5H8XA

Crystal structure of the complex mmp-8/bf471 (catechol inhibitor)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
b'MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil collagenase
publication title Catechol-based matrix metalloproteinase inhibitors with additional antioxidative activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2015-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5h8xA00
4L63A 1C3IA 1OS9A 3USNA 4ZR5A 3Q2GA 2DW2A 3VI1A 1SMPA 4A7BA 3LK8A 3F16A 2JNPA 3KEKA 4AXQA 3LUNA 3LJTA 3ZUKA 2MLRA 2OW1A 2HU6A 1DMTA 4PKSA 2PJTA 3F1AA 1C7KA 2DDYA 1G12A 1WNIA 5H8XA 1CXVA 830CA 2O36A 1OS2A 5L79A 3LKAA 3F15A 1I73A 3LGPA 1SATA 3LQ0A 3ZVSA 3LJGA 3HBUP 4DPEA 1FBLA 1CGLA 2V4BA 1IAEA 5CUHA 1QJJA 3ELMA 2D1NA 4PKWA 1BQQM 1I1IP 4WKEA 5B5OA 3HY9A 1UMTA 4IUWA 1OM7A 1BIWA 4ON1A 2KRJA 4FXQA 1JKYA 1ZVXA 2OI0A 4QKZA 3U1RA 3F18A 1BKCE 3GBOA 1YOUA 1CQRA 2O3EA 1EUBA 3DWBA 1XFWA 1BZSA 3F17A 1B3DA 1MMBA 5B5PA 1H71P 5I12A 1B8YA 1OO9A 3LQBA 4EFSA 2X7MA 1G9KA 1GKDA 1QIAA 2WOAA 1HFSA 4PKTA 3NX7A 966CA 1Y0VA 1KUKA 5D3CA 3LUMA 2OXWA 4J4MA 1D7XA 3K7NA 3EHYA 3O64A 4H2EA 5BOTA 4H82A 1HY7A 3LIRA 2N8RA 2X3CA 1OMJA 1IABA 1A86A 1FLSA 1IAGA 1IAAA 4XM6A 2SRTA 1KUFA 1AKLA 1PWWA 4PKUA 2OXZA 4L6TA 1JIZA 3KECA 3Q2HA 1OM6A 2AIGP 1JAPA 4JP4A 1QUAA 1KUIA 4XM8A 2L0RA 4GR8A 1CGEA 4ILWD 3L0TA 2POJA 1PWPA 1ND1A 4XCTA 2OW0A 1G49A 2AYKA 3LEAA 1JAQA 4GR3A 1K7IA 1SRPA 3HDBA 5I0LA 5CXAA 4GWMA 4I03A 3WV3A 1CK7A 1EB6A 2EROA 3KWVC 1KAPP 3RTSA 2MZEA 1ASTA 1OM8A 2JT5A 2Y6DA 3HBVP 2RJPA 1JK3A 1EAKA 4PKQA 3LMCA 4G9LA 2K9CA 3DL1A 4DV8A 3P24A 2MZIA 3G5CA 2JT6A 4JIJA 2OW9A 1XUCA 4PKRA 3DSLA 4DF9A 3HY7A 1XFZA 5D7WA 1D8MA 1D8FA 3KHIA 4I35A 2W12A 2E3XA 2FV5A 1O0QA 2OY2A 3OHOA 4IN9A 1PWUA 1XURA 1JIWP 2W15A 5LABA 4A3WA 1Z3JA 1I76A 1XFUA 456CA 1USNA 1R1HA 2Y6CA 3KMEA 3TT4A 1GE6A 5L7FA 1BM6A 1BKCI 3AYUA 4PKVA 3HB2P 3TVCA 3AIGA 1UEAA 2CLTA 1MMQA 4WKIA 2OZRA 1FM1A 4H1QA 1MMPA 1KUHA 3LIKA 1K7QA 3L0VA 3KEJA 2WO9A 4L19A 1Q3AA 1UTTA 1SLMA 1RMZA 1Y8JA 4GR0A 3VTGA 1R1IA 3F19A 2DW0A 1MNCA 3K7LA 1JANA 4HMAA 1SLNA 1QICA 4IJOA 3B92A 1ZXCA 5D1SA 1KUGA 2DDFA 1JAOA 3SHIA 1ROSA 2I47A 3EDGA 1QIBA 2J83A 2USNA 3G42A 1YP1A 3E8RA 2YIGA 2YB9A 4FXYP 1BUDA 4XM7A 1K7GA 1GO8P 1KBCA 1O0TA 1UTZA 2W0DA 1G05A 5D2BA 2OVXA 4R3VA 2QPJA 5BOYA 3N2UA 5D1UA 3DNGA 2MZHA 4H3XA 4WK7A 1DTHA 1CIZA 2E2DA 4G0DA 3V96B 4AIGA 3ZXHA 3P1VA 1HFCA 3HDAP 2TCLA 5BPAA 2DW1A 1S4BP 2J0TA 1IACA 3I7IA 3LILA 1BUVM 1BQOA 3CKIA 3EHXA 2ERQA 2A8HA 1ZP5A 1CAQA 4Q1LA 3KRYA 4WZVA 5I2ZA 2K2GA 1GO7P 3DPEA 1AF0A 1GE7A 1BKCA 1L6JA 4GQLA 3EDIA 3UVCA 4JPAA 2D1OA 3MA2A 1AYKA 2W13A 2OVZA 1IADA 2FV9A 3AYKA 3DPFA 1PWQA 1ATLA 3EWJA 1C8TA 1JJ9A 1GXDA 4H49A 4WF6A 1XFYA 3B2ZA 1YQYA 3HYGA 4XBHA 1ZTQA 2OXUA 5CZMA 1R54A 