5H80A

Biotin carboxylase domain of single-chain bacterial carboxylase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
463
structure length
430
Chain Sequence
TPRVLIANRGEVAVRIERAVSALGWQSVAVYAPDDAGSLHVRRADEAVALSGRGAAAYLDGAALLRVAQEHAATHVHPGYGFLSENADFARACAQAGLVFVGPDPDTLDLFGDKSRARGLAQRLGVPVIPGTDGATTLEEAAAFMQAQGGAPVMLRVVRQAGDLAAAFEQAYAERLIERARHIEVQVAGDGQSVTHLWERDCTVQRRHQKLLEFAPAPHLPQAVRTALIGAALQLAQEVKYRCLGTFEFLVTPGGDFYFIEANPRLQVEHTVTEEWCGTDLVTAQLRLAAGETLTAVGLATQPADAAPPPGQAVQARVNMEVGGGQVQTFTPPGGPGVRVDTFVTTGLTPSPQYDALLAKVVVHRRDAALPGLLRQAATALSEFQIAGVSTNLAFLQALLHHPDVQHYELSTHWLDERLPELVTQAAEYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylase
publication title Hybrid Structure of a Dynamic Single-Chain Carboxylase from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 139
structure length 430
sequence length 463
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain
A PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain
A PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5h80A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5h80A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h80A01
2YL2A 4EABA 4FFNA 4XX0B 3TW6A 1EUCB 3N6RA 5DMXA 2DWCA 2R84A 4IIJF 3ETHA 1KJQA 4MV9A 4FE2A 2GLTA 3R9RA 5CB4F 1GSOA 5CAEB 4DIMA 5D8DA 1C30A 4FFLA 3KALA 3KREA 2W6MA 3SE7A 4J6EA 1GLVA 4IWYA 4YJ2F 4O7NA 4DLKA 1KJIA 4I50F 4XYMB 4ZI7F 2PVPA 4L1KA 5C8YF 3KAKA 4XYLB 2YZNA 4YJ3F 4FFRA 1VKZA 4NYEA 1OBDA 2R7KA 2NU6B 3QFFA 1KJJA 1M6VA 4TUYF 4MV6A 5J2UF 1C3OA 4C5BA 3R5XA 3TIGA 3LP8A 2YRWA 2NU7B 5LA6F 3MWDA 5JQGF 4GGMX 2VHEA 5CA0F 3R5FA 2YS7A 1M0WA 3R5HA 2IP4A 3VPDA 1JKJB 2I8CA 4YB8B 1DV1A 1BXRA 4M9CA 3AX6A 4IWXA 2HJWA 5KX5F 2QK4A 2R7NA 1T36A 2GQSA 2YZMA 4HR7A 3DF7A 4M98A 2NUAB 3RV3A 1IOWA 5GONF 4I4TF 1M0TA 4ZQIA 5HV6A 5C1OA 1E4EA 3JZIA 3BG5A 3Q2OA 2NU8B 2CNUA 2PN1A 2CZGA 3MWEA 3U9SA 3BSWA 1I7LA 2YWVA 4MAMA 5FNVF 3HO8A 2P0AA 4MV3A 2GQRA 4O7YA 4FGRA 4EA9A 2CNQA 3VMMA 2W6ZA 3OUUA 4M9UA 2DZDA 4FFPA 2W6QA 2FP4B 2R82A 2V59A 5LXTF 4O4HF 2HGSA 5KKNB 1VBHA 2R7LA 1Z2NX 2VQDA 3NUAA 1JLLB 3OUZA 4QSHA 4YAKB 1EHIA 4O83A 2V5AA 3JRXA 2QF7A 4WD3A 1AUVA 1W93A 3U9TA 5HBRB 4O7WA 2GPSA 4O4JF 3TQTA 2FB9A 3VPCA 1VBGA 4O7LA 5J2TF 4EGJA 1EUDB 4YAJB 1A48A 4C5CA 3VOTA 2Z04A 4RZQA 1UC9A 3U55A 3MJFA 4I55F 3WNZA 4MA5A 1CS0A 1KJ9A 3VA7A 2YZLA 3I12A 1A9XA 2VPQA 2SCUB 4MV8A 4HNVA 4IHJF 4O7RA 2YYAA 4EG0A 3JRWA 5JH7F 1PX2A 2FPPB 3HBLA 2V58A 4IZOA 3E5NA 2R86A 4MV1A 1IOVA 3R23A 1AUXA 3UFXB 2J9GA 1KUTA 1BNCA 1CE8A 4FFOA 3RFCA 4ZHQF 4EA8A 3BSYA 2FPIB 4O7ZA 2PBZA 4TV8F 5JVDF 5BPFA 4WBNF 1WR2A 4MV4A 2I80A 2YRXA 2W70A 5LOVF 4O7SA 5JQWA 1E4EB 3K5IA 4E4TA 1GGOA 4YBZB 1Z2OX 4Y8VB 1GSHA 3V4ZA 5BPHA 2W71A 2I87A 2W6NA 4EA7A 2NU9B 4O4IF 2CQYA 4O2BF 3ORQA 1DV2A 1OBGA 2R85A 2ZDGA 1I7NA 4O7TA 4O81A 2Z02A 2R87A 1JDBB 3LWBA 5CA1F 5I47A 2X0SA 4EAAA 3ORRA 2R7MA 3N8DA 5C1PA 1JDEA 5IYZF 1KJ8A 2W6OA 2OLSA 4C5AA 2DLNA 4FU0A 3VPBA 4O84A 2YW2A 4ZOLF 1Z2PX 2YS6A 2ZDHA 2WYOA 2VR1A 4EGQA 2GPWA 4O2AF 3TINA 3TIIA 3V4SA 4O7VA 1PK8A 5BMVF 1EZ1A 3WO1A 4O4LF 1EYZA 3RUPA 5LP6F 4O82A 1UC8A 3BSSA 3JZFA 2NPOA 2DIKA 3WO0A 4O86A 4HNTA 3AW8A 2ZDQA 3ETJA 4HQ6A 1ULZA 1W96A 1B6RA 3G8CA 1CQJB 3K5HA 2W6PA 3HB9A 1DIKA 1KC7A 3GLKA 4MV7A 3RV4A 3BFPA 1KBLA 4ME6A 4MA0A 2YZGA 1SCUB 2R6FA 4XZ3B 1CQIB 5LYJF 3U54A 4FFMA 1B6SA 2FPGB 2XD4A 5EZYF 2C00A 1GSAA 2CNVA 3K3PA 5JVLA 3G8DA 4HNUA 1KEEA 3Q1KA 2XCLA 5K2MA 5H80A 4M99A 3GIDA 3KAJA 4TV9F
chains in the Genus database with same CATH superfamily
2HDWA 3UO8B 2GSDA 2X2PA 1MOPA 1H2WA 3TDNA 4FGUA 3BICA 1KTVA 4FWBA 4URYR 1TOAA 3L4EA 1SOUA 1C30A 3FNEA 3QU4A 1XCPA 3NM4A 1OX4B 4X1IA 1XHEA 3COSA 5JPCA 3NYWA 1G8YA 1ZIPA 2D8AA 2W93A 1EUYA 4QQ8A 4N5DA 4RMJA 3P9RA 3GLGA 4XFJA 4CMEA 5JSZA 1YR3A 3CSUA 1PVDA 4WXRA 2MIIA 3UPUA 3CNEA 2YRWA 1A0GA 1BJKA 1CSEE 5DNVA 2ASEA 4RCVA 1FFDA 1QF7A 3VPDA 1ONSA 2BQ3A 4DDHA 2WIGA 4L28A 1Z4JA 4ZD6A 4YJHB 4G41A 1YR7A 1EXDA 2R2GA 3F2IA 3PP8A 4GVXA 3NHRA 3E8XA 3G5TA 5KU7A 2E5LH 1C8KA 1IOWA 4ZFNA 4MUHA 4D0GA 1U7ZA 2OBLA 3ZCVA 3AHGA 1E4EA 3V7UA 2ZRBA 2H1RA 2RDMA 2V6MA 2O8DB 3R24A 2WU1A 2I78A 2PD6A 2ZE7A 3SSNA 3IIMA 1ZJZA 5LA6B 2DAAA 1OV4A 2IH2A 4EG8A 1VLZA 3NNDA 2BN4A 3GGGA 2X6RA 3UCXA 2GBLC 2G36A 3TZBA 2V5AA 4A0RA 1T1RA 1N2HA 2BFAA 2R11A 3WZMA 3KWJA 1US8B 1VG0B 2IDJA 1QYVA 3RB0A 2H2GA 3TPCA 1BQEA 3MTQA 3ZCTA 2R44A 1ZAUA 4ND1A 4DNOA 4F4XA 1RYSA 1VFNA 4I8IA 3ADOA 5F9LA 5KVCA 3EN0A 4Z9FA 4KN6A 5EJFA 3F74A 4KX5A 3WWPA 5LQCA 3BMCB 2W0SA 3HJFA 3L7IA 1FBNA 1XKLA 1GXSB 1FJ2A 2FFBA 3KQVA 3B3JA 3DJYA 2DU8A 2H3HA 2BGTA 1ZCBA 4NDNE 1XRJA 4XFKA 1HM5A 3KHUA 4KK4A 1ISPA 2VDOB 3FROA 3TL2A 3SDZA 2W7PA 1OVMA 2HMSA 3D6VA 3LT1A 4GXTA 1SEIA 3ENZA 4X20A 4HF7A 3ZWOA 1T0IA 4MV1A 3PF8A 2PH3A 3OQHA 4ABTA 2YBDA 4J07A 2XSZD 1NVAA 3D0RA 3WQBA 4DUYH 2IBTA 3JZDA 4ZQGA 4CMAA 3OZFA 3RQIA 4LSAA 1OV6A 2Y1KA 4H1WA 1RPAA 3DVAB 3T7JA 4S35A 3ZLTA 1CC1S 3NC1C 4PAQA 5D3ZA 5AHOA 1XMXA 1NM5C 5DHQA 3H16A 4F06A 1KARA 1AGPA 1CPYA 1KPIA 1YQ9A 3P9IA 3LNCA 1YRAA 2FW9A 4B80A 2AI3A 2L82A 2BUAA 1E79D 1K8RA 3BIWA 1Z29A 4DSAA 2DHEA 2YWEA 3ZHQA 3S55A 4Y9UA 2I8AA 1EDOA 4MWCA 2QPAA 3K70D 