA 5IC4A 5IN5A 2BEUA 3KHUA 1UIRA 2ZJ1A 2QRQA 3HJBA 2IH5A 3PV0A 2ZLBA 4HXGA 4KQKA 1TOAA 2PUAA 1P2SA 2HMVA 1X87A 3ED5A 4C78A 3E22A 3VNAA 3ZE6A 5T6MA 5I8WA 1CY7A 2R9VA 4LE1A 3DS8A 2XCPA 2YY6A 4YAIA 4E09A 4HNRA 1A97A 1Z88A 2ON6A 2IHJA 1IIRA 1O96B 4AP5A 5EMKA 3U3XA 2YICA 4CMEA 1S2GA 2O9JA 3T1OA 2OCYC 1R2QA 4HMQA 1ZK2A 4R2IA 3JQAD 3QHPA 2B8EA 4CMEC 1KY5A 4BUZA 4TRRA 1VMKA 5EKSA 2OCDA 2ZATA 4PX5A 1ESDA 3BXOA 3KFLA 2DVMA 3A2LA 4YP6A 1JZTA 1JSLA 5G4LA 4BIMA 4DV0B 2IIVA 1L4HA 3MF4A 3WMRA 5TQ2B 2PX4A 5IYZF 4AY3A 3CTPA 4AXBA 5JROA 3EUFA 3UMFA 1N5OX 3NH6A 5TT0A 2H2IA 4PSDA 4FYYA 4Y67A 3JALA 1JJAA 2O7QA 5EXDA 3Q9UA 2OWEA 4DLYA 1CD5A 1N6OA 2WB1E 4UU8A 2HADA 5AI6A 2O1SA 2Q3MA 5K8LA 4BLVA 3T5LA 3SF8B 1SRQA 2A5JA 3A6GA 1JYSA 3DBRB 3EXHB 5ABPA 3RK4A 4J94A 5CB8A 4ZI7B 2R4QA 3SYLA 2WUGA 4HYKA 1ZCFA 1C8LA 3ZNOA 3V80A 1C3VA 1P1RA 5LWHA 2EF1A 3W9UA 1PJZA 4CT5A 1NJSA 1FDSA 1JILA 1RHJA 1KPGA 3INRA 5F12A 1PJ4A 1B0ZA 1U1GA 4LXIA 3N2KA 4MI6A 1NTOA 3SOZA 4U2DA 4MUMA 3GARA 4IO1A 2O2HA 1BU5A 3DGEC 4NONA 3H7AA 1TT5A 3MJ4A 3HEAA 1GDTA 4X7BA 3EXFA 4N3GA 5AUPB 4QC2A 2CNWD 2HJVA 1PJSA 3S68A 2C9CA 4HCJA 4YPVA 3GLFA 3C16C 1TJ5A 4RAQA 1TK3A 2ICAA 4ED3A 1XV5A 4RJLA 1WMAA 2YNMD 4MUAA 5J59A 4K9PA 2RGYA 5J4LA 2ZM5A 4PBCA 1JDVA 4I7HA 4ZIRA 4IIGA 2JLSA 4HNUA 2P8JA 3KWMA 3RYFB 2IUUA 2V0GA 4OHFA 2Q41A 3FDZA 4R2KA 2JFOA 5FLMG 2Y4NA 1GGEA 4PXSA 5JJCA 4OHXA 3TIIA 5KNCD 1RLUA 3H20A 1GAXA 4M1YA 4Q18A 3TNFA 2X9QA 2MCFA 1NRIA 3V7FA 1KYQA 5DGIA 3FSJX 4LZOA 3VX3A 3LQQA 4N8SA 1XXHB 5KCMA 1E9BA 3WIBA 1W19A 3R6GA 3D7LA 3PRYA 2OV6A 4KX5A 3T9CA 3T9FA 3FH0A 2CNKA 4JL6A 1NVMB 2FEPA 2C57A 3TI7A 3SHFA 2FVXA 3OE1A 2QVZX 1B76A 4BNKA 4KHPH 5JAMA 3UG7A 1WRVA 2NAPA 