5H9EK

Crystal structure of e. coli cascade bound to a pam-containing dsdna target (32-nt spacer) at 3.20 angstrom resolution.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
199
structure length
139
Chain Sequence
MYLSVIIAWSRDLYQLHQGLWHDFLFHVECHVLLQSAQMSTAVATVIQVEFQLQVGVPLYFRLRANPIIKEAEQIAWLQRKLGNAARVEDVHPISERPQYKIQTVCFEGVLTINAPALIDLVQQGIGPMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
publication title Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Immune system/rna
total genus 21
structure length 139
sequence length 199
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5h9eK02
3QRRA 2Y8YA 5H9FK 3QRPA 4QYZK 2Y8WA 4U7UD 2Y9HA 5CD4A 1WJ9A 3QRQA 4DZDA 5H9EK
chains in the Genus database with same CATH superfamily
1REVB 3UN3A 5KFPA 1Z2LA 4JI3J 3GLJA 2VPYB 3DI6B 2JSXA 4QIVA 2Z30B 3L95X 1BQNA 3EDRB 4EWTA 1H0HB 3M6XA 3V6DB 4DV2F 8AT1B 2EFNA 4EEYA 3J7YU 1FJ7A 3HSZA 1FJEB 4ITSA 3BKUA 2ZWPA 2CPYA 3IWLA 3CJ3A 3VF0B 3VV2B 5HK4A 3AOCA 2GMHA 3KJNB 3SQGA 4NASA 2KFNA 3MTKA 4M8LA 1OMSA 1R8HA 2W8LA 1S0VA 1NB7A 3BN7A 4HI1A 2K3IA 1IKWA 1OJ4A 3AFGA 2L9NA 3QQCD 4K4WA 2DNMA 1Z4UA 4AL6A 1LW0B 2H5JB 1HI8A 2I8EA 5JJBA 1QAIA 1TAQA 2J9DA 3HHLB 1FNXH 3NLCA 3QGGA 3BQ1A 2DGSA 1ZAVA 3DXBA 4USWA 1FX2A 1GX6A 4ANDA 1SIZA 5ETQA 2B7CB 1C0TA 4J9MA 1ZZNA 1U6BA 5SZTA 2XTJP 1RGVA 1XJWB 1NPKA 2V69A 1HQUB 4DV3J 1NDPA 1PYSB 5L46A 1G7CB 1VISA 2OHDA 3MM7A 1T9TA 4QIFA 1RJJA 2HWIA 1P8GA 3BDPA 3KK3A 3LQVA 3V4IB 5HI7A 2XS2A 4KGZB 3PYFA 1KQFB 4LF5J 1RT4A 3M32B 3VGTA 4A8FA 1VK8A 4RW4A 1BHNA 3PM9A 4OV1A 2MGZA 2BE2A 4Q0BB 3QSYB 2B5JA 5C5JA 1SVDA 5H9EK 4J9OA 1LW2B 4QYZJ 1WORA 5FIIA 2IA6A 3AH6A 1NU4A 3NWRA 4P52A 1WOSA 2CZVC 1O0PA 4F50A 3MMCA 2K06A 2FPHX 4OYPA 1LOUA 2DB1A 1IR0A 1YBUA 4DS4A 3Q22A 5DGAA 3MM8A 4YEAA 5DDRC 3IS9A 2ZOGA 3A3PB 4DN0A 2R8HA 2R8IA 1N36J 3OSPA 1TKXB 2JEFA 4OYIA 2UZAA 3TUJC 4X62F 2L3MA 3CCVS 1KNZA 4ID5B 4JI7J 2RS8A 5L39A 2KHCA 2ZE2A 4Q45A 3CF5Q 2V8DA 3JQKA 4J9LA 5GVQA 2P9GA 1RAGB 1VQOS 3DOKA 1YRUA 2RILA 2X1BA 3VVTA 2CJBA 2ACMA 3TYTA 4DPYA 3EMTA 4OYOA 3PYDA 2HG4A 1X7VA 4Q43A 1D9FA 1BQMB 4S0MA 3MZIA 2CWKA 2A3JA 4UZCA 3SCJE 4LIRA 2MDAA 2OFGX 4CM0A 2W9CA 3LP2B 4OJGA 2HLTA 3IMQJ 2E9ZA 3D6FB 1Q95G 2AEJA 2DGVA 1KDNA 4QWCA 5IM0B 1HBNB 2ASYA 2OEJA 4Y2CA 1OY6A 5HO4A 3X3UA 2D9OA 2XI3A 1SJ4P 1FDAA 2AYGA 5KG7A 4A8QA 5EGYA 4CDIA 3T19A 4ER8A 1P9QC 3M6WA 1S0MA 4WU2A 1WSVA 1TV6B 5HROB 2IDLA 3GONA 5DQIA 2CJAA 1N5QA 1GH8A 2UXBF 3EX7B 2ZH5A 2AU0A 1S1WA 2HHPA 4NLDA 2M70A 3C16B 1X8DA 2CPDA 4UUXA 4YB7A 1JXEA 2VG7A 5DDOC 1MU2B 2OD4A 2DYAA 1IQZA 4D3HA 3IC1A 1S79A 3GV8B 4KH1B 5DJBA 2QJ3A 2QSWA 4OV6A 4CLPA 1F5AA 2YBVA 4ZVPB 3Q8PB 4O3NA 3MD1A 1HQEA 2YWKA 1QSSA 1O5JA 3OL9A 1MN9A 4PPZA 2FJWA 2DGQA 3NG8A 1NUEA 1KP6A 3TVZA 1UVKA 2HIQA 3TAMA 4N47A 2UUWA 4Y6IA 4F4AA 1M5SA 3I31A 2MZSA 5G4DA 4PXCA 2WW4A 1MWYA 2BRLA 3CIMA 4WWSA 2DGOA 1UA0A 2HK2A 1IKVA 2E9RX 2LECA 3MM9B 2OPPB 5HQMA 2FVPA 1WJ9A 1HMVA 3G71S 3HULA 4DV6F 3BS9A 3BKFA 3QO9A 5F9LA 3PTWA 3P5TL 4LSNB 4MKVA 2WSEC 2KDOA 2HMIA 4I0WA 1NJZA 4PWWA 2QYGA 4J5OA 2HHUA 2ASDA 2H48B 5KFOA 2GS8A 2BW7A 3DRYA 1H2UX 4F02A 1NJWA 1T9XA 1YJ9S 2RIJA 4Y2IA 3VZIA 1MWQA 2E5GA 2DPJA 3OD2A 2QX0A 4FN5A 2CJQA 3TAQA 3UO0A 3AXMA 3K89A 3SIPB 1YVFA 3SSRA 1JXVA 1X4AA 1NDCA 4KYZA 4RNNA 3FRYA 3ISZA 1F5CA 3MR5A 4B3SJ 3MFIA 1W25A 2Y1JA 2IAJA 1X4DA 1FFGB 2W9AA 2Y0SD 2KM8C 2R9LA 4U9RA 3KLGB 3J81Y 4RW8B 1KSPA 3GTYX 1RKJA 1RWUA 5A6PA 2FVSA 4UQGA 3MHYA 2ZVSA 4B02A 2JNJA 3M9OB 1T03A 2B56A 4XAKA 1HNVA 4N56A 3P6YC 2H51B 4B3RJ 3T6JA 3C6UB 4NMLA 4KGMA 3GPAA 2M8HA 3HJVA 2FTRA 3HVRA 3GIJA 1URRA 2EFGA 2XHWA 2VA2A 5THWA 3PR4A 3R5JB 1SL2A 4I4BA 1FKOB 4IOBA 2Z2YB 1QY7A 3DHXA 3TX8A 3O2IA 4WFAQ 4KHPF 2VFSA 3HKZD 5A76A 5F0WA 4IDKB 5HMXA 1BC6A 3G8QA 4RUHA 4NL5A 2MZQA 1LWFB 1XQIA 3TUZC 4I7FA 2RDIA 3HHNB 4ICLA 2LQBA 3H42A 4DOZA 4HYKA 1N5VA 3M1VB 1B0PA 4OZLA 3IR7B 1S9GA 2VD3A 2ADBA 2EG1A 1F0XA 3BB5A 3CNQP 1UWBA 2KH9A 3POTB 3UD4P 4WJBA 3L3CA 1GMVA 2IYIA 4LVOP 3WIUA 1JKHB 5IWAF 4KGVB 4IFYB 4LT6A 2GO8A 2XMKA 3KK2A 2CQBA 3CW2C 1UW4A 2XMUA 3PVXA 4ZIVA 4ZPTR 1FE4A 3CC7S 3M2UA 4I2QA 2WVEA 3JYTA 4I2PA 4PXBA 4DCJB 2VPZB 2PT0A 1DTTB 2BQUA 4DX8H 1S1VA 5J2NA 4DBQA 3AHPA 3BSAA 4OJ3A 4U7UD 4KV8B 2HHVA 1DQAA 2QV6A 3SEOA 3VZHA 3FCHA 3SQOP 3OR2B 1OWXA 1K8AT 4Y34A 4B3MJ 2OPRA 1JJ4A 1EKRA 3DMJB 2OD6A 1GXUA 1T3OA 2X3GA 2OPQB 5C25A 1HNWJ 1JLAB 1ZBTA 1H73A 4K4TA 3B4DA 4DG1B 1RWNB 2B43A 4TY8B 4I56A 1N6QB 4ANEA 4FNHA 1DAXA 2YPZA 5E33A 5AT1B 1X9MA 3RTVA 5B0EA 3RB0A 3EXYA 4F67A 3JB9k 1TL3A 5EDWA 4Q7AA 2CRLA 2A1BA 4KH0B 1RT2B 1CEZA 4TLQA 4EK2A 1FDNA 1RT6B 2GCFA 1AFJA 1JLEA 1RAAB 2V2VA 5E2QA 2XBPA 2V4QA 3K59A 3CMAS 1RWXB 2V9WA 4DL2A 3WZ0A 2XWYA 2ZHAA 2EFQA 2AYEA 2V5HG 2DNHA 1WG4A 4ATNA 1RTJA 4DFPA 4E98A 3RU0A 2KHDA 5I3UB 4KRWA 3E2EA 2FZKB 4F3MA 2E9TA 1RHQB 1CJUA 1NXIA 2HGMA 2UXDF 2PMWA 2EXUA 3G86A 1TUVA 5L8RC 2IM2A 4NCGB 4UOCA 4C11A 4ZJQA 2K2PA 2HWTA 2B4VA 1R8CA 1OSCA 2FJVA 2OIHA 2J9CA 2FY8A 2WVDA 1S4FA 4MIBA 3T41A 4OI0A 5I3QA 4N5SA 5LXYA 3LP0B 4LFAF 1RAFB 2V4JA 2GVDB 3M9NB 4DS5A 4QU7A 4QR0A 1FK9B 4USHA 3SV3A 3ILLA 4GVBB 3ITHA 1U0HA 1LFPA 1RLDA 3PW0A 5GADU 1ELOA 3R2CJ 3W2WB 3AY0A 2EC2A 1R27B 4KKOA 2DNOA 4KAIA 3KYLA 1J5EF 1N34F 1W2IA 1KTVA 1HBMA 3MUMP 5F8JA 2JEIA 1ZM4A 4QWBA 1P6TA 3F41A 1XC9A 1FFWB 4ED6A 1RKIA 3M8QA 4ID8A 1LNQA 4LJMA 4UW2A 3FBFA 4QIEA 3OL6A 3LP1A 2HFNA 2MZ1A 1VBXA 2MKSA 1GXTA 4RW9B 4C48A 4EO6A 4F26A 2B4PA 2ZJRQ 1LK5A 2E1PA 3W5XA 4HH0A 1LWXA 4FPIA 1FXRA 1N32F 3CD0A 5KT4A 4URSA 1QDUB 2L48A 3C6TA 4ED2A 1QUPA 4ZVGA 3I32A 4DL4A 3MOZA 2EWHA 2EC0A 1M1KT 4ED4A 2X7IA 4DR6F 2VQEF 3D6TB 1Q8LA 1GXLA 3KLFA 4ECSA 1D0EA 2VBWA 1IXKA 2ILYA 1SJRA 4LF9J 4RR5A 1AZSB 1C4AA 2YKPA 4ZLNA 2QLWA 3CCJS 4QWEA 1H6KX 3OL8A 2RS2A 1KOOA 2YNGA 5HQ8A 4M5NA 1R7IA 2LDYA 3GYNA 3BSNA 3G96A 4KIAA 4FBUA 2EK6A 2JC0A 4MTPA 4EBDA 3GJTB 3LTOA 2OLWA 2FZGB 1CC8A 1GAOA 1S7IA 3HD1A 3D0GE 4M5GA 3GFYA 5F8NA 4HLBA 2HHTA 2IRYA 2CQGA 1HQ2A 5DQHA 2E5HA 4NXNF 4RO0A 1S97A 1PYOB 4B9LA 2B8QA 4UOHA 3ETOA 2B9YA 5FDLB 1L3UA 2UUAF 2HRYA 2AEFA 2XWXA 2ALZA 4CNYA 2XS7A 1O51A 4DV5F 4DU7A 3C14B 1EP4A 4DV0F 4NLXA 2CUYA 3GFXA 1M5VC 4QR2A 3TR5A 2VC1A 1H7WA 3MFHA 2IJNA 1HLWA 4DPOA 5D4PA 5A8KB 3DLEA 2LQ9A 1PIEA 1SKWA 4EUVA 3M4XA 2P9CA 2B6AA 3NCQA 3G6VA 3DHWC 3PIPQ 4B9SA 4ES1A 2AZ3A 2XO7A 5ADZA 4Y0FA 4ZN3A 3VALA 4JI3F 4ZP8A 4CLTA 2LQ8A 3T1HF 3OTBA 3LF0A 2LMIA 3LOUA 1HR0J 2JDJA 5A2QU 1VQLS 1RB0A 5EWGA 1EJ7L 2APOA 4K2JA 5CYQA 1YJTA 3W5ZA 2KRBA 4CI0B 1RYSA 5LM7E 2GMJA 2QL5B 2UXCJ 2YKNB 1FRJA 3EGZA 3AJDA 4F04B 2ASLA 3QATA 4RNFA 3MMBA 3D0HE 1K0VA 2WVCA 4WE1B 4LFBF 1T94A 4O3OA 3H4BA 2CADA 1Q5VA 4HI2A 2KFZA 3VAMA 2NXCA 3VAHA 2DXFA 4ECQA 2M88A 5DRKA 4Q2MA 4OYZA 2IJFA 1W2BR 1UEKA 1BE4A 2BEFA 5KFZA 4G1QA 5IC6B 5HP1B 5KOXA 4F4WA 1RAOA 4L3NA 5DG7A 3OW2R 2XYGB 3CD7A 3FUYA 4ZP7A 4YFUA 1M90T 1A7GE 3TI0A 5L1JA 2HQCA 3KG1A 1TELA 4XO0A 3CJQA 3G82B 5HLFA 4ELUA 2BJEA 3OPKA 4ED8A 2W7OA 2R4FA 2F8MA 3CJ8A 2HVHA 1TVRB 3H5SA 5F8HA 4IH6A 5GAHI 1G1XA 3DOLA 2DH7A 2OEKA 1QD1A 5EUHA 2CZ9A 2YNFB 2JWNA 4LF5F 2RQ4A 4DEZA 3UR3C 5DM7Q 1NKBA 4WCEQ 4IR9A 3MM6A 4KTQA 5I4MA 3M8PB 3UDLA 4USIA 5HMYA 3QT7A 1E6VB 3NBPB 1PG5B 4C8NA 4JI5F 2G0IA 4DSFA 2LA4A 5J1EB 3R7BB 5HSPA 1KONA 2XC9A 1I51B 1XNQJ 3HVWA 2WVBA 2DNKA 3HD2A 5I42A 3THPA 3CJTA 2Z2MA 2QA1A 2YNIA 4DQPA 3QIDA 1EIYB 2CPZA 4BWMA 1DTQB 2ZHOA 2CVIA 1N36F 6FD1A 3B54A 1S1XB 2DH8A 1RCOB 3CCMS 1VQMS 3Q8UA 5KFLA 4LR9A 2HHHJ 2VF3A 1VMBA 4NLUA 4YP3A 3K5NA 2AD9A 3TZXA 4DXLA 3PEJA 3W3SA 1S12A 4ELTA 2P6TA 4QYZK 3ISND 4CP5A 4B9NA 2CJ9A 4P71A 2XMVA 3LWMA 2KM8B 1OPZA 3QZ8A 1T9UA 2M52A 1HW9A 4EBCA 2ZM6J 4F2RA 3THTA 2SXLA 2XLKA 3H5XA 4Y3CA 1NSQA 5LMUJ 5ETPA 1UAWA 4ZCKA 3KLEA 1RACB 2VKRA 2G2OA 4DV1F 2ZITA 2E1RA 4IG3A 2MKJA 2ZBCA 4ZMMA 4OMFG 5CCMA 3R1LA 2KRRA 3OVBA 1Y10A 4CH7A 3I0RA 4RX6A 5IV4A 1R8BA 1RTIB 3NRBA 1FJGJ 2Z57B 2J7KA 1FRHA 2K7KA 1RTDA 1U0SA 1JLCA 4DR5J 2MSTA 2YKAA 2UUBF 3MAQA 1X4BA 4ZPBA 1KVJA 3LAMA 1FWKA 3Q8QB 3H25A 2BDPA 1PGZA 2Q1LA 3NAIA 1FKPA 1RABB 1YQHA 1GTHA 2QLJB 3RAQA 3PCOB 3OFFA 1WEYA 3KJVB 3KLHA 3QYYA 2BJ8A 4O0IA 1WG5A 3FRZA 3MCSA 3CO9A 1J27A 3NNCA 2XM3A 3AXKA 2AJ4A 5IQQA 2CPEA 5CCLA 2AMCB 3PXGa 2QL7B 2OAUA 1TL7B 1VQ4S 2FJEB 4USVA 4WTYA 1Q5YA 3G6ES 3HT3A 3B8HA 2ZJPQ 2LEPA 1AXQA 2E66A 5A8WA 1RAIB 1LFWA 2HBYB 1S6QB 1JNRB 2LQ5A 1RWPB 3MDFA 4NLOA 3N9UC 4ELVA 1X4FA 2VPWB 1WEZA 2D69A 1SIWB 4IG0A 3N6NA 1K1SA 2FJBB 4EYHB 2J7WA 1FNOA 5LSRA 4HACB 4BCAA 3ONQA 2I2YA 3T5JA 3ZZTA 1HPZA 2GVZA 3UE2A 4JI4F 2HFVA 2JLGA 4HVZA 1Q86T 4PYDA 2BKNA 1CJKB 1FWLA 4HHUA 4QBUA 2W9BA 5LXRA 4RNMA 1MMLA 1RAHB 3M2VB 2HZCA 4CTAA 2F40A 1S49A 2G1HA 4K50A 4NLRA 4FXVA 2UVWA 3ENWA 1YI2S 2DNRA 3T9NA 4FVMA 3ULHA 2C2NA 4EGLA 4TYBA 4H4MB 4IKAA 5J2PB 5K14B 4B3SF 3V81B 2CQ0A 4F4ZA 3JSMB 4NI2B 1WWHA 2WOMB 2RKIA 3UN2A 4F3QA 1RT5A 3MEGA 4P73A 4M5KA 2G0JA 4UTGA 2KT2A 2IC3A 3TEHB 3MEKA 3IP0A 2FHOB 2F8HA 2Z2ZA 2DRBA 3QLHA 2KFYA 2AQ4A 1ZTTA 3FQLA 2FJXA 4I68A 4X4TA 3UCGA 4FP9A 3SDEB 1MROA 3HF5A 1UFLA 3TX0A 4ALZA 4Q8EA 4C0BA 1KFDA 4PG8A 4OZNA 4B3RF 1VOMA 1FVQA 1L3KA 1CBKA 1FERA 5ETLA 4URGA 1RDRA 1GT8A 3CUNA 1HNXF 1B0TA 1SUQB 4EBEA 2W1BA 2KN4A 1WDTA 4C8KA 2IRXA 2AF6A 2HZAA 2I9SA 3WX4A 2QFIA 3FFIA 2XCAA 5HQLA 1M0SA 3CCTA 3R8YA 1IKWB 4QIGA 2D41A 1R89A 1WUUA 3GQCA 1DARA 3GSIA 2H65B 1TMJA 1GFWB 3ILJA 4DLGA 2XULA 2EBEA 1U2CA 5JVGQ 2DHHA 3RRGA 4WTOB 1R8AA 2F1FA 2HFUA 2PGCA 3MECA 2PIIA 2E7XA 1WC5A 1FO1A 3EZUA 2DEIA 3RZAA 3UW1A 3QGHA 4DMZA 2WONB 4FZVA 1Y11A 4KO0B 2DR7A 3ISNC 1TL4A 2ZNYA 2ZC3A 5LSOA 3HLUA 1ROFA 2R3VA 2ZH9A 4IQMA 3BSOA 4PYAA 4M95A 2DCUB 5C42A 1FDBA 2I5JB 3PV8A 1KQSR 4YUDA 1CS4A 1XMBA 3OTCA 5KFQA 3DLGA 2UV8A 1M5HA 1ZS6A 4MKBA 3I5CA 2V8PA 3CCQS 4N77A 1IR2A 1DQ9A 4K59A 3VR1A 2XY7A 4LF4F 4DZDA 4NXMJ 1FWPA 3TZYA 1M1HA 1RT4B 3Q2SC 1SB6A 1YJRA 3M30A 2CQ1A 1NHUA 4RW6A 3TVKA 4FXWA 1XMQJ 4B3MF 4IRCA 2MGZB 4ZCIA 4V19X 2OJ3A 4KT0C 4WIQA 4DX7A 5A8RA 1HNWF 5AJ3F 2BJDA 1X5PA 4M1KA 4U67Q 3HFKA 1QJHA 2UUCJ 4K2XA 1VC0A 1C1CA 5KTQA 1RTHA 4QWDA 3CDEA 