5I3MA 3RTTA 1R55A 3TSKA 5I43A 3BA0A 4FU4A 1XFXA 4GUYA 2OW2A 1HTDA 1GKCA 2MLSA 3I7GA 4H76A 4AYKA 4AUOA 1BSWA 1UMSA 4DD8A 4H30A 1SU3A 1ZS0A 5D1TA 4GWNA 5JMYA 1XFVA 3WV2A 2X3AA 3TS4A 2Z2DA 5I4OA 4H84A 1QJIA 2CKIA 1GE5A 1PWVA 1HV5A 2ERPA 1ZXVA 1CGFA 4CTHA 3O2XA 2XS3A 3N2VA 1D5JA 4FVLA 4JQGA 2OY4A 3KMCA 1RM8A 3LJZA 1MMRA 1R1JA 1JH1A 3WV1A 2JIHA 3OHLA 1XUDA 3EDZA 1A85A 3B8ZA 4HX3A 1J7NA 1HOVA 2JSDA 1YCMA 2W14A 2X3BA 2XS4A 3EDHA 4JA1A 2RJQA 3LE9A 1Y93A 2WO8A 4GF1A 1G4KA
chains in the Genus database with same CATH superfamily
4L63A 1C3IA 1OS9A 3USNA 4ZR5A 3Q2GA 2DW2A 3VI1A 1SMPA 4A7BA 3LK8A 3F16A 2JNPA 3KEKA 4AXQA 3LUNA 3LJTA 3ZUKA 2MLRA 2OW1A 2HU6A 1DMTA 4PKSA 2PJTA 3F1AA 1C7KA 2DDYA 1G12A 1WNIA 5H8XA 1CXVA 830CA 2O36A 1OS2A 5L79A 3LKAA 3F15A 1I73A 4L7AA 3LGPA 1SATA 3LQ0A 1XAXA 3ZVSA 3LJGA 3HBUP 4DPEA 1FBLA 1CGLA 2V4BA 1IAEA 5CUHA 1QJJA 3ELMA 2D1NA 4PKWA 1BQQM 1I1IP 4WKEA 5B5OA 3HY9A 1UMTA 4IUWA 1OM7A 1BIWA 4ON1A 2KRJA 4FXQA 1JKYA 1ZVXA 2OI0A 4QKZA 3U1RA 3F18A 1BKCE 3GBOA 1YOUA 1CQRA 2O3EA 1EUBA 3DWBA 1XFWA 1BZSA 3F17A 1B3DA 1MMBA 5B5PA 1H71P 5I12A 1B8YA 1OO9A 3LQBA 4EFSA 2X7MA 1G9KA 1GKDA 1QIAA 2WOAA 1HFSA 4PKTA 1OZ9A 3NX7A 966CA 1Y0VA 1KUKA 5D3CA 3LUMA 2OXWA 4J4MA 1D7XA 3K7NA 3EHYA 3O64A 4H2EA 5BOTA 4H82A 1HY7A 3LIRA 2N8RA 2X3CA 1OMJA 1IABA 1A86A 1FLSA 1IAGA 1IAAA 4XM6A 2SRTA 1KUFA 1AKLA 1PWWA 4PKUA 2OXZA 4L6TA 1JIZA 3KECA 3Q2HA 1OM6A 2AIGP 1JAPA 4JP4A 1QUAA 1KUIA 4XM8A 2L0RA 4GR8A 1CGEA 4ILWD 3L0TA 2POJA 1PWPA 1ND1A 4XCTA 2OW0A 1G49A 2AYKA 3LEAA 1JAQA 4GR3A 1K7IA 1SRPA 3HDBA 5I0LA 5CXAA 4GWMA 4I03A 3WV3A 1CK7A 1EB6A 2EROA 3KWVC 1KAPP 3RTSA 2MZEA 3DTKA 1ASTA 1OM8A 2JT5A 2Y6DA 3HBVP 2RJPA 1JK3A 1EAKA 4PKQA 3LMCA 4G9LA 2K9CA 3DL1A 4DV8A 3P24A 2MZIA 3G5CA 2JT6A 4JIJA 2OW9A 1XUCA 4PKRA 3DSLA 3DTIA 4DF9A 3HY7A 1XFZA 3DTEA 5D7WA 1D8MA 1D8FA 3KHIA 4I35A 2W12A 2E3XA 2FV5A 1O0QA 2OY2A 3OHOA 4IN9A 1PWUA 1XURA 1JIWP 2W15A 5LABA 4A3WA 1Z3JA 1I76A 1XFUA 456CA 1USNA 1R1HA 2Y6CA 3KMEA 3TT4A 1GE6A 5L7FA 1BM6A 1BKCI 3AYUA 4PKVA 3HB2P 3TVCA 3AIGA 1UEAA 2CLTA 1MMQA 4WKIA 2OZRA 1FM1A 4H1QA 1MMPA 1KUHA 3LIKA 1K7QA 3L0VA 3KEJA 2WO9A 4L19A 1Q3AA 1UTTA 1SLMA 1RMZA 1Y8JA 4GR0A 3VTGA 1R1IA 3F19A 2DW0A 1MNCA 3K7LA 1JANA 4HMAA 1SLNA 1QICA 4IJOA 3B92A 1ZXCA 5D1SA 1KUGA 2DDFA 1JAOA 3SHIA 1ROSA 2I47A 3EDGA 1QIBA 2J83A 2USNA 3G42A 1YP1A 3E8RA 2YIGA 2YB9A 4FXYP 1BUDA 4XM7A 1K7GA 1GO8P 1KBCA 1O0TA 1UTZA 2W0DA 1G05A 5D2BA 2OVXA 4R3VA 2QPJA 1XM5A 5BOYA 3N2UA 5D1UA 3DNGA 2MZHA 4H3XA 4WK7A 1DTHA 1CIZA 2E2DA 4G0DA 3V96B 4AIGA 3ZXHA 3P1VA 1HFCA 3HDAP 2TCLA 5BPAA 2DW1A 1S4BP 1TVIA 2J0TA 1IACA 3I7IA 3LILA 1BUVM 1BQOA 3CKIA 3EHXA 2ERQA 2A8HA 1ZP5A 1CAQA 4Q1LA 3KRYA 4WZVA 5I2ZA 2K2GA 1GO7P 3DPEA 1AF0A 1GE7A 1BKCA 1L6JA 4GQLA 3EDIA 3UVCA 4JPAA 