5H94A

Crystal structure of swine mhc classi for 1.48 angstroms
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
275
Chain Sequence
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDSDAPNPREEPRAPWIQQEGQEYWDRETQISKDNAQTYRVNLNNLRGYYNQSEAGSHTFQNMYGCYLGPDGLLLHGYHQYAYDGADYIALNEDLRSWTAADTAAQITKRKWEASGWAEQERSYLQGLCVESLREYLEMGKDTLQRAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title Structural and Biochemical Analyses of Swine Major Histocompatibility Complex Class I Complexes and Prediction of the Epitope Map of Important Influenza A Virus Strains
pubmed doi rcsb
source organism Sus scrofa
molecule tags Immune system
total genus 76
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h94A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5h94A01
2HG5A 4K23L 1FHGA 1ROWA 3CX2A 4JPVH 2C5DC 1HQRA 4V1DB 4F3FA 3O41B 3GJFB 4HPOL 4WU5A 1HE7A 5F7WC 1PG7X 2HWZL 2BERA 1CGXA 3MV9E 1FLRH 5H35B 1SY6L 1MELA 4WTXA 4HT1H 1M1SA 3H6JA 1KXVC 1HH6A 4UBDD 1RJCA 4LLUB 2OYPA 2BRQA 3NABH 4ZAKD 5EPMA 2BCKA 3BOVA 3OR7B 1U0QA 4NO0D 1YEDA 3MLUL 3VE0B 1U8IB 1EO7A 1WZMA 4UNUA 5FYKD 4L9DA 4AEHH 1NPUA 1WVZA 4XMKL 1N6VA 1SEQH 3DNKA 2B7DT 1MFBL 2PYEE 5EFIA 5I8OH 3L7EA 5GRUH 4PY7A 4WGWB 5CZXD 1BM3L 4TNWK 3FQNA 2VQUA 3ZKQD 1G9NC 3UJIL 1MCHA 4YDLC 3VH8B 5IB2A 3REVA 2DQDL 2YBRA 4PLJC 1OF2B 3ZKSD 4ZS7L 3KAAA 4JKLA 5HHOD 1XF5B 1OGAA 5IMOB 3ZDYF 3FCTB 4J1UA 2V7HA 2R1XB 2I9TA 4Z7WA 3BQUC 1UJ3B 5E1AA 2P8LA 4NQXB 1CGTA 1T7VA 4HUVB 1RIUH 4N90E 5KVMC 2I60L 2W9EL 2OP4L 3CLFL 4HF5L 5I1JH 1MRFH 5GS0C 3BN9C 4POUB 5DA4A 3KPLB 1QBML 1JPFB 5I2IB 3AC0A 4WO4B 1GC1C 3AXLB 3TIEA 3LN5B 2ATKB 5E8DL 2UVEA 5LAXB 3MV9B 4DGYH 4OIBA 5ID1A 2A1WH 1F42A 5CEYB 1W0WA 2GJ6E 4JHBA 2ORBH 5EIQA 3MFFA 4LLDA 4LVNB 1AHWC 4X9FA 3MLYL 3BISA 1U92B 2WIMA 3RWDA 3MZTA 4DAGH 3GIZL 4XC3L 1GZQA 5DHVB 3GJFH 3EYQD 5I1AB 3ORJA 7FABL 3U9PH 2GTZB 3FRUA 1OAUL 2XTJD 1IC5L 4MLSA 1QSED 2XZAL 5D5MA 2MPAL 2VQ1A 2X4UB 4RAVB 2X10A 3TYGL 4OM1L 5DC0A 1FYTE 1NC4A 3MJ7A 3CVHA 1DDHA 4Q6IC 1AE6H 3HZYB 3QWOB 1CFNB 4JDTH 3SOBH 1DN0A 3ULUH 5DR5H 4OI8A 4JREC 3V8CA 3QRFM 4P4KB 3QXDA 1U8QA 2H32A 4NC1E 5MEQB 5JHDE 3VXPB 2HT3D 1N7ML 5E8OA 3ULVD 4BZ2H 4IDJL 2D4DA 2J12B 4QRQB 5E2WH 1HHJA 4GRLC 4P9ML 2AABL 3ZHDA 4XB8A 4TTDC 4FMFA 4KRNA 4W81A 1KENL 1JNHB 1NCCL 2R39A 2X44D 1T7XA 4GXUN 3RAJL 4OQTL 1ES0B 2LU7A 1S7WB 1E27A 4DUWA 3PABB 2GJ6B 2VXTH 1JWSB 2C26A 1IKFL 5HYJE 4EI5C 5ALCH 4UIKL 3BHBA 4XCYB 3UX9B 1QUNA 2OI9B 4FQCH 4RGMB 3G5VA 4OGXH 1S78C 5AWNH 1X5ZA 4B5EA 1S9XB 1EEYA 3X11A 1MQKH 1K8DA 3VXMB 2J1KA 4KQ4H 3WNLA 2HYMA 4M1GH 5HHNA 3IJSA 1YJDL 1MAMH 3IU3A 1EHAA 3VXUE 5EZLA 4YFLI 5ID0B 1CLYL 1B6UA 1T1YB 3WHE1 1ND0A 5DHVH 4U6TA 5FOJA 2MHAA 2LV4A 3FB7A 3GM0A 3QHTC 4ZSOA 3QEGH 5DJDA 2AJ3A 3JWOC 5L2JA 4OV5B 1IAII 3VMPA 2XOTA 3GKWL 3K4AA 4M6NL 3P4NA 5TE6L 1T2QL 4IOIB 4JQXA 4Y5YB 3SO3C 3D69B 1DLHA 1NC2A 5GGRY 4DUVA 5E4EB 1H3TA 1Q9OA 2YUXA 4JZOA 2XG4A 3S7GA 3GHBL 1A3LL 3OG4B 4U1LB 3VFTA 3LVEA 1KELL 2YPLA 5C0FB 3KG5A 4PJCF 1BD2B 4DTGL 4LSUH 4LRIC 3F65A 4MA8L 1PYWA 3IF1A 3RNQA 4ZUTA 3V6ZB 1XR8B 2FATL 2I07B 1EAPA 5HYJB 3QXUA 3VFNA 1KCSL 2A73B 2OXHA 1HCFX 3W81A 1QR4A 1F6FB 3IDIA 4QRUB 4A2LA 1NCAL 2AK4E 2NY5L 5C6TH 3PGDB 3VCLB 1IEAB 2R23A 3BMWA 5T3ZD 3BGAA 1HXMA 2BSED 4K3DH 4K7PH 1IAOB 3U1SL 3CXHJ 4NQUA 4YHIB 1GGIH 4FQLH 5IW1A 4NC2B 4QOKB 2H2SC 1MLCA 3V4VH 3O8XD 4M93B 4Y2DC 3HNSH 1CXLA 4ODWA 3E8UL 5CKAA 4HS3B 4S1QH 1YC8A 2WLYA 4N0YL 1ZVSB 3MLVH 2O5ZH 1IJ9A 3O4LD 3QBTB 4PB0L 3WLWD 5INCB 3RL2A 2MCPH 4ZAKC 3MRCB 4JFDE 4F8QA 3U4EA 4TSAH 1AH1A 2E5EA 3L7FA 5I15L 2AJSL 2OS7A 4S1RL 1NGZB 3W11C 5IB3A 2DN7A 4JPKL 4HLJA 1X5IA 4PRBA 3LKNB 5IEHB 4XCFL 5ENWB 3TBWA 4HIHB 4JGMA 4OZFA 5CD5D 3RNKA 2Z93B 3DGGB 1D7FA 4WY7H 3DROA 3RVTD 3S34H 3EOTH 1HHIA 3QRGH 4PD4J 4Z0BH 3RKDC 2RIKA 4X5LA 3RWHB 4K8RC 1DVFD 5TQ0H 4KMTL 2PXYC 3BWAA 4J4PC 1RUMH 4JANA 4JHAH 4FA8A 3MRHA 5CP7B 5DD5H 3GI8L 5I1GH 5KVFL 4D3CL 5IESL 3QJHA 2BK8A 3SCMC 2WM0A 3ARRA 5HVHB 2AJYL 1YPZB 4QHKJ 2YA2A 4KK6D 4PJGB 5ICZA 1G9MH 4IRZH 5I74B 4WV1B 1CE1L 2GTWA 3BUYB 4HS6A 3MBXL 4EVNB 1Z3GL 3CD4A 3QEHA 1FFOB 3HE6C 1MJJB 1A7OL 1FIGH 2V17H 4DZ8A 4YHKH 3N1QC 4F2MA 4XAWH 3I2CH 2OJZH 3TBYA 3BP4A 4JRXE 3M1BA 4OD1H 4D9RE 4PY8I 5HY9B 2KH2B 1D5IH 3MROB 2ADFH 4L1DA 3HI6H 5C0DB 1MSPA 4Y8AA 3NCYS 5CKGA 3B5GA 4DKEH 4UQ3B 4XNMA 3TCLB 3Q6GH 2PCPB 4WUUB 5FUOH 3CUPB 3K0WA 2VH5H 4H1LB 4PRNA 3T0DA 2Z31D 2LFGA 1TVBA 2CIIA 2XTJC 3D85B 1PVHA 3QDHA 2I5YH 3ZTNH 2DTML 4MJIB 4NKOB 1OAXL 5IWLC 2X09A 4KGLA 2Y6SD 3VWJD 5FGCB 2Q3ZA 4P5KB 5DT1H 1C5CH 1IZJA 2LAAA 2VLJE 5BW7C 1NCTA 3X12A 1JRHL 1UYWH 1YMHA 3I6GB 4I8DA 3MLSH 1JUFA 1OW0A 5E2VL 4BQ9A 3P9LA 3PP3H 3C8DA 5EZJB 1EXUB 5C09D 2UZIL 5DJXA 3WUWG 4RQQA 3MRFA 2XWJB 1HI6A 5C7XH 1B4RA 1VCAA 4PJ8C 1B4JH 2O61B 3EYUL 2XWBA 3WN5B 5JOEA 1OTTD 4R97C 1EBPA 3RRQA 2VERN 5IMLB 5I1DB 1GAFL 4LNVA 1JWUA 5A2JH 2YD4A 3NMEA 4MNGB 2AI0H 3TJHA 4JRXB 3T4AA 2EDJA 1RZKH 3QUMH 4Y5VA 1KACB 1MEXL 3AB0C 3NAAL 3WNNA 3LD8C 1CDHA 1ITBB 3BDXA 1Z9MA 3KYMB 4BSWA 4PRIE 1OP9A 1U8MA 4RRPA 4FG6D 3P0YH 5GRJH 4HFUL 1XT5A 3SDAA 3QUYD 4LPXA 4LCWA 