3W61A 3S8SA 1JLGB 1T05A 2E29A 4J91A 1N5SA 2VB6A 2Z0GA 3FZBA 1XR6A 1QE1B 3H90A 4USMA 1X0FA 1VGYA 4B17A 2I38A 2J9EA 3P8BB 1CQNA 3E01A 3UDVA 2JHEA 2UXBJ 3OVAA 2W4CA 1KHWA 1YHQS 2VFVA 2J0XA 3FK4A 2KT5A 2ZE2B 4X65J 1WOOA 4LR7A 4K0KF 3NNHA 3MAAB 3LAKA 3DOKB 4IQXA 1UEUA 2ZH1A 4X66J 2OO4A 1X0PA 1SJFA 3L4BC 1FCAA 2DHGA 1TKDA 1TL1A 3K5PA 4CO2A 2DR8A 2CPFA 3EPIA 4LIWA 3QBCA 3JAMY 4MKYA 1Y9OA 3UVJA 2QYCA 2KXHA 4O44B 4M63A 4YDXA 3N79A 1UPPA 4A8WA 4TKTA 3VQSA 1NK8A 2CQPA 2NQPA 3H5YA 1HWJA 1U1RA 4ETXA 1BXNA 3HO1A 2YNHA 3G4SS 2BJ1A 1VQ6S 4OI2A 5HMZA 2B4OA 4IH5A 5HN0A 3GJQB 3M8ZA 2KL8A 1WHYA 3ZNUA 4B9UA 2YQ1A 1VBKA 1LXNA 1KN6A 3OLAA 3DLLQ 3OHAA 1BWEA 3VQTA 2MQNA 1NHKL 3UCZP 1IKYA 1B99A 4OQJA 4CH0S 2D3OR 2VG7B 1S1UB 1RT3B 4LSZB 1MLAA 4R8UA 3JS9A 1XIQA 4EZ6A 1AYEA 4JI6F 1FEEA 3A1YG 2XMWA 1N5TA 2V8GA 2R7TA 2PMZD 1VRTA 3VWSA 3S1TA 5T7LA 1FRMA 1S9EA 1HYSA 1S10A 4DI6A 3OV7A 5EX0A 3V6JA 5D6GA 3V2UC 4LF8J 3N28A 2VU5A 3QSIA 2A6MA 2R2TA 2BANB 3ELHA 1Q4RA 3KKFA 5LOQA 3TAMB 1VYAA 4QJVA 4E0DA 3MR7A 2GIRA 4N76A 2A2DA 5E3PA 1Y5IB 1SC6A 2XMAA 3CULA 2M4MA 4C8OA 3V6DA 1U2RA 2EKYA 4QYRA 2XNRA 4NA3A 1UEVA 2Z2LA 2OTJS 5F0UA 2XLJA 1SC1B 2VOPA 4C98A 2B9XA 4DPTA 1JLFB 1U2FA 5E3RA 4PAAA 2YX1A 3ICLA 1TKTB 2QGFB 4U7CA 4DF8A 3MUVP 2F5GA 1U24A 2MKCA 4C0OC 2HMIB 2ADCA 3R6LB 3R5AA 2KZZA 4TYAA 2NUHA 2XMMA 2GX8A 5HMWA 3K8WA 1VHIA 1NM2A 1ZAWA 4HT5A 1K44A 1T0TV 4CWBA 3HHLA 3IO1A 2EEYA 3KHGA 2ERRA 4IR1A 4PPDA 1HBOB 2CIMA 2HBQB 5GADI 2DY9A 2F9JA 4OX6A 5EHHA 4P6QA 4ZOSA 1YSJA 2E1MC 2GQQA 2MLYA 5KG5A 3HJFA 3FZ2A 2FLNA 1N48A 2DH9A 2HNDB 2JJ4D 3MGJA 2IAJB 1X4CA 2MMYA 4RU2A 2BVZA 2DRDA 1ULRA 3KUEA 1GQEA 5IWAJ 2BX6A 3PY8A 2W7PA 4I6YA 1TMMA 3V4IA 3QPIA 5GAEI 1NNDA 4CIOA 2MQOA 5K20B 1T03B 3M32A 3A3NB 3BH7B 1NZ8A 4RL1A 5KFFA 4OL8A 1GTEA 3BGOP 2KB2A 3UD3P 4MT1A 4Q0BA 2RRBA 3KOAA 4XDCA 5ETOA 5A6WA 3PX4A 5D0GA 2RHQB 3HZGA 3CC4S 2NUUG 2QRRA 2VBYA 2K1RB 1S6PB 2YVSA 3ZTSA 1ZH5A 4UQTA 5MLCV 3UPFA 1RZMA 3GB0A 2H4YB 3QGPA 4A4JA 4CO0A 2R2RA 2IJRA 3SYZA 5FLXU 3A8EA 4NLWA 4OHZA 1XTZA 1VJWA 4X4NA 2MB0B 2Z58B 5G0RB 2WZ1A 4U96A 1WELA 1TKXA 2F7VA 3TP2A 3OUYB 1XN9A 4O3PA 3KDOA 4V1Ak 3NY0A 2ATCB 2KJWA 1NH7A 3EM1A 4ZVQB 2RUSA 1WDDA 1G4CA 2XYPB 3GV7B 3CTRA 4OIXA 3MF5A 5B0CA 1DZ5A 2KG0A 4ZJOA 3DCAA 3M2UB 3T6BA 1BQMA 4I2QB 3JYTB 4I2PB 4MFBA 2QLBB 3A8IA 2B9EA 2MKIA 3OLBA 1UETA 1S1VB 3PYGA 3PW2A 5J2NB 4OI1A 2VL1A 1T3NA 2DK2A 1X5OA 4QIWD 2Y0BB 4HH1A 3MUTP 5IM0A 1HBNA 4OYAA 2O01C 2UXDJ 3FSXA 4HDGA 3IWXA 4X4RA 1KHVA 3CCWA 2R8KA 3ZZ0A 1SXLA 5C25B 2LCWA 1RLCL 4O4RA 4WFXA 2W7AA 2C3YA 3OXLA 3Q86A 1WC1A 3D6MB 4X4VA 2VJVA 3N01A 3AA9A 5IT4A 1TV6A 5HROA 3QFWA 4HKQA 3KUHA 5KG6A 3KK1B 4ZLLA 3TWZA 2XGPA 1F60B 5U47A 4U8YA 3PZPA 1N4LA 1TL3B 3FSYA 2YQ3A 1K9MT 3C15B 1APSA 2R8GA 2M9KA 3G8TA 2E5JA 2XMJA 2HK3A 3E3XA 2XSFA 3MMJA 3H59A 1PSDA 1U02A 1JLEB 1X4GA 1SJQA 2Z8QA 3A8KA 3HXMA 1VCTA 1J5EJ 2VC0A 4KE5A 2Q66A 1XNQF 1JJHA 3W5YA 1F3VA 5DDPC 2M7SA 4URQU 2A6OA 1MMNA 3TRGA 1F5BA 4R5PA 4C3KA 4DF4A 3QAUA 3D68A 2QMWA 1M5PC 1TK0A 5K8MA 5KFKA 4A8KA 5CABA 4C3LA 2F9DA 4DQSA 2B0GA 4TU9A 2CQ2A 1T7PA 3GCWP 1RQ0A 3J81j 2P8IA 2P6SA 2XMTA 3B82A 2HHHF 5HAOA 3MI7X 4LQ3A 2Q6CA 1RYRA 2PFFB 3FSIA 3MM9A 3Q23A 4C0HA 3R9LA 2C42A 2XSJB 1F3FA 4LBIA 3QT8A 2V4JB 4LSNA 4DR6J 5ETKA 1U8SA 2VQEJ 4V19J 2DIUA 1FKAF 2CZ4A 1WACA 3ITHB 1UFWA 3VGUA 5LMUF 1LEOA 4I6WA 3F44A 5LJ5Y 4DQIA 1Q78A 4AUKA 3EZOA 2C3MA 2G2ZA 4I69A 3I4HX 3J80U 4LSLB 4LMZA 1RE1B 4CLLA 4NCAA 3HHLD 1HBMB 1KKHA 3FEXB 4WXOA 3CVKA 2L9DA 3LPEA 3P5BP 4WKRA 2CG8A 3GFZA 1NRKA 3CCUS 1JLBA 4OLOA 4PG7A 4KJIA 3BSCA 3N6LA 2JEJA 4BHQA 4TXSA 3G8SA 3DLKB 1P1LA 3RBEA 5C2GA 5M2RA 2RE1A 3M8QB 5L1IA 4DR2F 1HI0P 4LBPA 4NRUA 3KLGA 3AAWB 4FF2A 3X1LB 4RW8A 4K4YA 2YKMB 2FVCA 3PRVA 3BREA 5F3TA 5DG8A 2CDRB 4YHHF 2QIFA 4ES3A 4PWUA 3G87A 3ZZUA 5C24B 4MAKA 2BUNA 2UUAJ 4AYBD 4DZ6A 2DO0A 2NZCA 3I55S 2GGPB 4DV0J 4X2BA 3TEGA 1U1KA 1KLNA 3T1YJ 3BYPA 2DY1A 7AT1B 1XR5A 1NZAA 4MK7A 3OTOJ 3WHIA 1ZA1B 5GAHU 1VHFA 2ZWOA 1FKOA 4OZ5A 3EDQB 4ZVSB 2JLFA 2YNGB 3ENQA 3GJRB 3CCRS 2J0QD 3EICA 3GR0A 3QRRA 1RHMB 4IFVB 3T1HJ 5A0YA 4MK9A 4DWIA 3HKWA 3M1VA 3HX9A 2QTWA 1IBKJ 2B3TB 1VJQA 4PG4A 4P2SA 2AX1A 2RQMA 2I6WA 3DOMB 4FYYB 2H5IB 1IBLJ 3R5DA 1SV5B 3U1MA 2O66A 3POTA 2GQCA 2FDNA 1X4EA 2MQMA 3CB4A 1JKHA 2J0WA 1Z1ZA 1QTNB 4ZHRB 1PAEX 5H1SV 2ASJA 4LFBJ 4ILMA 2RU9A 2JFKA 3RJMB 2WAQD 5HBMB 3AB4B 1IR1A 3RR8A 3SSSA 5ETNA 3PJXA 2C2DA 1HNIA 1Q8KA 1DTTA 1EP4B 4F0HA 4QPXA 3EYZA 5KG1A 4JP8A 1LK7A 3J7Z5 4KV8A 1RHKB 2V34A 2HS3A 2DD8S 2VIHA 7FD1A 1FRIA 2YPYA 1Q53A 3Q24A 3DRSB 2L08A 3DLEB 1RP5A 3ZTRA 3OR2A 1YBTA 5D78A 5IT0A 3UN5A 3I9ZA 4DQQA 2OPQA 4YY3F 1JLAA 1UVJA 3K58A 5KFYA 2RRNA 4DG1A 4FVCA 4TY8A 3G6XA 2VG5A 2BKOA 1N6QA 1DLOB 2W8KA 1KWMA 5CYQB 2OGUA 3BM7A 1S4EA 2ZZNA 3T3FA 4CLZA 3W66A 3N5FA 2XI2A 4M94A 2BYCA 1RT2A 1NK9A 4DUTA 2DNLA 4HTJA 3Q2TC 2L9WA 3QRPA 1GK8A 2QA2A 2V4RA 4FPRA 1I94F 2HHSA 1UJ4A 3Q8SB 2CAJA 3DC2A 2H4WB 3PW4A 4PEOA 4JI5J 4K4UA 1R0BG 4ECZA 3W9JA 4KGKA 4DFKA 1RT1A 1AFIA 3HPOA 4LRCA 4ETZA 4OHVA 1NAQA 2QL9B 1SJ1A 4USJC 2AGOA 3GYXB 3KLIB 2P2CB 2ZBQA 3OTEA 4TVAB 5JXSA 3TQEA 4ED7A 2J8SA 4NCGA 3BO3A 3CMES 4YB5A 1TU0B 2LQJA 2CQCA 1Y5NB 2OELA 3IA0A 4HHHA 5F3ZA 3LP0A 4NYOA 3FBEA 3O44A 4ZVTB 2QE5A 1FK9A 1FTCA 1UMJA 3D54A 2FY1A 1K1QA 1MW7A 2ZBPA 3ZNJ1 1KVIA 4NXMF 5CAAA 3HHLC 1D1UA 4UOGA 3IBCB 4ZS6A 1XMQF 1U1OA 3QT5A 3VGSA 3MM5B 4CT8A 2DGXA 4HL9A 2W2MP 3HHKA 4DV1J 3CJ4A 2CPXA 2UUCF 2JLEA 2RUGA 4W98A 4GRSA 2RVJA 1Q7YT 1B64A 3TJ8A 2KU7A 5HVGA 1NK7A 4CZCA 5I42B 1FESA 1S5ZA 1V3RA 3H2UB 2KG1A 3PDNA 4ZPWR 5ETSA 4NA2A 3TUIC 5KT2A 4DR4J 3GIKA 4LFCJ 4RW9A 3QIPB 1H3DA 3BF4A 3IRXB 1KR4A 3U1LA 1U1MA 2UUBJ 5HJXA 2HFOA 4X65F 4AL7A 1V5VA 1EKSA 1UCNA 2RD5C 2XEXA 6FDRA 2YWFA 4X66F 3D3CJ 1F6TA 2FHJA 1ZETA 1ZA2B 1CQMA 1LWCB 3FEZA 3I5BA 1AZSA 2HRUA 4KFBA 3VVUA 3HVAA 1NB2A 4WYLA 1SBRA 4J9RA 4R25A 1S77D 3DLJA 1RA6A 5D4NA 3ZZRA 3VAJA 2ZD1B 4PXDA 2E1AA 4UF4A 3KLEB 4AT1B 1RBOB 3A3OB 5IS2A 3S7RA 1UJ6A 4PG5A 5JVHQ 2MQPA 1R0AB 3CWJA 3W9HA 1U8WA 3LO3A 3SFUA 2ZC4A 1ZTWA 4DN9A 1NSPA 1JLQA 2AW0A 4RW7B 1TP7A 1WNEA 2D3O1 3IM8A 3TANA 4RPFA 4JI4J 3HSDA 3PHTA 1RTDB 3NGUA 2DVIA 4GC7A 3AB2B 4MKAA 5IV3A 4L76A 3R97A 2KVQE 5FDLA 5GMDA 2HHXA 1JNZB 5DZ7A 5KFVA 1BD6A 1VRUB 2V2ZA 3PW5A 3C14A 1SH2A 2VZ9A 5KFDA 1NBEB 4CYUA 3FDSA 4JV2A 9RUBA 1KOHA 1T95A 2DHAA 4ECWA 4HT7A 3G2XA 5D0RA 1GMUA 2QA4G 3P96A 3BPDA 4LF8F 3PR5B 3QWUA 2H1YA 4P2FA 4CO1A 2GO9A 1PO6A 4WBFA 4C9DA 5H9FJ 3CCZA 3I56S 1JWWA 2BW2A 3ZZPA 4LUBA 4GKJJ 2MKHA 1HFEL 4LRAA 3AJ1A 4XPCA 3I0SA 1LKZA 2POKA 2ZKTA 2V63A 1TKZB 3KNGA 2BQ3A 3FMWA 1QVFR 1NSAA 1S1TA 3EVWA 4ED3A 3BR9A 2EI5A 5CD4H 3DNCA 3W60A 2GVZB 2PD1A 5AE2A 4WE1A 4RUBA 4M5LA 4ZVHA 2CXEA 4J9SA 4AFFA 3NOGA 1HNXJ 1U6FA 5BYSA 4NZ7A 3JSBA 3OQ2A 2CWXA 1ITPA 1JIHA 1LQ9A 2FVQA 3G9CA 1P1TA 2IA0A 1DRZA 4IRDA 1FRLA 2IVFB 4CTAB 3TW0A 1H98A 4OJ1A 4ES2A 4Q5VA 2XZWA 5HP1A 3O1LA 1YWXA 4NRTA 2UUTA 3K2YA 1FRKA 1I5OB 2J5AA 3J81U 2GHPA 4ZP6A 4RNHA 1XR7A 3BQ0A 4RWXA 4QCLA 2CQDA 4JYAJ 3FCVA 1SQGA 5D3GB 3V4MA 3G82A 3DU6A 5HL7Q 2HSEB 4GVLA 1RT5B 1HD0A 2AYMA 1JB0C 1EETB 3SCLE 2PC6A 2IC3B 3KDNA 1T8EA 3M6UA 1G2EA 1TVRA 1XNRJ 2BV3A 1VQKS 3KHLA 2J7UA 5KAKA 3IAS9 1N5YB 1U6ZA 4ZKAA 1VBZA 1FJCA 1BY9A 1X5TA 3I6PA 2GAGC 2YNFA 4LF1A 3MWBA 3RW7A 2VFUA 4MJKA 1SQEA 2W2QP 2QA4S 1B4SA 3A8JA 3M05A 4QZVB 3D5MA 1HWLA 3M8PA 2WCXA 4ZN1A 3DGVA 4NLTA 1O6XA 4DR7F 1E6VA 3NBPA 4LF4J 3L7UA 1UP1A 2FJAB 1KBRA 2R7SA 1VS3A 4NLPA 3DN9A 1P27B 2O1PA 4LRBA 4PRFA 3BKTA 5DLGA 1KLMB 1YRXA 4DU8A 5ETRA 4DSEA 3DRPA 3FCWA 3MEEB 1TFYA 5AJ3J 4JV5J 3KMSA 3J7ZT 4J9UE 1YJVA 4UY8T 1HWIA 2YTCA 1SH0A 1C0UA 4PQUB 2AIRB 2XGQA 1DTQA 2RQCA 4JV0A 2DNNA 5CYMB 5L38A 1S1XA 2DGTA 4B9VA 2DHSA 4CLSA 3SCIE 1A9NB 2EBGA 3M7VA 2NXEA 3FNNA 4WKYA 4EZ9A 3QRQA 3DFEA 1BGXT 2RU3A 2KT3A 4UZBA 3MPWA 2X1AA 2Q43A 4H4KA 3D28A 1M1GA 2J6TA 3EVOA 3D1QA 5KFSA 2DGUA 1CULB 1Z2ZA 1RT7A 2PMHA 4AXJA 3KLVA 5K8PA 3TA1A 3N6MA 3KG4A 5KT5A 2IM1A 2YX4A 1CS4B 1TFWA 1NHVA 2MJNA 4K0KJ 2FHJD 4FF1A 2HBZB 4GMKA 3AODA 3W9IA 3MMAA 4GO7X 2RJZA 3G6YA 4LQ9A 5KFJA 3H0PA 2HZVA 3RB6A 2HS4A 1WC4A 4F7VA 3CCES 4LBHA 5D4OA 4F36A 4RW6B 4L74A 1LWEB 2AP6A 4OYXA 2QC3A 4O23A 5B0BA 1RCXB 1UVMA 1DFDA 4M5IA 3MURP 5D0HA 3PG9A 3NGTA 4OFZA 5A8RB 2MZJA 4OYWA 1TUGB 2GZOA 2O67A 4K5SA 3R5GA 4DV7J 2X3DA 2GC8A 5SUHA 2BJ3A 2R42A 1AB8A 1RTZA 2HVZA 1UL3A 1T05B 1T9WA 4RLEA 2YH0A 4IYQA 5J2MB 1O8BA 3CJKB 1BMQB 2JZ5A 5KG4A 2U1AA 3Q8RB 5LL6d 2ATLA 2HQ3A 4A8MP 3E01B 2FHKA 2DNYA 1VR6A 2CJYB 4YR3A 1J5OA 4K4ZA 3MR3A 3MPVA 2Y8WA 1BQXA 2CA9A 5IC4B 3UDCA 1EARA 2DITA 4JI6J 2LXUA 1N33J 3KHHA 2MEWA 1WKKA 1TL7A 2RF2B 4W4MA 2NPFA 2N3LA 4O4GB 4C3MA 3GWCA 3GSDA 1KC8T 1S6QA 2N7CA 4KBIA 5GAEU 5T14A 1HW8A 4J9VA 4LREA 2E7WA 3MCOA 3HT0A 2ZEJA 3OTDA 4PQAA 3UVJB 2DO4A 2DIVA 3KNAA 5KFTA 3QWPA 5BXIA 5E0OA 1U09A 3WBZA 4HACA 4P9SA 2C3UA 3MR2A 3R6GB 4BDPA 2CVEA 1BLUA 3UFCX 1YLXA 1TQLA 3TUPA 3OXFA 3FBBA 4G6VB 2BRKA 3NGSA 1N8RT 4FKYA 3R7SB 3M8SA 1SCJB 8ATCB 3M2VA 2R7OA 1S7HA 2R7XA 3EUNA 2HRTA 1S59A 1MWZA 3U1NA 1FXDA 1XMOF 1HHTP 1QTMA 5B0FA 3ET6A 1CJTB 3BN4A 5D77A 1SC4B 1IKYB 2BXJA 2N82B 1K0TA 1A6LA 3MXHP 1BWVA 1LV5A 4H4MA 3QFHA 2NR0A 5J2PA 5K14A 2MTLA 1VRTB 4U6PA 3V81A 2BE9B 2WRMA 1FT8A 4PWDA 2WOMA 2V67A 2Y1IA 4ZVRB 3GV5B 3OR1B 5BJRA 4C6AA 4H4OA 3UD5A 1RWKB 3QZ7A 4HDHA 3TOQA 1S72S 1FHTA 3CJSA 1VQYA 2VG6B 3IXQA 3SDEA 2G2YA 1HBUB 3CJ0A 4EFAC 2ROGA 1S0OA 4BWJA 1WKJA 3H20A 3MEDB 5ETTA 5KFRA 1RA7A 2K7JA 3AOAA 1FE0A 3TJ9A 4ERDA 2HWHA 1N52B 3OXGA 3HCXA 1SUQA 3T1YF 3C66A 1NKCA 1FF2A 2YXLA 3OTOF 2VKZG 3ENVA 3S6EA 2BE7D 2WBRA 5D4LA 3QJJA 2EKNA 1RI7A 2CJKA 3IR6B 2R8JA 2ZKUA 2MXYA 3OL7A 4RU9A 1N88A 1MSWD 2OI2A 4AQYJ 4KC5A 1IBKF 3HHDA 2DISA 1JMTA 3ADAC 2DNGA 3DRRB 1IBLF 2WONA 4KO0A 3J7AN 5EX3A 3ZTOA 3B6BA 4YMEA 2OKQA 3R1HA 3T5KA 3GP9A 2IPOB 2HQFA 2OPSA 2I5JA 4F4XA 3Q8VA 5KOWA 2UVUA 3IG1A 1EZZB 4J9PA 1MG7A 3L7OA 4ECRA 2IDEA 1RAJA 3QAEA 1FX4A 3GIRA 3VAFA 1F9FA 2VDIA 4ECYA 4NLQA 1FA0A 4RUCA 4CLKA 4CH1A 1D9DA 4WZMA 1RISA 1PJ5A 3F73A 