2D1OA 3MA2A 1AYKA 2W13A 2OVZA 1IADA 2FV9A 3AYKA 3DPFA 1PWQA 1ATLA 3EWJA 1C8TA 1JJ9A 1GXDA 4H49A 4WF6A 1XFYA 3B2ZA 1YQYA 3HYGA 4XBHA 1ZTQA 2OXUA 5CZMA 1R54A 5I3MA 3RTTA 1R55A 3TSKA 5I43A 3BA0A 4FU4A 1XFXA 4GUYA 2OW2A 1HTDA 1GKCA 2MLSA 3I7GA 4H76A 4AYKA 4AUOA 1BSWA 1UMSA 4DD8A 4H30A 1SU3A 1ZS0A 5D1TA 4GWNA 5JMYA 1XFVA 3WV2A 2X3AA 3TS4A 2Z2DA 5I4OA 4H84A 1QJIA 2CKIA 1GE5A 1PWVA 1HV5A 2ERPA 1ZXVA 1CGFA 4CTHA 3O2XA 2XS3A 3N2VA 1D5JA 4FVLA 4JQGA 2OY4A 3KMCA 1RM8A 1MMRA 3LJZA 1R1JA 1JH1A 3WV1A 2JIHA 3OHLA 1XUDA 3EDZA 1A85A 3B8ZA 4HX3A 1J7NA 1HOVA 2JSDA 1YCMA 2W14A 2X3BA 2XS4A 3EDHA 4JA1A 2YUFA 2RJQA 3LE9A 1Y93A 2WO8A 4GF1A 1G4KA
chains in the Genus database with same CATH topology
4L63A 1C3IA 1OS9A 3USNA 4ZR5A 3Q2GA 2DW2A 3VI1A 1SMPA 4A7BA 3LK8A 3F16A 2JNPA 3KEKA 4AXQA 3LUNA 3LJTA 3ZUKA 2MLRA 2OW1A 2HU6A 1DMTA 4PKSA 2PJTA 3F1AA 1C7KA 2DDYA 1G12A 1WNIA 5H8XA 1CXVA 830CA 2O36A 1OS2A 5L79A 3LKAA 3F15A 1I73A 4L7AA 3LGPA 1SATA 3LQ0A 3ZVSA 3LJGA 3HBUP 4DPEA 1FBLA 1CGLA 2V4BA 1IAEA 5CUHA 1QJJA 3ELMA 2D1NA 4PKWA 1BQQM 1I1IP 4WKEA 5B5OA 3HY9A 1UMTA 4IUWA 1OM7A 1BIWA 4ON1A 2KRJA 4FXQA 1JKYA 1ZVXA 2OI0A 4QKZA 3U1RA 3F18A 1BKCE 3GBOA 1YOUA 1CQRA 2O3EA 1EUBA 3DWBA 1XFWA 1BZSA 3F17A 1B3DA 1MMBA 5B5PA 1H71P 5I12A 1B8YA 1OO9A 3LQBA 4EFSA 2X7MA 1G9KA 1GKDA 1QIAA 2WOAA 1HFSA 4PKTA 3NX7A 966CA 1Y0VA 1KUKA 5D3CA 3LUMA 2OXWA 4J4MA 1D7XA 3K7NA 3EHYA 3O64A 4H2EA 5BOTA 4H82A 1HY7A 3LIRA 2N8RA 2X3CA 1OMJA 1IABA 1A86A 1FLSA 1IAGA 1IAAA 4XM6A 2SRTA 1KUFA 1AKLA 1PWWA 4PKUA 2OXZA 4L6TA 1JIZA 3KECA 3Q2HA 1OM6A 2AIGP 1JAPA 4JP4A 1QUAA 1KUIA 4XM8A 2L0RA 4GR8A 1CGEA 4ILWD 3L0TA 2POJA 1PWPA 1ND1A 4XCTA 2OW0A 1G49A 2AYKA 3LEAA 1JAQA 4GR3A 1K7IA 1SRPA 3HDBA 5I0LA 5CXAA 4GWMA 4I03A 3WV3A 1CK7A 1EB6A 2EROA 3KWVC 1KAPP 3RTSA 2MZEA 3DTKA 1ASTA 1OM8A 2JT5A 2Y6DA 3HBVP 2RJPA 1JK3A 1EAKA 4PKQA 3LMCA 4G9LA 2K9CA 3DL1A 4DV8A 3P24A 2MZIA 3G5CA 2JT6A 4JIJA 2OW9A 1XUCA 4PKRA 3DSLA 3DTIA 4DF9A 3HY7A 1XFZA 3DTEA 5D7WA 1D8MA 1D8FA 3KHIA 4I35A 2W12A 2E3XA 2FV5A 1O0QA 2OY2A 3OHOA 4IN9A 1PWUA 1XURA 1JIWP 2W15A 5LABA 4A3WA 1Z3JA 1I76A 1XFUA 456CA 1USNA 1R1HA 2Y6CA 3KMEA 3TT4A 1GE6A 5L7FA 1BM6A 1BKCI 3AYUA 4PKVA 3HB2P 3TVCA 3AIGA 1UEAA 2CLTA 1MMQA 4WKIA 2OZRA 1FM1A 4H1QA 1MMPA 1KUHA 3LIKA 1K7QA 3L0VA 3KEJA 2WO9A 4L19A 1Q3AA 1UTTA 1SLMA 1RMZA 1Y8JA 4GR0A 3VTGA 1R1IA 3F19A 2DW0A 1MNCA 3K7LA 1JANA 4HMAA 1SLNA 1QICA 4IJOA 3B92A 1ZXCA 5D1SA 1KUGA 2DDFA 1JAOA 3SHIA 1ROSA 2I47A 3EDGA 1QIBA 2J83A 2USNA 3G42A 1YP1A 3E8RA 2YIGA 2YB9A 4FXYP 1BUDA 4XM7A 1K7GA 1GO8P 1KBCA 1O0TA 1UTZA 2W0DA 1G05A 5D2BA 2OVXA 4R3VA 2QPJA 5BOYA 3N2UA 5D1UA 3DNGA 2MZHA 4H3XA 4WK7A 1DTHA 1CIZA 2E2DA 4G0DA 3V96B 4AIGA 3ZXHA 3P1VA 1HFCA 3HDAP 2TCLA 5BPAA 2DW1A 1S4BP 2J0TA 1IACA 3I7IA 3LILA 1BUVM 