1GVIA 2XZCL 4J3TA 3FQTA 4M48H 3BJ91 4XP1H 5I1CL 2Y7QB 3LCYA 3JTTB 4NM8L 4J3VA 2AJVH 4M00A 3IVKA 4FQPA 1SYVB 1PX3A 4PJXB 4S2SA 4LQ1A 3U83A 1SHMA 4H1LH 4KI5E 1R5IB 3EKCA 4Z7OE 1SYSA 3MLTB 4R90L 5EOCL 4I77L 1HYSD 1NBZA 4YHMH 5FKAB 5F6IB 3K2UL 2DLGA 1RZFL 4G42A 3PL6B 4PJEA 5I6XB 4HH9A 3TPUA 1A7BA 3M45A 1YNTB 3TZVB 4OZGE 1C7TA 4G8FB 4MZ3A 2ZUQB 3WNKA 4PV9A 4PDCE 5C08D 2CLVB 2EDEA 2Y36L 5EUOF 2FLRT 1FL5B 2N1KA 3RJQB 4XCCL 1LD9A 1X9QA 1YEJH 4JR9H 5E6IB 5I71C 4S10A 1X3DA 1MIEH 4FN0A 4P2RE 3MRPB 3BPLB 5CHNA 4RNRB 4FFEX 1S5IL 1K6QH 2HTKC 2HWZH 5BS0B 3MRQA 4OAWA 4MNQD 1EV2E 1JN6A 1SJHA 5HDQH 2OQJA 3OJDA 5L2KA 1H3UA 2ITDA 1QRNB 4NRYA 4PJFB 4D9LL 4GKNA 4M02A 1E4XI 5D93C 3RWGB 4JFHD 1JYXA 4Y4KC 4QXWA 1UZ6F 4XHJD 5CJXC 4JGJA 3S88L 4OB5H 4JVWA 5SWSD 5DUPL 1QFWH 5IVXA 4LSVL 2ZG1A 4NQTA 3IB4A 2WUBH 2CDFB 2HLFC 4C56A 5IEKA 1K85A 3H42L 1A1NA 1P4BH 1WBZA 4FHBD 2FSEB 3ARFB 3L3HB 1BM3H 1NKRA 3T0EC 1KT2B 3IGAB 1KC5L 4JKWA 1CE6A 4NUGH 5ESVA 3MLZL 3UJIH 4PBWD 5KG9A 4PRHA 2X7LA 2DQDH 2HTLC 3CNKA 1XR9A 3BP6A 4PLKC 3N9GL 5KVEH 4U6YA 3I85A 5C07D 3EYOA 4P9HC 3D3VD 4ZS7H 2B2XH 3CFJA 3C5SA 1MIML 1FO0L 1OAQH 5DMJB 3KPNA 3M17B 1HZHH 1YUHA 1JV5B 3AY4C 4EUPA 5HHVH 4YGAB 1WT5A 2DQFA 3EDFA 2CLRA 2Q76B 3V52H 3OXRA 2NTSP 3SDYL 2OP4H 4LKCA 1ZHLB 3VI4F 2DLFH 3BGMA 2B1HL 4JG1H 4O2CA 32C2A 5IQ9A 4U1JB 1NMBH 4NO3A 1QLRA 4ESKA 2CUMA 1R3LB 3M8OL 4M5ZH 3HLAB 2YHGA 3G6JA 4MSWB 2NMSA 3CK0H 4LPVA 1CLZL 1Y6NR 1FFPB 1A6AA 4PJAE 3DLQR 2ESVB 2BSSB 2G2RA 4N0UA 1BFOA 4WFHE 3TEUA 5F3BA 1MUJB 1JE6A 1ED3B 1GGTA 1H15A 4Y19B 3RY6C 2MNUA 4CVXB 3GIZH 1QLEL 2OBGA 2EDXA 4FQHA 4P2OD 2HFFB 1U6AL 4RFNC 2EE9A 7FABH 1OAUH 5JOPE 2FHCA 5FO8B 5GQBA 2Q7YA 2XZAH 4OLVH 1IKNA 5JPNA 3FB5B 5GGTL 4JFEA 1S5HA 3RIFF 3UTZA 5I1IL 2GT9A 5IHBA 2A9ML 3WYRA 1DBML 4DCQB 4IOSD 2XXMB 4JFPB 4NKMA 1EA9C 4UTAH 1MH5B 1HSBA 5F9OH 5ALBH 4DN3H 2QHRL 4J6RL 3LQAC 3QO1B 4TRPL 3QQ4B 1S7RB 2H1PL 2PO6A 4PRPE 5IG7A 1N7MH 4JPIA 4NKDB 4IDJH 4LVHB 2FO4B 3ZT7A 3MO1A 4BSJA 4P9MH 3QUZB 5LGKA 3MRKB 1UB5B 4JM4H 3ZHLA 4NQEA 3G5YA 4Z76B 4KROC 1WZ1H 2C1OA 4NN6B 1DP0A 3RX7A 3D0VA 4M03A 4Z7VA 3MMEB 2WK2A 4NUJA 4WHTB 5HHME 1MHHB 4MD5B 5M94B 1LP9F 1NCCH 2VISA 3VFGL 5J12B 2GFBB 2IGFH 3RWEA 3T3ME 1E4WL 4F15C 3U2SA 3CH1B 1NLDH 2HH0H 3K3QA 3FFCA 1JPSH 1KTKE 2I9LB 3DRQA 3UTSA 1OTTC 4M7JH 3BEVB 3DUHA 4JFFA 2EDFA 4NKIL 4F7PA 1UA6H 2VLKA 1CGWA 2C4FU 2QADC 4XPGL 3GMNB 1YY8A 4D9QD 2Y5TA 3VFOB 5DI8A 4LLWA 3WEXB 2NLJA 3KR3L 1CQKA 1QYGL 2AK1L 1CZ8L 3W2DH 2BFVL 4KKNA 4OUOA 3LIZH 2XYCA 4FG6C 4IIQC 4FFVD 4CVWA 2VRAA 3EDKA 3VXOB 5GGRB 1G7MB 1XIWB 2EC9T 3DVGB 2UY7A 2DIBA 3HCVB 4K3GA 5ERWB 4ZYKA 5J1AA 1CG9A 4ODUA 3GSXA 3AS3A 4LLYB 2O5XL 1NCDL 2V5SA 1IT9H 3VRJB 3FMGH 3GHBH 2OCFD 1OP3H 1W72B 5CD3B 3WNOA 1HH9B 2JE8A 3QWRA 3DARA 1OAKL 4L8BA 2Q8AL 4DTGH 2NW3B 3QNXB 3PQYE 4MA8H 5MP6L 5DHYB 1JNLL 1OQXA 4LLQA 5FFLA 4PJHE 3L3IA 2W0PA 5CJ8A 3CC5B 5DFWH 3NFPA 5HDBF 3CFCL 4ODSH 3KGRA 2R9HD 4QCIA 1XF2A 1UCTA 3OPZH 3G6AB 2ED8A 3QUXA 1DQML 3I50H 2IALA 2J6EA 4LGSB 3TH2T 3U1SH 4U6XA 1NCBL 4UDTA 3DI2B 1KPVA 1BEYH 3ZMRA 1X44A 4G7VH 5C70A 4KJYB 4DFIA 4GBXC 4TSCL 2NXZD 3JUYA 1KJ2L 1U8JA 1A9BB 5AUMA 2AKRA 2LQRA 1SBSL 1T0NA 5CIPA 5CILH 4L4VE 3MA9L 2F8XC 2FGWH 3HTLX 3QDJE 4PB0H 3WS3B 3O3AB 2NY3B 1NFDA 1PD6A 1QFHA 1ZA3B 3S36L 4ZFZA 4C58B 1WWBX 4X6DE 1YECH 4KZDH 2AJSH 35C8H 4D0DA 6CGTA 3TLRA 3PXJA 1QZ1A 3DTXA 1MCLA 2HMIC 2P8PB 4NFDA 2HT2C 3MJ9H 4G80A 1UGNA 5C0CD 4LSTL 4K3JL 4XVUC 5EU5B 4X4XB 1EJOH 1CFQA 3W5NA 3WDIA 1RZGA 5CEZD 1DQLH 2OK0L 4NO0A 1OD9A 4OLYL 1N3NB 3DMMC 5EZOL 2D31A 1K3IA 3B5TA 4PREA 3UTOA 5D71H 5CINL 2CDEA 4BM7A 1KGCD 5KW9L 4O9HL 3TIDB 5HBBA 3KLAA 4GKZB 2EDNA 4D3CH 3MLXL 4TUOA 1W72H 2AEWA 1HKLL 2NTFA 25C8H 4LGRB 3EIFA 1I8LA 2A6JA 1MAKA 4GMTL 4JN2B 1LO2L 4AT6A 4BQ6A 4JQIH 1T7WA 4EDWH 3DV6A 2R0LL 5JXAL 4MS8A 5LCVH 4Z78A 4Y4HD 4MLIA 4WFED 4Q0XH 3DPBA 4EIZC 2NY0B 2OX5A 3CX5K 5E00A 4X8XA 3VG9B 4ZNCD 1X4XA 2J4WL 3VGHA 3QUKA 4F7TA 3V6OC 4X6EA 3MCLL 4ALAL 4FABL 1P4LB 5FOBB 1B0RA 4KHXH 4UT7L 3BD3A 4KKBC 3FOMB 1N4XH 4X6DB 4LMQE 1XZ0B 5IBLC 4NQDE 1RZ7L 4TVPL 4X7SL 4R9HA 2VZUA 4CVUA 4NRZB 4F7EB 3FT4B 1E4JA 5IHZB 5DEFA 2DTMH 1ADQL 1JHLH 1U95B 4JO1H 5T33L 1ERNA 3MUGA 2BHZA 3CFBA 5IVZB 2VKXA 3QDAA 4XWOD 5TF1L 1BZ7A 3MACH 4NYLB 4MGXA 1OAXH 3Q0HA 4Y1AE 4DN4L 1M7DA 4HJ0C 1OM3H 3SPVA 2DQGL 1KCKA 1JWMA 3MRDA 4KDTA 3MV8E 3W0WD 3GB7B 1CICB 1R3IL 2GQHA 3KDMA 1EFXD 1J8HE 1LGVA 4YIQA 1VESA 1JMZA 4NQSA 4GO6B 4CNIB 5E70A 3IDXL 1A1MA 2VDLL 3F62A 3O2DL 4P23A 4MDJB 4OLZL 3GO1L 1CXIA 5DUBA 5BMFL 5HJ3B 3QPQD 1E28B 3F7RA 4ZOEA 1HHGA 2D7NA 5C0BA 1Y6KR 3MR9A 2F9BT 3P0GB 1INEL 4V1DD 2OR8A 1F4AA 2AEQL 1FNSL 1R3JB 1AGCB 3DO7B 2MFNA 1MFAL 2FH8A 5DQ9B 5EBWB 4N0CD 1YEIH 1KOAA 1ZV5A 4I2XA 2L7UA 3EO0B 3VFUB 3KHQA 4U05A 5DTFA 4WI7A 4JJ5A 1J8KA 5AYQA 3ULUD 4P3DA 1M6OA 4ELKB 3BKCL 4G9DB 3RWCA 4HFUH 2BNQB 4RMRA 1PGRB 1N5YL 5BZWA 4EN3A 1NCNA 1FNGB 4HWEL 4NM8H 2BDNL 3MA7B 5DRZA 3QCUL 3GRWH 2BNRB 4ZPTA 5F6HI 1R3HB 2E6QA 1IAIM 3QFJD 1FO0B 3UBXG 4BFBD 3AVEA 3HE7C 3RZCA 4MAUL 4PJ5E 1A6TA 2ZUWA 2W0FA 3WUWA 1T21B 1W0VA 1RUQH 3TYFA 5EOCH 4KGJA 4R3SA 