1HD1A 2G4BA 2B51A 3SZ2A 2G0CA 3PIOQ 3H8YA 2VA3A 4OI6A 1AROP 2KJVA 1S9FA 3SBMA 2IYGA 3D2WA 3FEYB 4DUZJ 4X4SA 4NCBA 3BDEA 4CQ1A 3GMGA 1HNZF 3RGIA 2BACA 2R7RA 5HVFA 4FS2A 2XG8A 2EK1A 4LF6J 1NJXA 4DR1J 1JLGA 3I87A 3MOJB 4X4OA 4RWWA 2W4DA 5AXKA 2MQQA 1QE1A 1Y3JA 1HWUA 5AE3A 4TY9A 3VTIA 3NGDA 4DL0C 3BGFA 1KQGB 1IVZA 1NCLA 3GILA 3RR7A 4X4UA 4CRJA 2DNPA 2BKPA 5CH7B 2XY6A 2ABYA 1NKEA 3DDIA 2DTJA 3BEGB 3MAAA 4A47A 2YX7A 1UKUA 4QOTA 5K8NA 1AUDA 1CJVB 1IBMJ 5CHCB 3HSJA 3DU5A 4DDFA 3RB4A 2CQ4A 3EGWB 2IM3A 4DSJA 4MFBB 3IRWP 2RSQA 3M8WA 1PC4A 2J8AA 2AEMA 1H74A 2Y9HA 2CYYA 4RKUC 3PEHA 1AA1B 1RADB 5DZ6A 2W24A 3JXOA 4M5DA 4O44A 2CPIA 2PA8D 2MHNA 3FVYA 5F41A 3NEKA 4CLUA 1IWAA 4Z37A 2ZBIA 1EAYC 3A12A 3VAIA 4F25A 1U25A 1VQ7S 2HQDA 2VASA 2Z56B 2M2BA 2E5LF 2VPXB 3EE3A 1RWMB 1YK9A 1JX4A 2XB2D 4Z7CA 2GJIA 2VFTA 1X9SA 3IM9A 4ECTA 1L3VA 2PO4A 4DR3J 1QM9A 2AJ1A 3B78A 3O3LA 4TU7A 5KFHA 4ZCLA 1CG2A 5AE1A 4P2MA 1S1UA 1RT3A 3OFGA 4DUYF 4E8UA 5CA5A 1ZAXA 1YX2A 4A46A 2RRAA 5D0EA 2AZ1A 2N4CA 4NZ6A 5KFGA 1VIXA 3WIVA 4C8LA 3A13A 3HVTA 4ZVUB 4OZJA 4R5PB 4Y2MA 4W92B 2BANA 4B3OB 1F1BB 4DR4F 2XLIA 1HARA 4LFCF 5LMNF 3RG6A 2HAFA 2AWZA 4GC6A 2FC8A 4OI3A 2F8EX 1FFSB 3BZQA 1SKRA 4DR2J 1C2PA 3H2VE 1Q7LB 1JJCB 3ZZZA 5J2QB 4DL5A 1UFKA 1UTAA 2CPHA 4YHHJ 3CDAA 3N5BA 2RNEA 2HHWA 1RHRB 1JLFA 4JB8B 5K5MA 3HK2A 4XDDA 1TKTA 3BGRA 2ILZA 3CJ2A 2QFJA 3EJMA 3W8PA 2IVYA 3M2RB 5KFUA 4USTA 2MLZA 3U7JA 3SXLA 1U1NA 1XBWA 3V6HA 2V2QA 4EO8A 5K9FA 4PZVA 3LGNA 3HSGA 5C7PA 4KY3A 1RWOB 1HBOA 2NCKL 1WF1A 2V50A 2JOQA 5DS7A 2QG9B 1KFSA 4ZVEA 1RK8A 2GIFA 4B9MA 1Y00A 1ICEB 4H4KC 1JLBB 3DM2B 2YH1A 1IQTA 2HNDA 4C8ZA 3Q8YA 2JC1A 1U4BA 1T11A 2RHSB 4L3KA 2ZJQQ 2AJ0A 3W2VB 2Y8YA 3GG1A 4Z7YA 2WVFA 2B4UA 3NNAA 3FGVA 3PHEA 3K0JA 5E3CA 4QR1A 4JI1F 2F4VJ 1YZ6A 1EHWA 3PJWA 1KQKA 3VCDA 3W7BA 1CSJA 3DGPB 2LEAA 2CG4A 4EI2A 3NAHA 1U1PA 3UR0A 2OSRA 2ZOFA 2EVZA 2LDIA 2HHQA 2GJ2A 1IN0A 2YWHA 2MYFA 3Q83A 2LU2A 5KT7A 2VOOA 3HZEA 3KFWX 1Q8BA 5B08A 3CPWR 5CZXA 2FVRA 4DHVA 4GKJF 3CCLS 2K1RA 2ZDOA 1S6PA 2B8PA 1FVSA 3CCSS 5MAOA 2A2CA 5KFBA 2Z4PA 3CIZA 4YY3J 1VC6A 3OFEA 2UU9F 1VDHA 2QMUB 3PFOA 4DFMA 5A0YB 3I9V9 2HNYA 3BJYA 1WD6A 4WXWA 2HYIB 1BQNB 5G0RA 4RBVA 2QLXA 5J1PA 2P5VA 3SV4A 1B70B 3OUYA 2QT7A 2WTFA 3PO5A 4AL5A 2BJ7A 2F4FA 3D6HB 4FBTA 1AT1B 2CFXA 5KFXA 5E5NA 3TARA 5B7WA 2CDQA 2N4DA 3W1YC 2VBZA 1C1BA 3SQGB 4C7QA 2GA7A 4DSLA 4OZ3A 4Y2KA 5H9FK 1S57A 3DYAA 1I94J 1KTQA 4KB7A 1VLYA 4JI8F 5IFMA 2KVIA 4QPTA 5BR8J 4DL6A 2CNKB 1HNIB 2FQQB 3K7RA 4DPUA 5D15A 4OJHA 3TA2A 3HM9A 3GCXP 4CO4A 4JYAF 3QT6A 3RBZA 2A0FB 2XO6A 1DBDA 3D1HA 1R6VA 2I1RA 2E5IA 1C0TB 2C2RA 4YR2A 1NPRA 1GX5A 1UA1A 4R0JA 1XNRF 4N41A 1SPBP 1Y4ZB 2VG5B 3LPYA 5LT5A 3MR6A 2UVRA 2YKQA 3ENAA 1NMEB 3OJUA 3KK1A 3MM7B 4IRKA 2XZDB 1R43A 3TQ1A 4N8NA 2FD2A 3MD3A 2AGPA 3KK3B 3C15A 1E6YA 3D3BJ 2KTQA 2FYXA 2AYBA 2GV1A 4NE9C 3NOCA 4MIAA 4RW4B 1RAEB 3RRHA 2M8DB 2DGWA 1NDKA 4J9KA 3TNVA 4PABA 3ILIA 2BE2B 4J9NA 2WW8A 3CO0P 4ZIWA 5KFEA 4PUOA 1V6HA 2B5JB 1QAJA 4JV5F 1IJFB 3ZTQA 4YQWA 3HDSA 3ZZYA 1F2HA 2OMLA 1RT1B 2Q3PA 4YB6A 2H54B 2GJFA 2GW8A 4HEA9 1F9HA 4MYTA 3LA0A 1SL1A 3MMCB 2M0GB 3K5LA 3NS7B 1F2GA 3HMJG 2A18A 2MY8A 2ZH8A 3MM8B 3IBFB 4EU0A 3IS9B 3FMBA 4NEZA 2V9KA 1SL0A 1S99A 4XK8C 3I5AA 4J90A 1WC3A 1U49A 1QLNA 3OSNA 4FF4A 4F4YA 2AJQA 2XSJA 4CNZA 4OZ0A 1FDDA 3LANA 3FJ2A 5LJ3Y 2NLWA 3GFHA 1NK4A 2HNZA 2KXFA 4I1TA 4NPOA 2W9CB 4LSLA 3QJPA 4Q2LA 4F0KA 4RUAA 3R7NB 4X84A 2XZTB 3F56A 2NREA 4DV7F 1GEHA 2DEJA 2Q6BA 4DV4J 2ZFHA 4O3RA 4IOAQ 3DLKA 1IKXA 1Q16B 4OYMA 4AD6A 3MAHA 1VQ9S 2UP1A 5F8GA 2C22A 1HHSA 4NMXA 2IBKA 4M5MA 2GNKA 2R2UA 2YKMA 1S6UA 2AV5A 2Y3YA 3DDNA 2NYHA 2EW9A 1B3TA 2VQFJ 1H38A 2DR5A 1S1WB 4RBUA 1X31C 3HFZB 5C24A 3HP6A 4P74A 1FTRA 4FNIA 2BJ9A 3R5BA 1WI8A 3NXZA 2QN6B 1HKAA 2GGPA 5CD4A 3DXSX 3JAMU 1UJ5A 2O5DA 3BBBA 3D66A 3CSKA 1Y7PA 1N33F 1PYTA 4KFBB 1N0UA 3BPSP 1D3WA 4WFBQ 5I3PA 4LF7F 2ACYA 4H54A 2HW3A 1VQ8S 2XHCA 1P9YA 1FNMA 1OY9A 5KFMA 1HQEB 2PDAA 2EG2A 1T02A 2FC9A 1REVA 1WG1A 1WTFA 1RWVB 3DI6A 4IFVA 2IMOA 4NLYA 3LGMA 1WF2A 4OX9F 1PAUB 2RAQA 2MPUA 1YTYA 3J7A1 3NMRA 4WYWA 3DOMA 3AD7C 4TU8A 1SV5A 1S0NA 1IKVB 3O6QA 3QGIA 1JLQB 5IZHA 3K5MA 3PACA 1WHVA 4G1IA 1HMVB 3OBIA 2Y1LB 4ZHRA 1A0OB 5A2QY 4QU6A 3QO9B 2W2PP 4BC9A 4L73A 2RDJA 4ZPDA 3K8VA 1HHQA 5HBMA 3LWLA 3PJ9A 3CC2S 4A8SA 3HI9A 2JH3A 1GMWA 1NK5A 4GKKF 5DO2A 4CYUB 1LW0A 3NGRA 3N0VA 1YJNS 3OFHA 3KHRA 2NXJA 4KHRA 2HLUA 5CXTA 3DRSA 5KG3A 4ZPVR 3PX0A 1KS2A 4X4PA 4A48A 3CEDA 2VONA 2JFDA 5KFIA 3F0NA 3I96A 2D74B 2V94A 3EGVA 3FC9A 4OX8A 4DCOB 6AT1B 4CLYA 3DLBA 2AJFE 2CQIA 1UVLA 3H98A 5EWFA 2DBBA 1VLOA 3I0SB 3FQKA 4X4QA 4NA1A 1HQUA 1YITS 4P72A 1DLOA 4Q44A 3BGUA 1QAYA 2W25A 2LLZA 1RHJB 4P10A 2CKWA 2M3DA 3W63A 1S1TB 1B7FA 4P2XA 2VDHA 4NZ0A 1U26A 5FD1A 3V5RA 2MSSA 4DFJA 4J37A 2B9WA 1HNVB 1ZM3A 1W26A 4C2MA 1TTHB 3IR5B 4C4WA 4NLSA 1QVGR 4XTTA 1IM6A 4DR7J 1LW2A 1JXLA 1PCAA 3SI8A 3EGNA 3ILOA 4QWAA 4NYPA 4WFYA 1HI1A 2JVOA 4AQYF 1VIOA 2CNNB 4ZCMA 3KLIA 5GMKa 4U95A 5M2UA 3R5CA 1H2TZ 1ZPVA 4B3TJ 4I7FB 1VQNS 3IAM9 4IUFA 2PEBA 4ICLB 3I4PA 3NWGA 3P49B 3KUGA 3D7SB 5KFNA 1S9GB 3IFEA 4JI0J 4YR0A 3CDUA 3D0IE 3NCRA 4KPYA 4X64J 1UWBB 4DV3F 4NOHA 4ID5A 3UDEA 2PA3A 1RWWB 2HGNA 3H2LA 4XPEA 2C2ZB 3V6KA 2PSZA 3PKMA 2F65A 3KK2B 3GU0A 2ZH2A 1C4CA 4G65A 1R6YA 2BBEA 5DG9A 1I3OB 1YG0A 1WSRA 1L3TA 1VRQC 4C97A 4YOEA 1I1GA 2DJWA 3PFEA 1WI6A 2QZ8A 1K47A 1S76D 4FDFA 3UNGC 1Y0HA 2U2FA 2JRSA 2Y1RI 4LR8A 2MQLA 3LP2A 3MM5A 2ZUAA 5IXUA 1M5KC 3NS5A 7FDRA 4DUZF 3NP5A 2R7UA 3J7YI 2C2EA 3IWNC 5EN1A 1UZDA 4QW8A 2OPRB 3CD6S 1U1QA 5IOLA 3RW6A 3DRPB 4LF6F 4DR1F 4J9QA 1VQSA 2HAIA 3R2DJ 1C0UB 2JEGA 2HVEA 5B0DA 1TK8A 2ZOMA 2VJUA 1U1LA 3LUYA 2GHWA 4PKDB 3QIPA 3IRXA 5F8MA 3R27A 4JI7F 5GAGU 3C16A 4L6V3 2XCPA 1MU2A 2LA6A 5B0GA 2W2OP 3BBCA 2BA9A 1IBMF 1RT7B 2L41A 5ETVA 2KKHA 3IBWA 2VV5A 1LWCA 4K8RA 3VGVA 4DCPB 1XWLA 4DSKA 5C2CA 2YKOA 5DQGA 1FRXA 1YBAA 2ALYB 1HA1A 3MMAB 1L3SA 3Q89A 3VAKA 1RTJB 9ATCB 3W64A 1DQ8A 5E3AA 3HHEA 3MPUB 2HFZA 3HFVA 2NXUA 2ZD1A 1IBCB 2OFHX 2PN6A 1ZOTA 1CJUB 4BC7A 1IM4A 2C1EB 4JUZA 5E7OB 3AD9C 3U02A 4HHJA 4ILLA 1GNKA 4PG6A 2HS0A 2ZZTA 1D9AA 4C11B 5CZVA 1R0AA 2KO1A 4WK1A 2XQCA 4C8YA 2COLA 5T41A 1EQ0A 2ZVIA 4HR2A 1NSKL 2OPPA 5AXMA 1D8ZA 4RW7A 4JI2J 2OTLS 2WHOA 2HPUA 2HEKA 4WP9A 1BUXA 2FGCA 2J76E 3THVA 3PO4A 4O3QA 3SCKE 4DR3F 2ZH4A 1NJIT 4UUWA 1VRUA 4AXIA 1HWKA 2NSCA 3A4TA 1U0HB 3WDOA 3TA0A 3DDKA 2D9PA 1XMOJ 4K4XA 1GMWD 1Y5LB 1J5OB 4KKOB 2MKKA 4YN3B 4ECXA 4YS2A 1Q1KA 1OQ6A 2FGOA 2LXIA 3GJSB 5F9NA 1TAUA 2VODA 3UWTA 3ZXWA 2EPIA 1V9OA 1X5SA 2ZNZA 1R3NA 2BZ2A 4K4VA 1XEZA 2V0NA 2NXNA 2VBXA 3L7PA 1PKUA 1H2VZ 1S48A 4JBCA 3PX6A 4PCQA 4TQRA 1NPPA 5DGBA 3S01A 5DETA 3LP1B 4ENOA 5DDQC 1QSLA 3VAGA 1TKZA 1XK8A 1SQFA 3T5HA 5BYQA 2BM0A 3D67A 3RYLA 5L9NA 1U7LA 2LVWA 3PW7A 3OHBA 2XY5A 4O0NA 2H5EA 4Q8FA 4DV2J 2WK4A 3C6TB 4USKA 1NDLA 1AW0A 1WC0A 2EFPA 1RU2A 3C6UA 2AGQA 3KLFB 2HURA 3SMZA 1SKSA 1IUJA 2D3ZA 2IVMA 4F3OA 3O5TB 3ET6B 3PKYA 2IRUA 4IDKA 2HIYA 2D7SA 4PR6A 2CNLB 1LWFA 3CE8A 4CO5A 1OPIA 2KYZA 4B08A 4FKXA 1VK3A 2KZMA 3ZZOA 4PWDB 5D3GA 2K8GA 3RUBL 2N3OA 4IH7A 2VFRA 4OHWA 2ZHBA 3VHQA 3TAPA 2C2OB 1EETA 4H4OB 2R7VA 1NH8A 3KWMA 4U7UK 5H9EJ 5RUBA 3JQJA 1TR0A 1FD2A 3GIMA 4IFYA 3C46A 1ZZFA 1YJUA 3C19A 4BBYA 4A8YA 2OMOA 2W4PA 3W8GA 1YZ7A 4FYWB 1N5YA 1MN7A 5HANA 2F4VF 2IFXA 1OSDA 3B4MA 3T1AA 4OHYA 4CLFA 2CJXB 1S6OA 2OEMA 2YWGA 2PEHA 3AD8C 2ROPA 4Z2XA 2IM0A 4O3SA 2RB7A 4UY85 2JVRA 3NGKA 2PI5A 2FJDB 5DM6Q 1FEHA 2B6AB 4WK3A 2ROEA 5LSLA 4N7TA 4USUA 2YWWA 1KLMA 1L5UA 3DMJA 1KVKA 4RNOA 4EMDA 1WKLA 3MEEA 4I64A 1WOPA 4Y2AA 1XERA 4DJBA 4YDDB 3T9ZA 4QQBA 2VUGA 1TK5A 1NEEA 1NLKL 3N4WA 2FIUA 1HNZJ 1QSYA 1V3ZA 4PQUA 4JOUA 1ZM9A 1YJWS 3GYGA 1PJ7A 5CYMA 1SJ3P 2QMXA 3EWGA 3L09A 4IOCQ 2E7VA 2NYIA 5K8OA 4ZP9A 2NZ4A 3KJFB 5E3QA 3MMBB 1RT6A 1D8YA 1LXJA 4X62J 2OPSB 1CULA 4DL7A 2RMLA 3FBCA 4OZ1A 3IG1B 3M8YA 1FXLA 4OYBA 5BR8F 5B09A 2MJUA 3MPYA 2W2NP 3I82A 3BV8A 3MTJA 2MQ8A 4DX5A 3ZO7A 4G1QB 2FLLA 1UWAA 5I3UA 4FS1A 1WEXA 3DKDA 3FKBA 3JQMA 4BS2A 4ECUA 1DURA 1RBLA 2KXNB 1UVNA 1JJ2R 2J6SA 1YGYA 1LWEA 2QSFA 5KFWA 3ZFVA 3K57A 2VHGA 3KJQB 1U47A 3R3TA 4WPAA 4F8RA 2ZH6A 3RRKA 5HVHA 2H9ZA 1OYDA 1QAXA 3E51A 3Q0AA 1RUSA 2AKWB 4LVNP 5HLFB 1ZYQA 3IGVA 4ED1A 3O8WA 3MCNA 3NMAA 3H4DA 3WQPA 3RB3A 4RZRA 2GVDA 2BM1A 2FUG9 4L75A 1VQPS 1G3OA 1JK9B 3DOLB 2X1GA 5J2MA 2E5LJ 2ZUGA 3CJKA 4GVBA 2BQRA 4P7TA 3C2PA 3C8YA 4KQZA 5BYRA 4MK8A 1SI9A 5F8LA 5D8HB 3W2WA 2BOAA 4K7QA 3MM6B 1UPMB 4MMOA 5KT6A 1NJYA 2G9OA 4R0EA 4M5HA 3RAXA 2DPIA 4DUYJ 3H40A 2LP4A 2F3JA 3WC0A 4W90B 2LFVA 5E41A 2RF2A 4O4GA 1DHMA 1DJ0A 3C3LA 1REGX 5L1LA 4DL3A 2RQKA 2C3PA 4MH8A 4DPXA 4UT4A 2P9EA 4F0MA 2KYXA 2YNIB 2HQGA 3GIIA 3ZTPA 5LMNJ 5KFAA 4M5DB 2HVIA 4WP3A 3BGLA 3GE9A 2JX2A 3GG0A 5L9XA 4I6AA 1UZHA 1J2VA 3KXDA 2OUGA 3U27A 8RUCA 1I6JA 1ZM2A 1MNEA 4ZDNA 2GIQA 1H7XA 3K5OA 2YWEA 3EVMA 1IWGA 2IIHA 2RH3A 2YQ0A 1RHUB 2R2SA 2MY7A 4DV6J 2AT1B 3NL0A 5M2PA 3W62A 4IO9Q 1PILA 4HTIA 2QO3A 2FLOA 2X51A 3NS6A 1K73T 4ZLJA 2BABA 4FYVB 4KHMA 1CJTA 1KRPA 5L1KA 3AA8A 4ZVFA 2ZH7A 2BOPA 2CQ3A 1X60A 1FI4A 4DLEA 5DLFA 5F8IA 1R8PA 1U45A 1M5OC 2M5YA 1HL6A 2CQHA 4IG3B 4DV4F 3LALA 4NX9A 4OX7A 2DXDA 1TZ0A 4A8XA 1QUVA 1RSCA 4WIIA 3QMQA 5AXNA 3HVTB 3OR1A 3M8RA 3ETMA 1YIJS 2XYHB 3I0RB 2NSBA 5KFCA 5GMEA 5IT9Y 1JLCB 2DT9A 1CC7A 2UVVA 1MMDA 2VG6A 1T9VA 2VQFF 2V2KA 1B7YB 1HBUA 2LU1A 3JSYA 1FKPB 3BO2A 5KT3A 1TL5A 5B0AA 4WF9Q 3MEDA 3UCUP 4WU3A 2G13A 1VC5A 4JI1J 4RBTA 2AHOB 4FXDA 1NK0A 1RBAA 1URNA 3KLHB 2DNQA 3CJ5A 2OSQA 3BGRB 4LF9F 5A8KA 4F2SA 4K5RA 1YDLA 2XS5A 1YKWA 1PJ6A 1TUWA 3BR8A 1ZPWX 4D3GA 4MIWA 1SC3B 5ETMA 3US5A 4LRDA 4Y00A 3AQOA 3PRBA 1R31A 1DY3A 3GZ7A 3JTOA 3DLHA 4G3IA 5A8WB 4CO3A 1YJ7A 4WFNQ 5JMNA 1WHXA 4KHPJ 5IT9U 5IQ6A 1R0CB 3BH6B 4ZJLA 2HBRB 4OZ2A 4PXEA 2WSFC 2UU9J 4IG0B 3DRRA 2V68A 3H5UA 1NO8A 4AE5A 2YKNA 3CXCR 1AUSL 1V5IB 4FYXB 3CDWA 1HPZB 4ZPAA 2MZTA 2V6AA 1VQ5S 1JQGA 2W9BB 1KD1T 2HQIA 3EPGA 2DNZA 5FLXY 5CQGA 1EB0A 3IGNA 2MHEA 3BO4A 2D3UA 1Y3KA 