1BQOA 3CKIA 3EHXA 2ERQA 2A8HA 1ZP5A 1CAQA 4Q1LA 3KRYA 4WZVA 5I2ZA 2K2GA 1GO7P 3DPEA 1AF0A 1GE7A 1BKCA 1L6JA 4GQLA 3EDIA 3UVCA 4JPAA 2D1OA 3MA2A 1AYKA 2W13A 2OVZA 1IADA 2FV9A 3AYKA 3DPFA 1PWQA 1ATLA 3EWJA 1C8TA 1JJ9A 1GXDA 4H49A 4WF6A 1XFYA 3B2ZA 1YQYA 3HYGA 4XBHA 1ZTQA 2OXUA 5CZMA 1R54A 5I3MA 3RTTA 1R55A 3TSKA 5I43A 3BA0A 4FU4A 1XFXA 4GUYA 2OW2A 1HTDA 1GKCA 2MLSA 3I7GA 4H76A 4AYKA 4AUOA 1BSWA 1UMSA 4DD8A 4H30A 1SU3A 1ZS0A 5D1TA 4GWNA 5JMYA 1XFVA 3WV2A 2X3AA 3TS4A 2Z2DA 5I4OA 4H84A 1QJIA 2CKIA 1GE5A 1PWVA 1HV5A 2ERPA 1ZXVA 1CGFA 4CTHA 3O2XA 2XS3A 3N2VA 1D5JA 4FVLA 4JQGA 2OY4A 3KMCA 1RM8A 3LJZA 1MMRA 1R1JA 1JH1A 3WV1A 2JIHA 3OHLA 1XUDA 3EDZA 1A85A 3B8ZA 4HX3A 1J7NA 1HOVA 2JSDA 1YCMA 2W14A 2X3BA 2XS4A 3EDHA 4JA1A 2YUFA 2RJQA 3LE9A 1Y93A 2WO8A 4GF1A 1G4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L63 A;  1C3I A;  1OS9 A;  3USN A;  4ZR5 A;  3Q2G A;  2DW2 A;  3VI1 A;  1SMP A;  4A7B A;  3LK8 A;  3F16 A;  2JNP A;  3KEK A;  4AXQ A;  3LUN A;  3LJT A;  3ZUK A;  2MLR A;  2OW1 A;  2HU6 A;  1DMT A;  4PKS A;  2PJT A;  3F1A A;  1C7K A;  2DDY A;  1G12 A;  1WNI A;  5H8X A;  1CXV A;  830C A;  2O36 A;  1OS2 A;  5L79 A;  3LKA A;  3F15 A;  1I73 A;  3LGP A;  1SAT A;  3LQ0 A;  3ZVS A;  3LJG A;  3HBU P;  4DPE A;  1FBL A;  1CGL A;  2V4B A;  1IAE A;  5CUH A;  1QJJ A;  3ELM A;  2D1N A;  4PKW A;  1BQQ M;  1I1I P;  4WKE A;  5B5O A;  3HY9 A;  1UMT A;  4IUW A;  1OM7 A;  1BIW A;  4ON1 A;  2KRJ A;  4FXQ A;  1JKY A;  1ZVX A;  2OI0 A;  4QKZ A;  3U1R A;  3F18 A;  1BKC E;  3GBO A;  1YOU A;  1CQR A;  2O3E A;  1EUB A;  3DWB A;  1XFW A;  1BZS A;  3F17 A;  1B3D A;  1MMB A;  5B5P A;  1H71 P;  5I12 A;  1B8Y A;  1OO9 A;  3LQB A;  4EFS A;  2X7M A;  1G9K A;  1GKD A;  1QIA A;  2WOA A;  1HFS A;  4PKT A;  3NX7 A;  966C A;  1Y0V A;  1KUK A;  5D3C A;  3LUM A;  2OXW A;  4J4M A;  1D7X A;  3K7N A;  3EHY A;  3O64 A;  4H2E A;  5BOT A;  4H82 A;  1HY7 A;  3LIR A;  2N8R A;  2X3C A;  1OMJ A;  1IAB A;  1A86 A;  1FLS A;  1IAG A;  1IAA A;  4XM6 A;  2SRT A;  1KUF A;  1AKL A;  1PWW A;  4PKU A;  2OXZ A;  4L6T A;  1JIZ A;  3KEC A;  3Q2H A;  1OM6 A;  2AIG P;  1JAP A;  4JP4 A;  1QUA A;  1KUI A;  4XM8 A;  2L0R A;  4GR8 A;  1CGE A;  4ILW D;  3L0T A;  2POJ A;  1PWP A;  1ND1 A;  4XCT A;  2OW0 A;  1G49 A;  2AYK A;  3LEA A;  1JAQ A;  4GR3 A;  1K7I A;  1SRP A;  3HDB A;  5I0L A;  5CXA A;  4GWM A;  4I03 A;  3WV3 A;  1CK7 A;  1EB6 A;  2ERO A;  3KWV C;  1KAP P;  3RTS A;  2MZE A;  1AST A;  1OM8 A;  2JT5 A;  2Y6D A;  3HBV P;  2RJP A;  1JK3 A;  1EAK A;  4PKQ A;  3LMC A;  4G9L A;  2K9C A;  3DL1 A;  4DV8 A;  3P24 A;  2MZI A;  3G5C A;  2JT6 A;  4JIJ A;  2OW9 A;  1XUC A;  4PKR A;  3DSL A;  4DF9 A;  3HY7 A;  1XFZ A;  5D7W A;  1D8M A;  1D8F A;  3KHI A;  4I35 A;  2W12 A;  2E3X