1F17A 1SRRA 5F3DA 4AZ3A 1JFTA 3L7JA 4JEUA 4UCRA 4JWTA 4KQXA 5C80A 3S70A 3MTAA 2C35B 3J81A 4YRFA 1SC6A 2G83A 2H2IA 2JHAA 3SZLA 2BEUA 4ZCPA 5JMTA 1RXUA 3UOGA 3QVKA 2QN8A 3GRYA 3BL5A 2VPXA 3OVMA 2N9UA 3JVVA 3ACDA 2P7HA 1U8FO 2J87A 3DXXA 4CT4B 4A3JG 3NXKA 3G1TA 1TYBE 5KREA 2IH4A 2JBHA 1U7TA 3MT7A 1DC4A 4URUR 1ULBA 1ZI6A 2CVPA 5P8WA 2EBHX 2VNAA 5EE5B 4YHHH 4BO2A 3NEPX 3EIQA 5EZYF 4FQ8A 4KFSA 3W2HA 1YE3A 4JI5B 3CVWA 7REQA 2MSWA 2OTCA 4Q7LA 1SA0B 4AY3A 4M6WB 2BISA 3JR7A 2Q6IA 1FK8A 4LQLA 2ORWA 3C3XA 3LHSA 1ZSYA 5JALA 1MO2A 4L50A 2W98A 4ARVA 5L3RA 3EB9A 1V2GA 1LJUA 2YJZA 4P4SB 4YAIA 3OEHA 3H9GA 1A8UA 4RTPA 2XGQA 4R1QA 4C78A 3BXXA 5ITZB 1KDPA 3UXHA 5SY9A 4EYGA 1MNAA 3ZEAA 3JYNA 2AFIB 4OIFA 1HNWB 1EVYA 1FP1D 2YZNA 2DY0A 3R8CA 5EP4A 4BKRA 1J5EH 3ZQJA 1XG5A 3DBRA 4Q44A 4KXXA 4FOLA 4CR6A 5AOCA 4NNJA 3ZS9A 3THWB 1OAOA 1XXHB 4OXXA 4WIAA 4BO3A 4ZOCA 3MG9A 3MB8A 1JQLB 3VU3A 1T3GA 3DL2A 3DTTA 3KE8A 2DGDA 4GECA 4LE2A 3R40A 2Y1GA 2QMZA 5LL6P 1VIDA 4I5FA 2WWHA 1R15A 5KT4A 5JAQA 2YJTD 3O8DA 2NZWA 2F4VB 4PEVA 3AHDA 1L5MA 5C7YA 3GLHA 3ZCSA 3EXEA 3QEMB 2QMHA 1ZVMA 4LF9B 3PNMA 2YYSA 3K9HA 2C4WA 1VXOA 1TU0A 2QP9X 1SYXB 2W6ZA 1PT9A 2P2YA 5K0GA 3MFQA 1ZK0A 1SC3A 3LZDA 2DFTA 3PICA 1I51A 1E3LA 1W46A 3RABA 1B16A 1GAWA 1C8VB 3CX8A 4E3WA 1RDFA 4UOZA 1C4WA 3CLSD 3VKFA 2WJIA 4PC2A 5AUOB 5DJ5A 5KFNA 3LX4A 2Q3LA 4TYNA 1QGUB 3NHPA 4EKIA 2J30A 3NG1A 3T1TA 1NBHA 5F2KA 1Q6ZA 2FN9A 4X71A 5E8JA 2QS9A 4G0XA 3TEKA 3R76A 2AZMA 2YZLA 5AW0A 3TCXB 2SCUB 2EL9A 2ZYDA 3TOVA 3PEEA 2WPDD 1JE1A 1UAYA 1H2RS 1KZ7B 4LJAA 3PYLA 2IYLD 4H4CA 1E3EA 1E1CB 1I0LA 1KDTA 2RKWA 4UM7A 5IF9A 3AINA 4KQ1A 2DBQA 3U7EB 2CXPA 1PV2A 2AF4C 4KXQA 2NXJA 2C0CA 1D2GA 1A3CA 2W70A 1SBTA 2Q6KA 1AQLA 1BH2A 3MA0A 1P7ZA 1N2IA 3FLEA 1M1XB 1DO2A 1XTRA 5BSKA 4DV0B 3HCPA 2VN8A 3OZVA 5DISC 3H3XA 1I33A 3DDSA 2XYPA 1ZA1A 1BMQA 1OYWA 1YOVB 5GOTA 2WHXA 4XD7D 3D3WB 3ZD7A 1WXDA 3ZIDA 3LT0A 2PJDA 5A02A 3P19A 3PEFA 2HVQA 5FLEX 2R87A 2OD7A 1RRPA 4RNMA 2E55A 3RVRA 2D8MA 3DEZA 4ALJA 4JVNA 3HNOA 2II6A 3VSCA 2YR0A 4AG3A 3UAWA 5EKUA 3KWFA 3RJ5A 1Q92A 1EYZA 3R44A 4M7OA 3RYFA 5AM5A 4RHFA 3JZFA 4BB0A 2NPOA 1I7PA 1BFDA 3QM1A 3TDMA 3AV0B 2X1VA 2DFNA 4PQEA 5AIBA 1WTCA 4QFCA 4BNIA 2EX1A 1RJPA 4E30A 3JS5A 5FO0A 2PSFA 1DIHA 2PRIA 3DV0B 221PA 5CITA 2XA2A 2A4KA 5C1DA 3CJRA 4R6WA 4WT7A 3BIJA 2D0PB 4I4CA 4GMFA 4BFWA 3LZCA 3GP3A 1RSZA 1QS0B 4REQA 3KAJA 3NJRA 4WLNA 4BNFA 2R4UA 3KEFA 1Z73A 4TV9F 2Y1OA 2JFNA 1C7QA 3TW8A 2DR2A 5GADl 1Y4SA 3BA9A 4IIJF 3IT3A 1Q0PA 1C9MA 1B76A 3THOA 1U3TA 2X42A 4KPUB 3ONNA 3MWKA 3FKSD 2O3RA 4JJFA 1JEQB 1Y1SA 4GOLD 5GVRA 5LQMA 4L1KA 3LVQE 1CX9B 5CW1A 5BNTA 2V3WA 3DNFA 2CHFA 3QELB 4DPKA 3TAUA 2BBTA 2X76A 1Y63A 1JBKA 2AN9A 3SSMA 1T1GA 1QDUA 5J9FA 2OORA 1HUQA 1WBBA 5H8WA 1DUIA 5CB4B 4Z9XA 3AJ9A 3PIRA 2V7PA 3TRHA 1NW7A 4XJTA 2HSGA 4US2R 3INYA 3RVOA 3UY4A 5EHNA 2F3TA 1CZLA 3GEEA 1CUBA 3RBVA 2O2DA 4HAOA 3LQQA 4I7EA 1GTZA 4E6PA 2V7UA 4MGEA 2W2KA 5IM4F 4PFKA 3JPYA 1TT5A 5BN5A 3RRNA 3JAWA 1QVZA 2AE2A 3OZCA 2FCAA 1O96A 2VCEA 2XMCA 1G3RA 4RIGA 5NLLA 1DZ3A 5JNVA 1Y34E 3O73A 5AUQA 2AK2A 2VBGA 5LIRA 3FPJA 2YZ2A 4BAUA 2CCKA 3C1OA 1Y1VG 3THRA 2YX1A 3OTGA 1IN5A 2X0FA 3KHGA 1Z4MA 4MR7B 2X8LA 3E4DA 1Z2NX 3A31A 3F8SA 2IYPA 5TSDA 3CQZA 4RM2A 2HK8A 3KKPA 3KXKA 1R0LA 2PSEA 3N0VA 3NVMB 3RS7A 1IOLA 4Q7KA 4JK3A 1WUHS 1DRWA 1U8TA 3T3NA 1JDPA 5FL7A 3MTBA 2NPIA 3COYA 1VLJA 4BL5A 4LZLA 1HF3A 3HCEA 5FHQA 3GLFE 3WGMA 1KS2A 5ERGB 4CMHA 3K71B 4JVMA 4DV7B 1TQHA 3PUKA 2NXNA 2WVAA 1FXWA 1RXCA 1F5NA 2H85A 2HMVA 1H23A 2O3SA 2VHVA 2IBMA 4YREA 4BNHA 2Z2XA 4D96A 2DKNA 2D5IA 3UV7A 3W6UA 1IZ8A 2JLUA 1JFFA 3VUFA 4NENA 1BXRB 2B21A 3R23A 3DAFA 1Z2AA 2EKZA 1SXJC 3H5WA 4YYEA 5EIHA 4BTVA 1MABB 2H1OA 4Q9KA 3RUHA 2G6TA 3HKEA 3IAUA 1NR5A 4UXIA 5I5XA 3MJ4A 2VI5A 3HVIA 5JTUA 1MN6A 5CCXA 4HBGA 1FW8A 1RXEA 1V8FA 4LY6A 2OCPA 4FKBA 5CAEA 2R5NA 3IQXA 3C85A 4X63A 1U0LA 1CY1A 2C9DA 2XMZA 2WJ6A 2X9VA 3ORQA 3SEFA 3V1KA 2WWWA 3SWWA 3C6KA 1FFHA 3EXHC 1G66A 3PA6A 4BGUA 1LRJA 5IKMA 4NXNH 4II3A 1CUJA 2EJBA 2TRSB 4X6XA 1G7RA 4N0QA 3JZ6A 2QZZA 2DQZA 3DL0A 4YCCA 4NPHA 4Q9DA 4X6LA 1IYEA 1QHYA 3LLMA 5DGAA 1KYZA 3LH5A 4B3DA 1RPNA 4DJ5X 3U3ZA 3GVCA 4DJJA 4ZEWA 5TT0A 3VJLA 2C5FA 5D7NA 1ZS9A 3GPDG 1Y9EA 5JWOA 3OM9A 3BGWA 2EWMA 3I5UA 3VR3D 1MLDA 1WUIS 3DEKA 2Z8XA 4LYGA 3SQNA 3O8QA 3Q3IA 3GRCA 1KQFA 1QANA 2IYOA 1S2LA 1K83A 3CLVA 3II6X 5DZSA 5C46F 3U40A 3ET5A 4HH4A 2DFLA 3IG0A 4C6HA 2WD9A 1IHYA 3CMMA 4DLYA 2D74A 3SSAA 1YIOA 2FQYA 3LQ4A 3TQRA 4MYUA 1IXSB 3OSNA 4PNPA 3KZNA 1N4DA 4RADA 1JA9A 5BRAA 4BLOA 1L8QA 4ZDWA 2JCBA 1DRVA 3PNPA 4C07A 1CB7A 3QE2A 4FD2A 2ISQA 1UQUA 2OENG 4TWJA 2QAGA 5HZGA 2E49A 4ZI5A 4PZ9A 4RESA 5EI5A 4LXXA 4MI3A 4PANA 4BBRG 5CLLA 1II9A 4IUYA 3V4LA 4WECA 1CF4A 5FEMA 4YASA 4O4HA 4C3UA 4HPWA 2K7FA 3T7RA 1OPXA 3NGLA 4C2BA 2IS4A 3DA8A 4UHJA 4AKTA 2VPWA 2NVYA 2BZGA 2EKLA 3RFFA 1EK6A 4YV7A 4FNOA 1R4MA 1U4OA 3N3AC 4Y2TA 4YUWA 2H9IA 1O75A 4MKGA 4B8YA 2VSFA 3IOEA 3BXHA 3RV3A 3EUFA 3V4FA 2WV7A 2RGCA 1M0TA 1MV8A 1AZWA 1UBGA 3MJEA 2H7XA 3ZWKA 4PLWA 3WGZA 4J2OA 1VE9A 4O5OA 3GG2A 2ZBFA 2Z8YM 2HWYA 4LRTB 2B1RA 1Z25A 2XQGA 3ZBUA 1SBZA 3MMZA 5FA8A 4QBKA 1VIYA 