4DSIA 1X9WA 2HKEA 4ZVOB 2ZZMA 3JSRA 1OS5A 4DQRA 3CDBA 3D1OA 4JI8J 1NK6A 4ZA1A 2LYVA 2E44A 3AQPA 3MCMA 1V3SA 3SFGA 2G1DA 2LKZA 3P3DA 3CT9A 3QJLA 4ANCA 2FLPA 1Q8IA 3TZZA 3OJSA 1SH3A 1SKUB 2Q79A 1F9EB 2WBMA 4TQSA 2RKIB 4CM2A 1OYEA 3TJAA 1HR0F 3MEGB 4QW9A 2IY5B 1UW9A 2QEXS 2WB1D 1D09B 3W65A 2GHVC 4EYIB 2J6UA 3NCPA 2ZBRA 2KI2A 4OLPA 2UXCF 3QLHB 4F4KA 3WC2A 3IN5A 4LRFA 4MYUA 2HNYB 2GFFA 3AOBA 1MROB 5AXLA 2YY3A 2RT3A 2JL9A 4ZITA 3CD5A 2C28A 1ACMB 3PYEA 3ZC4A 2CNOB 4CT9A 4Y28C 4NWBA 2C3OA 4I67A 4A8OA 2LEBA 2CPJA 2GAHC 1U48A 1C1BB 3M6VA 4LF2A 5KG0A 1CJVA 1WC6A 5J1EA 2I0XA 3QNWB 3DYAB 2DXEA 3FFIB 2D1CA 1N0VC 2B7BB 4OI4A 2O3DA 4RJVA 3NKYA 2MKYA 4U8VA 3M9MB 4ED5A 1FD8A 3OVSA 4B3TF 3CGIA 3K17A 3PNIA 3TVYA 1B0VA 2V8VA 3MECB 1H72C 2IMWP 2AX0A 4JI0F 2N7YA 4X64F 3BBFA 2XNQA 1OQ3A 1Q81T 4WFZA 2MLXA 2J9DE 4IO1A 2QLFB 2MZRA 4NLVA 2OH2A 4J7CA 5C42B 2AJ2A 2BR0A 4TN2A 4WZQA 2DKOB 1RU1A 2PI4A 4NLGA 1N54B 2LXFA 2E1CA 4NEYA 4CLWA 4M5JA 2A10A 4WP8A 4LFAJ 3WX8A 1W7WA 4L72B 3DLGB 1OY8A 1E6YB 3BYRA 3UI3A 1VFJA 2FZCB 1UVIA 3M30B 4DX6A 5HATA 3KMQA 4ZPCA 1N34J 4PUOB 1CLFA 3D9BA 2DHXA 1X4HA 2WSCC 2ZDPA 3EZ5A 2DR9A 1PC5A 4B3OA 4TNOA 1IJEB 1RTIA 1C1CB 1RTHB 1YRTA 1T9YA 3JTNA 2PFDA 4NYZA 2X1FA 1CPZA 3BQ2A 5EWEA 3J80Y 1EX8A 5CYJA 2HVDA 2FHMA 2IHR1 1PBAA 1RXOB 3DRXA 3MPDA 2GQ2A 2W01A 5J2QA 3KTQA 2HFSA 4JV1A 3L9ZA 3GR1A 4CCHA 1N56A 4TLRA 1VBYA 2R7QA 3E8OA 2C2KB 2K3KA 1N32J 3KJVA 2RDDA 5ITHA 2HGLA 4ZLPA 2BMBA 2FB0A 3CJRA 2DRAA 4OHXA 4UOFA 1WTBA 1OIAA 1PBUA 3M2RA 4P7VA 3LW5C 5KG2A 4B9TA 1OO0B 2EFVA 2NS1B 3T5LA 2ZM6F 1WF0A 2V8HA 3P45B 2HNZB 1Q0NA 5JUMA 2H3EB 3RBXA 4LF7J 2VICA 1TL1B 2UV8G 2GMLA 2F63A 4G1PA 2NPIA 3UNYA 3PRDA 3CMQA 1HIYA 3LH2S 3H7HB 4ECVA 4FF3A 2J0SD 2IBOA 3DM2A 4Y65A 4JI2F 4OX9J 2DCLA 1FJGF 3TZWA 4ED0A 3RAMA 1IKXB 1CJKA 2YNHB 4DR5F 1CVJA 3D4JA 4FYDA 3KG0A 5FJ4A 4K4SA 1G6BA 3AT1B 4ZK7M 2PE8A 3W2VA 4NXNJ 4ILRA 1WHWA 2OP5A 4P75A 4KSEB 3EXCX 3P4UB 5J1NA 4E2FB 3RBDA 3DGPA 3JTPA 5HJYA 2ZH3A 1KEKA 4DPWA 4XIUA 4DV5J 2WB4A 4N8OA 2EFOA 2VH7A 4YB1P 4R8UB 1Q82T 4GKKJ 3UQSA 3OT9A 4KPCA 1EQMA 4KR0B 5GAGI 2C2MB 5T7LB 1S9EB 2DR6A 1HYSB 3JSMA 4NI2A 4KGXB 3LGHA 4C8MA 1Q79A 1VI7A 2R7WA 3AJ2A 3TO8A 4BLGA 3SSQA 4GO5X
chains in the Genus database with same CATH topology
3QRRA 2Y8YA 5H9FK 3QRPA 4QYZK 2Y8WA 4U7UD 2Y9HA 5CD4A 1WJ9A 3QRQA 4DZDA 5H9EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRR A;  2Y8Y A;  5H9F K;  3QRP A;  4QYZ K;  2Y8W A;  4U7U D;  2Y9H A;  5CD4 A;  1WJ9 A;  3QRQ A;  4DZD A;  5H9E K; 
#chains in the Genus database with same CATH topology
 1REV B;  3UN3 A;  5KFP A;  1Z2L A;  4JI3 J;  3GLJ A;  2VPY B;  3DI6 B;  2JSX A;  4QIV A;  2Z30 B;  3L95 X;  1BQN A;  3EDR B;  4EWT A;  1H0H B;  3M6X A;  3V6D B;  4DV2 F;  8AT1 B;  2EFN A;  4EEY A;  3J7Y U;  1FJ7 A;  3HSZ A;  1FJE B;  4ITS A;  3BKU A;  2ZWP A;  2CPY A;  3IWL A;  3CJ3 A;  3VF0 B;  3VV2 B;  5HK4 A;  3AOC A;  2GMH A;  3KJN B;  3SQG A;  4NAS A;  2KFN A;  3MTK A;  4M8L A;  1OMS A;  1R8H A;  2W8L A;  1S0V A;  1NB7 A;  3BN7 A;  4HI1 A;  2K3I A;  1IKW A;  1OJ4 A;  3AFG A;  2L9N A;  3QQC D;  4K4W A;  2DNM A;  1Z4U A;  4AL6 A;  1LW0 B;  2H5J B;  1HI8 A;  2I8E A;  5JJB A;  1QAI A;  1TAQ A;  2J9D A;  3HHL B;  1FNX H;  3NLC A;  3QGG A;  3BQ1 A;  2DGS A;  1ZAV A;  3DXB A;  4USW A;  1FX2 A;  1GX6 A;  4AND A;  1SIZ A;  5ETQ A;  2B7C B;  1C0T A;  4J9M A;  1ZZN A;  1U6B A;  5SZT A;  2XTJ P;  1RGV A;  1XJW B;  1NPK A;  2V69 A;  1HQU B;  4DV3 J;  1NDP A;  1PYS B;  5L46 A;  1G7C B;  1VIS A;  2OHD A;  3MM7 A;  1T9T A;  4QIF A;  1RJJ A;  2HWI A;  1P8G A;  3BDP A;  3KK3 A;  3LQV A;  3V4I B;  5HI7 A;  2XS2 A;  4KGZ B;  3PYF A;  1KQF B;  4LF5 J;  1RT4 A;  3M32 B;  3VGT A;  4A8F A;  1VK8 A;  4RW4 A;  1BHN A;  3PM9 A;  4OV1 A;  2MGZ A;  2BE2 A;  4Q0B B;  3QSY B;  2B5J A;  5C5J A;  1SVD A;  5H9E K;  4J9O A;  1LW2 B;  4QYZ J;  1WOR A;  5FII A;  2IA6 A;  3AH6 A;  1NU4 A;  3NWR A;  4P52 A;  1WOS A;  2CZV C;  1O0P A;  4F50 A;  3MMC A;  2K06 A;  2FPH X;  4OYP A;  1LOU A;  2DB1 A;  1IR0 A;  1YBU A;  4DS4 A;  3Q22 A;  5DGA A;  3MM8 A;  4YEA A;  5DDR C;  3IS9 A;  2ZOG A;  3A3P B;  4DN0 A;  2R8H A;  2R8I A;  1N36 J;  3OSP A;  1TKX B;  2JEF A;  4OYI A;  2UZA A;  3TUJ C;  4X62 F;  2L3M A;  3CCV S;  1KNZ A;  4ID5 B;  4JI7 J;  2RS8 A;  5L39 A;  2KHC A;  2ZE2 A;  4Q45 A;  3CF5 Q;  2V8D A;  3JQK A;  4J9L A;  5GVQ A;  2P9G A;  1RAG B;  1VQO S;  3DOK A;  1YRU A;  2RIL A;  2X1B A;  3VVT A;  2CJB A;  2ACM A;  3TYT A;  4DPY A;  3EMT A;  4OYO A;  3PYD A;  2HG4 A;  1X7V A;  4Q43 A;  1D9F A;  1BQM B;  4S0M A;  3MZI A;  2CWK A;  2A3J A;  4UZC A;  3SCJ E;  4LIR A;  2MDA A;  2OFG X;  4CM0 A;  2W9C A;  3LP2 B;  4OJG A;  2HLT A;  3IMQ J;  2E9Z A;  3D6F B;  1Q95 G;  2AEJ A;  2DGV A;  1KDN A;  4QWC A;  5IM0 B;  1HBN B;  2ASY A;  2OEJ A;  4Y2C A;  1OY6 A;  5HO4 A;  3X3U A;  2D9O A;  2XI3 A;  1SJ4 P;  1FDA A;  2AYG A;  5KG7 A;  4A8Q A;  5EGY A;  4CDI A;  3T19 A;  4ER8 A;  1P9Q C;  3M6W A;  1S0M A;  4WU2 A;  1WSV A;  1TV6 B;  5HRO B;  2IDL A;  3GON A;  5DQI A;  2CJA A;  1N5Q A;  1GH8 A;  2UXB F;  3EX7 B;  2ZH5 A;  2AU0 A;  1S1W A;  2HHP A;  4NLD A;  2M70 A;  3C16 B;  1X8D A;  2CPD A;  4UUX A;  4YB7 A;  1JXE A;  2VG7 A;  5DDO C;  1MU2 B;  2OD4 A;  2DYA A;  1IQZ A;  4D3H A;  3IC1 A;  1S79 A;  3GV8 B;  4KH1 B;  5DJB A;  2QJ3 A;  2QSW A;  4OV6 A;  4CLP A;  1F5A A;  2YBV A;  4ZVP B;  3Q8P B;  4O3N A;  3MD1 A;  1HQE A;  2YWK A;  1QSS A;  1O5J A;  3OL9 A;  1MN9 A;  4PPZ A;  2FJW A;  2DGQ A;  3NG8 A;  1NUE A;  1KP6 A;  3TVZ A;  1UVK A;  2HIQ A;  3TAM A;  4N47 A;  2UUW A;  4Y6I A;  4F4A A;  1M5S A;  3I31 A;  2MZS A;  5G4D A;  4PXC A;  2WW4 A;  1MWY A;  2BRL A;  3CIM A;  4WWS A;  2DGO A;  1UA0 A;  2HK2 A;  1IKV A;  2E9R X;  2LEC A;  3MM9 B;  2OPP B;  5HQM A;  2FVP A;  1WJ9 A;  1HMV A;  3G71 S;  3HUL A;  4DV6 F;  3BS9 A;  3BKF A;  3QO9 A;  5F9L A;  3PTW A;  3P5T L;  4LSN B;  4MKV A;  2WSE C;  2KDO A;  2HMI A;  4I0W A;  1NJZ A;  4PWW A;  2QYG A;  4J5O A;  2HHU A;  2ASD A;  2H48 B;  5KFO A;  2GS8 A;  2BW7 A;  3DRY A;  1H2U X;  4F02 A;  1NJW A;  1T9X A;  1YJ9 S;  2RIJ A;  4Y2I A;  3VZI A;  1MWQ A;  2E5G A;  2DPJ A;  3OD2 A;  2QX0 A;  4FN5 A;  2CJQ A;  3TAQ A;  3UO0 A;  3AXM A;  3K89 A;  3SIP B;  1YVF A;  3SSR A;  1JXV A;  1X4A A;  1NDC A;  4KYZ A;  4RNN A;  3FRY A;  3ISZ A;  1F5C A;  3MR5 A;  4B3S J;  3MFI A;  1W25 A;  2Y1J A;  2IAJ A;  1X4D A;  1FFG B;  2W9A A;  2Y0S D;  2KM8 C;  2R9L A;  4U9R A;  3KLG B;  3J81 Y;  4RW8 B;  1KSP A;  3GTY X;  1RKJ A;  1RWU A;  5A6P A;  2FVS A;  4UQG A;  3MHY A;  2ZVS A;  4B02 A;  2JNJ A;  3M9O B;  1T03 A;  2B56 A;  4XAK A;  1HNV A;  4N56 A;  3P6Y C;  2H51 B;  4B3R J;  3T6J A;  3C6U B;  4NML A;  4KGM A;  3GPA A;  2M8H A;  3HJV A;  2FTR A;  3HVR A;  3GIJ A;  1URR A;  2EFG A;  2XHW A;  2VA2 A;  5THW A;  3PR4 A;  3R5J B;  1SL2 A;  4I4B A;  1FKO B;  4IOB A;  2Z2Y B;  1QY7 A;  3DHX A;  3TX8 A;  3O2I A;  4WFA Q;  4KHP F;  2VFS A;  3HKZ D;  5A76 A;  5F0W A;  4IDK B;  5HMX A;  1BC6 A;  3G8Q A;  4RUH A;  4NL5 A;  2MZQ A;  1LWF B;  1XQI A;  3TUZ C;  4I7F A;  2RDI A;  3HHN B;  4ICL A;  2LQB A;  3H42 A;  4DOZ A;  4HYK A;  1N5V A;  3M1V B;  1B0P A;  4OZL A;  3IR7 B;  1S9G A;  2VD3 A;  2ADB A;  2EG1 A;  1F0X A;  3BB5 A;  3CNQ P;  1UWB A;  2KH9 A;  3POT B;  3UD4 P;  4WJB A;  3L3C A;  1GMV A;  2IYI A;  4LVO P;  3WIU A;  1JKH B;  5IWA F;  4KGV B;  4IFY B;  4LT6 A;  2GO8 A;  2XMK A;  3KK2 A;  2CQB A;  3CW2 C;  1UW4 A;  2XMU A;  3PVX A;  4ZIV A;  4ZPT R;  1FE4 A;  3CC7 S;  3M2U A;  4I2Q A;  2WVE A;  3JYT A;  4I2P A;  4PXB A;  4DCJ B;  2VPZ B;  2PT0 A;  1DTT B;  2BQU A;  4DX8 H;  1S1V A;  5J2N A;  4DBQ A;  3AHP A;  3BSA A;  4OJ3 A;  4U7U D;  4KV8 B;  2HHV A;  1DQA A;  2QV6 A;  3SEO A;  3VZH A;  3FCH A;  3SQO P;  3OR2 B;  1OWX A;  1K8A T;  4Y34 A;  4B3M J;  2OPR A;  1JJ4 A;  1EKR A;  3DMJ B;  2OD6 A;  1GXU A;  1T3O A;  2X3G A;  2OPQ B;  5C25 A;  1HNW J;  1JLA B;  1ZBT A;  1H73 A;  4K4T A;  3B4D A;  4DG1 B;  1RWN B;  2B43 A;  4TY8 B;  4I56 A;  1N6Q B;  4ANE A;  4FNH A;  1DAX A;  2YPZ A;  5E33 A;  5AT1 B;  1X9M A;  3RTV A;  5B0E A;  3RB0 A;  3EXY A;  4F67 A;  3JB9 k;  1TL3 A;  5EDW A;  4Q7A A;  2CRL A;  2A1B A;  4KH0 B;  1RT2 B;  1CEZ A;  4TLQ A;  4EK2 A;  1FDN A;  1RT6 B;  2GCF A;  1AFJ A;  1JLE A;  1RAA B;  2V2V A;  5E2Q A;  2XBP A;  2V4Q A;  3K59 A;  3CMA S;  1RWX B;  2V9W A;  4DL2 A;  3WZ0 A;  2XWY A;  2ZHA A;  2EFQ A;  2AYE A;  2V5H G;  2DNH A;  1WG4 A;  4ATN A;  1RTJ A;  4DFP A;  4E98 A;  3RU0 A;  2KHD A;  5I3U B;  4KRW A;  3E2E A;  2FZK B;  4F3M A;  2E9T A;  1RHQ B;  1CJU A;  1NXI A;  2HGM A;  2UXD F;  2PMW A;  2EXU A;  3G86 A;  1TUV A;  5L8R C;  2IM2 A;  4NCG B;  4UOC A;  4C11 A;  4ZJQ A;  2K2P A;  2HWT A;  2B4V A;  1R8C A;  1OSC A;  2FJV A;  2OIH A;  2J9C A;  2FY8 A;  2WVD A;  1S4F A;  4MIB A;  3T41 A;  4OI0 A;  5I3Q A;  4N5S A;  5LXY A;  3LP0 B;  4LFA F;  1RAF B;  2V4J A;  2GVD B;  3M9N B;  4DS5 A;  4QU7 A;  4QR0 A;  1FK9 B;  4USH A;  3SV3 A;  3ILL A;  4GVB B;  3ITH A;  1U0H A;  1LFP A;  1RLD A;  3PW0 A;  5GAD U;  1ELO A;  3R2C J;  3W2W B;  3AY0 A;  2EC2 A;  1R27 B;  4KKO A;  2DNO A;  4KAI A;  3KYL A;  1J5E F;  1N34 F;  1W2I A;  1KTV A;  1HBM A;  3MUM P;  5F8J A;  2JEI A;  1ZM4 A;  4QWB A;  1P6T A;  3F41 A;  1XC9 A;  1FFW B;  4ED6 A;  1RKI A;  3M8Q A;  4ID8 A;  1LNQ A;  4LJM A;  4UW2 A;  3FBF A;  4QIE A;  3OL6 A;  3LP1 A;  2HFN A;  2MZ1 A;  1VBX A;  2MKS A;  1GXT A;  4RW9 B;  4C48 A;  4EO6 A;  4F26 A;  2B4P A;  2ZJR Q;  1LK5 A;  2E1P A;  3W5X A;  4HH0 A;  1LWX A;  4FPI A;  1FXR A;  1N32 F;  3CD0 A;  5KT4 A;  4URS A;  1QDU B;  2L48 A;  3C6T A;  4ED2 A;  1QUP A;  4ZVG A;  3I32 A;  4DL4 A;  3MOZ A;  2EWH A;  2EC0 A;  1M1K T;  4ED4 A;  2X7I A;  4DR6 F;  2VQE F;  3D6T B;  1Q8L A;  1GXL A;  3KLF A;  4ECS A;  1D0E A;  2VBW A;  1IXK A;  2ILY A;  1SJR A;  4LF9 J;  4RR5 A;  1AZS B;  1C4A A;  2YKP A;  4ZLN