A;  2FV5 A;  1O0Q A;  2OY2 A;  3OHO A;  4IN9 A;  1PWU A;  1XUR A;  1JIW P;  2W15 A;  5LAB A;  4A3W A;  1Z3J A;  1I76 A;  1XFU A;  456C A;  1USN A;  1R1H A;  2Y6C A;  3KME A;  3TT4 A;  1GE6 A;  5L7F A;  1BM6 A;  1BKC I;  3AYU A;  4PKV A;  3HB2 P;  3TVC A;  3AIG A;  1UEA A;  2CLT A;  1MMQ A;  4WKI A;  2OZR A;  1FM1 A;  4H1Q A;  1MMP A;  1KUH A;  3LIK A;  1K7Q A;  3L0V A;  3KEJ A;  2WO9 A;  4L19 A;  1Q3A A;  1UTT A;  1SLM A;  1RMZ A;  1Y8J A;  4GR0 A;  3VTG A;  1R1I A;  3F19 A;  2DW0 A;  1MNC A;  3K7L A;  1JAN A;  4HMA A;  1SLN A;  1QIC A;  4IJO A;  3B92 A;  1ZXC A;  5D1S A;  1KUG A;  2DDF A;  1JAO A;  3SHI A;  1ROS A;  2I47 A;  3EDG A;  1QIB A;  2J83 A;  2USN A;  3G42 A;  1YP1 A;  3E8R A;  2YIG A;  2YB9 A;  4FXY P;  1BUD A;  4XM7 A;  1K7G A;  1GO8 P;  1KBC A;  1O0T A;  1UTZ A;  2W0D A;  1G05 A;  5D2B A;  2OVX A;  4R3V A;  2QPJ A;  5BOY A;  3N2U A;  5D1U A;  3DNG A;  2MZH A;  4H3X A;  4WK7 A;  1DTH A;  1CIZ A;  2E2D A;  4G0D A;  3V96 B;  4AIG A;  3ZXH A;  3P1V A;  1HFC A;  3HDA P;  2TCL A;  5BPA A;  2DW1 A;  1S4B P;  2J0T A;  1IAC A;  3I7I A;  3LIL A;  1BUV M;  1BQO A;  3CKI A;  3EHX A;  2ERQ A;  2A8H A;  1ZP5 A;  1CAQ A;  4Q1L A;  3KRY A;  4WZV A;  5I2Z A;  2K2G A;  1GO7 P;  3DPE A;  1AF0 A;  1GE7 A;  1BKC A;  1L6J A;  4GQL A;  3EDI A;  3UVC A;  4JPA A;  2D1O A;  3MA2 A;  1AYK A;  2W13 A;  2OVZ A;  1IAD A;  2FV9 A;  3AYK A;  3DPF A;  1PWQ A;  1ATL A;  3EWJ A;  1C8T A;  1JJ9 A;  1GXD A;  4H49 A;  4WF6 A;  1XFY A;  3B2Z A;  1YQY A;  3HYG A;  4XBH A;  1ZTQ A;  2OXU A;  5CZM A;  1R54 A;  5I3M A;  3RTT A;  1R55 A;  3TSK A;  5I43 A;  3BA0 A;  4FU4 A;  1XFX A;  4GUY A;  2OW2 A;  1HTD A;  1GKC A;  2MLS A;  3I7G A;  4H76 A;  4AYK A;  4AUO A;  1BSW A;  1UMS A;  4DD8 A;  4H30 A;  1SU3 A;  1ZS0 A;  5D1T A;  4GWN A;  5JMY A;  1XFV A;  3WV2 A;  2X3A A;  3TS4 A;  2Z2D A;  5I4O A;  4H84 A;  1QJI A;  2CKI A;  1GE5 A;  1PWV A;  1HV5 A;  2ERP A;  1ZXV A;  1CGF A;  4CTH A;  3O2X A;  2XS3 A;  3N2V A;  1D5J A;  4FVL A;  4JQG A;  2OY4 A;  3KMC A;  1RM8 A;  3LJZ A;  1MMR A;  1R1J A;  1JH1 A;  3WV1 A;  2JIH A;  3OHL A;  1XUD A;  3EDZ A;  1A85 A;  3B8Z A;  4HX3 A;  1J7N A;  1HOV A;  2JSD A;  1YCM A;  2W14 A;  2X3B A;  2XS4 A;  3EDH A;  4JA1 A;  2RJQ A;  3LE9 A;  1Y93 A;  2WO8 A;  4GF1 A;  1G4K A; 
#chains in the Genus database with same CATH topology
