5H8IA

Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
298
structure length
296
Chain Sequence
DKGRKVVVSALQFACTDDVSTNVTTAERLVRAAHKQGANIVLIQELFEGYYFCQAQREDFIQRAKPYKDHPTIMRLQKLAKELGVVIPVSFFEEANNAHYNSIAIIDADGTDLGIYRKSHIPDGPGYEEKFYFNPGDTGFKVFQTKYAKIGVAICWDQWFPEAARAMALQGAEILFYPTAIGSEPQSIDSRDHWKRVMQGHAGANLVPLVASNRIGNEIIETEHGKSEIKFYGNSFIAGPTGEIVSIADDKEEAVLIAEFNLDKIKSMRHCWGVFRDRRPDLYKVLLTLDGKNPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Investigations of N-carbamoylputrescine Amidohydrolase from Medicago truncatula: Insights into the Ultimate Step of Putrescine Biosynthesis in Plants.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Hydrolase
molecule keywords N-carbamoylputrescine amidohydrolase
total genus 100
structure length 296
sequence length 298
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.5.1.53: N-carbamoylputrescine amidase.
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 5h8iA00
2VHHA 4IZWA 2W1VA 1UF8A 4H5UA 2VHIA 2PLQA 5H8IA 4IZSA 5H8JA 4CYGA 5JQNA 1UF7A 3SDBA 4HG3A 3KI8A 2E2KA 3SEQA 4CYYA 1EMSA 4F4HA 2UXYA 4IZVA 5KHAA 3HKXA 1ERZA 1F89A 3SEZA 1UF4A 4GYLA 3DLAA 5H8LA 2E11A 2GGLA 3IW3A 1UF5A 4HG5A 3IVZA 2E2LA 3KLCA 3ILVA 1J31A 4GYNA 3WUYA 4CYFA 3SZGA 5H8KA 4KZFA 4IZTA 4LF0A 2DYUA 3P8KA 3SYTA 2GGKA 2DYVA 4IZUA 4HGDA 1FO6A 3N05A
chains in the Genus database with same CATH superfamily
2VHHA 4IZWA 2W1VA 1UF8A 4H5UA 2VHIA 2PLQA 5H8IA 4IZSA 5H8JA 4CYGA 5JQNA 1UF7A 3SDBA 4HG3A 3KI8A 2E2KA 3SEQA 4CYYA 1EMSA 4F4HA 2UXYA 4IZVA 5KHAA 3HKXA 1ERZA 1F89A 3SEZA 1UF4A 4GYLA 3DLAA 5H8LA 2E11A 2GGLA 3IW3A 1UF5A 4HG5A 3IVZA 2E2LA 3KLCA 3ILVA 1J31A 4GYNA 3WUYA 4CYFA 3SZGA 5H8KA 4KZFA 4IZTA 4LF0A 2DYUA 3P8KA 3SYTA 2GGKA 2DYVA 4IZUA 4HGDA 1FO6A 3N05A
chains in the Genus database with same CATH topology
2VHHA 4IZWA 2W1VA 1UF8A 4H5UA 2VHIA 2PLQA 5H8IA 4IZSA 5H8JA 4CYGA 5JQNA 1UF7A 3SDBA 4HG3A 3KI8A 2E2KA 3SEQA 4CYYA 1EMSA 4F4HA 2UXYA 4IZVA 5KHAA 3HKXA 1ERZA 1F89A 3SEZA 1UF4A 4GYLA 3DLAA 5H8LA 2E11A 2GGLA 3IW3A 1UF5A 4HG5A 3IVZA 2E2LA 3KLCA 3ILVA 1J31A 4GYNA 3WUYA 4CYFA 3SZGA 5H8KA 4KZFA 4IZTA 4LF0A 2DYUA 3P8KA 3SYTA 2GGKA 2DYVA 4IZUA 4HGDA 1FO6A 3N05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VHH A;  4IZW A;  2W1V A;  1UF8 A;  4H5U A;  2VHI A;  2PLQ A;  5H8I A;  4IZS A;  5H8J A;  4CYG A;  5JQN A;  1UF7 A;  3SDB A;  4HG3 A;  3KI8 A;  2E2K A;  3SEQ A;  4CYY A;  1EMS A;  4F4H A;  2UXY A;  4IZV A;  5KHA A;  3HKX A;  1ERZ A;  1F89 A;  3SEZ A;  1UF4 A;  4GYL A;  3DLA A;  5H8L A;  2E11 A;  2GGL A;  3IW3 A;  1UF5 A;  4HG5 A;  3IVZ A;  2E2L A;  3KLC A;  3ILV A;  1J31 A;  4GYN A;  3WUY A;  4CYF A;  3SZG A;  5H8K A;  4KZF A;  4IZT A;  4LF0 A;  2DYU A;  3P8K A;  3SYT A;  2GGK A;  2DYV A;  4IZU A;  4HGD A;  1FO6 A;  3N05 A; 
#chains in the Genus database with same CATH topology
 2VHH A;  4IZW A;  2W1V A;  1UF8 A;  4H5U A;  2VHI A;  2PLQ A;  5H8I A;  4IZS A;  5H8J A;  4CYG A;  5JQN A;  1UF7 A;  3SDB A;  4HG3 A;  3KI8 A;  2E2K A;  3SEQ A;  4CYY A;  1EMS A;  4F4H A;  2UXY A;  4IZV A;  5KHA A;  3HKX A;  1ERZ A;  1F89 A;  3SEZ A;  1UF4 A;  4GYL A;  3DLA A;  5H8L A;  2E11 A;  2GGL A;  3IW3 A;  1UF5 A;  4HG5 A;  3IVZ A;  2E2L A;  3KLC A;  3ILV A;  1J31 A;  4GYN A;  3WUY A;  4CYF A;  3SZG A;  5H8K A;  4KZF A;  4IZT A;  4LF0 A;  2DYU A;  3P8K A;  3SYT A;  2GGK A;  2DYV A;  4IZU A;  4HGD A;  1FO6 A;  3N05 A; 
#chains in the Genus database with same CATH homology
 2VHH A;  4IZW A;  2W1V A;  1UF8 A;  4H5U A;  2VHI A;  2PLQ A;  5H8I A;  4IZS A;  5H8J A;  4CYG A;  5JQN A;  1UF7 A;  3SDB A;  4HG3 A;  3KI8 A;  2E2K A;  3SEQ A;  4CYY A;  1EMS A;  4F4H A;  2UXY A;  4IZV A;  5KHA A;  3HKX A;  1ERZ A;  1F89 A;  3SEZ A;  1UF4 A;  4GYL A;  3DLA A;  5H8L A;  2E11 A;  2GGL A;  3IW3 A;  1UF5 A;  4HG5 A;  3IVZ A;  2E2L A;  3KLC A;  3ILV A;  1J31 A;  4GYN A;  3WUY A;  4CYF A;  3SZG A;  5H8K A;  4KZF A;  4IZT A;  4LF0 A;  2DYU A;  3P8K A;  3SYT A;  2GGK A;  2DYV A;  4IZU A;  4HGD A;  1FO6 A;  3N05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...