A;  2QLW A;  3CCJ S;  4QWE A;  1H6K X;  3OL8 A;  2RS2 A;  1KOO A;  2YNG A;  5HQ8 A;  4M5N A;  1R7I A;  2LDY A;  3GYN A;  3BSN A;  3G96 A;  4KIA A;  4FBU A;  2EK6 A;  2JC0 A;  4MTP A;  4EBD A;  3GJT B;  3LTO A;  2OLW A;  2FZG B;  1CC8 A;  1GAO A;  1S7I A;  3HD1 A;  3D0G E;  4M5G A;  3GFY A;  5F8N A;  4HLB A;  2HHT A;  2IRY A;  2CQG A;  1HQ2 A;  5DQH A;  2E5H A;  4NXN F;  4RO0 A;  1S97 A;  1PYO B;  4B9L A;  2B8Q A;  4UOH A;  3ETO A;  2B9Y A;  5FDL B;  1L3U A;  2UUA F;  2HRY A;  2AEF A;  2XWX A;  2ALZ A;  4CNY A;  2XS7 A;  1O51 A;  4DV5 F;  4DU7 A;  3C14 B;  1EP4 A;  4DV0 F;  4NLX A;  2CUY A;  3GFX A;  1M5V C;  4QR2 A;  3TR5 A;  2VC1 A;  1H7W A;  3MFH A;  2IJN A;  1HLW A;  4DPO A;  5D4P A;  5A8K B;  3DLE A;  2LQ9 A;  1PIE A;  1SKW A;  4EUV A;  3M4X A;  2P9C A;  2B6A A;  3NCQ A;  3G6V A;  3DHW C;  3PIP Q;  4B9S A;  4ES1 A;  2AZ3 A;  2XO7 A;  5ADZ A;  4Y0F A;  4ZN3 A;  3VAL A;  4JI3 F;  4ZP8 A;  4CLT A;  2LQ8 A;  3T1H F;  3OTB A;  3LF0 A;  2LMI A;  3LOU A;  1HR0 J;  2JDJ A;  5A2Q U;  1VQL S;  1RB0 A;  5EWG A;  1EJ7 L;  2APO A;  4K2J A;  5CYQ A;  1YJT A;  3W5Z A;  2KRB A;  4CI0 B;  1RYS A;  5LM7 E;  2GMJ A;  2QL5 B;  2UXC J;  2YKN B;  1FRJ A;  3EGZ A;  3AJD A;  4F04 B;  2ASL A;  3QAT A;  4RNF A;  3MMB A;  3D0H E;  1K0V A;  2WVC A;  4WE1 B;  4LFB F;  1T94 A;  4O3O A;  3H4B A;  2CAD A;  1Q5V A;  4HI2 A;  2KFZ A;  3VAM A;  2NXC A;  3VAH A;  2DXF A;  4ECQ A;  2M88 A;  5DRK A;  4Q2M A;  4OYZ A;  2IJF A;  1W2B R;  1UEK A;  1BE4 A;  2BEF A;  5KFZ A;  4G1Q A;  5IC6 B;  5HP1 B;  5KOX A;  4F4W A;  1RAO A;  4L3N A;  5DG7 A;  3OW2 R;  2XYG B;  3CD7 A;  3FUY A;  4ZP7 A;  4YFU A;  1M90 T;  1A7G E;  3TI0 A;  5L1J A;  2HQC A;  3KG1 A;  1TEL A;  4XO0 A;  3CJQ A;  3G82 B;  5HLF A;  4ELU A;  2BJE A;  3OPK A;  4ED8 A;  2W7O A;  2R4F A;  2F8M A;  3CJ8 A;  2HVH A;  1TVR B;  3H5S A;  5F8H A;  4IH6 A;  5GAH I;  1G1X A;  3DOL A;  2DH7 A;  2OEK A;  1QD1 A;  5EUH A;  2CZ9 A;  2YNF B;  2JWN A;  4LF5 F;  2RQ4 A;  4DEZ A;  3UR3 C;  5DM7 Q;  1NKB A;  4WCE Q;  4IR9 A;  3MM6 A;  4KTQ A;  5I4M A;  3M8P B;  3UDL A;  4USI A;  5HMY A;  3QT7 A;  1E6V B;  3NBP B;  1PG5 B;  4C8N A;  4JI5 F;  2G0I A;  4DSF A;  2LA4 A;  5J1E B;  3R7B B;  5HSP A;  1KON A;  2XC9 A;  1I51 B;  1XNQ J;  3HVW A;  2WVB A;  2DNK A;  3HD2 A;  5I42 A;  3THP A;  3CJT A;  2Z2M A;  2QA1 A;  2YNI A;  4DQP A;  3QID A;  1EIY B;  2CPZ A;  4BWM A;  1DTQ B;  2ZHO A;  2CVI A;  1N36 F;  6FD1 A;  3B54 A;  1S1X B;  2DH8 A;  1RCO B;  3CCM S;  1VQM S;  3Q8U A;  5KFL A;  4LR9 A;  2HHH J;  2VF3 A;  1VMB A;  4NLU A;  4YP3 A;  3K5N A;  2AD9 A;  3TZX A;  4DXL A;  3PEJ A;  3W3S A;  1S12 A;  4ELT A;  2P6T A;  4QYZ K;  3ISN D;  4CP5 A;  4B9N A;  2CJ9 A;  4P71 A;  2XMV A;  3LWM A;  2KM8 B;  1OPZ A;  3QZ8 A;  1T9U A;  2M52 A;  1HW9 A;  4EBC A;  2ZM6 J;  4F2R A;  3THT A;  2SXL A;  2XLK A;  3H5X A;  4Y3C A;  1NSQ A;  5LMU J;  5ETP A;  1UAW A;  4ZCK A;  3KLE A;  1RAC B;  2VKR A;  2G2O A;  4DV1 F;  2ZIT A;  2E1R A;  4IG3 A;  2MKJ A;  2ZBC A;  4ZMM A;  4OMF G;  5CCM A;  3R1L A;  2KRR A;  3OVB A;  1Y10 A;  4CH7 A;  3I0R A;  4RX6 A;  5IV4 A;  1R8B A;  1RTI B;  3NRB A;  1FJG J;  2Z57 B;  2J7K A;  1FRH A;  2K7K A;  1RTD A;  1U0S A;  1JLC A;  4DR5 J;  2MST A;  2YKA A;  2UUB F;  3MAQ A;  1X4B A;  4ZPB A;  1KVJ A;  3LAM A;  1FWK A;  3Q8Q B;  3H25 A;  2BDP A;  1PGZ A;  2Q1L A;  3NAI A;  1FKP A;  1RAB B;  1YQH A;  1GTH A;  2QLJ B;  3RAQ A;  3PCO B;  3OFF A;  1WEY A;  3KJV B;  3KLH A;  3QYY A;  2BJ8 A;  4O0I A;  1WG5 A;  3FRZ A;  3MCS A;  3CO9 A;  1J27 A;  3NNC A;  2XM3 A;  3AXK A;  2AJ4 A;  5IQQ A;  2CPE A;  5CCL A;  2AMC B;  3PXG a;  2QL7 B;  2OAU A;  1TL7 B;  1VQ4 S;  2FJE B;  4USV A;  4WTY A;  1Q5Y A;  3G6E S;  3HT3 A;  3B8H A;  2ZJP Q;  2LEP A;  1AXQ A;  2E66 A;  5A8W A;  1RAI B;  1LFW A;  2HBY B;  1S6Q B;  1JNR B;  2LQ5 A;  1RWP B;  3MDF A;  4NLO A;  3N9U C;  4ELV A;  1X4F A;  2VPW B;  1WEZ A;  2D69 A;  1SIW B;  4IG0 A;  3N6N A;  1K1S A;  2FJB B;  4EYH B;  2J7W A;  1FNO A;  5LSR A;  4HAC B;  4BCA A;  3ONQ A;  2I2Y A;  3T5J A;  3ZZT A;  1HPZ A;  2GVZ A;  3UE2 A;  4JI4 F;  2HFV A;  2JLG A;  4HVZ A;  1Q86 T;  4PYD A;  2BKN A;  1CJK B;  1FWL A;  4HHU A;  4QBU A;  2W9B A;  5LXR A;  4RNM A;  1MML A;  1RAH B;  3M2V B;  2HZC A;  4CTA A;  2F40 A;  1S49 A;  2G1H A;  4K50 A;  4NLR A;  4FXV A;  2UVW A;  3ENW A;  1YI2 S;  2DNR A;  3T9N A;  4FVM A;  3ULH A;  2C2N A;  4EGL A;  4TYB A;  4H4M B;  4IKA A;  5J2P B;  5K14 B;  4B3S F;  3V81 B;  2CQ0 A;  4F4Z A;  3JSM B;  4NI2 B;  1WWH A;  2WOM B;  2RKI A;  3UN2 A;  4F3Q A;  1RT5 A;  3MEG A;  4P73 A;  4M5K A;  2G0J A;  4UTG A;  2KT2 A;  2IC3 A;  3TEH B;  3MEK A;  3IP0 A;  2FHO B;  2F8H A;  2Z2Z A;  2DRB A;  3QLH A;  2KFY A;  2AQ4 A;  1ZTT A;  3FQL A;  2FJX A;  4I68 A;  4X4T A;  3UCG A;  4FP9 A;  3SDE B;  1MRO A;  3HF5 A;  1UFL A;  3TX0 A;  4ALZ A;  4Q8E A;  4C0B A;  1KFD A;  4PG8 A;  4OZN A;  4B3R F;  1VOM A;  1FVQ A;  1L3K A;  1CBK A;  1FER A;  5ETL A;  4URG A;  1RDR A;  1GT8 A;  3CUN A;  1HNX F;  1B0T A;  1SUQ B;  4EBE A;  2W1B A;  2KN4 A;  1WDT A;  4C8K A;  2IRX A;  2AF6 A;  2HZA A;  2I9S A;  3WX4 A;  2QFI A;  3FFI A;  2XCA A;  5HQL A;  1M0S A;  3CCT A;  3R8Y A;  1IKW B;  4QIG A;  2D41 A;  1R89 A;  1WUU A;  3GQC A;  1DAR A;  3GSI A;  2H65 B;  1TMJ A;  1GFW B;  3ILJ A;  4DLG A;  2XUL A;  2EBE A;  1U2C A;  5JVG Q;  2DHH A;  3RRG A;  4WTO B;  1R8A A;  2F1F A;  2HFU A;  2PGC A;  3MEC A;  2PII A;  2E7X A;  1WC5 A;  1FO1 A;  3EZU A;  2DEI A;  3RZA A;  3UW1 A;  3QGH A;  4DMZ A;  2WON B;  4FZV A;  1Y11 A;  4KO0 B;  2DR7 A;  3ISN C;  1TL4 A;  2ZNY A;  2ZC3 A;  5LSO A;  3HLU A;  1ROF A;  2R3V A;  2ZH9 A;  4IQM A;  3BSO A;  4PYA A;  4M95 A;  2DCU B;  5C42 A;  1FDB A;  2I5J B;  3PV8 A;  1KQS R;  4YUD A;  1CS4 A;  1XMB A;  3OTC A;  5KFQ A;  3DLG A;  2UV8 A;  1M5H A;  1ZS6 A;  4MKB A;  3I5C A;  2V8P A;  3CCQ S;  4N77 A;  1IR2 A;  1DQ9 A;  4K59 A;  3VR1 A;  2XY7 A;  4LF4 F;  4DZD A;  4NXM J;  1FWP A;  3TZY A;  1M1H A;  1RT4 B;  3Q2S C;  1SB6 A;  1YJR A;  3M30 A;  2CQ1 A;  1NHU A;  4RW6 A;  3TVK A;  4FXW A;  1XMQ J;  4B3M F;  4IRC A;  2MGZ B;  4ZCI A;  4V19 X;  2OJ3 A;  4KT0 C;  4WIQ A;  4DX7 A;  5A8R A;  1HNW F;  5AJ3 F;  2BJD A;  1X5P A;  4M1K A;  4U67 Q;  3HFK A;  1QJH A;  2UUC J;  4K2X A;  1VC0 A;  1C1C A;  5KTQ A;  1RTH A;  4QWD A;  3CDE A;  3W61 A;  3S8S A;  1JLG B;  1T05 A;  2E29 A;  4J91 A;  1N5S A;  2VB6 A;  2Z0G A;  3FZB A;  1XR6 A;  1QE1 B;  3H90 A;  4USM A;  1X0F A;  1VGY A;  4B17 A;  2I38 A;  2J9E A;  3P8B B;  1CQN A;  3E01 A;  3UDV A;  2JHE A;  2UXB J;  3OVA A;  2W4C A;  1KHW A;  1YHQ S;  2VFV A;  2J0X A;  3FK4 A;  2KT5 A;  2ZE2 B;  4X65 J;  1WOO A;  4LR7 A;  4K0K F;  3NNH A;  3MAA B;  3LAK A;  3DOK B;  4IQX A;  1UEU A;  2ZH1 A;  4X66 J;  2OO4 A;  1X0P A;  1SJF A;  3L4B C;  1FCA A;  2DHG A;  1TKD A;  1TL1 A;  3K5P A;  4CO2 A;  2DR8 A;  2CPF A;  3EPI A;  4LIW A;  3QBC A;  3JAM Y;  4MKY A;  1Y9O A;  3UVJ A;  2QYC A;  2KXH A;  4O44 B;  4M63 A;  4YDX A;  3N79 A;  1UPP A;  4A8W A;  4TKT A;  3VQS A;  1NK8 A;  2CQP A;  2NQP A;  3H5Y A;  1HWJ A;  1U1R A;  4ETX A;  1BXN A;  3HO1 A;  2YNH A;  3G4S S;  2BJ1 A;  1VQ6 S;  4OI2 A;  5HMZ A;  2B4O A;  4IH5 A;  5HN0 A;  3GJQ B;  3M8Z A;  2KL8 A;  1WHY A;  3ZNU A;  4B9U A;  2YQ1 A;  1VBK A;  1LXN A;  1KN6 A;  3OLA A;  3DLL Q;  3OHA A;  1BWE A;  3VQT A;  2MQN A;  1NHK L;  3UCZ P;  1IKY A;  1B99 A;  4OQJ A;  4CH0 S;  2D3O R;  2VG7 B;  1S1U B;  1RT3 B;  4LSZ B;  1MLA A;  4R8U A;  3JS9 A;  1XIQ A;  4EZ6 A;  1AYE A;  4JI6 F;  1FEE A;  3A1Y G;  2XMW A;  1N5T A;  2V8G A;  2R7T A;  2PMZ D;  1VRT A;  3VWS A;  3S1T A;  5T7L A;  1FRM A;  1S9E A;  1HYS A;  1S10 A;  4DI6 A;  3OV7 A;  5EX0 A;  3V6J A;  5D6G A;  3V2U C;  4LF8 J;  3N28 A;  2VU5 A;  3QSI A;  2A6M A;  2R2T A;  2BAN B;  3ELH A;  1Q4R A;  3KKF A;  5LOQ A;  3TAM B;  1VYA A;  4QJV A;  4E0D A;  3MR7 A;  2GIR A;  4N76 A;  2A2D A;  5E3P A;  1Y5I B;  1SC6 A;  2XMA A;  3CUL A;  2M4M A;  4C8O A;  3V6D A;  1U2R A;  2EKY A;  4QYR A;  2XNR A;  4NA3 A;  1UEV A;  2Z2L A;  2OTJ S;  5F0U A;  2XLJ A;  1SC1 B;  2VOP A;  4C98 A;  2B9X A;  4DPT A;  1JLF B;  1U2F A;  5E3R A;  4PAA A;  2YX1 A;  3ICL A;  1TKT B;  2QGF B;  4U7C A;  4DF8 A;  3MUV P;  2F5G A;  1U24 A;  2MKC A;  4C0O C;  2HMI B;  2ADC A;  3R6L B;  3R5A A;  2KZZ A;  4TYA A;  2NUH A;  2XMM A;  2GX8 A;  5HMW A;  3K8W A;  1VHI A;  1NM2 A;  1ZAW A;  4HT5 A;  1K44 A;  1T0T V;  4CWB A;  3HHL A;  3IO1 A;  2EEY A;  3KHG A;  2ERR A;  4IR1 A;  4PPD A;  1HBO B;  2CIM A;  2HBQ B;  5GAD I;  2DY9 A;  2F9J A;  4OX6 A;  5EHH A;  4P6Q A;  4ZOS A;  1YSJ A;  2E1M C;  2GQQ A;  2MLY A;  5KG5 A;  3HJF A;  3FZ2 A;  2FLN A;  1N48 A;  2DH9 A;  2HND B;  2JJ4 D;  3MGJ A;  2IAJ B;  1X4C A;  2MMY A;  4RU2 A;  2BVZ A;  2DRD A;  1ULR A;  3KUE A;  1GQE A;  5IWA J;  2BX6 A;  3PY8 A;  2W7P A;  4I6Y A;  1TMM A;  3V4I A;  3QPI A;  5GAE I;  1NND A;  4CIO A;  2MQO A;  5K20 B;  1T03 B;  3M32 A;  3A3N B;  3BH7 B;  1NZ8 A;  4RL1 A;  5KFF A;  4OL8 A;  1GTE A;  3BGO P;  2KB2 A;  3UD3 P;  4MT1 A;  4Q0B A;  2RRB A;  3KOA A;  4XDC A;  5ETO A;  5A6W A;  3PX4 A;  5D0G A;  2RHQ B;  3HZG A;  3CC4 S;  2NUU G;  2QRR A;  2VBY A;  2K1R B;  1S6P B;  2YVS A;  3ZTS A;  1ZH5 A;  4UQT A;  5MLC V;  3UPF A;  1RZM A;  3GB0 A;  2H4Y B;  3QGP A;  4A4J A;  4CO0 A;  2R2R A;  2IJR A;  3SYZ A;  5FLX U;  3A8E A;  4NLW A;  4OHZ A;  1XTZ A;  1VJW A;  4X4N A;  2MB0 B;  2Z58 B;  5G0R B;  2WZ1 A;  4U96 A;  1WEL A;  1TKX A;  2F7V A;  3TP2 A;  3OUY B;  1XN9 A;  4O3P A;  3KDO A;  4V1A k;  3NY0 A;  2ATC B;  2KJW A;  1NH7 A;  3EM1 A;  4ZVQ B;  2RUS A;  1WDD A;  1G4C A;  2XYP B;  3GV7 B;  3CTR A;  4OIX A;  3MF5 A;  5B0C A;  1DZ5 A;  2KG0 A;  4ZJO A;  3DCA A;  3M2U B;  3T6B A;  1BQM A;  4I2Q B;  3JYT B;  4I2P B;  4MFB A;  2QLB B;  3A8I A;  2B9E A;  2MKI A;  3OLB A;  1UET A;  1S1V B;  3PYG A;  3PW2 A;  