1L8AA 4ZDIA 3DDNA 1E9RA 5EMKA 2QZ9A 2B94A 5AHWA 3ELYA 2GF2A 4MUAA 4AJHA 4JV0A 1NXOA 1EFTA 2PUFA 3P4XA 4BV3A 1Y8RA 1YA4A 4LF5B 2PKEA 1PD1A 1GUFA 1M3SA 2HGZA 4PAWA 1ESCA 2VRCA 4G8DA 1G18A 1IQUA 2R93A 1KKMA 3NU1A 2QOEA 2EP5A 2RDJA 2P4SA 4EFDA 1S3IA 5T8KA 2V6IA 2WHRA 3L9WA 1N2JA 4DQ0A 3S4YA 3O3NB 3B85A 4EOGA 3R8FA 1WMEA 2OM2A 2PGLA 1JHUA 1U7UA 2QU8A 1CUIA 2YNMD 3JATB 3LLUA 2AOTA 4AO8A 5D1NA 1NLFA 4OF4A 4XLTA 3VU1A 4R8UA 1NN3A 5JSHA 4L3VA 1JPJA 1NDHA 1W75A 4RABA 5JYBA 1XEWY 1JJ7A 3KTOA 4ZI3A 1AU9A 2YIJA 2R6GA 5JXWA 2OAP1 2VPSA 2ZRMA 4A2AA 1NZFA 4FT2A 2IT1A 2BQUA 2XNCA 2F3QA 2IIVA 4DOMA 3RT1A 2HIAA 3ZTYA 4F9TA 4A3FG 5FLYA 3AEKB 3WISA 1WRBA 3D6NB 2NZVG 4RXTA 3SBDA 1OXTA 3CZCA 3I9V1 4MRPA 3BXOA 1HEUA 5AVSA 1Q16A 4QYIA 5CVEA 1EXNA 1J8VA 1Y1LA 3QXGA 3TW4A 2AJLI 2ZYHA 4QQNA 3O47A 1PK7A 4NI5A 2J0SA 4DG8A 2QZJA 4W5QA 3H4IA 4PC1A 4ENUA 3EXIA 2OZVA 4R1TA 1NUTA 4R7GA 4OGKA 1P3JA 4AQYB 2ZEJA 2AFHA 3O2SB 1SQGA 4JT9A 3V8MA 2M9MA 3IURA 2I91A 3F98A 1WXIA 3R7DA 1KO7A 3T7TA 1IY2A 4D9HA 2X4IA 5FBQB 2BCJQ 1YC2A 2AC4A 3AFGA 2NN3C 3D4IA 3THYA 1HT2E 3EFOA 3GJ5A 2GMWA 1KHTA 3VSBA 3ASVA 1W19A 3ST7A 2EGGA 1C2TA 4JS0A 3K0EA 3RREA 1ILWA 1X8KA 1Z0SA 4DR4B 2PZLA 4EFMA 2GPAA 1QB8A 4OQMA 2X2OA 4RSGA 4XIGS 1ZHHA 3GIDA 4R2LA 1S5PA 3HB7A 3B1JA 4UOQA 2HJRA 2P79A 2ONYA 1QKIA 2BI4A 4PM4A 4DIDA 3A05A 1IC6A 5HKOA 4EY6A 2IPMA 1U2DC 4G0NA 4W9NA 4UZSA 3J81W 3GBSA 4DUPA 4G9BA 4YMGA 1AHIA 2RONA 5EOVA 4W1PA 3KSBC 2JFGA 3EG9B 5TF4A 2VUTA 2ZRHA 2CLDX 2CN1A 2GXAA 4Y9SA 4DR6H 1P4JA 1HFKA 5KTPA 1DEXA 1HSZA 5IZCC 1DAEA 2B82A 1WH2A 4CCAA 4O3RA 1SRQA 1OH5A 1G55A 4ENQA 4BWFB 3IMCA 2B6HA 4O3OA 3FWHA 1G63A 4RCYA 4QBHA 5LNK1 4YP5A 1NAHA 2IZOA 1HQDA 1PL0A 3WRYC 2AKYA 2VZEA 1XDNA 4YRNA 4MV0A 3EEBA 4IMIB 3W8EA 1G1MA 2AWNA 1DDGA 1U0GA 2XMDA 5BY2A 1NW6A 2A9VA 3V6KA 1V9CA 4QA9A 4DRXA 2PMKA 2J0EA 3L0BA 4I4NA 2BHTA 4RHYA 4CZ2A 1LW6E 1O94A 3FUUA 5KI6A 3ILHA 1XNQB 1MOSA 4GR4A 4CM3A 4FX2A 3L4BA 4EF4A 4GDFA 1SXJE 2R6JA 1E3WB 2D2FA 2QJOA 1LNQA 4GFDA 1N6IA 4H9GA 4JJGA 1JLRA 1G4HA 4GPD1 3QMVA 4V0MA 4TQUS 1SU6A 5IDWA 4M0MA 3TTTA 4HAXA 4YV2A 4U9IS 5DHAA 4KKXB 3LLCA 5L1KA 4P22A 4DXHA 4V38A 5CDUA 2Y66A 1FUKA 4IDFA 4OQQA 3LGXA 4RY0A 3QX9A 4FYMA 1R6DA 2FW6A 1ORTA 5H16A 4D74A 2VDWB 3ZK7A 3NWEA 4B9AA 1X1BA 5KOYA 4BYMA 1EJBA 5H4GA 2OSBA 3CWQA 4CMIA 3IVGA 1T2FA 1GFIA 4CMGA 1HL7A 4RULA 3UJ9A 4BGVA 4FHFA 3FKIG 2C1EA 2IIBA 4HJXA 4LJYA 5DM1A 4BWGA 3SG0A 2BR5A 2UXBH 5JPIA 4GI2A 5D51S 1X7WB 2BRUA 2JI4A 1CUEA 4K5QA 1VMDA 4NSNA 2Q3DA 3HUEA 4DM4A 1FKAH 1IZ0A 4C4SA 3IQGX 2ZBVA 2ZJ2A 2BFEB 5IWAB 3IYLW 2WW8A 3VR6H 1T6YA 2J6BA 3D2LA 4H60A 1S68A 3TRFA 3Q41A 3IJPA 2J9XB 3OD5A 1LUAA 2FSUA 3D64A 5ITSA 3T5GA 3AVXA 3PGXA 2GAFA 5DX1A 3ZE8A 2R8EA 1MIHA 5E1DA 4OUKX 4HI0E 4YAFA 1U7HA 3S7ZA 1A50B 3LP6A 4CIBA 2AYZA 1MA0A 2W8LA 3DMTA 4LV5B 4D9IA 3T95A 4BNGA 4AMVA 1STOA 2ZJ5A 3W78A 3PU6A 5BNIA 4OOFA 3AG5A 2QW8A 5BVHA 1DIAA 2XJ9A 3W4IA 5IUKC 2FSSA 2DPLA 2NTEA 5MN4A 4RH0A 3Q2KA 2R00A 3EEQA 1VP9A 1TK2A 2P65A 4D8VA 1NJSA 3T35A 1W49A 4CKCA 3PITA 4RKFA 4QOGA 2V5VA 3I4CA 1PNRA 5B7GA 4JBIA 3ANNA 5FR1A 2ZUCA 4X0EA 4KR6A 2IEGA 2DYKA 3NIGB 1OT5A 3D5EA 2VUHB 2F3PA 5KTKA 2L2QA 1T34A 4LSGA 3E2PA 4L8GA 2UUCB 3KFXA 1YQQA 3WJ7A 4J1NA 1BOFA 2RIRA 1NXWA 4PV7A 4R98A 3M1AA 2WPNA 3HG7A 4YT5A 4NJEB 2BEJA 5DBIA 4UTXA 3SIPA 1SKQA 4FKZA 2ACWA 2Z6QA 2IX3A 4DMFA 3PA8A 1C50A 1MRSA 5F9MA 4MRVA 1P1CA 2PR7A 3DD5A 3O4FA 3DMYA 2OV8A 4I50F 4JKOA 2V03A 5KWJA 4C6RA 3JYPA 3CNQS 1RQXA 2QENA 3OOHA 1UBOS 3SK0A 1S01A 2UXDH 4WXPA 3EZ7A 3DNPA 4KZPA 1MQ9A 1SVIA 2LRHA 1TYDE 4EMUA 4DLUA 4M1OA 5AIAA 2W9XA 1ULUA 1QM5A 3LPCA 3U4MA 3LFHA 4OFXA 3OPYA 2RGRA 1K9VF 2O0KA 4IG4A 2RGXA 3EEIA 3TQIA 4UHCA 3MCTA 2YZMA 1JHRA 3WXBA 4BU0A 1A4RA 5AKLA 2IXFA 2X8WA 3IUSA 1P6XA 1A7AA 3SP1A 1KZGB 3U44A 1OKKA 1QTRA 2EZ9A 2HTEA 1L4HA 3RSCA 4K3VA 4GO1A 2ZFUA 2ORVA 1G5FA 3W4JA 4K9MA 3VNAA 3RTXA 4I4LA 2XE4A 1BIFA 4Z4CA 2XUPA 4AJ2A 2WIDA 4REMA 1CDOA 4DY4A 3ND7A 4D4GA 4LSXA 4U0KA 4QSHA 1GWNA 1VECA 5E0OA 1M0EA 3GFRA 4NP6A 1Y8ZA 2ATXA 3T5DA 2NZYA 3HPQA 5K8VA 5FCDA 1POXA 3MGBA 2R8RA 4FUTA 5JNWA 3O21A 1VKJA 2D1RA 3SIXA 3OCJA 4TLDA 5KB3A 3OLZA 1C9NA 5HRAA 3NVKI 1YI1A 2Z43A 3PHLA 3QVGB 8LDHA 1GGKA 1WCMA 3BGIA 5FD8A 1SVSA 2VK4A 1H85A 1XOIA 1EEHA 5JWRA 1DO0A 3JRNA 2I6GA 2E5WA 4V0QA 2CV0A 3SBXA 3UWKA 4W6ZA 1JQKA 1UKAA 2VP2A 3G2KA 2GXUA 1R0XA 1KEZA 1AUQA 1CJSA 4GKKH 1GL9B 1UBKS 3MFIA 1NNEA 3NIWA 2A9JA 2OOKA 1X15A 3PUWA 4RWZA 3JQGA 2G72A 4QOHA 2BEWB 1IN8A 1I4DD 4FT4A 4NDAA 1OYVA 3ZW8A 1TMGE 5FUXA 1W9MA 3KLOA 4NMLA 1V9SA 3OFND 4JQYA 1RAHA 1Y7PA 3QGMA 5C8DA 3JWEA 4B0PA 2PAAA 1ZFNA 3TDKA 5I9BA 3RKSA 5I47A 1QG4A 3AB8A 4TTPA 1CV2A 3L5OA 1E8DA 4CLOB 2D3WA 2Q3HA 3JSNA 3U7QA 4JCCA 4EJMA 2J07A 3S27A 5DT2A 4AKGA 4EI2A 1U3UA 1ACMA 3S7TA 3NBMA 4Y1RA 2EFGA 1XPOA 5LMUH 1JPVA 2JHFA 1F2TB 1F48A 5F64A 2AUNA 1K6MA 1C7ZA 2JFFA 2LPMA 1N3IA 2N1MA 3H11B 1T1IA 4Q4CA 3PGVA 5KVSA 1FDRA 2VDNB 4DL5A 1N8KA 5IP7G 2GK6A 2R1VA 4HLUC 5C34B 1DCFA 1GUAA 4DIUA 4BMXA 2R6FA 4D9EA 1U8XX 3S5UA 2YH2A 5I8PA 4KLZA 3E7DA 1K8YB 1LPOA 3IUPA 1DJLA 4I3HA 3C45A 3KELA 2QTWB 1E2QA 3Q1KA 1ZHQA 1D07A 2GEKA 2XYRA 1G5IA 5H3CA 3WGTA 2B0JA 4M99A 