3ZZ1A 1NCUA 3PHOB 5INDB 4JFZH 5D1XA 1X5LA 2V2TB 1RZFH 4XPAH 1MJ7H 4QT5B 3QNZB 4X6CB 4ZTOL 2UWEA 2QSCL 3L5XL 1RFDH 2MCG1 5BVPH 4OZIB 4YXLH 2QQLH 1S7XB 1IGMH 1J5OH 3B6SB 1INDH 4J12A 1QA9A 2DQIL 5A2LH 1KJVA 2COQA 1AXIB 2WLZA 1BVLA 4WO4D 1LEKB 3TF7C 3B9EA 2D7QA 1I1RA 5FYJL 1KTDB 1FN4A 3O45A 4I18A 2PTUA 2E27L 3V0AC 4KDVA 3P0VH 3MSPA 4I0PB 3MV9D 4LPCA 4MJ5A 3TVMA 3BGFC 5KZCB 2FYYA 4XXDB 1QSFE 1ZLSL 2HKFL 1S5IH 4OBSA 5DD1H 1D5XA 1NDMB 2HVJA 5B3JE 4OCMC 2Q3AA 1UM6H 4ONOA 3AU1B 3VD5A 1A7RL 1B0GB 1WWCA 2YPVH 4D9LH 3ARQA 1WITA 3KPOB 4UINH 3DVNB 3B2UD 4YDKH 3AAZA 3OX8A 3G9VA 3O6KL 3HG1B 1A3QA 5DUPH 3AMKA 5E1HB 5DSCB 3OJ2C 3PP4L 4QRPE 3ARUA 1FLTX 3C2SA 4GXVL 3H42H 2KQMA 4XBGB 4YHLH 4Y5XB 2ZCHL 3TV3H 4ORZC 5E7FA 5D7LB 2EZ0D 4N8VB 5K9OB 1ZWIB 1RJZA 4Y88A 4Z9KB 4P4KD 4U1KB 5L7XL 1F58L 3OMZA 3N9GH 4YK4C 2G5BB 2KBGA 3EOBB 1PSKL 3X14A 1HXYA 4GAGL 5DRXA 1LE9B 3QIUB 3FO1A 1QQDA 3O8XA 5ITBH 1WISA 1BF8A 2PR4H 1FO0H 4N90D 1U2HA 3AMLA 3H7BB 1MRCL 1H5BA 2NY7L 2PYFA 2HJKA 1MCQA 3PWPB 4Q2ZA 3FQUB 3RVWD 5FO7B 3O4LA 4CU7A 2CKBL 4YGVA 3ARBB 5ICYB 2ZOLB 2FEEI 4RX4D 6FABH 2V9RA 2H41A 4BUGA 2GJ6D 4WWKA 1T20B 2JJSA 2X4OB 2VTFA 1KJMA 1RAMA 4GAFB 1ZA6B 1CLZH 1CDIA 4F7CA 2OSLB 1YPZF 3G04A 1DQDH 4MXQD 4PJGF 3OJMB 4LGPB 4U1GC 5DA0B 5FCUL 3VXMD 1DVFA 3VWKA 1BP3B 3F7YB 1NL0L 2ZCKH 1U6AH 4U7MA 4QRPB 1UQSB 1QPXA 5TPWH 1P84J 4M3KB 4DZBB 3HNTL 4X9HA 4B0MM 1OARL 4BH8B 5FDWA 3G08B 4FRWA 1KXTB 3KJ6H 4O00A 5JHDD 4OIAA 3PDOB 4B53A 3ROLB 1A7PL 1AO7E 2Y72A 5F1KC 5CS7A 4PJBA 5ITFB 3LMJL 3OL2A 4J6RH 4MD0A 4HIXH 4P59H 3OR6B 1IGTB 4NHUA 2IANE 5EOCJ 5JORA 2UZYB 2YD8A 4YPGA 2WY3A 4Q97A 4YBQC 3ARTA 4HEME 1JHTA 1DQJB 2XV6B 5ETUB 2EH8L 4PRAB 3GSUA 5HYJD 5TDNA 5F7EH 3PGCB 1YNLL 1KB5L 1OAZL 3ROOA 4Q58C 2Z31A 3QNYA 1VFUA 3P77B 1I9RL 5D2NA 1K8IA 3U6RB 4XGZA 1IARB 4Z0XB 3GHEL 4M43L 3TBSB 3RX8A 5BQ7B 4QNPE 3EDEA 1G0DA 3TFKC 1J1PL 4PJCA 3DURB 3I75A 4QOKD 5GS0L 1NFKA 4JFOB 1FSKB 5E4IA 3VWJA 2OTPA 1M71A 3EFFA 3U0PB 1Y18B 4G9FE 3WHXA 4LF3B 1FRGL 3VH8G 4EJ1C 3ZHKA 1JK8B 1JI1A 3WXVL 2A74A 2QQKL 4X4YB 1T0PB 3AGVA 1ZT4A 3BIAX 3GMMA 2WUCH 1XGYL 5JW4M 4ZOAA 1XF4A 1CZ8H 1HEZB 3O3EA 4ZFOB 3ULSA 4DFHA 2IF7A 5JXED 2IBGA 4XH2B 3TNNA 3Q5OA 4J3OC 2WBWB 1X6LA 5F97E 2QSTA 4X6BB 3RUGA 3UZVB 4F8TA 1JPGA 1T5XA 5LXGH 3MRJA 4HUUB 5DS8A 5I8KH 3U0TB 1P1ZB 5E8PA 1IL1B 1QO3A 5EU6E 3DXAA 4TUKL 1I7ZB 3X3FL 3QEQA 1QOKA 5FA3B 1S9WA 1CN4A 3ESUF 4PJXF 5MERB 2IAMB 4XPBL 5I1KL 1NCDH 3B83A 5L9DL 2YA0A 2VAAB 2CUHA 1ZGLB 1G7PB 2WWMD 5D70L 5D6DC 3LHPL 4GKSB 4HMDA 3MRMB 5MP6H 3QUYA 1GIGH 4U0RC 3T04D 1JNLH 3UJJL 1OTUD 2CXGA 1FORH 3JZ7A 5BV7L 4KVCL 1LK2A 5IMKA 4PG9B 4HC1L 3EYVA 1GGYA 3CFCH 4A6YL 4KHTH 3D87B 3TO2B 15C8H 5I18L 4BUHA 1QSVA 3PE9A 1DEEB 3KS0J 3FONA 3U46B 3UPRB 3RWFB 4GW1A 3A6BH 5MHSD 1AIFB 1B88A 4GS7B 3SBWC 4TSCH 5SWZA 2OTUA 4PGEB 5F9WC 4R4ND 4LVNC 2H8PB 1QHOA 3GMPB 4M62H 2X4SB 4JY5L 4G6KH 4HJGB 5HHPB 4XBPB 4TULL 5C08A 2EXWD 4PJFF 1J18A 2HFTA 3B3IB 3MV11 1X5FA 2XZQL 4IHOA 3D85D 4L9LA 2FEDC 4NWUL 1D5ZB 1IGYA 4MJID 4MCZB 4TYUA 5EU6B 3SKMB 3WXWL 3OB0K 3HPJB 1A0QL 1JFQL 2FJFB 3HMWH 1Q9KB 3Q5YA 3U30C 2HFEA 4MNQA 2ADJB 2FGZA 4KI5F 4LSTH 1KIRB 1V3JA 4P4KC 4ZOCA 1OL0A 2C7UA 4NFBA 2GSGB 4QY8A 3FL7A 4AEIL 5IB5A 1UXWA 3NIDE 4LLAA 2XICA 3MNZA 2EDRA 1CL7H 1NBQA 5KW9H 4LSQH 3U0WH 2VUYA 3RVWC 1FZMB 4FZ8H 4OFPA 1VDGA 5C0ND 5EBMA 4GH7B 3HPLB 3S9DB 1FBIL 3D39A 3FKUS 5JXAH 4UT9L 3WS6A 4JRXD 5FKPB 4D9RD 3CFEB 5D1QD 3NZ8A 4QHUA 5C0GB 1KN4L 4L3EE 3LKRA 4FXKA 2XY2A 5E8EA 4U1NB 2OI9C 2DQCH 1U58B 2FO1A 4ALAH 5E5MA 4P48A 1IGJB 4RGMC 4ZXBA 3DWTA 3P4OB 3IXTA 1KN2L 5IHLB 4BKLB 4HKJA 3C2AH 3WFBH 5F1IA 5ACZA 3VGAB 3GFUA 1EEZA 1VFBB 2DMCA 2FZ3A 4Z7UE 3SJVB 3SDCB 2VZ3A 3N85L 5F3HA 4P46B 5HYQB 4PGBA 1GL4B 5HI4C 3UBXI 1IEBA 2GK0A 2V7NA 4WI2A 3WL9A 2VLJD 1ZGLP 2WAHA 3GKZA 3HI1B 3FOLB 3UDWC 1TQCC 3OJVC 4DN4H 2P5WE 1MCOH 4JCLA 2A2QT 4U1HA 3PL6D 1S9VA 3RU8L 3WLBA 4X80H 2D0FA 2AXHA 1R3IH 1L7IH 2OZ4H 4P2OA 3IJYA 3TZVD 4Q9RL 1ORSA 2HRPL 3FTGA 4GG6B 1S7SB 4XPFH 1RUPL 1UM5H 3IDXH 5B22A 4M1DL 3FFDA 3O2DH 2DB8A 4LK4A 5DDHB 2JJVA 1NFIA 1N5AA 5E6ID 5F7NC 3L3JB 5K9JL 5FM8A 3GO1H 4RAUB 4XTRD 5LGHL 2NY2B 3C6SA 4BFIA 3L1OL 2Q1EA 4OFYD 5IQ7L 5L2KE 1G9MC 4QGYA 4JFXB 1AGDB 3WIFB 3NZHH 4KDTC 4ELME 2BZDA 2AQ2A 3E6FA 3WCYA 4K71B 1KNOB 1CT8A 4L3EB 1HIML 4E42B 3I02B 5BS0D 2JCCB 5E08L 1MFAH 1KIQA 1QRND 2Z9TA 4P23C 4O2EA 4NZJA 5E2TH 3IDMB 1OSZB 4R2GC 5SV4A 5KSAC 4PBVC 4PGCA 3AM8C 4LIQE 1I7RA 3DBXA 4GAJL 3TBTA 1EH9A 3CMGA 4MJ6B 5C0RH 4JO2H 3ZKXC 4RMQA 2EDTA 4XXCA 3GSWA 2EC8A 2D2OA 2VQTA 1XGQA 1JZ4A 1MFEL 3RIAF 1DBKL 3FQXB 5JW3L 1O7VA 4X4MA 3ARFD 1RIVL 2WP3O 4HAFA 1O5DT 4JFQB 2AERT 2BDNH 3OKKA 1LO5B 3QCUH 4KI5D 3IU4H 5C0AA 3ZKNC 3CU7A 1A3RH 5DJ0B 3F12B 4X4ZA 3JTCA 1KPUA 3EUUA 5GZND 4QHMB 3BDYL 4HK3N 1H3XA 2CKBB 5ICXA 2VZVA 3FN0L 4LKXB 2NX5A 4EN3C 2Z92A 2AJZB 3U36B 3ET9F 1CD1B 4JDZA 4OLXL 1L0XA 2XA3A 1GGCL 3ECBB 3O0RH 3RZCC 2DQIH 5I19L 5T1LB 2EO1A 4MA1B 4OSUH 4F33B 5EC1B 2CIKA 5DVOA 5DXWA 5CWSA 1I8IA 2WWMC 5TGBA 1A6ZA 1P6AB 3WIHL 4LCCB 4OLWL 2APXA 1K4DA 1F4YL 5HVHC 1D5MA 2ESVD 1JYWA 2HKFH 3VXQB 4H1LG 