5J2N B;  4OI1 A;  2VL1 A;  1T3N A;  2DK2 A;  1X5O A;  4QIW D;  2Y0B B;  4HH1 A;  3MUT P;  5IM0 A;  1HBN A;  4OYA A;  2O01 C;  2UXD J;  3FSX A;  4HDG A;  3IWX A;  4X4R A;  1KHV A;  3CCW A;  2R8K A;  3ZZ0 A;  1SXL A;  5C25 B;  2LCW A;  1RLC L;  4O4R A;  4WFX A;  2W7A A;  2C3Y A;  3OXL A;  3Q86 A;  1WC1 A;  3D6M B;  4X4V A;  2VJV A;  3N01 A;  3AA9 A;  5IT4 A;  1TV6 A;  5HRO A;  3QFW A;  4HKQ A;  3KUH A;  5KG6 A;  3KK1 B;  4ZLL A;  3TWZ A;  2XGP A;  1F60 B;  5U47 A;  4U8Y A;  3PZP A;  1N4L A;  1TL3 B;  3FSY A;  2YQ3 A;  1K9M T;  3C15 B;  1APS A;  2R8G A;  2M9K A;  3G8T A;  2E5J A;  2XMJ A;  2HK3 A;  3E3X A;  2XSF A;  3MMJ A;  3H59 A;  1PSD A;  1U02 A;  1JLE B;  1X4G A;  1SJQ A;  2Z8Q A;  3A8K A;  3HXM A;  1VCT A;  1J5E J;  2VC0 A;  4KE5 A;  2Q66 A;  1XNQ F;  1JJH A;  3W5Y A;  1F3V A;  5DDP C;  2M7S A;  4URQ U;  2A6O A;  1MMN A;  3TRG A;  1F5B A;  4R5P A;  4C3K A;  4DF4 A;  3QAU A;  3D68 A;  2QMW A;  1M5P C;  1TK0 A;  5K8M A;  5KFK A;  4A8K A;  5CAB A;  4C3L A;  2F9D A;  4DQS A;  2B0G A;  4TU9 A;  2CQ2 A;  1T7P A;  3GCW P;  1RQ0 A;  3J81 j;  2P8I A;  2P6S A;  2XMT A;  3B82 A;  2HHH F;  5HAO A;  3MI7 X;  4LQ3 A;  2Q6C A;  1RYR A;  2PFF B;  3FSI A;  3MM9 A;  3Q23 A;  4C0H A;  3R9L A;  2C42 A;  2XSJ B;  1F3F A;  4LBI A;  3QT8 A;  2V4J B;  4LSN A;  4DR6 J;  5ETK A;  1U8S A;  2VQE J;  4V19 J;  2DIU A;  1FKA F;  2CZ4 A;  1WAC A;  3ITH B;  1UFW A;  3VGU A;  5LMU F;  1LEO A;  4I6W A;  3F44 A;  5LJ5 Y;  4DQI A;  1Q78 A;  4AUK A;  3EZO A;  2C3M A;  2G2Z A;  4I69 A;  3I4H X;  3J80 U;  4LSL B;  4LMZ A;  1RE1 B;  4CLL A;  4NCA A;  3HHL D;  1HBM B;  1KKH A;  3FEX B;  4WXO A;  3CVK A;  2L9D A;  3LPE A;  3P5B P;  4WKR A;  2CG8 A;  3GFZ A;  1NRK A;  3CCU S;  1JLB A;  4OLO A;  4PG7 A;  4KJI A;  3BSC A;  3N6L A;  2JEJ A;  4BHQ A;  4TXS A;  3G8S A;  3DLK B;  1P1L A;  3RBE A;  5C2G A;  5M2R A;  2RE1 A;  3M8Q B;  5L1I A;  4DR2 F;  1HI0 P;  4LBP A;  4NRU A;  3KLG A;  3AAW B;  4FF2 A;  3X1L B;  4RW8 A;  4K4Y A;  2YKM B;  2FVC A;  3PRV A;  3BRE A;  5F3T A;  5DG8 A;  2CDR B;  4YHH F;  2QIF A;  4ES3 A;  4PWU A;  3G87 A;  3ZZU A;  5C24 B;  4MAK A;  2BUN A;  2UUA J;  4AYB D;  4DZ6 A;  2DO0 A;  2NZC A;  3I55 S;  2GGP B;  4DV0 J;  4X2B A;  3TEG A;  1U1K A;  1KLN A;  3T1Y J;  3BYP A;  2DY1 A;  7AT1 B;  1XR5 A;  1NZA A;  4MK7 A;  3OTO J;  3WHI A;  1ZA1 B;  5GAH U;  1VHF A;  2ZWO A;  1FKO A;  4OZ5 A;  3EDQ B;  4ZVS B;  2JLF A;  2YNG B;  3ENQ A;  3GJR B;  3CCR S;  2J0Q D;  3EIC A;  3GR0 A;  3QRR A;  1RHM B;  4IFV B;  3T1H J;  5A0Y A;  4MK9 A;  4DWI A;  3HKW A;  3M1V A;  3HX9 A;  2QTW A;  1IBK J;  2B3T B;  1VJQ A;  4PG4 A;  4P2S A;  2AX1 A;  2RQM A;  2I6W A;  3DOM B;  4FYY B;  2H5I B;  1IBL J;  3R5D A;  1SV5 B;  3U1M A;  2O66 A;  3POT A;  2GQC A;  2FDN A;  1X4E A;  2MQM A;  3CB4 A;  1JKH A;  2J0W A;  1Z1Z A;  1QTN B;  4ZHR B;  1PAE X;  5H1S V;  2ASJ A;  4LFB J;  4ILM A;  2RU9 A;  2JFK A;  3RJM B;  2WAQ D;  5HBM B;  3AB4 B;  1IR1 A;  3RR8 A;  3SSS A;  5ETN A;  3PJX A;  2C2D A;  1HNI A;  1Q8K A;  1DTT A;  1EP4 B;  4F0H A;  4QPX A;  3EYZ A;  5KG1 A;  4JP8 A;  1LK7 A;  3J7Z 5;  4KV8 A;  1RHK B;  2V34 A;  2HS3 A;  2DD8 S;  2VIH A;  7FD1 A;  1FRI A;  2YPY A;  1Q53 A;  3Q24 A;  3DRS B;  2L08 A;  3DLE B;  1RP5 A;  3ZTR A;  3OR2 A;  1YBT A;  5D78 A;  5IT0 A;  3UN5 A;  3I9Z A;  4DQQ A;  2OPQ A;  4YY3 F;  1JLA A;  1UVJ A;  3K58 A;  5KFY A;  2RRN A;  4DG1 A;  4FVC A;  4TY8 A;  3G6X A;  2VG5 A;  2BKO A;  1N6Q A;  1DLO B;  2W8K A;  1KWM A;  5CYQ B;  2OGU A;  3BM7 A;  1S4E A;  2ZZN A;  3T3F A;  4CLZ A;  3W66 A;  3N5F A;  2XI2 A;  4M94 A;  2BYC A;  1RT2 A;  1NK9 A;  4DUT A;  2DNL A;  4HTJ A;  3Q2T C;  2L9W A;  3QRP A;  1GK8 A;  2QA2 A;  2V4R A;  4FPR A;  1I94 F;  2HHS A;  1UJ4 A;  3Q8S B;  2CAJ A;  3DC2 A;  2H4W B;  3PW4 A;  4PEO A;  4JI5 J;  4K4U A;  1R0B G;  4ECZ A;  3W9J A;  4KGK A;  4DFK A;  1RT1 A;  1AFI A;  3HPO A;  4LRC A;  4ETZ A;  4OHV A;  1NAQ A;  2QL9 B;  1SJ1 A;  4USJ C;  2AGO A;  3GYX B;  3KLI B;  2P2C B;  2ZBQ A;  3OTE A;  4TVA B;  5JXS A;  3TQE A;  4ED7 A;  2J8S A;  4NCG A;  3BO3 A;  3CME S;  4YB5 A;  1TU0 B;  2LQJ A;  2CQC A;  1Y5N B;  2OEL A;  3IA0 A;  4HHH A;  5F3Z A;  3LP0 A;  4NYO A;  3FBE A;  3O44 A;  4ZVT B;  2QE5 A;  1FK9 A;  1FTC A;  1UMJ A;  3D54 A;  2FY1 A;  1K1Q A;  1MW7 A;  2ZBP A;  3ZNJ 1;  1KVI A;  4NXM F;  5CAA A;  3HHL C;  1D1U A;  4UOG A;  3IBC B;  4ZS6 A;  1XMQ F;  1U1O A;  3QT5 A;  3VGS A;  3MM5 B;  4CT8 A;  2DGX A;  4HL9 A;  2W2M P;  3HHK A;  4DV1 J;  3CJ4 A;  2CPX A;  2UUC F;  2JLE A;  2RUG A;  4W98 A;  4GRS A;  2RVJ A;  1Q7Y T;  1B64 A;  3TJ8 A;  2KU7 A;  5HVG A;  1NK7 A;  4CZC A;  5I42 B;  1FES A;  1S5Z A;  1V3R A;  3H2U B;  2KG1 A;  3PDN A;  4ZPW R;  5ETS A;  4NA2 A;  3TUI C;  5KT2 A;  4DR4 J;  3GIK A;  4LFC J;  4RW9 A;  3QIP B;  1H3D A;  3BF4 A;  3IRX B;  1KR4 A;  3U1L A;  1U1M A;  2UUB J;  5HJX A;  2HFO A;  4X65 F;  4AL7 A;  1V5V A;  1EKS A;  1UCN A;  2RD5 C;  2XEX A;  6FDR A;  2YWF A;  4X66 F;  3D3C J;  1F6T A;  2FHJ A;  1ZET A;  1ZA2 B;  1CQM A;  1LWC B;  3FEZ A;  3I5B A;  1AZS A;  2HRU A;  4KFB A;  3VVU A;  3HVA A;  1NB2 A;  4WYL A;  1SBR A;  4J9R A;  4R25 A;  1S77 D;  3DLJ A;  1RA6 A;  5D4N A;  3ZZR A;  3VAJ A;  2ZD1 B;  4PXD A;  2E1A A;  4UF4 A;  3KLE B;  4AT1 B;  1RBO B;  3A3O B;  5IS2 A;  3S7R A;  1UJ6 A;  4PG5 A;  5JVH Q;  2MQP A;  1R0A B;  3CWJ A;  3W9H A;  1U8W A;  3LO3 A;  3SFU A;  2ZC4 A;  1ZTW A;  4DN9 A;  1NSP A;  1JLQ A;  2AW0 A;  4RW7 B;  1TP7 A;  1WNE A;  2D3O 1;  3IM8 A;  3TAN A;  4RPF A;  4JI4 J;  3HSD A;  3PHT A;  1RTD B;  3NGU A;  2DVI A;  4GC7 A;  3AB2 B;  4MKA A;  5IV3 A;  4L76 A;  3R97 A;  2KVQ E;  5FDL A;  5GMD A;  2HHX A;  1JNZ B;  5DZ7 A;  5KFV A;  1BD6 A;  1VRU B;  2V2Z A;  3PW5 A;  3C14 A;  1SH2 A;  2VZ9 A;  5KFD A;  1NBE B;  4CYU A;  3FDS A;  4JV2 A;  9RUB A;  1KOH A;  1T95 A;  2DHA A;  4ECW A;  4HT7 A;  3G2X A;  5D0R A;  1GMU A;  2QA4 G;  3P96 A;  3BPD A;  4LF8 F;  3PR5 B;  3QWU A;  2H1Y A;  4P2F A;  4CO1 A;  2GO9 A;  1PO6 A;  4WBF A;  4C9D A;  5H9F J;  3CCZ A;  3I56 S;  1JWW A;  2BW2 A;  3ZZP A;  4LUB A;  4GKJ J;  2MKH A;  1HFE L;  4LRA A;  3AJ1 A;  4XPC A;  3I0S A;  1LKZ A;  2POK A;  2ZKT A;  2V63 A;  1TKZ B;  3KNG A;  2BQ3 A;  3FMW A;  1QVF R;  1NSA A;  1S1T A;  3EVW A;  4ED3 A;  3BR9 A;  2EI5 A;  5CD4 H;  3DNC A;  3W60 A;  2GVZ B;  2PD1 A;  5AE2 A;  4WE1 A;  4RUB A;  4M5L A;  4ZVH A;  2CXE A;  4J9S A;  4AFF A;  3NOG A;  1HNX J;  1U6F A;  5BYS A;  4NZ7 A;  3JSB A;  3OQ2 A;  2CWX A;  1ITP A;  1JIH A;  1LQ9 A;  2FVQ A;  3G9C A;  1P1T A;  2IA0 A;  1DRZ A;  4IRD A;  1FRL A;  2IVF B;  4CTA B;  3TW0 A;  1H98 A;  4OJ1 A;  4ES2 A;  4Q5V A;  2XZW A;  5HP1 A;  3O1L A;  1YWX A;  4NRT A;  2UUT A;  3K2Y A;  1FRK A;  1I5O B;  2J5A A;  3J81 U;  2GHP A;  4ZP6 A;  4RNH A;  1XR7 A;  3BQ0 A;  4RWX A;  4QCL A;  2CQD A;  4JYA J;  3FCV A;  1SQG A;  5D3G B;  3V4M A;  3G82 A;  3DU6 A;  5HL7 Q;  2HSE B;  4GVL A;  1RT5 B;  1HD0 A;  2AYM A;  1JB0 C;  1EET B;  3SCL E;  2PC6 A;  2IC3 B;  3KDN A;  1T8E A;  3M6U A;  1G2E A;  1TVR A;  1XNR J;  2BV3 A;  1VQK S;  3KHL A;  2J7U A;  5KAK A;  3IAS 9;  1N5Y B;  1U6Z A;  4ZKA A;  1VBZ A;  1FJC A;  1BY9 A;  1X5T A;  3I6P A;  2GAG C;  2YNF A;  4LF1 A;  3MWB A;  3RW7 A;  2VFU A;  4MJK A;  1SQE A;  2W2Q P;  2QA4 S;  1B4S A;  3A8J A;  3M05 A;  4QZV B;  3D5M A;  1HWL A;  3M8P A;  2WCX A;  4ZN1 A;  3DGV A;  4NLT A;  1O6X A;  4DR7 F;  1E6V A;  3NBP A;  4LF4 J;  3L7U A;  1UP1 A;  2FJA B;  1KBR A;  2R7S A;  1VS3 A;  4NLP A;  3DN9 A;  1P27 B;  2O1P A;  4LRB A;  4PRF A;  3BKT A;  5DLG A;  1KLM B;  1YRX A;  4DU8 A;  5ETR A;  4DSE A;  3DRP A;  3FCW A;  3MEE B;  1TFY A;  5AJ3 J;  4JV5 J;  3KMS A;  3J7Z T;  4J9U E;  1YJV A;  4UY8 T;  1HWI A;  2YTC A;  1SH0 A;  1C0U A;  4PQU B;  2AIR B;  2XGQ A;  1DTQ A;  2RQC A;  4JV0 A;  2DNN A;  5CYM B;  5L38 A;  1S1X A;  2DGT A;  4B9V A;  2DHS A;  4CLS A;  3SCI E;  1A9N B;  2EBG A;  3M7V A;  2NXE A;  3FNN A;  4WKY A;  4EZ9 A;  3QRQ A;  3DFE A;  1BGX T;  2RU3 A;  2KT3 A;  4UZB A;  3MPW A;  2X1A A;  2Q43 A;  4H4K A;  3D28 A;  1M1G A;  2J6T A;  3EVO A;  3D1Q A;  5KFS A;  2DGU A;  1CUL B;  1Z2Z A;  1RT7 A;  2PMH A;  4AXJ A;  3KLV A;  5K8P A;  3TA1 A;  3N6M A;  3KG4 A;  5KT5 A;  2IM1 A;  2YX4 A;  1CS4 B;  1TFW A;  1NHV A;  2MJN A;  4K0K J;  2FHJ D;  4FF1 A;  2HBZ B;  4GMK A;  3AOD A;  3W9I A;  3MMA A;  4GO7 X;  2RJZ A;  3G6Y A;  4LQ9 A;  5KFJ A;  3H0P A;  2HZV A;  3RB6 A;  2HS4 A;  1WC4 A;  4F7V A;  3CCE S;  4LBH A;  5D4O A;  4F36 A;  4RW6 B;  4L74 A;  1LWE B;  2AP6 A;  4OYX A;  2QC3 A;  4O23 A;  5B0B A;  1RCX B;  1UVM A;  1DFD A;  4M5I A;  3MUR P;  5D0H A;  3PG9 A;  3NGT A;  4OFZ A;  5A8R B;  2MZJ A;  4OYW A;  1TUG B;  2GZO A;  2O67 A;  4K5S A;  3R5G A;  4DV7 J;  2X3D A;  2GC8 A;  5SUH A;  2BJ3 A;  2R42 A;  1AB8 A;  1RTZ A;  2HVZ A;  1UL3 A;  1T05 B;  1T9W A;  4RLE A;  2YH0 A;  4IYQ A;  5J2M B;  1O8B A;  3CJK B;  1BMQ B;  2JZ5 A;  5KG4 A;  2U1A A;  3Q8R B;  5LL6 d;  2ATL A;  2HQ3 A;  4A8M P;  3E01 B;  2FHK A;  2DNY A;  1VR6 A;  2CJY B;  4YR3 A;  1J5O A;  4K4Z A;  3MR3 A;  3MPV A;  2Y8W A;  1BQX A;  2CA9 A;  5IC4 B;  3UDC A;  1EAR A;  2DIT A;  4JI6 J;  2LXU A;  1N33 J;  3KHH A;  2MEW A;  1WKK A;  1TL7 A;  2RF2 B;  4W4M A;  2NPF A;  2N3L A;  4O4G B;  4C3M A;  3GWC A;  3GSD A;  1KC8 T;  1S6Q A;  2N7C A;  4KBI A;  5GAE U;  5T14 A;  1HW8 A;  4J9V A;  4LRE A;  2E7W A;  3MCO A;  3HT0 A;  2ZEJ A;  3OTD A;  4PQA A;  3UVJ B;  2DO4 A;  2DIV A;  3KNA A;  5KFT A;  3QWP A;  5BXI A;  5E0O A;  1U09 A;  3WBZ A;  4HAC A;  4P9S A;  2C3U A;  3MR2 A;  3R6G B;  4BDP A;  2CVE A;  1BLU A;  3UFC X;  1YLX A;  1TQL A;  3TUP A;  3OXF A;  3FBB A;  4G6V B;  2BRK A;  3NGS A;  1N8R T;  4FKY A;  3R7S B;  3M8S A;  1SCJ B;  8ATC B;  3M2V A;  2R7O A;  1S7H A;  2R7X A;  3EUN A;  2HRT A;  1S59 A;  1MWZ A;  3U1N A;  1FXD A;  1XMO F;  1HHT P;  1QTM A;  5B0F