 4L63 A;  1C3I A;  1OS9 A;  3USN A;  4ZR5 A;  3Q2G A;  2DW2 A;  3VI1 A;  1SMP A;  4A7B A;  3LK8 A;  3F16 A;  2JNP A;  3KEK A;  4AXQ A;  3LUN A;  3LJT A;  3ZUK A;  2MLR A;  2OW1 A;  2HU6 A;  1DMT A;  4PKS A;  2PJT A;  3F1A A;  1C7K A;  2DDY A;  1G12 A;  1WNI A;  5H8X A;  1CXV A;  830C A;  2O36 A;  1OS2 A;  5L79 A;  3LKA A;  3F15 A;  1I73 A;  4L7A A;  3LGP A;  1SAT A;  3LQ0 A;  1XAX A;  3ZVS A;  3LJG A;  3HBU P;  4DPE A;  1FBL A;  1CGL A;  2V4B A;  1IAE A;  5CUH A;  1QJJ A;  3ELM A;  2D1N A;  4PKW A;  1BQQ M;  1I1I P;  4WKE A;  5B5O A;  3HY9 A;  1UMT A;  4IUW A;  1OM7 A;  1BIW A;  4ON1 A;  2KRJ A;  4FXQ A;  1JKY A;  1ZVX A;  2OI0 A;  4QKZ A;  3U1R A;  3F18 A;  1BKC E;  3GBO A;  1YOU A;  1CQR A;  2O3E A;  1EUB A;  3DWB A;  1XFW A;  1BZS A;  3F17 A;  1B3D A;  1MMB A;  5B5P A;  1H71 P;  5I12 A;  1B8Y A;  1OO9 A;  3LQB A;  4EFS A;  2X7M A;  1G9K A;  1GKD A;  1QIA A;  2WOA A;  1HFS A;  4PKT A;  1OZ9 A;  3NX7 A;  966C A;  1Y0V A;  1KUK A;  5D3C A;  3LUM A;  2OXW A;  4J4M A;  1D7X A;  3K7N A;  3EHY A;  3O64 A;  4H2E A;  5BOT A;  4H82 A;  1HY7 A;  3LIR A;  2N8R A;  2X3C A;  1OMJ A;  1IAB A;  1A86 A;  1FLS A;  1IAG A;  1IAA A;  4XM6 A;  2SRT A;  1KUF A;  1AKL A;  1PWW A;  4PKU A;  2OXZ A;  4L6T A;  1JIZ A;  3KEC A;  3Q2H A;  1OM6 A;  2AIG P;  1JAP A;  4JP4 A;  1QUA A;  1KUI A;  4XM8 A;  2L0R A;  4GR8 A;  1CGE A;  4ILW D;  3L0T A;  2POJ A;  1PWP A;  1ND1 A;  4XCT A;  2OW0 A;  1G49 A;  2AYK A;  3LEA A;  1JAQ A;  4GR3 A;  1K7I A;  1SRP A;  3HDB A;  5I0L A;  5CXA A;  4GWM A;  4I03 A;  3WV3 A;  1CK7 A;  1EB6 A;  2ERO A;  3KWV C;  1KAP P;  3RTS A;  2MZE A;  3DTK A;  1AST A;  1OM8 A;  2JT5 A;  2Y6D A;  3HBV P;  2RJP A;  1JK3 A;  1EAK A;  4PKQ A;  3LMC A;  4G9L A;  2K9C A;  3DL1 A;  4DV8 A;  3P24 A;  2MZI A;  3G5C A;  2JT6 A;  4JIJ A;  2OW9 A;  1XUC A;  4PKR A;  3DSL A;  3DTI A;  4DF9 A;  3HY7 A;  1XFZ A;  3DTE A;  5D7W A;  1D8M A;  1D8F A;  3KHI A;  4I35 A;  2W12 A;  2E3X A;  2FV5 A;  1O0Q A;  2OY2 A;  3OHO A;  4IN9 A;  1PWU A;  1XUR A;  1JIW P;  2W15 A;  5LAB A;  4A3W A;  1Z3J A;  1I76 A;  1XFU A;  456C A;  1USN A;  1R1H A;  2Y6C A;  3KME A;  3TT4 A;  1GE6 A;  5L7F A;  1BM6 A;  1BKC I;  3AYU A;  4PKV A;  3HB2 P;  3TVC A;  3AIG A;  1UEA A;  2CLT A;  1MMQ A;  4WKI A;  2OZR A;  1FM1 A;  4H1Q A;  1MMP A;  1KUH A;  3LIK A;  1K7Q A;  3L0V A;  3KEJ A;  2WO9 A;  4L19 A;  1Q3A A;  1UTT A;  1SLM A;  1RMZ A;  1Y8J A;  4GR0 A;  3VTG A;  1R1I A;  3F19 A;  2DW0 A;  1MNC A;  3K7L A;  1JAN A;  4HMA A;  1SLN A;  1QIC A;  4IJO A;  3B92 A;  1ZXC A;  5D1S A;  1KUG A;  2DDF A;  1JAO A;  3SHI A;  1ROS A;  2I47 A;  3EDG A;  1QIB A;  2J83 A;  2USN A;  3G42 A;  1YP1 A;  3E8R A;  2YIG A;  2YB9 A;  4FXY P;  1BUD A;  4XM7 A;  1K7G A;  1GO8 P;  1KBC A;  1O0T A;  1UTZ A;  2W0D A;  1G05 A;  5D2B A;  2OVX A;  4R3V A;  2QPJ A;  1XM5 A;  5BOY A;  3N2U A;  5D1U A;  3DNG A;  2MZH A;  4H3X A;  4WK7 A;  1DTH A;  1CIZ A;  2E2D A;  4G0D A;  3V96 B;  4AIG A;  3ZXH A;  3P1V A;  1HFC A;  3HDA P;  2TCL A;  5BPA A;  2DW1 A;  1S4B P;  1TVI A;  2J0T A;  1IAC A;  3I7I A;  3LIL A;  1BUV M;  1BQO A;  3CKI A;  3EHX A;  2ERQ A;  2A8H A;  