4N65A 4IUBS 4B3SB 5FL7D 2M05A 2EJUA 2IHUA 3WLLA 2BFBB 3LOQA 2JGMA 1C7EA 5DISB 3Q12A 2ZVQX 4V0NA 7GPBA 2AQHA 4LOIA 3RTGA 3TR5A 4UQPA 3BWYA 2XZDA 1SIUA 5EZYB 3DG9A 3P2YA 3FB4A 3UGTA 4NV0A 3TE6A 4DZRA 4LBYA 1UFOA 2O8FB 1O0CA 2XNHA 3U1TA 2AQ4A 2Y0DA 1ZIDA 4IFTA 2ST1A 2BW0A 3MRTA 1DG3A 1I2CA 2XQJA 2GZ3A 5D5HA 2Q5FA 5CMLA 1KH3A 3KU1A 4PO8A 3CUYA 3IAXA 4BNKA 3FNGA 2I4TA 1P1HA 3SBEA 3NQ41 1DXQA 2PMZA 2PG3A 4I55A 3PSAA 3T3DA 5ED0A 2W2TA 5AVWA 5EIXA 2AS0A 3ZWVA 1UXOA 1Y0BA 3FZYA 1MH1A 4GE0A 4RBNA 4GOND 2GYVA 5EZQA 3ZDDA 4Z1OA 1PDWA 1ZMOA 1YDEA 4X44A 1H93A 3VZSA 2IEBA 4BNDA 4D3FA 2I66A 4G09A 3RGGA 5EPEA 3TLXA 1ETUA 3DMFA 4TV8A 4HDMB 1CRWG 3CM0A 3PPYA 2QVXX 3NHMA 1LV7A 2E4UA 3ZS8A 4GBGA 5I7EA 2FCRA 4L4ZA 4JQCA 1WZNA 2IS1A 1V3VA 4K9LA 5IRCD 1SXGA 1JHYA 4HZGA 4V0SA 1UXHA 2I29A 4N3NA 3EODA 5M29A 1UMKA 1I3QA 3CG0A 4QFBA 2HYDA 1NVGA 3A37A 5LUAA 1QIMA 4HAIA 5EJ8A 2QVLA 4GP6A 2O2ZA 4RA6B 1L5QA 2GERA 4R0NA 4AS1A 4K0KH 1GR1A 1Q19A 1D5WA 5A05A 3OU2A 4N12A 1Y4UA 4RA9B 2HFKA 3PNLA 5LP6A 3HLKA 2O07A 4FSHA 4RAQA 3SFZA 3GV5B 3G2QA 4AZWA 3VFDA 4GAEA 1RZRD 4Z7OB 1EJ6A 3JYLA 3GCWA 3K16A 3LPLA 3M70A 2PX0A 1NF2A 1JJAA 1SQFA 3R3SA 3AIOA 1HR0H 2JKYA 4ED8A 5TQ2B 4EMBA 4DV6H 3FZEA 5B55A 1Z4PX 4X7MA 4TN1A 3IOCA 1AQIA 1ZAKA 2IYNA 4FBGA 1VMEA 4BTLA 5DNYB 1LNSA 3RSQA 4FYHA 1ZEMA 4BVKA 1S2NA 4X8OA 5HKAA 1VC2A 3QBEA 3N2ZB 3B70A 1XDBA 1B8NA 1PKXA 1L7QA 3UAGA 3KUXA 4PZ8A 5KFWA 2XVZA 1W581 2WINI 2ZM5A 4ZIRB 3I1IA 1XKTA 2BZ0A 1XQ6A 5KT5A 3KLNA 2YV1A 5KKAA 2BM9A 5FV4A 4D56A 1D2RA 2BMDA 1SBYA 3R0QA 4JAVC 2OH2A 3C5EA 1ATIA 1NDQA 3IRVA 3QE9Y 4IGFA 1CQPA 2HA4A 5JSYA 3DYVA 1SXJB 2OILA 2J46A 4B8WA 1MT0A 2XQIA 1CEQA 4K46A 2Q0SA 1ISJA 4DLZA 2JHGA 2UYCA 3KS9A 1D03A 4X7BA 3NJ8A 1FQOA 4D43A 1CR6A 4JDPA 5AW6A 3ZGOA 4WY8A 3WL6A 4YI5A 2VRCD 5DN6A 4XX0B 4RJJA 4RNNA 3U4QB 3I4LA 3QVWA 2QRKA 2WJHA 4MQEA 3VKHA 4W9RA 4EJ2A 2W9CB 1N2XA 2P2ZA 4S1OA 4GI3A 1OTYA 2H0QA 1I2KA 1EVIA 3EXHB 1J0XO 4CUKA 1NN5A 4CQMA 2AMVA 4IJKA 3RR5A 5TY0A 9LDBA 4ND2A 2BBWA 1M6VA 5U4QA 3ZHXA 1IM5A 4N41A 4TV9B 5JW6A 1O95C 3U4DA 3MJCA 1UBUS 4IIJB 2E4AA 4WKPA 3THXB 1UBNA 1ODCA 3FUXA 2I7CA 2IP4A 4EEKA 3NTXA 2QL7A 1Y1VA 1MAUA 4UNQA 2VKQA 4GKBA 4P5EA 4LDZA 2BEKA 3ISTA 2J33A 1BXKA 1KRXA 3LF2A 1GQYA 3RLIA 3C70A 4WI1A 4P7BA 1M34B 3A9WA 1P0MA 2V8OA 1ODTC 5BQ3A 4Q37A 2WSYB 1V8DA 3T38A 2ZTVA 1I80A 2C4NA 1N5OX 1L4NA 1PEYA 1QIGA 2XGGA 3ZYZA 1S4MA 2WSBA 4ETWA 2IGBA 1N34B 1AKTA 4JB8A 5FFNA 4OFZA 3EOZA 5G02A 3OMLA 5D1HA 5ICGA 2O3JA 4TMZA 3S2GA 5AVXA 5JC1A 1Z0AA 3U2QA 4ZAFA 3TPZA 5ALQA 3OX3A 2R66A 1QCYA 3ORSA 5D1OA 1BX0A 1P2DA 4WD3A 421PA 2BV3A 1FX1A 4PPNA 1XMOH 3ENVA 2OKGA 2FN3A 1W5TA 3UC9A 3IDQA 2B4RO 1M7BA 2VPIA 5TF0A 3CVVA 4MUMA 4NMMA 4G4JA 4LNAA 4C4RA 2H2HA 4ADSG 3QWHA 3RTCA 4BMYA 2AOWA 4MJLA 4YRPA 2BM1A 2AZDA 1SCUA 1U9CA 3ANYB 1YR8A 3NDIA 1O77A 1VJCA 2V58A 3UWOA 2ZXFA 2YQ4A 3ED5A 3Q8RB 2Y8EA 1BE0A 5DTMA 4HB4A 3DHWC 1S1MA 2VK1A 4V1CB 4BN5A 2N75A 4NS4A 1SZDA 3VYWA 2PAFA 4LJ4A 1WIWA 4ED9A 1A72A 2BBOA 4RQBA 2I80A 2D13A 4HMOA 5K3FA 4CM6A 3PNBA 3TBFA 4DA4A 4BB9A 5KBYA 4E88A 2X4LA 2B69A 5LBTA 3CU5A 4V1CI 2MYPA 1UMBB 1UMCB 3KM0A 5KFMA 3A6PC 3F5MA 4ZARA 2Q21A 5LBUA 4XYMA 1M8PA 3KTAA 1EG7A 1UDCA 1DAOA 2XT6A 1KOLA 4L4XA 3ELUA 1WXWA 3F5QA 5F1OA 5DWDA 3QWUA 5KFOA 1RFLA 3KOZA 3D8TA 3EC7A 3SC3A 1N7HA 2HPAA 3GBPA 4R1OA 3ONVA 2HNBA 1XIVA 3H5OA 4OXIA 3KKQA 4U3JA 4PFQA 4YLGA 1L8LA 4Y2UA 4IDEA 1O94D 2YOFA 3RBDA 1FFBA 1VIVA 2GTHA 1UWLA 3NIFB 2J4CA 3KXPA 5I7WA 3SCZA 5IYZA 4BATA 3UUGA 2OP0A 1C3VA 2BMAA 5EIAA 2O03A 5FUWA 5BMVA 1JVBA 3NPMA 2AJTA 3D43A 5LQKA 3AXSA 3IT0A 2XNKA 5DTRA 2Q49A 1E6CA 4NDZA 4HQNA 1YJQA 4GLWA 4R51A 1KPGA 5BT8A 3SFVA 3GRKA 3O3CA 1VI2A 3UJ3X 5CGZA 1BDIA 2H29A 2QVBA 3Q7PA 3BA8A 3OAAA 3CCFA 3VHXB 1ZITA 4Q4AB 2R84A 3Q8QB 3K35A 1OI2A 4REOA 5CCEA 3R9XB 4AJNA 2BGLA 3AWDA 5ALIA 1ID1A 4UUMA 3PVSA 3QTBA 2WUVA 1YSCA 1K4YA 5HFJA 5DW3A 4W7SA 1PV4A 4ESEA 4MWGA 1L8OA 1Q3TA 4JB3A 2ANBA 1CRPA 1S0UA 2YY6A 3BCRA 4NARA 4V0LA 4HWRA 5LXTA 3H6HA 5HZKA 3M4JA 3ZXSA 3S81A 2W6CX 2X5OA 3HACA 5AUPB 1BEZA 1V26A 4D4JA 3AC0A 4DNFA 3EF1A 1KI6B 3FOWA 1U7PA 4U6SA 4CLRA 1NR1A 5IF3A 2PXHA 4JVSB 4X8MA 1Z13A 1UM9B 2WRZA 4A8TA 1RI5A 3NJ4A 4GNKA 1TCVA 4PZ6A 4G36A 5CHEA 3C6BA 2O2EA 1O8CA 1RLIA 4AD8A 3TPFA 2ZQYA 2WQZA 1XZBA 4CDGA 2OGSA 1H69A 1W47A 2VUUA 1KJZA 1ZGJA 3U49A 1JEYA 3DB1A 2I33A 1E77A 3KYDB 2RHLA 4CMJA 5ADVA 3IELA 5B4VA 2IITA 2A0WA 3Q7RA 2H54A 2JI8A 2QUKA 2G9UA 3CR3C 3HJNA 4BO9A 1ZR4A 1XZMA 3LUBA 4MQUA 1U5BB 1TX4B 5HOQA 3O95A 3GVHA 2WJJA 1Q14A 3OP1A 2EDCA 1YD7A 4N0EA 3ZHBA 2ZKIA 3M9NB 4MKXA 2HV8A 2UAGA 3O7WA 3MFYA 5LDHA 1R5BA 5JAOA 2OCBA 4PO3X 3WGNA 3R2JA 1M2JA 3Q5EA 4AULA 4RZQA 3RSLA 1Q1EA 3G9XA 3L05A 4RL6A 1FTYA 3TX6A 3TLBA 1HSOA 2IK8A 4KGVA 1ZQ1A 3PC8C 3LTEA 4MI1A 1Y1KE 2V7WA 2DPMA 3FH0A 2WAAA 4H4DA 3P2EA 3KWMA 4G0WA 3LUPA 4PX2A 5KOIA 2RDIA 2I9PA 2HT6A 4QGHA 3L7BA 4WEOA 1R5JA 1EFPA 3B6MA 1YCFA 2LIVA 1DC7A 3KXLA 3PR3A 1KUTA 1FZQA 3AR2A 2AJ8A 5CVCA 4BAZA 3JD2A 3GOQA 3PXDA 2XCOA 1CQWA 3L7YA 4UBMA 2RKBA 4IV8A 3M82A 3I1JA 1YCHA 3FBGA 2HC9A 2XKKA 3PXAA 4J0IA 1YUMA 4ZYZA 3AFNA 2MHCA 1LKZA 1GG9A 3JD3A 1YS7A 4GUAA 3WWIA 3L7LA 2QYHA 