A;  3ET6 A;  1CJT B;  3BN4 A;  5D77 A;  1SC4 B;  1IKY B;  2BXJ A;  2N82 B;  1K0T A;  1A6L A;  3MXH P;  1BWV A;  1LV5 A;  4H4M A;  3QFH A;  2NR0 A;  5J2P A;  5K14 A;  2MTL A;  1VRT B;  4U6P A;  3V81 A;  2BE9 B;  2WRM A;  1FT8 A;  4PWD A;  2WOM A;  2V67 A;  2Y1I A;  4ZVR B;  3GV5 B;  3OR1 B;  5BJR A;  4C6A A;  4H4O A;  3UD5 A;  1RWK B;  3QZ7 A;  4HDH A;  3TOQ A;  1S72 S;  1FHT A;  3CJS A;  1VQY A;  2VG6 B;  3IXQ A;  3SDE A;  2G2Y A;  1HBU B;  3CJ0 A;  4EFA C;  2ROG A;  1S0O A;  4BWJ A;  1WKJ A;  3H20 A;  3MED B;  5ETT A;  5KFR A;  1RA7 A;  2K7J A;  3AOA A;  1FE0 A;  3TJ9 A;  4ERD A;  2HWH A;  1N52 B;  3OXG A;  3HCX A;  1SUQ A;  3T1Y F;  3C66 A;  1NKC A;  1FF2 A;  2YXL A;  3OTO F;  2VKZ G;  3ENV A;  3S6E A;  2BE7 D;  2WBR A;  5D4L A;  3QJJ A;  2EKN A;  1RI7 A;  2CJK A;  3IR6 B;  2R8J A;  2ZKU A;  2MXY A;  3OL7 A;  4RU9 A;  1N88 A;  1MSW D;  2OI2 A;  4AQY J;  4KC5 A;  1IBK F;  3HHD A;  2DIS A;  1JMT A;  3ADA C;  2DNG A;  3DRR B;  1IBL F;  2WON A;  4KO0 A;  3J7A N;  5EX3 A;  3ZTO A;  3B6B A;  4YME A;  2OKQ A;  3R1H A;  3T5K A;  3GP9 A;  2IPO B;  2HQF A;  2OPS A;  2I5J A;  4F4X A;  3Q8V A;  5KOW A;  2UVU A;  3IG1 A;  1EZZ B;  4J9P A;  1MG7 A;  3L7O A;  4ECR A;  2IDE A;  1RAJ A;  3QAE A;  1FX4 A;  3GIR A;  3VAF A;  1F9F A;  2VDI A;  4ECY A;  4NLQ A;  1FA0 A;  4RUC A;  4CLK A;  4CH1 A;  1D9D A;  4WZM A;  1RIS A;  1PJ5 A;  3F73 A;  1HD1 A;  2G4B A;  2B51 A;  3SZ2 A;  2G0C A;  3PIO Q;  3H8Y A;  2VA3 A;  4OI6 A;  1ARO P;  2KJV A;  1S9F A;  3SBM A;  2IYG A;  3D2W A;  3FEY B;  4DUZ J;  4X4S A;  4NCB A;  3BDE A;  4CQ1 A;  3GMG A;  1HNZ F;  3RGI A;  2BAC A;  2R7R A;  5HVF A;  4FS2 A;  2XG8 A;  2EK1 A;  4LF6 J;  1NJX A;  4DR1 J;  1JLG A;  3I87 A;  3MOJ B;  4X4O A;  4RWW A;  2W4D A;  5AXK A;  2MQQ A;  1QE1 A;  1Y3J A;  1HWU A;  5AE3 A;  4TY9 A;  3VTI A;  3NGD A;  4DL0 C;  3BGF A;  1KQG B;  1IVZ A;  1NCL A;  3GIL A;  3RR7 A;  4X4U A;  4CRJ A;  2DNP A;  2BKP A;  5CH7 B;  2XY6 A;  2ABY A;  1NKE A;  3DDI A;  2DTJ A;  3BEG B;  3MAA A;  4A47 A;  2YX7 A;  1UKU A;  4QOT A;  5K8N A;  1AUD A;  1CJV B;  1IBM J;  5CHC B;  3HSJ A;  3DU5 A;  4DDF A;  3RB4 A;  2CQ4 A;  3EGW B;  2IM3 A;  4DSJ A;  4MFB B;  3IRW P;  2RSQ A;  3M8W A;  1PC4 A;  2J8A A;  2AEM A;  1H74 A;  2Y9H A;  2CYY A;  4RKU C;  3PEH A;  1AA1 B;  1RAD B;  5DZ6 A;  2W24 A;  3JXO A;  4M5D A;  4O44 A;  2CPI A;  2PA8 D;  2MHN A;  3FVY A;  5F41 A;  3NEK A;  4CLU A;  1IWA A;  4Z37 A;  2ZBI A;  1EAY C;  3A12 A;  3VAI A;  4F25 A;  1U25 A;  1VQ7 S;  2HQD A;  2VAS A;  2Z56 B;  2M2B A;  2E5L F;  2VPX B;  3EE3 A;  1RWM B;  1YK9 A;  1JX4 A;  2XB2 D;  4Z7C A;  2GJI A;  2VFT A;  1X9S A;  3IM9 A;  4ECT A;  1L3V A;  2PO4 A;  4DR3 J;  1QM9 A;  2AJ1 A;  3B78 A;  3O3L A;  4TU7 A;  5KFH A;  4ZCL A;  1CG2 A;  5AE1 A;  4P2M A;  1S1U A;  1RT3 A;  3OFG A;  4DUY F;  4E8U A;  5CA5 A;  1ZAX A;  1YX2 A;  4A46 A;  2RRA A;  5D0E A;  2AZ1 A;  2N4C A;  4NZ6 A;  5KFG A;  1VIX A;  3WIV A;  4C8L A;  3A13 A;  3HVT A;  4ZVU B;  4OZJ A;  4R5P B;  4Y2M A;  4W92 B;  2BAN A;  4B3O B;  1F1B B;  4DR4 F;  2XLI A;  1HAR A;  4LFC F;  5LMN F;  3RG6 A;  2HAF A;  2AWZ A;  4GC6 A;  2FC8 A;  4OI3 A;  2F8E X;  1FFS B;  3BZQ A;  1SKR A;  4DR2 J;  1C2P A;  3H2V E;  1Q7L B;  1JJC B;  3ZZZ A;  5J2Q B;  4DL5 A;  1UFK A;  1UTA A;  2CPH A;  4YHH J;  3CDA A;  3N5B A;  2RNE A;  2HHW A;  1RHR B;  1JLF A;  4JB8 B;  5K5M A;  3HK2 A;  4XDD A;  1TKT A;  3BGR A;  2ILZ A;  3CJ2 A;  2QFJ A;  3EJM A;  3W8P A;  2IVY A;  3M2R B;  5KFU A;  4UST A;  2MLZ A;  3U7J A;  3SXL A;  1U1N A;  1XBW A;  3V6H A;  2V2Q A;  4EO8 A;  5K9F A;  4PZV A;  3LGN A;  3HSG A;  5C7P A;  4KY3 A;  1RWO B;  1HBO A;  2NCK L;  1WF1 A;  2V50 A;  2JOQ A;  5DS7 A;  2QG9 B;  1KFS A;  4ZVE A;  1RK8 A;  2GIF A;  4B9M A;  1Y00 A;  1ICE B;  4H4K C;  1JLB B;  3DM2 B;  2YH1 A;  1IQT A;  2HND A;  4C8Z A;  3Q8Y A;  2JC1 A;  1U4B A;  1T11 A;  2RHS B;  4L3K A;  2ZJQ Q;  2AJ0 A;  3W2V B;  2Y8Y A;  3GG1 A;  4Z7Y A;  2WVF A;  2B4U A;  3NNA A;  3FGV A;  3PHE A;  3K0J A;  5E3C A;  4QR1 A;  4JI1 F;  2F4V J;  1YZ6 A;  1EHW A;  3PJW A;  1KQK A;  3VCD A;  3W7B A;  1CSJ A;  3DGP B;  2LEA A;  2CG4 A;  4EI2 A;  3NAH A;  1U1P A;  3UR0 A;  2OSR A;  2ZOF A;  2EVZ A;  2LDI A;  2HHQ A;  2GJ2 A;  1IN0 A;  2YWH A;  2MYF A;  3Q83 A;  2LU2 A;  5KT7 A;  2VOO A;  3HZE A;  3KFW X;  1Q8B A;  5B08 A;  3CPW R;  5CZX A;  2FVR A;  4DHV A;  4GKJ F;  3CCL S;  2K1R A;  2ZDO A;  1S6P A;  2B8P A;  1FVS A;  3CCS S;  5MAO A;  2A2C A;  5KFB A;  2Z4P A;  3CIZ A;  4YY3 J;  1VC6 A;  3OFE A;  2UU9 F;  1VDH A;  2QMU B;  3PFO A;  4DFM A;  5A0Y B;  3I9V 9;  2HNY A;  3BJY A;  1WD6 A;  4WXW A;  2HYI B;  1BQN B;  5G0R A;  4RBV A;  2QLX A;  5J1P A;  2P5V A;  3SV4 A;  1B70 B;  3OUY A;  2QT7 A;  2WTF A;  3PO5 A;  4AL5 A;  2BJ7 A;  2F4F A;  3D6H B;  4FBT A;  1AT1 B;  2CFX A;  5KFX A;  5E5N A;  3TAR A;  5B7W A;  2CDQ A;  2N4D A;  3W1Y C;  2VBZ A;  1C1B A;  3SQG B;  4C7Q A;  2GA7 A;  4DSL A;  4OZ3 A;  4Y2K A;  5H9F K;  1S57 A;  3DYA A;  1I94 J;  1KTQ A;  4KB7 A;  1VLY A;  4JI8 F;  5IFM A;  2KVI A;  4QPT A;  5BR8 J;  4DL6 A;  2CNK B;  1HNI B;  2FQQ B;  3K7R A;  4DPU A;  5D15 A;  4OJH A;  3TA2 A;  3HM9 A;  3GCX P;  4CO4 A;  4JYA F;  3QT6 A;  3RBZ A;  2A0F B;  2XO6 A;  1DBD A;  3D1H A;  1R6V A;  2I1R A;  2E5I A;  1C0T B;  2C2R A;  4YR2 A;  1NPR A;  1GX5 A;  1UA1 A;  4R0J A;  1XNR F;  4N41 A;  1SPB P;  1Y4Z B;  2VG5 B;  3LPY A;  5LT5 A;  3MR6 A;  2UVR A;  2YKQ A;  3ENA A;  1NME B;  3OJU A;  3KK1 A;  3MM7 B;  4IRK A;  2XZD B;  1R43 A;  3TQ1 A;  4N8N A;  2FD2 A;  3MD3 A;  2AGP A;  3KK3 B;  3C15 A;  1E6Y A;  3D3B J;  2KTQ A;  2FYX A;  2AYB A;  2GV1 A;  4NE9 C;  3NOC A;  4MIA A;  4RW4 B;  1RAE B;  3RRH A;  2M8D B;  2DGW A;  1NDK A;  4J9K A;  3TNV A;  4PAB A;  3ILI A;  2BE2 B;  4J9N A;  2WW8 A;  3CO0 P;  4ZIW A;  5KFE A;  4PUO A;  1V6H A;  2B5J B;  1QAJ A;  4JV5 F;  1IJF B;  3ZTQ A;  4YQW A;  3HDS A;  3ZZY A;  1F2H A;  2OML A;  1RT1 B;  2Q3P A;  4YB6 A;  2H54 B;  2GJF A;  2GW8 A;  4HEA 9;  1F9H A;  4MYT A;  3LA0 A;  1SL1 A;  3MMC B;  2M0G B;  3K5L A;  3NS7 B;  1F2G A;  3HMJ G;  2A18 A;  2MY8 A;  2ZH8 A;  3MM8 B;  3IBF B;  4EU0 A;  3IS9 B;  3FMB A;  4NEZ A;  2V9K A;  1SL0 A;  1S99 A;  4XK8 C;  3I5A A;  4J90 A;  1WC3 A;  1U49 A;  1QLN A;  3OSN A;  4FF4 A;  4F4Y A;  2AJQ A;  2XSJ A;  4CNZ A;  4OZ0 A;  1FDD A;  3LAN A;  3FJ2 A;  5LJ3 Y;  2NLW A;  3GFH A;  1NK4 A;  2HNZ A;  2KXF A;  4I1T A;  4NPO A;  2W9C B;  4LSL A;  3QJP A;  4Q2L A;  4F0K A;  4RUA A;  3R7N B;  4X84 A;  2XZT B;  3F56 A;  2NRE A;  4DV7 F;  1GEH A;  2DEJ A;  2Q6B A;  4DV4 J;  2ZFH A;  4O3R A;  4IOA Q;  3DLK A;  1IKX A;  1Q16 B;  4OYM A;  4AD6 A;  3MAH A;  1VQ9 S;  2UP1 A;  5F8G A;  2C22 A;  1HHS A;  4NMX A;  2IBK A;  4M5M A;  2GNK A;  2R2U A;  2YKM A;  1S6U A;  2AV5 A;  2Y3Y A;  3DDN A;  2NYH A;  2EW9 A;  1B3T A;  2VQF J;  1H38 A;  2DR5 A;  1S1W B;  4RBU A;  1X31 C;  3HFZ B;  5C24 A;  3HP6 A;  4P74 A;  1FTR A;  4FNI A;  2BJ9 A;  3R5B A;  1WI8 A;  3NXZ A;  2QN6 B;  1HKA A;  2GGP A;  5CD4 A;  3DXS X;  3JAM U;  1UJ5 A;  2O5D A;  3BBB A;  3D66 A;  3CSK A;  1Y7P A;  1N33 F;  1PYT A;  4KFB B;  1N0U A;  3BPS P;  1D3W A;  4WFB Q;  5I3P A;  4LF7 F;  2ACY A;  4H54 A;  2HW3 A;  1VQ8 S;  2XHC A;  1P9Y A;  1FNM A;  1OY9 A;  5KFM A;  1HQE B;  2PDA A;  2EG2 A;  1T02 A;  2FC9 A;  1REV A;  1WG1 A;  1WTF A;  1RWV B;  3DI6 A;  4IFV A;  2IMO A;  4NLY A;  3LGM A;  1WF2 A;  4OX9 F;  1PAU B;  2RAQ A;  2MPU A;  1YTY A;  3J7A 1;  3NMR A;  4WYW A;  3DOM A;  3AD7 C;  4TU8 A;  1SV5 A;  1S0N A;  1IKV B;  3O6Q A;  3QGI A;  1JLQ B;  5IZH A;  3K5M A;  3PAC A;  1WHV A;  4G1I A;  1HMV B;  3OBI A;  2Y1L B;  4ZHR A;  1A0O B;  5A2Q Y;  4QU6 A;  3QO9 B;  2W2P P;  4BC9 A;  4L73 A;  2RDJ A;  4ZPD A;  3K8V A;  1HHQ A;  5HBM A;  3LWL A;  3PJ9 A;  3CC2 S;  4A8S A;  3HI9 A;  2JH3 A;  1GMW A;  1NK5 A;  4GKK F;  5DO2 A;  4CYU B;  1LW0 A;  3NGR A;  3N0V A;  1YJN S;  3OFH A;  3KHR A;  2NXJ A;  4KHR A;  2HLU A;  5CXT A;  3DRS A;  5KG3 A;  4ZPV R;  3PX0 A;  1KS2 A;  4X4P A;  4A48 A;  3CED A;  2VON A;  2JFD A;  5KFI A;  3F0N A;  3I96 A;  2D74 B;  2V94 A;  3EGV A;  3FC9 A;  4OX8 A;  4DCO B;  6AT1 B;  4CLY A;  3DLB A;  2AJF E;  2CQI A;  1UVL A;  3H98 A;  5EWF A;  2DBB A;  1VLO A;  3I0S B;  3FQK A;  4X4Q A;  4NA1 A;  1HQU A;  1YIT S;  4P72 A;  1DLO A;  4Q44 A;  3BGU A;  1QAY A;  2W25 A;  2LLZ A;  1RHJ B;  4P10 A;  2CKW A;  2M3D A;  3W63 A;  1S1T B;  1B7F A;  4P2X A;  2VDH A;  4NZ0 A;  1U26 A;  5FD1 A;  3V5R A;  2MSS A;  4DFJ A;  4J37 A;  2B9W A;  1HNV B;  1ZM3 A;  1W26 A;  4C2M A;  1TTH B;  3IR5 B;  4C4W A;  4NLS A;  1QVG R;  4XTT A;  1IM6 A;  4DR7 J;  1LW2 A;  1JXL A;  1PCA A;  3SI8 A;  3EGN A;  3ILO A;  4QWA A;  4NYP A;  4WFY A;  1HI1 A;  2JVO A;  4AQY F;  1VIO A;  2CNN B;  4ZCM A;  3KLI A;  5GMK a;  4U95 A;  5M2U A;  3R5C A;  1H2T Z;  1ZPV A;  4B3T J;  4I7F B;  1VQN S;  3IAM 9;  4IUF A;  2PEB A;  4ICL B;  3I4P A;  3NWG A;  3P49 B;  3KUG A;  3D7S B;  5KFN A;  1S9G B;  3IFE A;  4JI0 J;  4YR0 A;  3CDU A;  3D0I E;  3NCR A;  4KPY A;  4X64 J;  1UWB B;  4DV3 F;  4NOH A;  4ID5 A;  3UDE A;  2PA3 A;  1RWW B;  2HGN A;  3H2L A;  4XPE A;  2C2Z B;  3V6K A;  2PSZ A;  3PKM A;  2F65 A;  3KK2 B;  3GU0 A;  2ZH2 A;  1C4C A;  4G65 A;  1R6Y A;  2BBE A;  5DG9 A;  1I3O B;  1YG0 A;  1WSR A;  1L3T A;  1VRQ C;  4C97 A;  4YOE A;  1I1G A;  2DJW A;  3PFE A;  1WI6 A;  2QZ8 A;  1K47 A;  1S76 D;  4FDF A;  3UNG C;  1Y0H A;  2U2F A;  2JRS A;  2Y1R I;  4LR8 A;  2MQL A;  3LP2 A;  3MM5 A;  2ZUA A;  5IXU A;  1M5K C;  3NS5 A;  7FDR A;  4DUZ F;  3NP5 A;  2R7U A;  3J7Y I;  2C2E A;  3IWN C;  5EN1 A;  1UZD A;  4QW8 A;  2OPR B;  3CD6 S;  1U1Q A;  5IOL A;  3RW6 A;  3DRP B;  4LF6 F;  4DR1 F;  4J9Q A;  1VQS A;  2HAI A;  3R2D J;  1C0U B;  2JEG A;  2HVE A;  5B0D A;  1TK8 A;  2ZOM A;  2VJU A;  1U1L A;  3LUY A;  2GHW A;  4PKD B;  3QIP A;  3IRX A;  