3BPNC 3GSVA 3PXHA 1IQWL 1U3HB 3B8YA 4WV1C 1MCIA 4Y19D 5AYUL 3IKCA 1XFPA 3VD9A 1KBGL 1NMAL 3HZKA 1KG0A 3LKSA 4PS4H 1QNZL 5EC2B 3ILPA 2ITCA 3LH2H 3UBXA 3O6KH 3TVMC 3ZSSA 3I6LD 2ENYA 3PV6A 2F19H 4TSBH 4DUXA 2FX7H 2WSKA 3VFPA 5A3IC 1AXSA 5FCSH 2CLZA 4ETQA 2ZCHH 43CAB 4K55A 2VXUL 3VMNA 1VKXB 2OL3L 4EZMA 3L3KB 4OLUL 5DRNA 4NQEE 4MNHB 4PR5A 4LU5H 2BOCB 4QXGL 5L7XH 2ZSVA 4Z7VE 1CFSB 1KPRA 2P5EB 5JHLL 4XNZC 1PSKH 5DFTA 4GAGH 1HDMA 4HHAA 5JDSB 4O58L 1OGTB 1BIIB 2G60H 2DL2A 1DN2A 1MRCH 1Q9WB 5I1HL 1QLFB 2HJLA 1NAMA 5M95B 3BQUB 5TDPA 1M7IA 5ESAB 1A9EA 3RVXC 5B8CA 3D0LB 4G8IB 3UTSE 4G5ZL 5IFAL 5CGYC 4F58H 1FNEA 3N1MC 4TPRL 3WD5H 1NGQL 1O0VA 4RBPK 3VFVA 4MX7A 4HBCH 4XAKE 4XVTL 1A6PA 5IROA 2ZUUA 3KPRB 2V2WB 3JVGA 3V5KB 4DGIH 1RHHA 4KK9D 3L3GA 4P5TA 5F9DC 4XMPL 1RJLB 1EEUA 5C0CA 1LP9A 3A0OA 3CZFA 5D7SL 4ORGB 4OCSH 5FCUH 4F7MB 1P7HL 2DDQL 5CUSL 4LOUC 3S97C 4PD4K 3JV4B 4XCNB 4LIQH 3EO1B 4XCEA 2BRRH 4YDIL 2YRLA 4APQC 1NCWL 5DD3L 5JLZA 5A1AA 1D9KC 3FB8B 5GRZA 3X3GL 1EO8H 3SKJH 4HKBB 5EO9A 2VLLA 1JF5A 2FD6H 1HHHA 3TGXA 1FL3B 2YSSB 3IDNA 4N1HB 4LCIL 4KTEH 3ZE2E 4X6DF 5GHWH 1XIWD 4Q6IB 1UACL 1C1EH 1WFTA 4OGAD 2VLME 1A7PH 4Y4HA 4EQ2A 1I85A 4RMWA 1MJUL 2X4QB 5IV2B 4JREB 1A6WL 4PP2B 2P44B 3P4MB 3ARXA 3ILQC 4NNXA 1ZLUK 5BJTB 5J3HD 4ZFGH 1G9NH 3K8KA 5F8QC 2VXVH 4M7KH 2V5MA 3QIWB 4GRLB 4LHUA 4JB9H 4OBRA 3RZWA 3AREC 2ZNWA 5I1EH 2D0GA 5GGQH 5CBAB 3MRIB 5IBUB 3QEUB 4HFWB 5IUSA 2GW5A 1CDBA 3GSOB 5FUZH 3BZDA 4DVRH 1FAIH 5MEOB 5CLWA 2MQCA 3B9KC 1I9RH 5CEXB 3B9DA 2C1PA 5C0JA 2WWKT 2APVA 2PTVA 3VXRE 2E3VA 1LK3L 2J3SA 2H9GB 4EI5B 1HN1A 4PP1C 4UIMA 2YEZA 5GS0H 3JV0A 4U31A 1YC7A 5CSZB 1MI5E 4M61A 2DTSA 1NFDE 3BYTA 1GC1H 3W0WA 3T0BA 5KSBB 1EFXA 3SY0A 4RGNC 3I3DA 4W4OA 2KDGA 3CFKA 4R8WL 1CTNA 3WXVH 1I7UB 1T66D 4AENA 4MVBD 5EO1B 3N50A 5TFSH 4XVJL 1UM4L 3LS4H 2NY3D 1S7QB 2GCYA 5J57B 3EBAA 1VHPA 1FH5L 1XGYH 1PDKA 4RZCA 5EORL 1FZJA 4ZFFB 2CSPA 4V1DA 4NGHL 5I0DA 3GMOB 2IQ9L 3O41A 3GMRB 3GJFA 1RVFH 1YN7B 4O4YL 2JB5L 3MZGB 2VE6B 3O2WH 1QEWB 1A14L 5FYKE 1H3PL 3SGKA 3S36X 2BMKB 3CVIH 3SO3B 3X3FH 4N0CA 4LLUA 1FNAA 1KEMH 1S9YA 2VDPH 3PWLB 3LRSB 2J8UA 4KKCC 1NSNL 5I1KH 1I75A 1P7QB 5GZNC 3IJHB 3ZE0E 3O3BA 1NH6A 3VXSE 4JKPH 3O11A 1F3DH 5EA0L 1J1OH 3LHPH 3O9WD 2ICEA 4X6CF 2D7TH 4WI4A 2IFFL 5GS3A 1T2XA 3TPKA 5HHOE 5DRWA 3EFDH 5DJ2B 4OZIF 4KVCH 1BFVH 5F1SA 4HXBH 1DQQB 3CVHL 3QFJA 1PG7L 4WI6A 3UAJD 3TA3C 3RVVD 1FG2B 1OF2A 2P45B 4OFDA 2NY0D 1VGKB 3O3DB 2CO7B 5DWUL 5IMOA 4JY4A 1MWAB 3FCTA 4PJIA 3ZKMD 4F37K 5E2UL 1J11A 3U4BL 4LAJH 4G7YL 5FF6B 5D7JC 3NCFB 3ZT6A 2PW1B 1WIOA 1UJ3A 3K1KC 1YJDC 2YD9A 3KPMB 3P73B 4Y2DB 3CSGA 1CLOH 5D6CB 2EEBA 3MRNA 2X40A 2W9DL 4G59A 1Y6MR 2RCSL 4WW2F 4LRNL 4ODVL 2YPKB 1XF1A 2DWEB 3KPLA 3W82A 1JPFA 2QTEA 3F7VB 3LB6D 4WO4A 1ZANL 4DKFL 4M7LH 5FM5M 3LN5A 1GGUA 2CR6A 1MCBA 4G6ML 1S7TA 3MV9A 4KPHH 2ARJB 1GCFA 5CEYA 3LEXA 4PGDB 5DJAA 4U6VL 4RWHA 4QO1A 2XTJE 2RFXB 3HC0B 5D72H 1QSEE 5IFHL 1BJ1H 2EH7L 1CICD 4JO3H 5DHVA 3VXSB 3RP1A 3JWOH 4I3SH 3IFNL 1MFCL 1YEHL 2EYSB 5E99H 5I1AA 3DV4B 2GIYA 4PTTA 1A7QL 1OHQA 4I3RL 3EOAA 4QHLB 3I84A 3TT1H 2PXYB 3QUZC 3VGBA 3GGWB 5ISZB 5DD6B 2H3NA 3HZYA 5IHUH 2NY5C 2A6KB 3TO4D 1Y0LB 1CFNA 2AV1B 3SCMB 2DAVA 4I2XE 3QI9C 5HI3C 1FBIH 4LSDA 1N8ZB 1KCLA 4V2BA 2JJUA 4OIIH 5MEQA 1ONQB 1BQUA 3VXPA 4OTXL 3T0WA 3OAUL 4CW1A 4JQVA 5D7IB 4XWGL 2E7HA 4Y4FC 1N0XL 4YHPB 5F88A 3WFHB 2BC4B 5D1ZB 3X17A 3OKEA 2VDRL 2F54B 4MWFB 1MWAH 3PNWA 3QG7H 2BNQD 1I3VA 1MOEA 5GS1B 1IBGH 3B9AA 1YQVH 4RX4A 4LBEA 4S0SD 2BNRD 4KY1H 3PABA 2GJ6A 1JWSA 1FL6B 5JW4N 4G8EA 2VDNH 2AEPH 2G75A 2VZOA 4Y1AD 4PP8C 3N85H 3BXNB 3OV6A 4QRTB 4NKQB 1ZLWK 3KVQA 4YR6A 3MV8D 2F53B 1CTOA 2X1XR 1VFMA 3TBVB 1J8HD 3O6FB 4MXQA 1Z9OA 1YMMB 4PRDB 3RU8H 4K94L 3H0TB 3VXMA 3ZDYE 5C9KA 3UTQB 4FQIL 5HD8D 2QBWA 1FYTA 3V7MA 4YDVA 2FL5B 4M1DH 5ID0A 1T1YA 4HWBH 3GSQB 4TNWF 4WEBL 5K9JH 3BKJL 3EDJA 3NGBB 1F3DJ 2CO6B 3R1GL 4YJZL 4PJ8B 2DI9A 4I0PD 5IQ7H 3GI9H 4K8RH 5KZCD 2XY1A 5JHDA 4ONFH 4IOIA 3S4SG 4ZDHB 4JE4B 5IK3B 4Y5YA 4RIRA 2MOVA 2CGRH 3D69A 2F58H 4I3GA 1HIMH 4G6JH 4NDMB 1CIUA 3LPWA 3PWVA 4KXZH 4N8CL 5K33A 1I8KA 1NEUA 2NY4C 1FGNL 4GAJH 4ZUWB 1UZ8B 5C0FA 1KEGH 3EW3B 4AEFA 3AB0B 2CK0H 3EJYC 1BJMA 5T3ZE 4Z8FL 5DC9B 2MKWA 5DJ6B 1JGDB 1C8PA 1FYHB 2I07A 5HYJA 3MGAA 3B43A 4HQQL 3F5WB 1N26A 1JGVL 1RIVH 1A4KA 1RUAH 4JHWL 5D7LD 4HS8L 1NGPH 2OJEB 1V3LA 1FAKT 3MCKB 4FFYH 3EYFB 3PGDA 1G6VK 3VCLA 5L0QB 1CK0L 5BVJB 1IAOA 4IMKA 2E9IA 4M5YH 2XNAB 1SM3L 4CDGC 2BVTA 3O4LE 4M4PA 4NO2B 4WHCA 3QIUD 5E56A 2CKNA 3QDGB 1QFPA 2F8OA 1IC7H 3T0EE 4NZRL 2VDKH 2X2YA 4KK8D 1FZOA 4AH2B 1U8PB 4HMCA 1MVUB 3VXUA 5HYEA 3ARGC 4NZDA 4IM8A 3G5ZB 3V5DA 1T03L 3PWPD 3B2VH 1IAIL 1BJ1J 3QDME 5C0IA 3ARBD 3MRCA 1KFAL 3KXFB 5AZEH 4X98A 1CDJA 1QFWI 3QH3A 4LASL 1DE4B 1OPGL 1QSFD 3FN3A 2FBJL 5JXEA 5J7CC 2QV2A 3PHQA 4OZHE 1IM9B 3WIHH 5IJKA 5IEHA 5ENWA 1I1AA 4HIHA 3T0XA 4GAYB 1KYOK 4LLVB 3DGGA 4PUBH 4AQOA 2O5YL 3MJ8B 4LVEA 3C6LA 3UAJC 4JFYB 3RVVC 4OFIA 4UTBL 3CFDB 1J0JA 4JAMB 5DMIL 2R0ZH 2DQTH 3VG9C 2DS4A 3HRZB 4QRPD 3BKYL 4LDEB 4Y4KB 3V2AR 3MUZ1 2VR4A 2VB5A 2HG5B 2AK4A 5H94A 4LCYB 