2ZIEA 5CIQA 1VJTA 1II8B 1PWXA 2A1TR 3VVCA 1KK1A 2J3JA 4X9XA 2CYAA 1M2KA 4X95A 4JGBA 3V4PB 1F0YA 1GITA 4Q1VA 1Z4OA 1O89A 3AESB 1GPBA 1T4DA 4DSUA 4FMCF 3I0NA 4O3SA 1OKKD 1GTL1 1P77A 3OT1A 1NFFA 4E5DA 1OGIA 3K2BA 5C9ZA 2GHIA 4M0JA 3W5JA 3ZDXB 1VKOA 1TW3A 3AY3A 3A4MA 3QUSA 2I7XA 5EWJB 3GJ8A 1WVIA 3TTWA 4AKIA 3BABA 1CQIB 1YJ5A 4HNAB 1J6UA 4KJXA 3DC2A 1NXTA 2WNHA 3K15A 1WPXA 3FVTA 1W8DA 4L08A 4UCOA 3SY8A 5LVAA 1JQBA 4TWIA 1FE8A 1YTUA 5CNKA 2C8LA 3UJBA 3PUYA 1J8YF 4KPUA 3ZBPA 5BR7A 2PXAA 1UBTS 2GAIA 1G2IA 2DTDA 2GCPA 2G04A 4B81A 1DKUA 1KVTA 4M1TA 4GNRA 4OLBA 2OLEA 1KDZA 2Y76A 2BUCA 4CI0B 1Y3CE 2PIDA 4BMZA 3RGWS 3OX2A 4ETIA 2WZDA 3CRZA 5BNWA 2R79A 5JAHA 2D1QA 3P4UA 3M5PA 4YMTA 1RAGA 3JU3A 3R3VA 4YAOA 2PKWA 1AQYA 2DC1A 3KAPA 3IVCA 3GUUA 1OLSB 5FTJA 2X2EA 4XWYA 1EWRA 1WW2A 1FYEA 2DH6A 4Q66C 4CKWA 4L5JA 1N75A 3TNDA 3KPWA 1JI0A 4V3CA 3KQYA 1T26A 3UAVA 2TYSB 1ZCZA 1CF2O 1R6VA 3C41J 5MHTA 4FGSA 1BYUA 1NBWB 3FAKA 4OGGA 5TPWB 1UK9A 1CJMA 4PBRA 2JA7G 4Y2GA 5IXYA 4FLMA 3I83A 3JVIA 3TLCA 1V96A 3QHQA 1YA8A 1Y1QA 2MCFA 1JEDA 2OBMA 3E2IA 4D57A 2IYEA 1MG0A 2I7DA 4RNDB 3A3KA 2AX4A 2D5LA 5B30A 1L5HB 1MVNA 3EXAA 4HB3A 3B6EA 4Z7QB 5NULA 1NC1A 5EJIA 4B74A 5GY7A 2CVHA 3O1IC 1LFDB 5CVTA 1JDVA 3HKDA 2ZJ8A 2Z09A 3IR6A 2Z0MA 3GDHA 3AY6A 4F5ZA 4IMRA 3K9FC 2FMUA 2GT1A 4HVLA 3M4XA 2CUKA 2JBWA 1SQSA 5J1TB 5ICCA 2CXNA 4KXNA 5KSYA 5CHYA 4AMYA 1JR3E 1WXEA 1IPHA 4WNAB 1Y8QA 4L22A 1AQUA 5K9ZA 4YCAA 4OV6B 1IYZA 3UFXB 4RB3C 3GLSA 5FTMA 5EFZA 1Z88A 4PNZA 3STWA 3D7NA 3BE8A 1DC5A 4NCNA 2VJOA 4ES6A 1SBCA 2PRZA 2HXYA 1ENYA 4E2YA 1RJRA 4KDCA 4WWHA 1P73A 1HO3A 1D1PA 3GTPA 1B41A 2CQYA 4HV4A 2CDRA 3I1YA 4QFDA 1EAYA 4W5JA 4FJ1A 1W9HA 3FI9A 3ZWYA 2B78A 3L0OA 2JW5A 1NW8A 4DDTA 2HWKA 2HQ1A 4OHUA 1FYVA 4EGSA 3DHNA 3CZRA 2JJMA 5EWMA 1G4UR 3OSPA 3Q3CA 1UWVA 1YHNA 5IKOA 5JXHA 2HU2A 5K1ZA 1EZZA 5B1EA 3PHGA 3QBVA 2E5LB 2B25A 1YULA 1OMOA 5IS2A 1JR4A 3HJBA 4J03A 3I92A 2JAWA 5ESWA 2YWDA 1GEEA 4ENSA 4GC6A 2P62A 4C3ZA 5KG1A 4IZHA 1L7OA 4OHPA 3RYIB 5FI0B 4FQ7A 2Z56A 2X8JA 2OCIA 3T5TA 3PDUA 1AGRA 2OR3A 2XRYA 1IRIA 1YXMA 1XLTA 2P6UA 4G1FA 4BB6A 3K1TA 1EEXB 3OIYA 4CR7A 5HGJA 2ZQZA 1H9CA 2FU5C 2LTAA 2HO5A 5C5EA 3OE7A 2I2AA 4KCGA 3RAXA 1WO8A 3BK2A 2EX0A 3H2IA 3RVKA 2IBSA 1XE3A 2DWCA 4Y30A 2OHGA 4MIEA 3ZJUA 1W52X 3RB4A 4RK4A 2VT3A 3TTSA 3BMOB 4BFUA 4A3SA 1Y6RA 1G8HA 2JEOA 1Q6YA 2GTPA 2IQIA 2XGJA 1XZEA 3MJSA 1YKSA 4EHBA 4UU0A 1ISFA 5CDHA 1QHSA 3MPUA 3T1YH 2UZ0A 4JXZA 2X5KO 2YICA 3LI2A 2JIQA 3DLIA 1Y1TA 3HCBA 4JYZA 1T5HX 1KXZA 5GZ3A 4XYBA 2Y6VA 2VHEA 5C7IO 3QV2A 2PUHA 3A7EA 3FPSA 4GR5A 2M1ZA 1L7DA 3LULA 4C1BA 3U4GA 2ZIXB 2NO5A 3B13B 1OX5A 4QUJA 1NLMA 4I50B 3ROTA 4UJ5A 3GFPA 5AJWA 3VR4A 3ESZA 2OSVA 3FDFA 1G3IA 3R1IA 4N5MA 4QATA 2EHDA 1OCEA 1QJCA 5H82A 3HCWA 3OMXA 4C06A 1OAKA 3PUZA 3IDSA 4H7FA 1REQB 2CNUA 4O4LB 3VH3A 4F04A 4G5FA 4QUIA 3FHJA 1E1MA 3BMNA 3OZDA 2YHIB 2RE8A 3WIOA 2G8NA 1E3DA 3CLTD 4MO2A 4HT3B 1G3MA 1RC0A 1WY5A 4C43A 3P5SA 4G3IA 5HE8A 2GI4A 1AOXA 3WWZA 5BQXA 4LJ6A 4LXHA 3G9UA 1QHEA 3RYHB 3MTJA 4FE3A 1W29A 3MR2A 3N2EA 3AJRA 1GZ3A 2W8BA 3IP8A 1G21A 1K0FA 4DNQA 3ZDAA 5BN3B 1A9QA 1KI2A 4NABA 4J0JA 3OPXA 1LZKA 1SQ6A 4RMGA 1N0WA 4KREA 3ANXA 5JAZA 3KYCB 1KIAA 3E15A 4P84A 3FSEA 4QGAA 2B2NA 3PXEA 1NYLA 2N1BA 3QVJA 1HETA 2HF2A 1H1LB 5B7NA 3AWIA 4XIYA 4HUQB 1PZNA 4YCLA 3ILYA 2J5QA 1GKLA 2QMEA 1IWOA 4YJGB 3TBKA 1PQ4A 4J43A 1H9AA 2CMHA 3LY7A 3LY5A 5H02A 1X7GA 3NX4A 3UQYS 4TMKA 1CS4C 1NC3A 3MS2A 4KTVE 4QBIA 4H16A 4PLGA 4NZYA 1OZHA 2GHQA 3TW0A 3W5CA 2WP8J 1TZBA 4DMHA 1P44A 3J7AC 4E2XA 3HHPA 4ZCSA 3VR5H 4CIDA 2WTAA 3SZMA 4R71A 4CQMD 1FFCA 1Z38A 1EM6A 4MRAA 4HWKA 5EMJA 5LYJA 3SSOA 1Q3HA 3LGSA 3FCYA 4EI9A 1YVPA 1GCGA 2UVPB 1J5EB 3K2QA 1MJ5A 4DHEA 2OZLB 4FS8A 3WYAA 2B8NA 3HRKA 1SUIA 3TJZA 4QOJA 1JIXA 2PX2A 5DX0A 1GNTA 1E7MA 5L3SB 2OQVA 3MBIA 4LK3A 2EJ3A 2YMMA 1IXZA 1YQUA 2WYUA 3EZNA 2IU4A 4MYDA 2ZSDA 4WXEA 3RARA 4TKZA 2BKUA 4LYHA 3LPDA 3DDOA 4KN9S 3WV4A 3B1YA 5BRJA 4MGKR 4D8XA 1Y3DE 2MINB 2O50A 3I73A 3C3MA 1KFJB 4DC9A 5I8ZA 2IZ6A 3BWCA 1CW2B 1RKXA 4ZCTA 1UBRS 4MQLA 4QLAA 4DRYA 4EW2A 4XCQA 5EE0A 1M1YE 4BEVA 3BIOA 4CCWA 2C2GA 2ZR9A 5GIPE 2OV4A 3WLNA 5FOSA 1EFRA 4C7KA 1G8MA 1U99A 9ATCA 1IN7A 4A82A 3RWOA 2HJHA 4CLEA 4CN9A 5C5IA 4EVSA 1JSXA 3QXCA 3QIVA 4DLLA 5HR5A 4B4DA 4DMMA 3JASB 2W9AA 3LDAA 5JRDS 3WNVA 3SX4A 1CTQA 4MRSA 2AMFA 4UQOA 2ODBA 5FAXA 3H75A 2P4UA 4JBXA 2P3OA 3H3VH 2ZSKA 1NXXA 3HXKA 5TDHA 1T4BA 4N5IX 4YCSA 1PJRA 2OUKA 2HMWA 2A88A 1K1SA 1ZN7A 3S1AB 4YJ3F 2XX3A 4CFYA 3VDNB 4S1VA 3TY9A 2ZI5A 3GMIA 4EYOA 5KC8A 3ITDA 5KCMA 2QRMA 1UBJS 2HIGA 3Q0EA 3RK0A 1UOQA 2HSJA 3UYYA 2VWPA 2A35A 2J59A 2KBFA 1GGMA 3LCCA 3RIZA 3UXEA 4RL4A 1KL7A 1K7FB 4L2IA 4Y1EA 1QHFA 1P80A 4NU8X 2BGUA 1J49A 1OASA 4KODA 1IU9A 3D4LA 1A97A 4W63A 1PX0A 4OAPA 3H4VA 5HNKA 3ELBA 1U1CA 1KE2A 3DWFA 3BAAA 4C3VA 3GO4A 1JTVA 3S0JA 1EGMB 1F38A 1TWAA 5DFAA 5C1OA 2O57A 3BTSA 4IUDS 1B0UA 3JSXA 3BG5A 2XUKA 5ALHA 3OEHD 2DFVA 3P1JA 4QG7A 2P41A 4HYQA 1JDNA 4JODA 3JSLA 1D4ZA 4QEKA 4R1NA 2DZDA 5E7MA 3KLBA 4ZXFA 3Q6IA 3DTYA 4MTLA 3ROQA 5CFNA 3PUJA 1E66A 3QBDA 6YASA 4IAJA 5CRIA 4ECWA 2KLHA 3ODGA 3EAQA 1VI5A 4KVGA 2GBPA 4Y6QA 3U9TA 