5F8M A;  3R27 A;  4JI7 F;  5GAG U;  3C16 A;  4L6V 3;  2XCP A;  1MU2 A;  2LA6 A;  5B0G A;  2W2O P;  3BBC A;  2BA9 A;  1IBM F;  1RT7 B;  2L41 A;  5ETV A;  2KKH A;  3IBW A;  2VV5 A;  1LWC A;  4K8R A;  3VGV A;  4DCP B;  1XWL A;  4DSK A;  5C2C A;  2YKO A;  5DQG A;  1FRX A;  1YBA A;  2ALY B;  1HA1 A;  3MMA B;  1L3S A;  3Q89 A;  3VAK A;  1RTJ B;  9ATC B;  3W64 A;  1DQ8 A;  5E3A A;  3HHE A;  3MPU B;  2HFZ A;  3HFV A;  2NXU A;  2ZD1 A;  1IBC B;  2OFH X;  2PN6 A;  1ZOT A;  1CJU B;  4BC7 A;  1IM4 A;  2C1E B;  4JUZ A;  5E7O B;  3AD9 C;  3U02 A;  4HHJ A;  4ILL A;  1GNK A;  4PG6 A;  2HS0 A;  2ZZT A;  1D9A A;  4C11 B;  5CZV A;  1R0A A;  2KO1 A;  4WK1 A;  2XQC A;  4C8Y A;  2COL A;  5T41 A;  1EQ0 A;  2ZVI A;  4HR2 A;  1NSK L;  2OPP A;  5AXM A;  1D8Z A;  4RW7 A;  4JI2 J;  2OTL S;  2WHO A;  2HPU A;  2HEK A;  4WP9 A;  1BUX A;  2FGC A;  2J76 E;  3THV A;  3PO4 A;  4O3Q A;  3SCK E;  4DR3 F;  2ZH4 A;  1NJI T;  4UUW A;  1VRU A;  4AXI A;  1HWK A;  2NSC A;  3A4T A;  1U0H B;  3WDO A;  3TA0 A;  3DDK A;  2D9P A;  1XMO J;  4K4X A;  1GMW D;  1Y5L B;  1J5O B;  4KKO B;  2MKK A;  4YN3 B;  4ECX A;  4YS2 A;  1Q1K A;  1OQ6 A;  2FGO A;  2LXI A;  3GJS B;  5F9N A;  1TAU A;  2VOD A;  3UWT A;  3ZXW A;  2EPI A;  1V9O A;  1X5S A;  2ZNZ A;  1R3N A;  2BZ2 A;  4K4V A;  1XEZ A;  2V0N A;  2NXN A;  2VBX A;  3L7P A;  1PKU A;  1H2V Z;  1S48 A;  4JBC A;  3PX6 A;  4PCQ A;  4TQR A;  1NPP A;  5DGB A;  3S01 A;  5DET A;  3LP1 B;  4ENO A;  5DDQ C;  1QSL A;  3VAG A;  1TKZ A;  1XK8 A;  1SQF A;  3T5H A;  5BYQ A;  2BM0 A;  3D67 A;  3RYL A;  5L9N A;  1U7L A;  2LVW A;  3PW7 A;  3OHB A;  2XY5 A;  4O0N A;  2H5E A;  4Q8F A;  4DV2 J;  2WK4 A;  3C6T B;  4USK A;  1NDL A;  1AW0 A;  1WC0 A;  2EFP A;  1RU2 A;  3C6U A;  2AGQ A;  3KLF B;  2HUR A;  3SMZ A;  1SKS A;  1IUJ A;  2D3Z A;  2IVM A;  4F3O A;  3O5T B;  3ET6 B;  3PKY A;  2IRU A;  4IDK A;  2HIY A;  2D7S A;  4PR6 A;  2CNL B;  1LWF A;  3CE8 A;  4CO5 A;  1OPI A;  2KYZ A;  4B08 A;  4FKX A;  1VK3 A;  2KZM A;  3ZZO A;  4PWD B;  5D3G A;  2K8G A;  3RUB L;  2N3O A;  4IH7 A;  2VFR A;  4OHW A;  2ZHB A;  3VHQ A;  3TAP A;  2C2O B;  1EET A;  4H4O B;  2R7V A;  1NH8 A;  3KWM A;  4U7U K;  5H9E J;  5RUB A;  3JQJ A;  1TR0 A;  1FD2 A;  3GIM A;  4IFY A;  3C46 A;  1ZZF A;  1YJU A;  3C19 A;  4BBY A;  4A8Y A;  2OMO A;  2W4P A;  3W8G A;  1YZ7 A;  4FYW B;  1N5Y A;  1MN7 A;  5HAN A;  2F4V F;  2IFX A;  1OSD A;  3B4M A;  3T1A A;  4OHY A;  4CLF A;  2CJX B;  1S6O A;  2OEM A;  2YWG A;  2PEH A;  3AD8 C;  2ROP A;  4Z2X A;  2IM0 A;  4O3S A;  2RB7 A;  4UY8 5;  2JVR A;  3NGK A;  2PI5 A;  2FJD B;  5DM6 Q;  1FEH A;  2B6A B;  4WK3 A;  2ROE A;  5LSL A;  4N7T A;  4USU A;  2YWW A;  1KLM A;  1L5U A;  3DMJ A;  1KVK A;  4RNO A;  4EMD A;  1WKL A;  3MEE A;  4I64 A;  1WOP A;  4Y2A A;  1XER A;  4DJB A;  4YDD B;  3T9Z A;  4QQB A;  2VUG A;  1TK5 A;  1NEE A;  1NLK L;  3N4W A;  2FIU A;  1HNZ J;  1QSY A;  1V3Z A;  4PQU A;  4JOU A;  1ZM9 A;  1YJW S;  3GYG A;  1PJ7 A;  5CYM A;  1SJ3 P;  2QMX A;  3EWG A;  3L09 A;  4IOC Q;  2E7V A;  2NYI A;  5K8O A;  4ZP9 A;  2NZ4 A;  3KJF B;  5E3Q A;  3MMB B;  1RT6 A;  1D8Y A;  1LXJ A;  4X62 J;  2OPS B;  1CUL A;  4DL7 A;  2RML A;  3FBC A;  4OZ1 A;  3IG1 B;  3M8Y A;  1FXL A;  4OYB A;  5BR8 F;  5B09 A;  2MJU A;  3MPY A;  2W2N P;  3I82 A;  3BV8 A;  3MTJ A;  2MQ8 A;  4DX5 A;  3ZO7 A;  4G1Q B;  2FLL A;  1UWA A;  5I3U A;  4FS1 A;  1WEX A;  3DKD A;  3FKB A;  3JQM A;  4BS2 A;  4ECU A;  1DUR A;  1RBL A;  2KXN B;  1UVN A;  1JJ2 R;  2J6S A;  1YGY A;  1LWE A;  2QSF A;  5KFW A;  3ZFV A;  3K57 A;  2VHG A;  3KJQ B;  1U47 A;  3R3T A;  4WPA A;  4F8R A;  2ZH6 A;  3RRK A;  5HVH A;  2H9Z A;  1OYD A;  1QAX A;  3E51 A;  3Q0A A;  1RUS A;  2AKW B;  4LVN P;  5HLF B;  1ZYQ A;  3IGV A;  4ED1 A;  3O8W A;  3MCN A;  3NMA A;  3H4D A;  3WQP A;  3RB3 A;  4RZR A;  2GVD A;  2BM1 A;  2FUG 9;  4L75 A;  1VQP S;  1G3O A;  1JK9 B;  3DOL B;  2X1G A;  5J2M A;  2E5L J;  2ZUG A;  3CJK A;  4GVB A;  2BQR A;  4P7T A;  3C2P A;  3C8Y A;  4KQZ A;  5BYR A;  4MK8 A;  1SI9 A;  5F8L A;  5D8H B;  3W2W A;  2BOA A;  4K7Q A;  3MM6 B;  1UPM B;  4MMO A;  5KT6 A;  1NJY A;  2G9O A;  4R0E A;  4M5H A;  3RAX A;  2DPI A;  4DUY J;  3H40 A;  2LP4 A;  2F3J A;  3WC0 A;  4W90 B;  2LFV A;  5E41 A;  2RF2 A;  4O4G A;  1DHM A;  1DJ0 A;  3C3L A;  1REG X;  5L1L A;  4DL3 A;  2RQK A;  2C3P A;  4MH8 A;  4DPX A;  4UT4 A;  2P9E A;  4F0M A;  2KYX A;  2YNI B;  2HQG A;  3GII A;  3ZTP A;  5LMN J;  5KFA A;  4M5D B;  2HVI A;  4WP3 A;  3BGL A;  3GE9 A;  2JX2 A;  3GG0 A;  5L9X A;  4I6A A;  1UZH A;  1J2V A;  3KXD A;  2OUG A;  3U27 A;  8RUC A;  1I6J A;  1ZM2 A;  1MNE A;  4ZDN A;  2GIQ A;  1H7X A;  3K5O A;  2YWE A;  3EVM A;  1IWG A;  2IIH A;  2RH3 A;  2YQ0 A;  1RHU B;  2R2S A;  2MY7 A;  4DV6 J;  2AT1 B;  3NL0 A;  5M2P A;  3W62 A;  4IO9 Q;  1PIL A;  4HTI A;  2QO3 A;  2FLO A;  2X51 A;  3NS6 A;  1K73 T;  4ZLJ A;  2BAB A;  4FYV B;  4KHM A;  1CJT A;  1KRP A;  5L1K A;  3AA8 A;  4ZVF A;  2ZH7 A;  2BOP A;  2CQ3 A;  1X60 A;  1FI4 A;  4DLE A;  5DLF A;  5F8I A;  1R8P A;  1U45 A;  1M5O C;  2M5Y A;  1HL6 A;  2CQH A;  4IG3 B;  4DV4 F;  3LAL A;  4NX9 A;  4OX7 A;  2DXD A;  1TZ0 A;  4A8X A;  1QUV A;  1RSC A;  4WII A;  3QMQ A;  5AXN A;  3HVT B;  3OR1 A;  3M8R A;  3ETM A;  1YIJ S;  2XYH B;  3I0R B;  2NSB A;  5KFC A;  5GME A;  5IT9 Y;  1JLC B;  2DT9 A;  1CC7 A;  2UVV A;  1MMD A;  2VG6 A;  1T9V A;  2VQF F;  2V2K A;  1B7Y B;  1HBU A;  2LU1 A;  3JSY A;  1FKP B;  3BO2 A;  5KT3 A;  1TL5 A;  5B0A A;  4WF9 Q;  3MED A;  3UCU P;  4WU3 A;  2G13 A;  1VC5 A;  4JI1 J;  4RBT A;  2AHO B;  4FXD A;  1NK0 A;  1RBA A;  1URN A;  3KLH B;  2DNQ A;  3CJ5 A;  2OSQ A;  3BGR B;  4LF9 F;  5A8K A;  4F2S A;  4K5R A;  1YDL A;  2XS5 A;  1YKW A;  1PJ6 A;  1TUW A;  3BR8 A;  1ZPW X;  4D3G A;  4MIW A;  1SC3 B;  5ETM A;  3US5 A;  4LRD A;  4Y00 A;  3AQO A;  3PRB A;  1R31 A;  1DY3 A;  3GZ7 A;  3JTO A;  3DLH A;  4G3I A;  5A8W B;  4CO3 A;  1YJ7 A;  4WFN Q;  5JMN A;  1WHX A;  4KHP J;  5IT9 U;  5IQ6 A;  1R0C B;  3BH6 B;  4ZJL A;  2HBR B;  4OZ2 A;  4PXE A;  2WSF C;  2UU9 J;  4IG0 B;  3DRR A;  2V68 A;  3H5U A;  1NO8 A;  4AE5 A;  2YKN A;  3CXC R;  1AUS L;  1V5I B;  4FYX B;  3CDW A;  1HPZ B;  4ZPA A;  2MZT A;  2V6A A;  1VQ5 S;  1JQG A;  2W9B B;  1KD1 T;  2HQI A;  3EPG A;  2DNZ A;  5FLX Y;  5CQG A;  1EB0 A;  3IGN A;  2MHE A;  3BO4 A;  2D3U A;  1Y3K A;  4DSI A;  1X9W A;  2HKE A;  4ZVO B;  2ZZM A;  3JSR A;  1OS5 A;  4DQR A;  3CDB A;  3D1O A;  4JI8 J;  1NK6 A;  4ZA1 A;  2LYV A;  2E44 A;  3AQP A;  3MCM A;  1V3S A;  3SFG A;  2G1D A;  2LKZ A;  3P3D A;  3CT9 A;  3QJL A;  4ANC A;  2FLP A;  1Q8I A;  3TZZ A;  3OJS A;  1SH3 A;  1SKU B;  2Q79 A;  1F9E B;  2WBM A;  4TQS A;  2RKI B;  4CM2 A;  1OYE A;  3TJA A;  1HR0 F;  3MEG B;  4QW9 A;  2IY5 B;  1UW9 A;  2QEX S;  2WB1 D;  1D09 B;  3W65 A;  2GHV C;  4EYI B;  2J6U A;  3NCP A;  2ZBR A;  2KI2 A;  4OLP A;  2UXC F;  3QLH B;  4F4K A;  3WC2 A;  3IN5 A;  4LRF A;  4MYU A;  2HNY B;  2GFF A;  3AOB A;  1MRO B;  5AXL A;  2YY3 A;  2RT3 A;  2JL9 A;  4ZIT A;  3CD5 A;  2C28 A;  1ACM B;  3PYE A;  3ZC4 A;  2CNO B;  4CT9 A;  4Y28 C;  4NWB A;  2C3O A;  4I67 A;  4A8O A;  2LEB A;  2CPJ A;  2GAH C;  1U48 A;  1C1B B;  3M6V A;  4LF2 A;  5KG0 A;  1CJV A;  1WC6 A;  5J1E A;  2I0X A;  3QNW B;  3DYA B;  2DXE A;  3FFI B;  2D1C A;  1N0V C;  2B7B B;  4OI4 A;  2O3D A;  4RJV A;  3NKY A;  2MKY A;  4U8V A;  3M9M B;  4ED5 A;  1FD8 A;  3OVS A;  4B3T F;  3CGI A;  3K17 A;  3PNI A;  3TVY A;  1B0V A;  2V8V A;  3MEC B;  1H72 C;  2IMW P;  2AX0 A;  4JI0 F;  2N7Y A;  4X64 F;  3BBF A;  2XNQ A;  1OQ3 A;  1Q81 T;  4WFZ A;  2MLX A;  2J9D E;  4IO1 A;  2QLF B;  2MZR A;  4NLV A;  2OH2 A;  4J7C A;  5C42 B;  2AJ2 A;  2BR0 A;  4TN2 A;  4WZQ A;  2DKO B;  1RU1 A;  2PI4 A;  4NLG A;  1N54 B;  2LXF A;  2E1C A;  4NEY A;  4CLW A;  4M5J A;  2A10 A;  4WP8 A;  4LFA J;  3WX8 A;  1W7W A;  4L72 B;  3DLG B;  1OY8 A;  1E6Y B;  3BYR A;  3UI3 A;  1VFJ A;  2FZC B;  1UVI A;  3M30 B;  4DX6 A;  5HAT A;  3KMQ A;  4ZPC A;  1N34 J;  4PUO B;  1CLF A;  3D9B A;  2DHX A;  1X4H A;  2WSC C;  2ZDP A;  3EZ5 A;  2DR9 A;  1PC5 A;  4B3O A;  4TNO A;  1IJE B;  1RTI A;  1C1C B;  1RTH B;  1YRT A;  1T9Y A;  3JTN A;  2PFD A;  4NYZ A;  2X1F A;  1CPZ A;  3BQ2 A;  5EWE A;  3J80 Y;  1EX8 A;  5CYJ A;  2HVD A;  2FHM A;  2IHR 1;  1PBA A;  1RXO B;  3DRX A;  3MPD A;  2GQ2 A;  2W01 A;  5J2Q A;  3KTQ A;  2HFS A;  4JV1 A;  3L9Z A;  3GR1 A;  4CCH A;  1N56 A;  4TLR A;  1VBY A;  2R7Q A;  3E8O A;  2C2K B;  2K3K A;  1N32 J;  3KJV A;  2RDD A;  5ITH A;  2HGL A;  4ZLP A;  2BMB A;  2FB0 A;  3CJR A;  2DRA A;  4OHX A;  4UOF A;  1WTB A;  1OIA A;  1PBU A;  3M2R A;  4P7V A;  3LW5 C;  5KG2 A;  4B9T A;  1OO0 B;  2EFV A;  2NS1 B;  3T5L A;  2ZM6 F;  1WF0 A;  2V8H A;  3P45 B;  2HNZ B;  1Q0N A;  5JUM A;  2H3E B;  3RBX A;  4LF7 J;  2VIC A;  1TL1 B;  2UV8 G;  2GML A;  2F63 A;  4G1P A;  2NPI A;  3UNY A;  3PRD A;  3CMQ A;  1HIY A;  3LH2 S;  3H7H B;  4ECV A;  4FF3 A;  2J0S D;  2IBO A;  3DM2 A;  4Y65 A;  4JI2 F;  4OX9 J;  2DCL A;  1FJG F;  3TZW A;  4ED0 A;  3RAM A;  1IKX B;  1CJK A;  2YNH B;  4DR5 F;  1CVJ A;  3D4J A;  4FYD A;  3KG0 A;  5FJ4 A;  4K4S A;  1G6B A;  3AT1 B;  4ZK7 M;  2PE8 A;  3W2V A;  4NXN J;  4ILR A;  1WHW A;  2OP5 A;  4P75 A;  4KSE B;  3EXC X;  3P4U B;  5J1N A;  4E2F B;  3RBD A;  3DGP A;  3JTP A;  5HJY A;  2ZH3 A;  1KEK A;  4DPW A;  4XIU A;  4DV5 J;  2WB4 A;  4N8O A;  2EFO A;  2VH7 A;  4YB1 P;  4R8U B;  1Q82 T;  4GKK J;  3UQS A;  3OT9 A;  4KPC A;  1EQM A;  4KR0 B;  5GAG I;  2C2M B;  5T7L B;  1S9E B;  2DR6 A;  1HYS B;  3JSM A;  4NI2 A;  4KGX B;  3LGH A;  4C8M A;  1Q79 A;  1VI7 A;  2R7W A;  3AJ2 A;  3TO8 A;  4BLG A;  3SSQ A;  4GO5 X; 
#chains in the Genus database with same CATH homology
 3QRR A;  2Y8Y A;  5H9F K;  3QRP A;  4QYZ K;  2Y8W A;  4U7U D;  2Y9H A;  5CD4 A;  1WJ9 A;  3QRQ A;  4DZD A;  5H9E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...