4F3FB 4YHNB 1YPZA 2XQBH 4WU5B 5KBNC 3QUMA 1QBBA 4CMMA 2A6DA 2YK1H 5ILTL 3RY4A 5E24E 3LRHA 5FA4A 5F9JA 4NBYB 4EVNA 4WW1A 1HH6B 4EI6B 1MJJA 4QXGH 5CZVL 3NA4A 5JDJA 1YEDB 3T2QA 5JHLH 4O5LL 1CF8H 5EOQH 4MJ2A 4KQ3L 3F7PC 1AXTH 4QTHB 2BVQB 3HS0B 3MROA 3GNMH 5DK0A 5C0DA 5EFIB 5GGVL 3L7EB 3SQOL 1YEKL 3H3PL 3TCLA 1MFDL 1A1OA 3CUPA 4XMLL 4H1LA 2DQJL 4FQXC 4PJCE 4OZHB 5IB2B 5IFAH 2NR6D 2YBRB 4TN9A 1LO4L 3IS1X 5J9PB 3T2NH 3D85A 3V6BR 2R2HA 5SX5K 1OGAB 2B4CL 1CXHA 4OM0L 4XVTH 4M1CC 2V7HB 1BQLL 4IRSC 2I9TB 3DECA 4Z7WB 2D7OA 5C09E 5E1AB 1MLBA 1SQ2N 4P5KA 4YHOH 1GXEA 2ZG3A 4HUNB 4L3AA 3KPSE 1LNUA 4R7DA 1UKQA 1EXUA 5EZJA 3UCRA 4FTVE 4PJDE 3TIEB 2D03L 2FECI 2J7LA 5GJTL 2YXMA 2O61A 1QR1B 3WN5A 1MCEA 1IVLA 4AL8L 5LQBL 5MI0C 2BOBA 3MFFB 2X4NB 1IQDA 5IMLA 5D7KE 4I9WE 3LKOA 3RWDB 2JELL 4MNGA 1DBAL 1ACYH 1GZQB 4OF3A 1F3JA 4JRXA 5KSUA 2DBLL 1D5BB 3DX8A 1FE8L 1UWGL 5C2UB 1DEDA 5D1QA 2FX8H 2IAMD 1AD9A 4UV7L 2WIIB 3FRUB 5HDOA 2Y5EA 4DW2L 5KN5B 5D5MB 3KYMA 2VQ1B 1F8TL 1WWWX 1DDHB 2D7MA 1ZSDB 2ZPKL 1DL7H 3GJEB 4KROB 2Y7QA 4ZTPL 1DN0B 2EDKA 2M8XA 5AZ2L 4NNYA 1DFBL 1D6VH 5L88L 3WKML 5F70A 3QXDB 1VSCA 1MF2L 4PJXA 1JYVA 4P5MB 1G1YA 2H32B 3GSNB 2DLHA 5ADOH 5E8OB 5EU4B 4U49A 3KPQB 3UJTL 3I9GL 2MSPA 2VLJA 3MLTA 1PW3A 2IWGA 4HKZB 4L8DA 1BBDL 3KPSB 3BPOC 3OKNA 3PL6A 1J87A 2FDBP 4FTVB 3QHZL 1U9KA 4PJDB 2D7PA 1WZLA 3TZVA 5FAAA 4G8FA 3SE4A 4R8WH 2JCCF 3BAEL 3LSOA 3ME0A 4EOWL 2CLVA 4ZUSB 3U7WL 1UM4H 2CRIA 1FL5A 1E27B 1RIHL 2DMBA 3O4OC 4OT1H 1WUNT 3BHBB 2WP3T 5EU6D 4IMLA 3MRPA 5SX4H 4JFHE 4IIQB 5KJRL 5JUEL 3LN4B 2J88H 2Q7NA 4S1DC 5SWSE 3SEPA 4YUEH 2W9LA 5BS0A 1F6AB 1P9MC 1QRNA 3IJSB 1L7TH 3IU3B 2EYRA 3V4PH 3RWGA 5HPMB 1JYNA 2H2PD 4R6UA 3CX5J 1NSNH 1FPTL 2ADGA 4YXKL 3VW3L 3S35X 1ND0B 2MHAB 4ZSOB 3INUH 5DJDB 2BX5A 3H9ZA 3VFRA 1F3RB 3IRPX 2JLLA 4PTUB 3BZ4A 4MQSB 3LQAH 4ONGH 3R8BB 2V5TA 2DICA 2FSEA 5C07E 3ARFA 3D3VE 2AEIT 2FX9H 2YMXL 3AS1A 4MCYA 3SGKC 4H25B 3ARBC 1YQ2A 1KT2A 1UEMA 3IGAA 3WJJA 2LVCA 4TNVF 1RY7B 3J8F7 3WE6B 3ESVF 1Q9OB 3X13A 1UJTA 4ZMAT 3OXSB 5ADPH 5IIEB 5MEPB 1ZXQA 12E8L 5DWUH 3VFTB 1YEGH 1DANT 2YPLB 4OZGA 3U4BH 2H32H 4G7YH 3GSNH 1HILB 3M17A 2PF6A 1JV5A 2N4IA 3IF1B 4JZJA 4GBXB 1AC6A 3RGHA 1H3VA 1EAPB 1OOAA 2W9DH 5H2BB 2RCSH 1ZHLA 4LRNH 3V6OE 4ODVH 3VXTB 2VSCA 5JOFA 2R23B 5DLMH 1HXMB 1R3LA 4FNLH 3SJVD 5CCKH 2RHEA 1E4XL 3SDCD 4MSWA 4QHNB 4P46D 5IB1B 1BGXL 2YWZA 5I76B 4LARL 1FFPA 4KAQL 1WFOA 1XMWA 1R24A 4ODWB 1J9CT 2BSSA 5EBGA 3T2OA 1MCPL 1FFRA 2BVUA 1R3KB 3MRBB 2W65B 4HWZB 1S7UA 1VFOA 4QRRE 1ED3A 4YQXH 5ACMA 3VD7A 3K2MC 5E9DB 3RL2B 1F6LL 2HFFA 3U4EB 3DUUA 1JL8A 3L7FB 2IFGA 4X7FC 4XNXL 4YHZH 3VG0L 1PLGL 3VGGA 5FO8A 5FGBC 4UMGA 4ZODA 3DMMB 4RGOL 5IB3B 3LKQA 1G6RB 4PRBB 3RQ3A 1YEEL 3TBWB 1QSZA 2FB4L 3BPCB 5EUOE 5J06A 5IF0A 5E5RB 4JM2C 1R0AL 4DCQA 2OMBA 1U8OB 3DROB 3SN6N 1FGVH 1HHIB 1J1XL 1MH5A 4L3ED 4ZG1A 1G1CA 5DJCA 2PKDA 3QO1A 1S7RA 2BHYA 4NKDA 4KK5D 3DUSA 2FO4A 4XWGH 3MRHB 4CVZB 4KTDL 1FSKC 1P4IH 1PQZA 3MGOA 1KJ3L 3STLA 3QJHB 5EWIL 1WZKA 4JRYB 1A64A 1S7VB 1X5YA 1WAAE 1UZ6E 5FYLH 3D25A 2EEDA 5ICZB 1I1FB 2ZCLL 2AQ3A 4U7SA 1AGEA 3D2UD 2Z35B 3JXAA 2NW2A 4QXUL 4TQEL 3IYLW 2GTWB 1EDQA 1XCQA 3SKOB 3WFCH 2Y4SA 3O2VL 5HXMA 3BZEA 1CFVL 4PJAA 4JQVC 3QEHB 2GI7A 3TC9A 1FC1A 4OGYL 4F2MB 4LAQH 4QRRB 2L7JA 3TBYB 2J6EL 3QPXL 3WO4C 5JIPA 3RDTC 1EGJA 2YKLL 2EDBA 3UO1H 3UPCA 2WINB 9CGTA 2ED9A 3VFOA 3L6FA 2P7TA 3RGVA 4OD3L 2AJXH 3WEXA 1TVBB 2CIIB 5T1LD 3MJ9A 4BA8A 5I8CB 4RFOH 2E7LC 4OCRH 5LBSL 3DHMA 2PTTB 1CU4L 1P84K 3R1GH 3MBEC 3VI4E 5I0ZA 1DCLA 2XWTA 3VXOA 1TJHL 3DYOA 4L8SC 5L6YL 3QR2A 1IFHL 5KAQF 1XIWA 1OP5H 1IRAY 4OF5A 4PRPA 1WBXA 4P3CL 1G6RH 5ERWA 4WI8A 3X12B 3MV7E 3KYNB 1U3HD 4OCWH 3MYZA 5JIHA 4LLYA 1KTLA 5IP4A 4HJJH 1R5VB 4N8CH 3Q1SH 2IPUK 1W72A 3MRFB 1HI6B 1QVOA 1CD9B 2XN9E 4GS7C 5T3XL 2APTA 1KLGA 2YR3A 4NC1C 1NAKL 2BVPA 5FYKL 4KMLB 5KSBF 4P4RB 1JWUB 3BSZH 4XX1E 1F4HA 4JG0H 1MHEB 5KTEH 3T4AB 2GK2A 5C6WH 1CK0H 4GG8B 4YXHL 3QWQB 2VITB 1AC0A 4LP5A 1SM3H 1CDUA 2P5ED 3QIBA 4PLJD 5T1MA 3S37H 4X7TB 1U8MB 5T1DH 4KRPC 3RTQC 1KXQE 4LCWB 1M05B 1FV1B 1T03H 3BQUD 3WS3A 3S4SA 3O3AA 2WQRA 1SEBA 1SVCP 1RPQA 4S2SB 4N5ED 4PJ9A 4LASH 3S98A 5GS0D 2R4SH 3BN9D 2P24A 5C0CE 3WV0A 4XNUL 4AJ0A 4HK3J 1SYSB 3MV7B 1FFNB 3OB0H 4LMQI 2P8PA 1RURH 1JHKH 3MXWL 3KPRD 1UCBL 4G42B 2CJUL 1EHNA 3LV3A 4PJEB 2VN4A 3BD4A 4HH9B 1LHZA 4JZNB 3TPUB 2NY6C 2DIJA 2O5YH 4JCMA 1KGCE 4OV6F 3M07A 5CBEA 1EO5A 2XN9B 2GITA 4PV9B 5DFVC 4GQ9L 4B7LA 4AMKH 1XF3A 3PQYA 1WBYB 2CMRL 3PIQA 4PBXA 5F7YC 1N3NA 1LD9B 3MRLB 3OBAA 2X42A 3BKYH 4HLZH 1VB9A 2CPCA 3ARVA 1SJEB 2ZP0T 4GKZA 3O9WA 2ICWI 1KCRL 4JN2A 2VDOL 3C6LC 1OT2A 5TJWK 1JN6B 1SJHB 3VGAC 2ITDB 4NRYB 3TESA 1NGXA 4Q9QL 4B7IA 3FAXA 4P46C 5AAWA 4H0IA 4G8GB 1N0LA 5EIVA 3FQRB 4O5LH 4YK4B 4X7EC 1J05B 5IVXB 4UILH 3ULVL 1S3KH 4KQ3H 1H3GA 3ARDC 5JW5A 5FOBA 4CRPA 3EYSL 4GRLD 3SDDC 3GRWA 5GSVA 3C5ZC 5GGVH 1A1NB 1WBZB 4U4BA 4TTDD 4X6DA 4HK0B 3H3PH 4XMLH 5ESVB 5KG9B 1CE6B 4XAKD 4NWTL 1TDQA 4KV5E 4PRHB 2X7LB 4BSVA 4HUMB 5CJQL 1LO4H 1XR9B 4F7EA 4U6YB 3W0WE 1X5AA 5IHZA 3RWJA 5IM7B 1U95A 2PNDA 3C5SB 5IVZA 2NY2C 5HDBE 