1E61A 1YI8A 1JDNA 1C4XA 1QFYA 3IBSA 4WDQA 4O6VA 2E6KA 1XE3A 3NXSA 3B6KA 3HK2A 3OHMA 1QHHB 1AU9A 2EHJA 1EFTA 4R8MA 3DZ8A 1XA4A 3R0JA 4DEVA 4U5QA 4A92A 2IY9A 4DC1A 5DK6A 5FHQA 2PHZA 4A82A 2GN0A 1D1TA 1A7JA 1NMSA 4UCFA 8ATCA 4GKJB 2F9FA 2WICA 1R0KA 1QGOA 4RXUA 2NU8A 3RS3A 2IS1A 3BK1A 3IR6A 3ZU2A 5FWXB 3LF1A 4C0AC 1KI7A 2R7AA 1JHRA 3DTNA 2X19A 2J3IA 1NW6A 4TQAA 4DCTA 4R0VA 3AUKA 4G3IA 1MX1A 1PI3A 1W5BA 3HY3A 5AJVB 1FP4A 5J3JA 4W5OA 1DDGA 5DB4A 1D4ZA 4V1CA 721PA 4MUHA 4C0SA 3E9NA 3T1YH 4B2PA 3RRXA 3ABRB 2EGGA 2YOGA 5GZ3A 3I32A 4NPCA 4J1TC 2GLXA 1VI6A 1F17A 5C4IA 5ILQA 2QV0A 2WIBA 3FG9A 4EYEA 4NEGA 3OLQA 2CCKA 1ND6A 4ZZIA 4D46A 4Q9DA 1T35A 2Q6IA 2Y3IA 2J0SA 1OAOA 1D03A 3W5CA 3H9EO 3TDKA 2C3UA 1DAKA 4MS1A 4AY4A 1KRXA 3QVTA 4ESOA 2C78A 1EUZA 4RA9A 2AYZA 3D8HA 5B58C 3E27A 5D5HA 1W88A 4P9NA 4ED6A 3A9VA 3KSAC 2P9YA 2JD1A 3Q7PA 2NW6A 1SK8A 3AETB 4W9RA 2SBTA 3CVYA 1YHYA 3H4VA 3P96A 4UUOA 1BMFD 1NN1A 1Q16A 1SVNA 4F3TA 4C2AA 3QUCA 4QXAA 2RIPA 4YJHA 4IG9A 5I48A 1E7WA 2WTFA 4Q7KA 1I0IA 4R7TA 1N92A 4OBBA 4CUKA 1HDOA 3PXEA 4JYAH 4LRWA 3REQB 5HVNA 5JOQA 4MQFB 1QJCA 4I1SA 3GOQA 4O4IB 4CYMA 1LF5A 1VBMA 3CBQA 3ENZA 1OI7A 5EIWA 4BZQA 1UXHA 5JEEA 3KEOA 2J6CA 3KOUA 1NG1A 1XEFA 4JI5B 3WP0A 4MV4A 1ZH6A 4YH1A 4RNOA 1RHUA 1XFAA 2A94A 4GBJA 1J8DA 2LCIA 1E8DA 2YJGA 2C82A 2CYAA 3RRBA 3I6IA 1ZA1A 5BURA 3NDBB 4N65A 1RBZA 1O87A 4V3BA 4KQHA 2AYYA 4CM8A 4OQNA 3NJ4A 2GBPA 4OBEA 4KCGA 4BMSA 4HDOB 1O75A 1U5CA 1H93A 1OX4B 2APJA 4C7OB 3QP9A 3FPKA 2ZXUA 3LCJA 1H8EA 3BACA 4X24A 4O2BA 1Z7WA 2DHQA 1AXRA 4R8UA 4POOA 4ZEMA 2AFHE 1UK8A 5GIPE 1MB0A 2HIHA 4O1HA 2DCMA 5KG4A 5FX2A 5KJ6A 2HNAA 4D96A 2HA6A 2NO0A 2WWWA 3QEJA 3OSNA 1NVGA 4G5YA 4MDFA 