1ZP5 A;  1CAQ A;  4Q1L A;  3KRY A;  4WZV A;  5I2Z A;  2K2G A;  1GO7 P;  3DPE A;  1AF0 A;  1GE7 A;  1BKC A;  1L6J A;  4GQL A;  3EDI A;  3UVC A;  4JPA A;  2D1O A;  3MA2 A;  1AYK A;  2W13 A;  2OVZ A;  1IAD A;  2FV9 A;  3AYK A;  3DPF A;  1PWQ A;  1ATL A;  3EWJ A;  1C8T A;  1JJ9 A;  1GXD A;  4H49 A;  4WF6 A;  1XFY A;  3B2Z A;  1YQY A;  3HYG A;  4XBH A;  1ZTQ A;  2OXU A;  5CZM A;  1R54 A;  5I3M A;  3RTT A;  1R55 A;  3TSK A;  5I43 A;  3BA0 A;  4FU4 A;  1XFX A;  4GUY A;  2OW2 A;  1HTD A;  1GKC A;  2MLS A;  3I7G A;  4H76 A;  4AYK A;  4AUO A;  1BSW A;  1UMS A;  4DD8 A;  4H30 A;  1SU3 A;  1ZS0 A;  5D1T A;  4GWN A;  5JMY A;  1XFV A;  3WV2 A;  2X3A A;  3TS4 A;  2Z2D A;  5I4O A;  4H84 A;  1QJI A;  2CKI A;  1GE5 A;  1PWV A;  1HV5 A;  2ERP A;  1ZXV A;  1CGF A;  4CTH A;  3O2X A;  2XS3 A;  3N2V A;  1D5J A;  4FVL A;  4JQG A;  2OY4 A;  3KMC A;  1RM8 A;  1MMR A;  3LJZ A;  1R1J A;  1JH1 A;  3WV1 A;  2JIH A;  3OHL A;  1XUD A;  3EDZ A;  1A85 A;  3B8Z A;  4HX3 A;  1J7N A;  1HOV A;  2JSD A;  1YCM A;  2W14 A;  2X3B A;  2XS4 A;  3EDH A;  4JA1 A;  2YUF A;  2RJQ A;  3LE9 A;  1Y93 A;  2WO8 A;  4GF1 A;  1G4K A; 
#chains in the Genus database with same CATH homology
 4L63 A;  1C3I A;  1OS9 A;  3USN A;  4ZR5 A;  3Q2G A;  2DW2 A;  3VI1 A;  1SMP A;  4A7B A;  3LK8 A;  3F16 A;  2JNP A;  3KEK A;  4AXQ A;  3LUN A;  3LJT A;  3ZUK A;  2MLR A;  2OW1 A;  2HU6 A;  1DMT A;  4PKS A;  2PJT A;  3F1A A;  1C7K A;  2DDY A;  1G12 A;  1WNI A;  5H8X A;  1CXV A;  830C A;  2O36 A;  1OS2 A;  5L79 A;  3LKA A;  3F15 A;  1I73 A;  4L7A A;  3LGP A;  1SAT A;  3LQ0 A;  3ZVS A;  3LJG A;  3HBU P;  4DPE A;  1FBL A;  1CGL A;  2V4B A;  1IAE A;  5CUH A;  1QJJ A;  3ELM A;  2D1N A;  4PKW A;  1BQQ M;  1I1I P;  4WKE A;  5B5O A;  3HY9 A;  1UMT A;  4IUW A;  1OM7 A;  1BIW A;  4ON1 A;  2KRJ A;  4FXQ A;  1JKY A;  1ZVX A;  2OI0 A;  4QKZ A;  3U1R A;  3F18 A;  1BKC E;  3GBO A;  1YOU A;  1CQR A;  2O3E A;  1EUB A;  3DWB A;  1XFW A;  1BZS A;  3F17 A;  1B3D A;  1MMB A;  5B5P A;  1H71 P;  5I12 A;  1B8Y A;  1OO9 A;  3LQB A;  4EFS A;  2X7M A;  1G9K A;  1GKD A;  1QIA A;  2WOA A;  1HFS A;  4PKT A;  3NX7 A;  966C A;  1Y0V A;  1KUK A;  5D3C A;  3LUM A;  2OXW A;  4J4M A;  1D7X A;  3K7N A;  3EHY A;  3O64 A;  4H2E A;  5BOT A;  4H82 A;  1HY7 A;  3LIR A;  2N8R A;  2X3C A;  1OMJ A;  1IAB A;  1A86 A;  1FLS A;  1IAG A;  1IAA A;  4XM6 A;  2SRT A;  1KUF A;  1AKL A;  1PWW A;  4PKU A;  2OXZ A;  4L6T A;  1JIZ A;  3KEC A;  3Q2H A;  1OM6 A;  2AIG P;  1JAP A;  4JP4 A;  1QUA A;  1KUI A;  4XM8 A;  2L0R A;  4GR8 A;  1CGE A;  4ILW D;  3L0T A;  2POJ A;  1PWP A;  1ND1 A;  4XCT A;  2OW0 A;  1G49 A;  2AYK A;  3LEA A;  1JAQ A;  4GR3 A;  1K7I A;  1SRP A;  3HDB A;  5I0L A;  5CXA A;  4GWM A;  4I03 A;  3WV3 A;  1CK7 