4NYLA 4EI5D 3Q6FA 4R7NA 3TT3L 5IBTL 4J2XA 1E4KC 3T77B 3THML 1YUHB 1B2WL 4EUPB 1OSPL 2BJML 2DQFB 4K71C 3ZYJA 2CLRB 4GJTB 4S1SL 3OXRB 1CICA 1TMCA 3BW9B 4WTZG 4LKCB 4U1GB 3TWCH 4O2CB 4CNIA 32C2B 5IQ9B 4O2FB 4MDJA 1RJYA 4OFKA 5CFHA 2YWYA 1FC2D 2GY7B 5D7IF 4KKAC 3E3QC 5DGQA 5ANMB 5GJTH 2MTPA 5GXBB 3CCHB 4BFEA 4Y2OA 5LQBH 5GJSL 2VMFA 1J88A 2GSIB 1A6AB 3EHBC 3TO4A 3LN9A 4X5WA 1T1ZA 1OAYL 2W92A 5D2LE 1NGYB 1BZQK 4N0UB 1BFOB 3CAFA 3BP5A 3T08A 5F3BB 1H15B 2H26B 2M2DA 1DBAH 1R3JA 1AGCA 4BQCA 3DO7A 2Y23A 5EBWA 3AS2A 4FQHB 5DQ9A 1IAMA 3OKMB 2XZZA 4F57L 3V4UL 3IAPA 4GW4A 3VFUA 4KI1A 1ZAGA 2B1AH 4IRJC 1INQB 4JFEB 3H3BC 1F8TH 2Q6WA 4ELKA 2BNQA 1MCNA 2ZPKH 2P1YA 4XP6L 1RMFL 3MA7A 3NCJH 1MPAL 4R26H 3FT2B 1DFBH 4HBQA 3HMXH 4QTIH 1HSBB 5HGBB 5JNYB 5L88H 2ED7A 4UT6L 1PKOA 5F96H 3WKMH 3JWDL 4Y1AA 1MF2H 4P2QE 4MA1C 1FVEA 3H9SB 1CFBA 2PO6B 5IG7B 3UYOD 1TQBC 3C8KB 3MV8A 3UJTH 1K2DB 1EVUA 1CS6A 2ICWA 3K7UA 2SEBA 1J8HA 3G5YB 5INDA 2V2TA 4NHCL 2H2SD 1Q72H 2A83B 3QCTH 4QT5A 3D0VB 3FO0H 4X6CA 4IS6A 4Y2DD 1F2XK 2EYTB 4L5FL 2B20A 2DKMA 2KZ1B 4QXTA 1U3HC 1S7XA 2VISB 3B6SA 4KJQC 1V7NL 1IM3B 5E6ZA 4EUPH 1JPTH 5GZOC 4EOWH 3RWEB 1ZTXH 2GKIA 2R69L 5DURB 2V6HA 3U2SB 5D2LB 1KTDA 1BIHA 2L0DA 2ENSA 1I8MA 4ODHH 4I0PA 5JR1L 4FQJL 5J13C 3UYRH 4C83A 4CBPA 1HINL 1ZMYA 2DRUA 3W11D 1P5UA 3WFDL 5KJRH 1NDMA 2VLKB 1N6QL 1OB1B 4RWYL 2R56L 1J86A 4N9GA 4HV8A 1AR1C 1XGTA 4WW2A 1A6VH 4WDIB 1OLLA 4C4KO 1B0GA 3VXSD 4LEXH 2PUQT 3KPOA 3RKDD 2NLJB 2FJHA 2I26N 2Z4QA 4K8RD 2H6PA 3QQ9C 2PXYD 4N1EA 1JVKA 3N1PC 4J4PD 3LKPA 4WEUD 1QFWM 2G9HB 5ISZD 4LSSL 4XBGA 4P2QB 2ZG2A 4U0RB 4Y5XA 4PJ5A 5DC4B 3SCMD 1A7NH 4HZAA 4ZYKB 1ZWIA 1I3GH 1CG9B 4ODUB 3GSXB 1U93A 4N5EC 4ONHA 3L95B 1B0WA 4NJAL 4XNYL 3P2TA 3WIIL 1LE9A 3QIUA 3HE6D 2N7BA 4CAGA 1NBVL 4L8BB 2AXFB 3H7BA 1WFUA 5C8JB 2IBBA 5D1ZD 3MODL 3VFMA 1Q1JH 3PWPA 4LLQB 5IT2L 5FUCC 2F54D 5F9WB 5FO7A 1Q0YH 3FQWA 2VDQL 3NFPB 4CUCA 4L3CA 1NGWA 1YDPA 3RA7H 1P69B 3C60C 2DJUA 4QCIB 2BVYA 5FV2A 1TCRB 3QUXB 4RBPH 1QSFA 3DGCR 2IALB 4MQXC 1OT1A 3GSRB 4U6XB 4CDHA 1KPVB 4NT6B 1VGEH 1ZA6A 3VXME 5KAQG 3DVIA 2F53D 1JNJA 5IBUG 2Z91A 1RZJL 3T2PA 1MCPH 2QQNH 3O6FD 2AKRB 1T0NB 2WBJA 4PY8J 5CIPB 1YMMD 1K5NA 4HGKC 3U30B 3MLPA 5GISH 1FQ9C 4L8CA 1WQVT 4YWGH 5FHAL 1H3WM 3KPPA 4ZFZB 3CZJA 4QRPA 5MENB 1T83A 3T0AA 1UQSA 2AV7A 4D0DB 3QIWC 2D9CA 5BV7C 2X4PB 5EBLA 5HGDA 4BH8A 5KS9B 5KSVB 3BT2L 4PJ8D 3P9MB 3D18A 4G3YL 2FB4H 4WI3A 4YX2L 3SE8H 4G80B 3FAWA 3ROLA 3GIVB 3VRLF 1J1XH 4OLEA 2FR4A 1LEIB 1BD2E 4OZHF 1GZPB 5EIIA 3NH7L 5CMAA 1RZGB 3WMSA 3V0WL 2XRAH 5CGTA 4POZC 3HNVH 5FYKU 2HFGH 4XP5H 1ZLUH 2FEEL 3LEYL 4E0RA 1C16B 5A2IH 3G6DH 2NZ9D 4XI5C 2CDEB 3ES6B 4AIOA 3KLAB 2IPTH 3QO0B 2A77H 2MQ3A 5EWIH 3T4YB 2A6JB 1XGPA 3VGFA 4AT6B 3PGCA 4QOKE 3BVNA 1BOGB 4Z78B 3FRPA 4QXUH 3P77A 3U6RA 1X5HA 2VC2H 5F1OB 2X4RB 4WWID 3TBSA 3DETC 4DK3A 5BQ7A 1UXSB 1JF6A 5CJBA 4F7TB 3DURA 1MCRA 4LQFH 4X6EB 3CLEH 4NBZB 3S8WA 3VGDA 1B0RB 4EEEA 1Y18A 4K07A 2ADIA 1N64L 5JQ6L 2VXSL 1TQCB 4QF1B 3SHSA 2K9UA 4ZD3H 1JZ8A 1I9IL 5C2BL 3QXTA 5BO1H 1MCJA 3HR5A 2Y9RT 1RQ5A 4X4YA 2FWOA 2V2XA 2PETA 3KXFD 4PIRF 5CIPH 1BZ9B 4OD3H 4KUCF 1DUZA 5KOMC 1HEZA 4ZFOA 3HI5L 4HPYL 3MUGB 1RSFA 1CGUA 3LEVH 2CXKA 2RGSA 4OCYL 5D5MF 5B4MD 3IAGC 5DJZB 1CU4H 1T1XA 1AO7A 3CMOL 1IM9D 3DI3B 4X6BA 1J0HA 3HC3L 1TJHH 1M7DB 3SPVB 2YD2A 5L6YH 4MMXC 3MRDB 3U0TA 1P1ZA 1IL1A 4ZUUB 3V79C 1I7ZA 2IANA 3CDGA 3P3YA 3RGVC 2HTKD 4YIQB 2IH3B 1AQKH 4XP4L 5MERA 3PP3K 2IAMA 2VL4A 3SE3C 5HGAA 4P23B 2VAAA 1YPZE 2R29L 4R2GB 2YA1A 4PJGE 5KSAB 3PHSA 4Y4KD 1WC7B 5T3XH 3WSQL 4LEOA 1U8LB 3HAEB 5DUBB 3ZKXB 5GGSA 4K3EH 4HKXA 5C0BB 3MR9B 5IVOA 4W6WB 3MTRA 4PJDF 3JV6A 5MHSE 1DSFH 1YYLH 2HLFD 3L3OB 3ZL4L 1F97A 3GDBA 4ZOBA 4Z6AT 1ZHNA 4JN1L 5I8EA 3PGFL 4Y16A 3TO2A 1R5WB 4XPTH 3T0ED 3NOIA 3PG2A 3UPRA 3EGSA 3RWFA 2PN5A 4G9FA 5D8JH 2APWA 2HTLD 2DWDB 1BVKA 4PLKD 1QBLL 1KLUB 3QHFL 2AP2A 4WUUE 5DTFB 2XKNA 4DQOH 1T89A 3QDMD 4PGEA 1DTUA 4P3DB 2GAZB 2XI9A 1G7HA 3E2HA 5IOPB 2EO9A 4HJGA 5HHPA 5D9SB 2Y07H 3KYKL 5BZWB 4NBXB 4EDXB 1YYMH 4EN3B 4MJIE 1PEWA 3CXDH 5DD0L 1A02N 5DRZB 1CR9L 4ZPTB 4MZ2A 2DL9A 3VFWA 3B3IA 3K8LA 3QIBC 5FGCE 3RPIA 1PG7W 3RZCB 5D4QA 2EDHA 1T1WB 4KJWC 1D5ZA 3UTTB 1OGAD 4XNUH 5EU6A 3SKMA 3U79A 2OZ4A 2FJFA 5D1XB 5K9KA 3QYCA 5SWQA 1JI2A 5ELIA 3LS5L 3ARSA 2UWEB 4WCYL 3QQ3A 3WJLA 3BP7B 3BPNB 3GBLA 2AGJL 1KIRA 1U8NA 4GQ9H 1ZHBA 4PJ9C 3NPSC 1CQYA 1KJVB 2AW2A 2CMRH 1BVLB 3QCVH 2WW8A 1FN4B 1F11B 4MAYC 4MNGE 5D1ZC 2Q86B 1VADA 4ODTL 5GIRA 3VDCA 2JJTA 3TVMB 5I66B 1FZMA 3ALWA 1IGFH 5KVGH 2IADA 2E9WA 5EB9A 4HUKB 4JRWA 1D5XB 3TN0C 4H20L 1Q9LA 2E9JA 2VDOH 5GS1C 2ZKHH 1CBVH 3HAEH 1LDSA 2C4XA 2AXGA 5GS2H 2XA8H 5J6GB 4UU9A 5EU7E 4Q9QH 5GGUA 5HHXL 3CFEA 1JZ5A 3AAZB 3HZMA 4KUCD 2RB8A 2W38A 5LWYL 1QPPA 4XNZB 2HN7A 4HMEA 1EMTL 3VFSA 1IGJA 3FO9B 3P4OA 3O6FC 1ZK9A 1IC4L 4PJXE 4Q9BA 3UTPD 4ZS6C 4BKLA 4PGJA 3P9WB 1KCUH 4KROD 2D9QB 4GLRH 1CFTA 3VA2C 3K1DA 1RJZB 1VFBA 1K3ZA 2LE9A 3LZFH 1U3ZA 4QRSB 4D0CA 2VABB 3SJVA 4DGVH 3SDCA 1LE5B 1FCGA 1NUFA 4R0LA 3OZ9H 4LCUA 3FO1B 1ZLWH 2DQEL 1L4IA 4YO0B 1TITA 2NZIA 3NGBC 3CSPA 3FOLA 1HWHB 