3BSYA 1RLJA 3A25A 3HEMA 2JEJA 1RPZA 1XD2B 1Z15A 3VAZA 1EGMB 5AHWA 2CL6X 3V5NA 4BBAA 3GV7B 2AG6A 3P4UA 3DJYA 1CQZA 2QE7A 3AM3A 2GB4A 4MRAA 1OWNA 2FN4A 1EP1B 2IEBA 3HLKA 4D4HA 1C9JA 4TMKA 1E69A 4PF1A 1RQGA 1DT3A 2P6NA 2I8LA 4L9SA 1EESA 3NM4A 2NU7B 3TRIA 3IX7A 5KPJA 2FJ0A 1WCYA 1YRAA 5BSUA 3WICA 1UBGA 1N8KA 2A2ZA 3EASA 3UFXB 4OB8A 3TK1A 2AT1A 3WSVA 5TV2A 1KXJA 2B1RA 3IURA 2C03A 2GBFA 4XWTA 1N2ZA 3IRVA 1M2VB 1NN0A 2IOFA 3LQYA 1C7EA 2AHRA 4K3VA 3AUUA 4IOMA 1XTKA 2VDRB 4OQXA 4AAYA 3VOAA 3IQZA 4PLVA 3FTEA 1AN7A 3MWDA 1OH7A 4FOSA 4A27A 2C1ZA 2IYYA 4B3GA 1QNFA 2FRVA 5LP6B 1OH6A 4JBNA 3FMAA 3C7KA 5GMOA 2B2NA 2GXQA 4DMRA 4YAKB 3UJHA 3AR5A 5D1PA 2CUKA 4QUIA 3LRTA 3GLKA 2YTZA 4RD1A 3TW8B 3Q15C 4ZAYA 4ECYA 4DLPA 3OCXA 2BI7A 5KYUA 3JQ6A 3RC3A 4DUGA 1F4VA 3DWIA 3G68A 1EX1A 1W5SA 2GYVA 3T7KA 1CHDA 5F5XA 1IYEA 2YUTA 1L2TA 2VTBB 5CVUA 2Z8XA 3NJRA 1OBFO 4C1BA 2E37A 4CBVA 2P75A 3NEAA 5ESRA 4WOBA 5AUQA 4Q37A 2V7EA 4JI8B 3P0EA 4XDZA 3VTFA 2JJ2A 1DELA 1AQJA 4BO6A 4BTVA 1GA1A 2G8LA 3EFOB 2ZFUA 4PYLA 1RXEA 4DNXA 4ITUA 1ZHSA 5F1KA 2WMOB 1PT7A 4L4SA 1NSTA 3JZFA 3OX1A 4LYHA 2ONJA 4CMAA 4BEBA 1UFKA 5DCUA 3T9BA 1P81A 4KPYA 4R8KA 1RKXA 4X1KA 1NW3A 2E1PA 5TS3A 5HOEA 3R09A 5JPDA 1CKNB 3RLFA 1W0CA 1ZSNA 3JSAA 1YMVA 3H2SA 2XNSA 2F4NA 5FYDA 3TL2A 3KOWA 4UM9B 4L1KA 4DV4H 3RB8A 2FOLA 3EZ9A 7AT1A 1R74A 5LZ5A 3ZVNA 1Q77A 3KT0A 1D0VA 5L9AA 2QEQA 3FVQA 1PD0A 3VSCA 3I3SR 2NVWA 5JV5A 5GJVC 1U8FO 2VSFA 1QHYA 1T6NA 2ZUTA 2EQBA 3IHLA 5IEBA 1F8XA 2AMLA 3X3HA 3QOWA 1IQPA 3SQOA 1NJFA 2FWBA 521PA 2IPNA 4MP8A 5K0TA 2YQ5A 3VUFA 1MORA 3N8KA 1V6SA 3NQ41 2IBSA 2IEYA 3NGLA 4RDXA 4A10A 2V4QA 1ZK1A 4UU0A 4RHXA 4X20A 4JQCA 4PM4A 4G1BA 4PC2A 3U3JA 4B3CA