1WA5A 1WCIA 5F23A 4NCBA 4IFIA 1VPVA 1SVKA 2HN9A 4M86A 5JZVA 1TE2A 1VRVA 3AVVA 3MD9A 2DR0A 1Y1PA 4LRYA 1Z82A 2ZRCA 5FOXA 3FIUA 3C6XA 1K8QA 4FWIB 4J9PA 4Q47A 4O2BA 3V8BA 5E4TA 3LBHA 1BCSA 2VYVA 2IU3A 2EJTA 2HIXA 3E9MA 5ARDA 2VT2A 3WHKA 1EFVB 2OT3B 2OAQ1 4OYRA 4DLPA 3BN3A 4XW2A 4IHJF 2ZBDA 1OFIA 5CM2Z 3MD0A 3VXKA 4MLZA 2WTBA 1GKIA 4WCFC 4ZOLA 4BO1A 3OAAD 2E87A 5E9AA 2ZE5A 1ORVA 1HKUA 5AK5A 1J0CA 4Q9HA 4ENTA 3BL6A 4TXMA 3ZLVA 3DOUA 1U3DA 3GZTB 2EW2A 3I72A 5K0ZA 3GG9A 1OC2A 3P9QA 3V8QA 2ONJA 4L27A 2XGMA 2RHMA 5G4KB 3I5AA 5GOZA 3SNOA 4URXR 1TC1A 1TM3E 2WVJA 3M4NA 3FXAA 4CIWA 1XVTA 4DL7A 5JCPA 1FEZA 1J2TA 3RW9A 4FDVA 3VYRB 3O03A 3K5WA 2J31A 3GD7A 1HA3A 3BE6A 1J4AA 1CUCA 4W8OA 2WE8A 4F56A 2DVMA 1HE4A 1ZXLA 1JSCA 3MT9A 4LFCH 5GTDA 3GLFB 3H0GG 2W9BB 4YJFA 4MKIA 1DEKA 4GSYA 2OCDA 4BQIA 1JR2A 4Y0VA 5KOHB 2GS9A 4PG4A 4AS3A 4XD2A 4O4LF 3M6MD 1CKNA 2FJ0A 1QO9A 4BQOA 1WDLA 4DQLA 4NEHB 3FE2A 2CDCA 1O6GA 1SB9A 3KJEA 2NUAA 4CF7A 2QLFA 1W5BA 4NICA 4P2GA 3BFPA 4XASA 4LOHA 3HJUA 1DBQA 3O31A 3AUAA 4O2AA 2JZCA 4Z3DA 5CD1A 2QYSA 3C6YA 2C00A 1SVLA 4M1ZA 1YKGA 1J24A 3VU9B 2AOXA 3IUQA 2PO7A 1MPTA 1AZTA 4NCAA 4F6RB 3CB2A 5EIBC 3AOGA 4D92A 5CFZA 2G1UA 1M8FA 2D2VA 2BTEA 4JJ6A 3N59A 1U8EA 4ONEA 4C0JA 1QQBA 3DKVA 1S8OA 4HBZA 4AC9A 4EECA 4L0MA 1MQSA 3P8ZA 2QUHA 3QVMA 1DGQA 3HUDA 3BFKA 1IDN1 3NEYA 5HDBB 1QV7A 1SUCA 3EVEA 1KY2A 2GJAA 3NVAA 5J2UF 4MLCA 4IIFA 4FI3F 5CX1A 3M9WA 3QYAA 4JV1A 4PSKA 2XCIA 4U9HS 4A1FA 5JQGF 3FJYA 2IOHA 4M53A 2FK8A 3G0HA 4ZVKA 3DVSX 1RC8A 4HP8A 2OY0A 2Y9PB 4OH7A 1H65A 3H84A 1ZNWA 1Y4AE 2WWXA 2ZSHA 1VZ3A 3ZJTA 4IH9A 1Y48E 1L1EA 3T1HH 4M98A 4LDRA 1RPZA 2ZWPA 1E4FT 5ER6A 2Z83A 3VX3A 1Y42X 4MSUA 1A4UA 5D7BA 3SJAA 2E4VA 1BWPA 2NXCA 4ZT7A 1Y7TA 1VL8A 2BGJA 2E7ZA 3ZR4B 5DP1A 3DZIA 2O0HA 1DO8A 3GNQA 1IE3A 1Q1AA 3JZAA 4MQFA 1QFJA 4BQPA 2IUYA 2SKCA 1JL3A 5J5VA 1IXKA 2GQRA 3X1XA 1TADA 4F38A 4A8JC 4TQ9A 5IUJC 3I2KA 2JKVA 3FPKA 3CF6R 4GHWA 1P8JA 3GWZA 3VDRA 4OQ4A 4B3FX 2JEZA 4YJDA 1NKVA 4LXUA 2QSYA 2HRDA 3AF5A 5L3QB 4IRKA 1N0VC 2ZYAA 1GTVA 4RELA 1DQRA 4MOWA 1SC1A 2E6UX 3T9EA 2C2HA 3LAWA 4EY7A 2OHXA 1SFRA 1P4SA 3AIIA 4DV3H 5CFMA 4RSMA 3DP7A 4R0VA 3DV9A 4NK5A 3WP1B 3U7GA 3P9PA 4W5TA 1I6MA 4W5HA 3BILA 1FVFA 1A7JA 3SD7A 1MT3A 4WHXA 2C2KA 4CMCA 1IEVA 4L16A 2I55A 1HYQA 2ZBPA 1ADYA 4FFOA 1L7XA 1G8SA 5C8VA 1ARZA 4PTLA 4DW8A 2NP7A 1FNCA 4CEJB 4EHDA 4N1AA 4IHQA 4CBVA 4ALNA 1DIGA 1XX6A 3HY6A 3KZVA 4DAAA 3FTPA 3T6KA 2QNRA 2ZREA 1XVAA 4JJAA 1ZK2A 5HQ3B 3KJIA 4JXKA 1IQPA 2W11A 4UBNA 3SXJA 1Y9ZA 1VL0A 4LHVA 4NV1A 1VGVA 1XYVA 3T3EA 1P19A 1WXXA 4Y2XA 5DW0A 4CIVA 3WYNA 2X3YA 1R7RA 2WU0A 1YCDA 4G8CA 1XZAA 3WL4A 3LWBA 4LHSA 4F12A 4XYLA 3O3MB 4JEMA 4U0JA 2PKRA 1ELOA 4W5WA 3CJTA 5B58T 1CDEA 2CLFB 2WYOA 2J6UA 2FEMA 1M8KA 3IBYA 2G63A 4UCWA 3MQ4A 5J23A 2FQ1A 4C7VA 4RANA 1SY7A 4WK6A 2WDPA 2EF0A 2IU6A 3GGCA 2FFQA 2MJLA 4HVCA 2Q0QA 3N2NA 1A9XB 3VHQA 3UKOA 3VAZA 2W6PA 2Z9DA 4UQLA 2WLSA 5CGQB 1PGNA 2VZLA 3HKZA 2OAGA 4BHTA 6Q21A 2RHGB 4GICA 4OHRA 3IVAA 4XVUA 4DUZH 5CH5A 1FSGA 4FI3C 2V7QA 3V2IA 4LDQA 1QPBA 1Z5OA 5E7QA 2R6ZA 4MB0A 5JTTA 1DC3A 4R9VA 3BWXA 3D3KA 3LWNA 4HHEA 3NOXA 4NE2A 5EWLA 4R8KA 4NULA 3AUKA 5JJBA 4KIGA 3ZU6A 3NTRA 5JV5A 1RKQA 1RKVA 3CONA 4FYIA 3OG9A 5I5VA 2P2CA 3DO8A 2JAXA 5B1HA 2F1RA 4BIIA 1V39A 4PS1A 4MQMA 1ZA2A 3RD5A 3IAM1 4PSVA 2X0DA 1U6JA 1KO8A 3SC2B 4R2KA 3TE7A 3U09A 5FADA 1YS1X 4I2NA 1FP4A 1UEXC 1SZJG 1TF7A 4NFLA 3GUHA 3GV0A 3IODA 1QZZA 2QW1A 4EDFA 4YCJA 1SUFA 1RWXA 1RCUA 2GDZA 3MWDA 1T1EA 2JIMA 4J0GA 3UK7A 4PLPA 4PAGA 3I01A 4FYXA 5IDXA 4ERXA 1IBSA 3ZGXA 5JD6A 1W59A 1MDBA 2XXAB 1DS6A 4G0OA 4Q1DA 1C1DA 1UXKA 2EGHA 1P5ZB 1N2CA 4I4TF 1DAPA 2J5XA 1NU6A 1FS4A 4LZAA 1FJGB 2F67A 1PEDA 3EVGA 2VTKA 1TLTA 4I8DA 4ZT2A 1QH8A 3D7LA 4J9SA 1A76A 3CF2A 2Q62A 3ELWA 3FZNA 3PWZA 5C1BA 1WQ1R 3NWPA 2FG5A 1CZOA 4WH0A 5FA5A 2OZKA 4KWTA 4MKFA 4ZHQA 1NVKA 3ZJYA 5EMNA 1UFVA 4TRMA 3F6YA 4P4TA 1E94E 3IHKA 1BG6A 2E4XA 1OD6A 4Z51A 5HZHA 4CMDA 3GQCA 4ITVA 2VATA 1T13A 1D1SA 1KSHA 3KQUA 5BV1A 4Y67A 3QU9A 2XDQB 1KBZA 2QRNA 3VVLA 3DAGA 3E8SA 4Q3KA 3INTA 1YRBA 1E3JA 1K3UB 3RRJA 2VAPA 3D1LA 1VHJA 3O93A 4I0WB 2D0DA 4DBZA 1R3UA 4DL4A 1DIBA 4DQXA 3OE7D 3GTGA 3W7BA 1NWCA 2GEVA 1Z08A 1Q0LA 4EO7A 4L8FA 1P29A 3SF8B 4FOSA 4DA6A 2PS1A 4XTRA 2PMEA 4AM8A 4UAUA 1L4EA 2WKPA 4JJIA 2ZSFA 1LBSA 2BSXA 3RC8A 1BRTA 4ECYA 1FY2A 2K4MA 3IAEA 4UU7A 1HFEL 5COQA 1TAGA 1ML4A 3HRHA 1RM5A 4FGLA 1JEAA 3GFVA 1KY3A 2Q7OE 3PD1A 2V6GA 1OX4A 4DR6B 3ESQA 1E9EA 3GCDA 4TSFA 1PV1A 1PR3A 2G4VA 5SZJA 3F9RA 3BQ0A 4RTNA 1QF9A 3TXYA 2YU9A 2E1PA 4JJEA 3OFJA 3IL2A 4DDWA 5K6AC 4DMCA 4CE5A 1A8HA 4TS9A 4B3CA 1N5MA 3HKBB 2CNWA 4PLTA 1KYYA 3EZGA 2C2WA 2Q4RA 4TXLA 1SELA 4MRNA 3Q85A 1PNOA 2HXSA 5DBOA 1I1NA 1GZVA 5F76A 5IULC 4YJHA 4YLYA 3PI7A 3I04M 4HFJA 1U2QA 2QE7A 5L53A 1Z6XA 3AFHA 4Q48A 1A9YA 3Q9UA 4HTAA 3GUZA 4AYBE 1UZUA 4MR8B 5L3VA 5BORA 4FZJA 2FHSA 2FPGB 3MSXA 2O8DA 2XKBA 2QGZA 3GROA 4ARUA 3G8DA 1VGRA 5LA6A 3ZZ1A 4C7OB 4FMCB 4F4IA 1XYGA 1KVSA 4XWGA 4MCAA 2O7NA 3LY9A 4IXMA 3T9DA 5IHXA 3NGXA 4ID9A 5I9LA 4ALKA 3A58B 3GEDA 2P4QA 4R8RA 1KIMA 4RDXA 3UMBA 1US8A 4U02A 3DAYA 5DMHA 1EFDN 2EZ8A 1RC1A 1SEVA 4YJ2F 