1G0XA 3K8MA 4YC2B 1A21A 3KPSD 4AM0B 1B2WH 1OSPH 4ENED 4TOYL 1EHLL 4WNQA 4Q2ZB 4TUJB 4YZFF 4XNQB 1RZ8A 4FTVD 1AFVH 1MHCB 4YGVB 2MWCA 2F74A 4KUZL 2UY6A 4HD9A 2R8SH 2QADD 1II4E 2JIXB 4J3XA 4XRCA 5EZIL 4CADB 1I9JL 5CJ5A 4WWKB 2NZ9C 4FZEH 1F4XH 4APQB 5BS0E 1KJMB 2ZSWB 4RAUA 1D9KB 1CCZA 3H9HB 4I9WD 5D7KD 5F1NA 3SE9L 3I6KA 5GJSH 3V5HB 4ZNEE 1QRNE 4PJFE 3WIFA 5HDLA 4U1MA 5TQ2L 1T5WB 4L3EA 4E42A 4K9EL 3MUY1 1NLBH 2JCCA 2X41A 3S3PA 1ZT1A 2RBLA 4W70A 5F7HA 3L3DA 1DBJH 3VWKB 2CQVA 5L0QC 3V4UH 1YN6A 1PJ9A 4JO4H 4M6ML 4HCRA 4ERSL 4ZO6A 5FDWB 4Z7UA 4BK5A 3AREB 3D2UA 2BSTA 1RMFH 4JFQA 1LO5A 4AG4H 2R0KH 4PJBB 3CPLB 4NM4L 3JWDH 4WTZA 1TTUA 3RBSA 2P5WA 3F12A 2DMKA 3B9KB 5DZNA 4Z5RB 3GZKA 1TZGH 5B4MC 4MQ7B 4XVSH 1U3JA 4QHMA 5JORB 5FYLD 2YPLD 4LKXA 4NHCH 3C87A 1DBBL 5DUML 2AJZA 4K23H 3U36A 4GBXD 1BQHA 1JHTB 1F4WL 1CD1A 3GSUB 4HPOH 5TDNB 1NAML 1ORQA 4ISVB 4RGNB 1UVQA 1SY6H 4HIEB 3QNYB 5T1LA 1HOCB 2ESVE 5D2NB 4ELMA 2R69H 5JQHC 4XGZB 4F33A 5HGHA 1WAAF 1AKJA 3BO8A 3MLUH 4Y19E 3VXNA 4LCCA 1U8KB 1DR9A 3CSYB 3BH9B 1M71B 3EFFB 3T1FA 4XMKH 3VXQA 5CGMA 3MRGB 2HMID 2WQ8A 1N6QH 1MFBH 5IGXL 2HT2D 4RWYH 3UC0L 3I6LE 1Q94A 3R0MA 5E9DD 3F7QA 2J5LB 4X6FA 1HNGA 4XVUD 4GW5A 4PLNC 2BNUB 1V3KA 5CEZL 1XF4B 2J8OA 1ZLVK 1HQ4B 3ZDXE 3DMMD 3EZ8A 1BF2A 2WMPA 5B39B 2X89D 3RUGB 1V05A 3IDGB 4W6YB 3SGEI 1FLRL 4FP8L 5E8PB 3P30L 3DXAB 1VKXA 1XGRB 4HT1L 3QEQB 3JBG7 4JKKA 3L3KA 5EOTA 2I60H 2W9EH 3CLFH 4MNHA 4HF5H 2BOCA 2HJFB 4FFWC 1CFSA 1QBMH 3TA3B 4XNYH 3W9DB 1KF9B 1OGTA 1BIIA 5E8DH 3K46A 1SEQL 5D7JB 4YNYB 5GRUL 1S9KC 3BQUA 3C9NA 4JRYD 2YOCA 1VENA 3BRDA 1LK2B 3MLYH 4KKBD 4U0QB 3EYVB 4CN6A 3IETB 5IBLD 4XC3H 3FONB 5I16A 2VWEE 5F7FA 1FFQA 1AD0B 1TTFA 2E6JA 4M3JA 5AEAA 1BQSA 4ZO9A 3JTSB 4QRRD 3KPRA 1IC5H 2V2WA 2MPAH 2EDQA 5SWZB 3TYGH 4OM1H 1RIUL 3BN3B 1AHWA 1WF5A 3CSBA 4HJ0D 4D0BB 3DX9B 5I1JL 5DJ8A 3BDBA 5C08B 2NQCA 5K59F 5FHAH 5BRZE 4XCNA 4I48B 3FZUC 3EO1A 4H26A 4YAQA 1G7IB 4I5BA 3FB8A 2NXYC 1T2JA 5IVXF 1IGYB 1ZT7B 4DGYL 2AABH 3HZVB 2ORBL 3MJGX 2YSSA 4G3YH 1G7LB 1C5DB 2DM3A 1KENH 4MNQB 4DAGL 5TE7L 3IT8D 4X8JA 4UB0L 1G7JB 1VACA 4BH7B 2QKIA 3RAJH 3QI9B 4JLRB 2X4QA 4OQTH 1P5VA 4LSPL 3NH7H 1ETZA 1ZHKB 3KHOA 4JEGB 5BJTA 2EXYC 3U9PL 2NNAA 4HUWB 1NEZB 2D0HA 5IB5B 2DJ4A 1IKFH 1UXWB 4RFEB 2R2EA 2E8ZA 4GRLA 4UIKH 2CK2A 4UZGA 4Y4FB 3MUHL 4ENEC 1AE6L 5JO5B 5CBAA 2C3VB 3MRIA 4JDTL 4I13B 5EBMB 3SOBL 1C08A 2HT4D 3ULUL 3FO2B 3FHAA 3D39B 4PV8A 4PB9L 4JVUA 1YJDH 5CEXA 1HK6A 4BZ2L 3NZ8B 1ACZA 5DEGB 5E2WL 3LKRB 4EI5A 4FXKB 3HE7D 1CLYH 5E5MB 3D9AL 4ZXBB 5L8KB 4P57A 2VL5B 3IXTB 4IDLA 1KYOJ 4M8QB 4UAOC 5BRZB 4WU7B 5KSBA 3ALXA 1N64H 4I0CC 2DJSA 4KXZI 4LCWD 3GKWH 4M6NH 5TE6H 1I9IH 1T2QH 5A2FA 5J8OA 1I7UA 5F1IB 5EO1A 1ZEAL 3MOAL 3NIGF 3C08L 1S7QA 2VXTL 1WEJL 4K7PY 3LDBC 3PWUA 1UENA 5F6HJ 5F3HB 2QSVA 4PGBB 1A3LH 4ZFFA 4HPYH 4FQCL 3RVUC 3W9EB 1IEBB 5IB4B 4V3DB 2JB6B 3MV7D 3RBGA 1KELH 4MDIB 1FDLL 4KV5F 5AWNL 5TDOB 1YN7A 4ODBD 1MQKL 2VE6A 3FN9A 4JQXC 1S9VB 3WLBB 1BLNB 2FATH 4KQ4L 1H8SA 3QA3A 4M1GL 4WJ5B 4AK1A 5C71A 2BMKA 1MAML 1KCSH 4AIZB 3FTGB 3QULB 2XN9D 2WNGA 4XP4H 3PWLA 1NCAH 1EAJA 2NY5H 4AZ8A 2Q20A 1CGYA 3IFPA 5DMGD 4UOW0 1AP2A 2ZNXA 1N5AB 3QEGL 2NY4B 5J4MA 5DMKA 2ZWLT 3C6SB 3WSQH 4BFIB 3J7HA 1ODAA 4LRIA 3E6FB 2E7CA 3E8UH 2X4TA 3VXRA 1RHFA 4JKMA 4YBLB 1Z9SA 5HGGS 4N0YH 2VOTA 5E2JA 2FLBT 1MI5A 5FK9B 4B50A 4HH8A 2MMXA 5DK2B 5D2LF 5BZDB 3O3DA 3OAYK 1I7RB 3DBXB 1MWAA 4G8GD 4PJ7E 5I15H 4LL9A 1QBLH 5LJYH 3QHFH 4LSUL 3WDJA 2PW1A 3GSWB 4K94C 4S1RH 4ODXA 4JPKH 4C4KT 4XCFH 1JGLL 4GUPB 3ARGB 4X0KB 5DD0H 2YPKA 2P49B 2UVFA 2HLAB 5C0AB 3EJZC 4PRHD 3DJ9A 4W6XB 4ZAKA 4K3DL 3STZA 4K7PL 3OKOB 1GGIL 4FQLL 4NIKB 4KMTH 3KLHD 3V4VL 5DMYA 3S3JA 5AG9A 2ARJA 3HNSL 1IAKB 5FB8B 3GI8H 5ICXB 4S1QL 5KVFH 2NX5B 4ZUVA 2DF3A 4XZUB 2Z92B 3MNWB 5IESH 1UC6A 2RFXA 2DD8L 3B9VA 3U9UB 1MNUL 2O5ZL 3E6HA 2AJYH 4WCYH 4NQCE 2MCPL 2Y25A 4HWBA 2AGJH 3VXSA 1T4KA 4R96A 5C3TA 3W39B 2EYSA 4TSAL 1CE1H 3OGCB 3MBXH 1Z3GH 4KVNL 5HHOA 1IGIL 1KIPA 1NBYA 2X5PA 1A7OH 2PXYA 4KKLC 1I8IB 4J4PA 5CWSB 3GGWA 1OY3B 4HIJA 1K4DB 4NSKB 5CP3H 2BSRA 4WY7L 1Y0LA 3SCMA 2HVKA 4XPHL 3EOTL 3QRGL 1Z9LA 5DQDL 5IKCB 1Z5LA 3GBNL 4PJ7B 4AY0A 4BYHA 2EE6A 4PG2A 4WGVB 1ONQA 1BBJA 3HZKB 3HHRB 4UUJA 2BNQE 3QT2A 4HUXA 4JHAL 3HE6A 4DVBB 3QFDB 5DD5L 2PW2A 5I1GL 2BC4A 4N5UA 2BNRE 3PV6B 2F54A 4MWFA 3OAZK 3MC0A 5IVNA 1HSAA 4HLZG 2EDLA 3Q5TA 1X5KA 4PYGA 4IEFB 4YBQD 1CXFA 1CI5A 4GFTB 1JJUA 1JRHH 1NJ9A 1WK0A 3BWUC 1CD8A 1UH4A 4UQ2A 5E2VH 1FL6A 4FQXB 1C5BL 2V17L 1FZKB 2ZSVB 4U3HA 4X6CE 3H9SD 1GOFA 2UZIH 3BXNA 2PO6D 4XAWL 4QRTA 3I2CL 2OJZL 3OQ3B 4OZIE 5I30L 1FJ1A 4HHAB 4RAHA 1QSEA 4JVPA 4OD1L 4NQCB 1D5IL 3EYUH 2ADFL 3PF2A 5KS9F 2EIDA 1IEHA 3HI6L 1DQTA 2HJLB 3TFKD 5IWLA 4IRSB 5GRVK 1YMMA 4TOYH 5TDPB 2WWKO 1M7IB 4X9IA 3H0TA 3H8NA 3Q6GL 5FUOL 1OW0C 5HYSB 1GAFH 5BW7A 3FT3A 2NY1C 4LPUA 3NVQA 4M4RA 4R0LC 2I5YL 3ZTNL 1I9JH 5J1SC 4MX7B 2IG2L 4W68A 3GSQA 1MEXH 3NAAH 3MYJA 3JUZA 4MA3B 2ATPB 1J7VR 4YEFA 2HT4C 4J3WA 5DT1L 4QKXB 4ZDHA 5MI0B 4P5TB 5IK3A 3UROR 2VLKD 1UYWL 5F7KC 2XZCH 3HG1E 1PKQE 3MLSL 2BY3A 3CZFB 4K9EH 4NDMA 4X9BA 5I1CH 