A;  1EB6 A;  2ERO A;  3KWV C;  1KAP P;  3RTS A;  2MZE A;  3DTK A;  1AST A;  1OM8 A;  2JT5 A;  2Y6D A;  3HBV P;  2RJP A;  1JK3 A;  1EAK A;  4PKQ A;  3LMC A;  4G9L A;  2K9C A;  3DL1 A;  4DV8 A;  3P24 A;  2MZI A;  3G5C A;  2JT6 A;  4JIJ A;  2OW9 A;  1XUC A;  4PKR A;  3DSL A;  3DTI A;  4DF9 A;  3HY7 A;  1XFZ A;  3DTE A;  5D7W A;  1D8M A;  1D8F A;  3KHI A;  4I35 A;  2W12 A;  2E3X A;  2FV5 A;  1O0Q A;  2OY2 A;  3OHO A;  4IN9 A;  1PWU A;  1XUR A;  1JIW P;  2W15 A;  5LAB A;  4A3W A;  1Z3J A;  1I76 A;  1XFU A;  456C A;  1USN A;  1R1H A;  2Y6C A;  3KME A;  3TT4 A;  1GE6 A;  5L7F A;  1BM6 A;  1BKC I;  3AYU A;  4PKV A;  3HB2 P;  3TVC A;  3AIG A;  1UEA A;  2CLT A;  1MMQ A;  4WKI A;  2OZR A;  1FM1 A;  4H1Q A;  1MMP A;  1KUH A;  3LIK A;  1K7Q A;  3L0V A;  3KEJ A;  2WO9 A;  4L19 A;  1Q3A A;  1UTT A;  1SLM A;  1RMZ A;  1Y8J A;  4GR0 A;  3VTG A;  1R1I A;  3F19 A;  2DW0 A;  1MNC A;  3K7L A;  1JAN A;  4HMA A;  1SLN A;  1QIC A;  4IJO A;  3B92 A;  1ZXC A;  5D1S A;  1KUG A;  2DDF A;  1JAO A;  3SHI A;  1ROS A;  2I47 A;  3EDG A;  1QIB A;  2J83 A;  2USN A;  3G42 A;  1YP1 A;  3E8R A;  2YIG A;  2YB9 A;  4FXY P;  1BUD A;  4XM7 A;  1K7G A;  1GO8 P;  1KBC A;  1O0T A;  1UTZ A;  2W0D A;  1G05 A;  5D2B A;  2OVX A;  4R3V A;  2QPJ A;  5BOY A;  3N2U A;  5D1U A;  3DNG A;  2MZH A;  4H3X A;  4WK7 A;  1DTH A;  1CIZ A;  2E2D A;  4G0D A;  3V96 B;  4AIG A;  3ZXH A;  3P1V A;  1HFC A;  3HDA P;  2TCL A;  5BPA A;  2DW1 A;  1S4B P;  2J0T A;  1IAC A;  3I7I A;  3LIL A;  1BUV M;  1BQO A;  3CKI A;  3EHX A;  2ERQ A;  2A8H A;  1ZP5 A;  1CAQ A;  4Q1L A;  3KRY A;  4WZV A;  5I2Z A;  2K2G A;  1GO7 P;  3DPE A;  1AF0 A;  1GE7 A;  1BKC A;  1L6J A;  4GQL A;  3EDI A;  3UVC A;  4JPA A;  2D1O A;  3MA2 A;  1AYK A;  2W13 A;  2OVZ A;  1IAD A;  2FV9 A;  3AYK A;  3DPF A;  1PWQ A;  1ATL A;  3EWJ A;  1C8T A;  1JJ9 A;  1GXD A;  4H49 A;  4WF6 A;  1XFY A;  3B2Z A;  1YQY A;  3HYG A;  4XBH A;  1ZTQ A;  2OXU A;  5CZM A;  1R54 A;  5I3M A;  3RTT A;  1R55 A;  3TSK A;  5I43 A;  3BA0 A;  4FU4 A;  1XFX A;  4GUY A;  2OW2 A;  1HTD A;  1GKC A;  2MLS A;  3I7G A;  4H76 A;  4AYK A;  4AUO A;  1BSW A;  1UMS A;  4DD8 A;  4H30 A;  1SU3 A;  1ZS0 A;  5D1T A;  4GWN A;  5JMY A;  1XFV A;  3WV2 A;  2X3A A;  3TS4 A;  2Z2D A;  5I4O A;  4H84 A;  1QJI A;  2CKI A;  1GE5 A;  1PWV A;  1HV5 A;  2ERP A;  1ZXV A;  1CGF A;  4CTH A;  3O2X A;  2XS3 A;  3N2V A;  1D5J A;  4FVL A;  4JQG A;  2OY4 A;  3KMC A;  1RM8 A;  3LJZ A;  1MMR A;  1R1J A;  1JH1 A;  3WV1 A;  2JIH A;  3OHL A;  1XUD A;  3EDZ A;  1A85 A;  3B8Z A;  4HX3 A;  1J7N A;  1HOV A;  2JSD A;  1YCM A;  2W14 A;  2X3B A;  2XS4 A;  3EDH A;  4JA1 A;  2YUF A;  2RJQ A;  3LE9 A;  1Y93 A;  2WO8 A;  4GF1 A;  1G4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...