4BCCA 2ZU0C 4KIFA 4XQGA 4P5PA 3DZBA 3FFBA 1IM8A 3AIMA 4KOEC 3OZRA 4HGPA 3GEBA 3BMCA 2AVNA 5B3JC 1AH2A 4D45A 1GXSA 3L7AA 1X80B 2ADFA 2UXBB 2D7CA 1OPRA 2XEXA 3ZN2A 3BOSA 1LCIA 2JA7A 1U9ZA 4D80A 4ZYUA 1W25A 2YS7A 1M0WA 2CW8A 4BXXG 1A5BB 2HJWA 4AVYA 3ZHSA 1F4LA 5EJ7A 3G2JA 3PJFA 1SG0A 2IS6A 2F8MA 4UTRA 2RAVA 4JU8A 3H9QA 4HXFB 4OATA 5FO1A 1GLGA 1R37A 3QI2A 3JWGA 3TVDA 1BX3A 3HP7A 4Q3DA 3DVAA 2ANCA 5AESA 4AIIA 4P36A 3K30A 3U4AA 1KORA 2VJNA 3AI3A 3DGFC 3SHWA 3WWDA 3VU8A 3RVMA 3GB8B 1P75A 5TARA 4IF6A 2FW1A 4F1KA 3HU1A 1IK6A 2A58A 3DAOA 1OFHA 1AMOA 3VNQA 4DCJA 621PA 4A9AA 3WADA 5BWWA 1C0IA 4KQ6A 3U0VA 3ZHUA 1V1RB 4LEIA 4DJEC 5FR2A 5IT9A 3MCAA 2AA3A 2VRBA 3DJFA 1Z74A 3NT5A 4LJKA 1L4BA 2OD2A 1OWPA 1JAHA 1TO6A 4YRAA 1PGPA 4L8LA 5IP5A 3E18A 1N1GA 5BR4A 2Q9UA 4R8LA 1ECFA 1I32A 3PNQA 4CRWB 4OI0A 3C8ZA 3WG9A 4AJLA 3E22B 2X15A 4BQNA 3RBEA 4L72A 1C3OB 4WK2B 1VKRA 3VDQA 4PGAA 3N2IA 3W8NA 4LH7A 1FTGA 1RWKA 2F6RA 4AYXA 3CEAA 4I19A 4HAUA 4B76A 3O4GA 1NDUA 1YQXA 5KCZA 3VAYA 4GKJH 1MB9A 1E0KA 2WF7A 1QAQA 4XXHA 1G2OA 3G1UA 5DKFA 1MU0A 2PUEA 5TMDA 2ZGIA 3Q0IA 1P4RA 2NYAA 3CKKA 5T64A 1P1IA 1SA0A 1BHJA 4M6WA 3P4YA 1J70A 5KTNA 1KDRA 4IBOA 5DLFA 4IIHA 4B1FA 2IV3A 2YMPA 4E13A 4YX9A 3E3AA 5FBHA 3PE6A 2JF0A 4P4SA 2NU9B 2ATIA 5COAA 1ZL2A 4JOBA 1MG5A 4YROA 5ITZA 3I04A 2NVBA 3WJAA 2UXDB 1QPGA 5L9AA 4OEHA 4Y2PA 4L57A 2AFIA 2BSAA 2QTVB 1E2HA 3B52X 5JAIA 5C31A 3VO9A 4EAAA 4D02A 5LQNA 1ENOA 2OQ2A 2OLSA 4AWAA 4ARIA 3THWA 3RTEA 2QD5A 2P35A 1XXHA 1X1CA 4PWYA 3K09A 3ETNA 2V7GA 2H4YA 4FLEA 1RTKA 2PH7A 1GZ4A 3ZDEA 1DJMA 3UW1A 3AM5A 4AECA 4YMWA 2VK8A 3A1NA 5HE9A 4J90A 3NHUA 1G5PA 2ZRFA 5ALVA 2D5BA 4P53A 4F8EA 4MA0A 4EATA 3NBQA 4GOJA 2W57A 3T54A 5IVDA 4MMXB 3WV5A 3QEMA 1OWMA 3FLAA 4QJ3A 3ND6A 2GN8A 2ZJYA 3RHSA 2ZJZA 1E2GA 2QAIA 3WWCA 4I99A 1RD4A 1R9NA 2IHZA 4ED7A 3BF7A 1F3OA 3K96A 4EUEA 2FH5B 2A1IA 4LBVA 3KJHA 4FNMA 5FOWA 4PLZA 2JCGA 2I3AA 2WWIA 5J4HA 1FVIA 4R2MA 2GLXA 3ZHRA 2AK3A 2RGNA 2VYVD 1GILA 2WIFA 4E6EA 3GMDA 4MUFA 2QTZA 1A1SA 3ZVRA 2JIZA 2YZKA 1QGUA 2ZRPA 1WZEA 5B4UA 4LKRA 3GFTA 1PJ2A 1PWHA 2HLHA 4KE7A 5UKDA 4IL5A 2XITA 3FWPA 1DAKA 4HD8A 4YAGA 1WU7A 3QKRB 4H31A 5JMPA 1E1DA 3L1JA 5JJ5A 3I6IA 2O7VA 1MO5A 3IP7A 4GKKB 3PTAA 2SCUA 3TX2A 3NB0A 3CH6A 3IERA 3PGKA 4UCSA 1IN1A 5TT1A 3H5TA 3ESRA 1X1SA 1YS6A 2P69A 5AKJA 3WYDA 1BX1A 1E1CA 3K4QA 3HV0A 2JJQA 4D9GA 2OBFA 1LQ2A 2ZWOA 4M89A 2FMTA 1JAYA 4RVSA 5IZ4A 5IM5A 3DPIA 4H6VA 5JZBA 1FYFA 1VHDA 3K6RA 3ANTA 5I7UA 5CLGA 3CCBA 3TOSA 3O8BA 2P0AA 1KE1A 1PO7A 3CY6A 1YOVA 4MUYA 1I1OA 5F9NA 1GN8A 3D3WA 1Z39A 3QUBA 5F12A 2YV4A 5EP1A 2FP4B 1CB0A 1A69A 5A4AA 4I6GA 3FZQA 3KDAA 4BMOB 2JZOA 1E0SA 1LEHA 2VHQA 3QNUA 4YMSA 4FLFA 3VUEA 3OTQA 2VRNA 3BD9A 5JJKA 3DM5A 2GYUA 3P97A 1WU8A 1D4AA 2OWOA 1T9GS 1GTSA 2P9GA 3V1YA 5KHLB 5FPRA 2OBBA 5LMUB 1EUDB 3G9TA 3MUEA 3GQBB 4QVGA 1GEGA 3PPXA 2RG1A 2Q3JA 2O5EA 3K4PA 2HBZA 5GAJA 2HKIA 1F4VA 4UBKA 1W5AA 5CJPA 1T9BA 1WPQA 4WFJA 5EMMA 3SEQA 1SVOA 1L5LA 1R0KA 3DV0A 4ZVLA 1EHCA 4BNZA 2BGWA 5JG7A 2BR3A 1L1RA 3WQSB 3IP3A 5DLDA 7MHTA 4P80A 5KWIA 5HXAA 1PG0A 2H2FA 1QS0A 1HBJA 3N86A 2V9CA 3GAZA 3BMXA 3B12A 3ZE2B 2C3PA 3AF3A 4HX5A 2AG1A 4M7RA 1BMDA 1CR4A 3IIKA 3NNSA 4JXJA 2FE3A 3QW4B 3PQEA 4KUGA 3ROMA 5HJ5A 3R7WB 2OECA 3M9LA 2HWUA 1FNDA 2C31A 3COWA 2I6XA 5AK3A 1YS9A 4FYYA 1JEQA 1LPSA 1OIXA 2QJWA 2PSSA 1OZ0A 1JQ3A 4JNKA 4E31A 3LT5A 3QELA 3VSEA 1Y89A 5ALEA 1LXCA 4W5RA 4O84A 3UQZA 2AH5A 1JFSA 1N5RA 2HD4A 3AI2A 4WBXC 1KEPA 2D5CA 2ZIAA 3TINA 4ECXA 4HQOA 4GU5A 1JKXA 5CB4A 4KRGA 4X8HA 5GJBA 1UC8A 4I5GA 2HMUA 3G6KA 2OPBA 4OOEA 1I30A 3ORYA 4HWTA 1XQ9A 5EXXA 5ICEA 5EQFA 4JV5H 1ZWLA 5KFRA 3IEPA 5B5SA 2CL6X 4FE7A 4B5KA 4EF6A 1WSWA 2ZR7A 1TT7A 3E0XA 4Z7NB 1GP2A 2IEZA 1EUQA 4AJ9A 4WCFB 2ES4A 1ML3A 1FX0B 3KK0A 2Q07A 4DJAA 3L8EA 4B8ZA 1H9BA 3N6VA 3H8WA 4LI0A 2AF3C 3FMAA 5H70A 3HBJA 5JMOA 1E3QA 2ZULA 4ZVMA 4MR7A 1L1QA 5CYFA 2EERA 3BQ2A 1AURA 1BGVA 1MJGA 4TYQA 4XIJA 2I22A 3AKEA 5KYXB 4BUCA 1Z4QA 2A0XA 1YRLA 3KHSA 3FKIA 2WSIA 5HCUA 5LL6b 5BYKA 1Z8NA 2CHVA 3C3DA 4G4SO 4DLKA 1XDZA 2HB6A 4B3BA 4QIWE 5CFLA 2WQ6A 4IIGA 1DIOB 1FCJA 4ND4A 4X90A 5BV7A 3KL2A 3VNBA 4OP1A 4DLTA 5K3OA 3K3VA 1WXGA 1EU1A 3SIWA 3KEQA 4E32A 3CT6A 5EY5B 5AVVA 3VKGA 3KQNA 2CEKA 3QYFA 1NHWA 2X14A 2NZ8A 4UHBA 2QKYA 2VNHA 1U0OC 4K0KB 4YP3A 2Q5OA 3GR6A 1BXRA 2H7VA 1M9NA 3ZPXA 1LLUA 3W05A 4HPXB 4MPPA 3UK6A 2V1UA 1MABA 2BM0A 1WE2A 4HH1A 5E7JA 3DLAA 4YJ3B 3IVRA 1H8EA 3CC8A 2NNWB 2AG5A 4DA7A 4HDAA 3RUIA 3C4VA 5JZOA 2CFTA 4QM7A 3BH6A 3IOBA 2C83A 3GJTA 4DV6B 3UFBA 1UK7A 1QRSA 2ZCUA 3EMVA 2JIPA 2RJOA 4LDAA 4F45A 4B7CA 2A92A 5FJ8G 1FTQA 4YAKB 3UJNA 5JJIA 3UQ8A 4MTDA 3H3FA 1JWBB 3DBVO 4UUNA 1QQ7A 5FTNA 2X0RA 4XDYA 2XBUA 1O97D 1GPJA 3GDFA 3LMLA 3RUCA 3U61B 4B6QA 5BNZA 3HVKA 2NSYA 1G20E 3W1EA 2ZIZA 4F2DA 5LMCA 3PNYA 2BIFA 3VTAA 3PK0A 1H5NA 3D7SA 5BUZA 1O0SA 1BYIA 3HC7A 1RWNA 2PBFA 2FUG1 2C4MA 2R65A 2V7QD 4ZVOA 4Q05A 1N6RA 4KRYA 1AKMA 1X7HA 4FPXA 1E7WA 1ANKA 1XT6A 1Q77A 1E7YA 2O7RA 3UAOA 2XZLA 5EERA 4N3CA 2Y0PA 3K9WA 3UA4A 2YOGA 1NVVQ 1F0NA 2NUTB 2PU5A 4ZYVA 5DG7A 1CUGA 3I0MA 2NTNA 1C1HA 2OXFA 3ANSA 1Q1GA 2HNAA 1I4WA 3VYVA 3H0GA 2PBZA 3RSOA 3ZBTA 