3TJHC 5DQJA 4F37F 2A0LC 2ZOKA 5F89B 4Y5VC 1N59A 1QTYT 1RK0B 1RZIB 4XCEB 3MREA 4OI7A 5C7XL 5JLZB 3C5JB 1B4JL 1VEMA 3RWIB 1UZ8A 5D7LE 2C3HA 4M6MH 4L4TE 1MCSA 4R90H 1XEDA 1UB6B 4I77H 3SDAC 3K2UH 3G9AB 1AQDB 1GOGA 4P2QD 3F5WA 1GHFL 2AI0L 3V6FB 4YLQT 3SGDH 1B9ZA 2B4CC 4Y4HB 1RZKL 4RMSA 3QUML 2YS4A 4XX1G 2Y36H 2XNAA 3PWPE 5SX4I 4HGWB 4XCCH 4NO2A 1JZ6A 4Y0GA 4HX1A 5DJYB 2CDGB 1U8PA 4LHUB 3P0YL 2VUOA 3T1WA 5AD0A 4M48L 4RDQF 3BPOB 2AJVL 2J2ZA 1TPXC 3DIFB 1X5XA 2QEJA 5DMGC 5HHQA 5F7DA 2C1PB 3QUXD 2RJMA 1A4JA 4U1SB 3S88H 3O4OB 1IM9A 1PKQB 4YHML 2FEDD 4M61B 4LSVH 4HZLB 2I24N 3ZT5A 4UV4L 3SY0B 2FIKB 4JFYA 4KDWA 3LPFA 3UC0H 4L4TB 1KC5H 4JAMA 3MLZH 8FABA 4YDJA 3HRZA 5MEND 4Y4KA 1J12A 5CJXA 1FZJB 4EUPG 3U4AA 4U33A 1MIMH 4LCYA 1K6QL 4YHNA 2YUWA 1KULA 2P43B 3UZQA 4FP8H 5HDQL 3P30H 2P8MB 3T0EA 4CN1A 1TFHA 2YRPA 4IJ3C 1NANH 3SDYH 4EI6A 1P7KB 1S9YB 4OF6A 2B1HH 5T3XD 2J8UB 4BK4A 3KLHC 4OB5L 2B5IC 1W2KT 2GUOA 3KS0H 1WCBA 3M8OH 1QFWL 2EKSB 3O3BB 3QDMA 4QTHA 3SKNA 2BVQA 2DQUL 2WUBL 1YY9C 3HS0A 3O11B 3HUJE 4BQ8A 5C6PB 2X1OA 4F80A 1P4BL 1WT5C 2ICEB 3CJJA 4OCLC 3LY6A 3AY4A 2UWEF 5DRWB 2X9WA 1KTRL 5EN2B 4NUGL 4OZHA 3PWNA 3QFJB 4MS8D 5J9PA 1QLEH 5KVEL 4OUUB 1T0MA 2B2XL 1FVDB 1AI1L 4JY4B 3JWNC 4PJIB 1OAQL 3LPGA 1JF1B 4Z77B 1HZHL 1QBAA 2W59A 5HHVL 5HI4D 5GGTH 3DX7A 3L5WB 3CFIC 3V52L 1PY9A 4WIQA 5DVKA 3Q3GA 4XC1L 1BPVA 5I1IH 1D6EB 3MRNB 1A6UL 1EZVX 2D3VA 2A9MH 5JPMA 2QR0A 1DBMH 2DLFL 4TVSa 4JG1L 3RY6A 1RK1A 4N0FA 1NMBL 2QHRH 4M5ZL 3T8XA 5GRXG 4TRPH 2W07A 1QR1A 2H1PH 1S7TB 3CK0L 1TCMA 3BIKB 1IKNC 5J89A 1TZHA 1LEGB 2FHBA 3LEXB 1BD2D 4Q74A 2X4NA 5DJAB 1VEOA 5GSRB 3NTCL 4GMSL 4JM2B 5TE7H 3ERYA 3KNBB 2KQNA 5TH2A 2E7LE 3DRTB 4UB0H 1D5BA 3VFGH 3HUJB 4Z7QF 5H37H 4LSPH 5I75B 4PTTB 1VFAB 2PO6C 2PYEB 1WFNA 2WIIA 1E4WH 3EOAB 4P23D 1KLFA 5KN5A 4R2GD 1KJ2B 4OLVL 5KSAD 3B8SA 4HDIB 3QXAB 1ZSDA 2H3NB 4HWNA 4NKIH 5C0BD 4G6AC 3GJEA 4K2UL 5GS2D 1BHGA 4UTAL 5F9OL 5ALBL 1WJ3A 4DN3L 3MXVL 4PB9H 4XPGH 5I9QB 3H7LA 4P5MA 4POYA 5C09A 3GSNA 4ZQKB 5EU4A 3KPQA 4TVPE 4CW1B 4EKXA 4LDOB 3ZKND 2DI7A 3KR3H 3IDJA 1QYGH 4MYWB 2AK1H 4JM4L 5TE4L 5F88B 2FECL 4HKZA 2BFVH 3KPSA 4CGTA 3OKEB 1WZ1L 3D9AH 4H88L 4FTVA 3PNWB 2AXJA 1C12B 1I7TB 2K3TA 4PJDA 3WO4B 3FB6A 2XFXB 5A16A 4NZUL 3RDTB 4EN3D 4J8RB 4LBEB 2IGFL 2IH1A 2E7MA 4RISL 3LQZB 4NRXB 4ZUSA 1ZEAH 3MOAH 4C55A 3C08H 3V7AE 1WEJH 5F44A 4G8EB 4IOFC 4LPTA 2G75B 2O5XH 1NLDL 4MJ4A 5IR1B 2HH0L 4H5SB 3B5HA 4MD4B 1JPSL 3RZCD 3DX6B 4M7JL 2IEPA 4YR6B 3UTTD 4V3EB 5SV3A 1FDLH 1OAKH 4IIQA 1UA6L 2Q8AH 3LN4A 3MBEB 1F5WA 5D1XD 3DHJA 4L8SB 1EVTC 3BX7C 1F6AA 43C9A 4U1IA 1PZ5A 5HPMA 4PJBF 1JCKA 4NN7B 4LP4A 3NCBB 2W60B 1FYTB 4YDVB 1L8JA 1QFUL 2I27N 2Y06L 1DQMH 5FECB 3W2DL 1DZBA 3LIZL 4CU6A 1CXKA 1NCBH 1HYRC 4NQVB 2Q8BL 4PTUA 3TVMD 5I17B 1URLA 5JHDB 1KJ2H 1ZS8B 4H25A 4RIRB 1SBSH 4HIIB 3MA9H 5A3ID 3PWVB 3WE6A 4WUUD 3QUXC 3S37X 5EO0B 3N06B 1IT9L 3BE1L 4NCDA 3OXSA 3FMGL 1I8KB 3S36H 5IIEA 5MEPA 1GYAA 1EUUA 2EIZB 4O51A 1HILA 3S35L 4GBXA 2JTDA 4QWWC 1M7XA 3SJVE 1CWVA 5C92A 4NOBA 1RUKL 4KRPB 1JGLH 3ETBF 3RTQB 5H2BA 4ODSL 5DZLA 4I4WB 1A4KB 5CJOL 4D8PA 1ZOXA 3VXTA 3RVXD 3OPZL 2HA1A 3JSSA 4K3JH 3I50L 2ZUYA 4BZ1L 2OK0H 5CGYD 2YN3A 4QHNA 5SWSA 4UOJA 1BEYL 5IW6A 4G7VL 4HAGA 4Z95L 5IB1A 4OLYH 3QJFB 5EZOH 5I76A 2FJGB 3OKLB 5FYJE 4GG6E 1FZOB 5CINH 4ZPVB 3RUGF 3GUTA 3ZSTA 1R3KA 4O9HH 3VXUB 3MLXH 2X70B 3V5DB 3IKKA 5CILL 3MRBA 2W65A 4HWZA 2DD8H 1JTTA 1HKLH 1X4ZA 1MNUH 2FGWL 4GMTH 4NP4L 1LO2H 4UBDC 2VLRE 2NY6B 5E9DA 5C0IB 3MJ6A 5FO9A 1EGJL 4X98B 2R0LH 2XPGB 1Q0XL 1YECL 4KZDL 3QH3B 2JIXD 35C8L 4LOUD 5C07A 3D3VA 1U8HA 4KVNH 3UP1A 1IGIH 4WWKD 4GT7A 3DMMA 2J4WH 4APQD 3PHQB 1G6RA 2X89A 1D9KD 2JCCE 5E94A 1I1AB 3MCLH 3MJ9L 4FABH 5CZXC 3N0PB 3BPCA 4C57C 3RHWK 4U6HB 1I8LC 2VIRA 4UT7H 1U8OA 2N56A 1N2RB 4XPHH 3LOWA 3E3QE 5DQDH 4URTB 3C6LB 3GBNH 4MS8C 1EJOL 1WSST 1DQLL 1RZ7H 4R4BA 3VWKD 4L29A 4TVPH 4X7SH 4E5XB 3BZFA 1Z0NA 4NCC1 5D71L 4CVZA 4WFGD 2VKWA 3ILQD 1ADQH 5T33H 4RDQG 3V6OA 1W72L 4FS0A 1T04A 2AK4B 5TF1H 3ARDB 4JRYA 25C8L 1I1YB 5H94B 3VRIA 1S7VA 3SDDB 3C5ZB 4JQIL 1T22B 2DQGH 2RAMA 1NUDA 3QUMB 1I1FA 3ARED 4CMMB 4EDWL 2A6DB 4OJFL 4PG2C 2Z35A 5LCVL 5FA4B 5F9JB 3SKOA 3ZDXF 4WW1B 3MQIA 4RCAA 4Q0XL 1AGFA 5HPOA 1C5BH 3HAEG 3L5HA 2VDLH 3B9KD 4OD2B 4QRRA 1U41A 5I30H 4OKVA 5E6YA 4OLZH 2EIBA 2VLRB 4KHXL 4JFDB 5DK0B 1N4XL 4PP1D 5BMFH 3PJSB 4WI9A 2BVOA 1INEH 1A1OB 2R1YB 2UYLB 2WINA 3EYQC 2AEQH 3PDDA 4RGND 1FNSH 1I3RA 5EUOA 2R2HB 2P46B 3IDYB 5I8CA 1JHLL 4JO1L 2IG2H 1F13A 3SDXE 4TNVK 4IBLT 2PTTA 3MACL 3QZWB 4D94A 1TJGL 4G43B 1OM3L 1MLBB 2ILLA 1G7QB 3BKCH 3RI5K 2JK5B 3TNMA 3KYNA 4WENB 1N5YH 1EIBA 2OTWA 1LNUB 5B3NA 4UDUA 4HWEH 4R7DB 2HT3C 1UT9A 3ULVC 3EDDA 1R5VA 1T3FB 2A9NL 2ZUSA 1KB9K 1WAAA 4RMVA 3U82B 2F15A 4KMQA 4MAUH 4KKCD 5EG6C 1TXKA 1P2CB 4EXKA 3NPZB 3KJ4B 1U91B 4IRJB 2VZSA 4KTYA 2BOBB 4LPWA 1IQDB 2P5EE 4P4RA 2IQAA 2DQHL 3LKOB 3MPCA 4ZTOH 2QSCH 3L5XH 3VDAA 1GHFH 1MHEA 3DXAD 2Z0BA 1XCTB 1F3JB 1AGBA 3QEQD 5KSUB 3QP3A 1YEIL 3DX8B 5M7QA 5HVWA 5D1QB 5ESQA 4GG8A 1AD9B 4M6AA 2VITA 3HE7A 3TA3D 1A5FL 5CSGA 5FYJH 4X7TA 1TQBB 4E41E 2E27