3IB3A 4B4UA 4WBNF 1E2KA 3T3OA 1LJLA 4Z86A 2BQRA 3N0WA 1YDHA 1UK6A 1NIJA 1XP5A 4MW5A 3GH1A 4HPJB 4IHJB 3ZUPA 5THQA 2NO7A 3O7MA 1JA1A 2ZI3A 4A8JB 5JFOA 4OFBA 2I6UA 1D3AA 3LCVB 3M4YA 5FPTA 3NM6B 4L7VA 3RAQA 5AOAA 4OFWA 4H3HB 4GSLA 3SPXA 3F9CA 5H7XA 5ALLA 4BBSG 2NO9A 1JDEA 1KO1A 4G37A 3KOOA 4LGVA 3WB9A 3H5VA 1P62B 4M1QA 2Z4SA 3OQIB 4OP2A 5AW2A 4RNOA 1QE3A 1ZD4A 1SGWA 4BQFA 4TTTS 4OG2A 5KDDA 4YO7A 1WQ4A 1E5QA 1L5SA 3GEIA 2PUDA 2EFCB 4HGZA 3UHAA 3SR0A 2VUIB 2R4TA 5IFLA 2PZFA 1NA5A 3RFVA 3ZE0B 3LG2A 4YV1A 1NYTA 3IDOA 2IUFA 3MMSA 4PPQA 2ZWIA 2PH5A 3UMRA 4ZXPA 1GDTA 3HB9A 2X40A 4RDIA 4DUYB 4AJ1A 1N77A 4Y2SA 4PC3A 5L4NA 1QR6A 4BLVA 3JQEA 1U3GA 2Q6OA 4Y2JA 3I76A 4UHDA 2CNVA 3TYXA 1CE8B 2YFHA 4B09A 3GDOA 4IIXA 3L8ZA 4HNUA 3HR4A 4KPFC 2QG6A 3N0XA 5JAMA 1R0RE 3E9DA 4BBZA 1QGZA 5FTWA 4TLCA 1FSFA 3A9UA 4LYJA 3GZ4A 1OBFO 1HG1A 2J85A 3ID6C 3G2NA 2FMFA 1BD3A 3HEAA 3V1UA 1XMOB 1ISSA 2Z2JA 2AGQA 3C43A 4NZMA 4H7DA 2RGWA 1P0CA 3Q98A 1YOBA 2RH9B 3CXRA 2NM0A 3BTOA 4CLXA 4CIAA 2P91A 2IRWA 2GO1A 1DNPA 3GW8A 4AUMA 2RKOA 4Q7QA 4F4YA 1UNNC 2A5YB 1H4TA 2GBIA 4QARA 5TQJA 5C53B 2QYOA 4LXQA 4N3AA 1IZ9A 4GLBA 5CA0F 3DO6A 4BUZA 5DTJA 3BJMA 3IJRA 1H94A 1ICEA 2NT3A 1J22A 2FMAA 4EEQA 4WINA 4AICA 3EASA 3JATA 4YHHB 4WCDA 4QGGA 1EVEA 1I2BA 4A0GA 4WKBA 1T1JA 2C3UA 1R9GA 2JA5G 3T7IA 3V55A 4TPKA 4BVGA 4FYVA 1KJNA 4OCZA 3IAS1 2F17A 1ZXXA 4UUAA 3OJWA 1JMVA 1FS5A 5DN6D 1GYRA 4WEQA 2WJPA 4CW7A 4YP0A 2D4HA 3OM8A 2VWGA 5J2UB 1ZN9A 4QXMA 1GPH1 4TSFD 4RH3A 1CUDA 2PYZA 2HBRA 5JQGB 4DTIA 3TJRA 1J5XA 3UB2A 3D7MA 2F4NA 3AEKA 2WFAA 4H1HA 5JRZA 1QHXA 1R4AA 2CNWD 3MF4A 8AT1A 4PQFA 2WMNB 4ZGGA 2H06A 4IVQA 5IJWA 4FS1A 3GIMA 2D59A 3JD4A 1UBFA 3TLMA 1IBLH 1FFSA 5C2JB 2LNDA 4RV5A 1NQOA 2QE7D 2QG4A 2XCAA 1U8ZA 2B7LA 1XTZA 4GWKA 3HGTA 3FDZB 4GI1A 1ZJ5A 3A1WA 4A3IG 2B2CA 3U3OA 3ODPA 4TM8A 3EH2A 4M9XA 2XY4A 1FMFA 4ZZIA 2FEOA 3DOFA 3G0OA 5BWUA 3OU7A 1FDVA 2R9VA 3R7NA 3ETLA 3A4NA 2XNSA 1TFRA 2EFEB 1AUXA 2OUIA 2CB0A 2OB1A 2VXCA 3ZGYA 1ULSA 5J5AA 3QFTA 3WLSA 4PYIA 1YQGA 2F1JA 4IDHA 1Z6GA 1E1YA 5LOVF 5AW1A 3LQFA 3GX1A 2QZSA 3TIVA 5IT9W 2NVXA 2DPYA 3SNHA 5EJMA 4EGAA 5A3SA 1XYYA 2PK3A 5L4SA 2UYOA 3K72B 2ZXUA 2IW3A 3HGQA 1VSVA 2PZEA 3DDWA 1JFLA 4O4IF 1XAJA 5EJGA 1CR2A 2XMSA 4RFVA 2VJYA 5C3MA 3EG9A 4O7TA 4M8LA 1Q22A 2AGOA 2I1QA 4EGFA 3TSZA 3EW7A 3AI7A 3D3JA 3I6MA 1XJ0A 1POWA 1QH1B 2XIJA 4PVDA 4DQVA 1Z2PX 5AD1A 2PMFA 4ZOAA 5EXSA 1WULS 4O7VA 3RROA 5A6VA 1S0OA 1K86A 4P92A 1K5DA 1PZGA 3HYLA 4WJKB 3MHTA 5KJEA 5KT7A 3CNOA 3PXCX 1DRJA 2XMGA 1AT1A 5EFOA 3WGKA 1DCKA 1P60A 3MWGA 3ANLA 4PBSA 1JE0A 3TTVA 1QG2A 4QD3A 5FQNA 4K87A 3C3BA 1CKMA 4Q8EA 3AVTA 1E3WA 4HEA1 5AWFC 2G9RA 5KNDH 1H4QA 2PM8A 5ALPA 1KO5A 4BE4A 1XTBA 3HH8A 4YO8A 2XF2A 1E20A 1YMQA 4Q4JB 2ZI6A 4NOMA 2O2CA 3DHEA 4L51A 4I1RA 1S8FA 3FMFA 2F1OA 2X41A 1G9TA 4D41A 4M1KA 4AG5A 2Q2QA 4ND7A 3ZTWA 3EIFA 4O7NA 3RUFA 2QLTA 3DCYA 1N48A 2VDWA 4RPKA 5CLQA 3M9OB 3B53X 3FKJA 3LT4A 4KWEA 3MCUA 2I71A 2XMBA 3I28A 1UIMA 3M3HA 5LFAA 2KYRA 4ALIA 3RO7A 1K5HA 3IDFA 2V96A 3B6JA 1I2AA 3QU7A 3OLXA 1NBEA 4AF7A 4Y2HA 1YE5A 4RF2A 1ORIA 3EISA 5CDTA 1OLUB 2D2IA 1X7WA 4HEQA 1DXOA 2VP6A 2PE5A 1XA4A 1YQWA 4BO4A 4YMUA 2BFEA 4QPDA 5GIOE 5IAKA 4YACA 2YWCA 2B6NA 3C7KA 1W4LA 2H1CA 2B9VA 3T7KA 4GM1A 5ADWA 4NL4H 4ED2A 3O8CA 4MICA 2P2LA 3OHAA 3HDTA 2XUAA 1XDUA 2CNQA 3EIWA 5AW4A 4ESVA 5I45A 2X1MA 1T4CB 1PGQA 4G81A 5GP1A 4Q1AA 4C20A 2EQ5A 4E94A 2GBLA 4AF6A 1WCXA 1DINA 5F2EA 1WS6A 1YL7A 5ARBA 2PZGA 2PWAA 1MF7A 4X91A 1XJCA 4FFBB 1NN0A 1CUZA 4HGYA 1JFRA 4I4TB 3N5CA 2PPVA 1QDEA 2VDJA 3NIDB 4NE7A 2WM8A 3FPFA 1EK2A 3FY4A 4NESA 4O5AA 5DQIA 3BBLA 2WVHA 1RLMA 2NQTA 2NWQA 1THZA 1TRKA 3HDGA 5IPFA 3TNJA 1DLIA 3F8WA 1FPQA 1TD9A 5A0VA 3LUKA 1ZR2A 1EDZA 1IHXA 5B57C 4UHFA 5TXGA 5JY6A 4N39A 3KKKA 2Q7XA 1IG0A 4MB2A 3WZ2A 4UEKA 2P40A 1OJLA 3ZH2A 4GRAA 1T2NA 4K03A 1Z16A 2OFXA 3LHDA 1Z6QA 1IATA 2H57A 3ZJ5A 3T0GA 4EDHA 2FPIB 2E0IA 4UMDA 5BPFA 1CUWA 2FZVA 1MFZA 3KT6A 2GBFA 2BGMA 4BZXA 1NM5A 3X2SA 3LC1O 4NJEA 1PFYA 2UKDA 2JIZD 3OCVA 1VB3A 4IICA 1EAMA 4GLLA 3MWEB 4K7JA 1EBFA 3WFZA 2BGNA 4L78A 4D0SA 4KN8A 1V45E 3BWDD 3F5SA 1M75A 1VE3A 2O14A 5HWSA 3ND5A 3ADCA 1TZCA 3OLWA 2QY9A 2I2WA 3LJKA 3A3OA 2FOLA 1ZJYA 1PGJA 3A3PA 4B7ZA 4O81A 3RSSA 3BD6A 4EG7A 2XI4A 3HYTA 3BE5A 1G2PA 2CC2A 4JX8A 4N6NA 3W4KA 2P6NA 2BFFB 3L84A 2YJNA 4IIBA 3ZVNA 5BV2P 4UUPA 2A0FA 1XVUA 1HEIA 2QJFA 3ASYA 2CW7A 5L7WA 5AJVB 3SR3A 4BLUA 2P3LA 4MYCA 2W48A 3GUCA 1WOMA 4EBCA 1PSDA 3ME5A 2I8LA 3USCS 4E5NA 3T52A 3EDCA 3UH0A 3V4OA 4FN5A 1E1NA 2CD7A 2G5TA 3U80A 2X5RA 1BDBA 3A27A 2P7IA 5LQUA 4GD3Q 4DABA 3I9JA 2MMCA 4B3IA 4QJIA 1F6DA 5JECA 2FLKA 2TECE 3I34X 2JAUA 2I3DA 1I1LA 4OSPA 4JJKA 3T4PA 2NGRA 2IVFA 3RASA 1MOZA 2RBEA 4N6GA 4EL0A 5KVAA 1ONPA 3I01M 3NTQA 3HVRA 4X94A 2HGWA 2JK0A 3G5UA 4J2TA 4NXNB 5HF8A 3RU3A 4C7MA 4FFLA 3ENKA 3K0FB 3COPA 1T5IA 5JJCA 4Y6OA 4HMPA 2JLYA 1NFQA 1SQ0A 3QVGA 1OBHA 2PGNA 4O1HA 4A26A 5DXAA 1NF8A 4YC7A 1E9CA 3MTGA 3M4IA 1HDOA 3EZLA 4WFIA 4UZFA 4B79A 3ZU2A 5JXJA 4ZWNA 1UEIA 5K20A 3B5EA 3BZBA 3RIXA 3A4LA 1M8JA 2HXGA 2HSWA 3HY4A 1GG5A 4RTJA 3DMRA 2JATA 5KEIA 5G41A 1UP4A 2JFUA 1IIBA 5KX5F 1L7PA 2VT6A 4HATA 1U1DA