5H9EK

Crystal structure of e. coli cascade bound to a pam-containing dsdna target (32-nt spacer) at 3.20 angstrom resolution.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
199
structure length
139
Chain Sequence
MYLSVIIAWSRDLYQLHQGLWHDFLFHVECHVLLQSAQMSTAVATVIQVEFQLQVGVPLYFRLRANPIIKEAEQIAWLQRKLGNAARVEDVHPISERPQYKIQTVCFEGVLTINAPALIDLVQQGIGPMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
publication title Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Immune system/rna
total genus 21
structure length 139
sequence length 199
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5h9eK02
3QRPA 3QRRA 2Y8WA 4QYZK 2Y9HA 2Y8YA 3QRQA 4U7UD 5H9FK 1WJ9A 5CD4A 4DZDA 5H9EK
chains in the Genus database with same CATH superfamily
3CDUA 1TL5A 3G6YA 5K8MA 5KG7A 1YJ9S 2CNOB 4X4PA 1H72C 2DGTA 2KG1A 1S76D 5LL6d 1OY9A 4WFAQ 5LMNF 4DQRA 2MJNA 2W2NP 4ZKAA 3I32A 3UO0A 2ZFHA 5KG6A 3HSJA 4JUZA 1NK7A 3WDOA 4FBTA 1VQPS 3TVYA 5KFYA 4ED2A 2AW0A 5J2NA 2XZTB 4DPUA 1FI4A 2FY1A 2DGXA 1NB7A 3C16A 4ZK7M 2RSQA 4O4GA 2MQPA 4OI3A 4X84A 3P5BP 1LW2B 5HP1A 1HWUA 3MM8A 3VAFA 3Q8VA 5AXLA 1C1CA 5CABA 2RUSA 2ROPA 4PYDA 1RTHA 4O3NA 1NPRA 4RW4B 2C2NA 1EARA 1HYSA 2HK3A 4J9VA 2CFXA 1X4DA 4ED7A 3I4PA 1N5VA 2U1AA 2R7TA 1AXQA 1BQMA 2MYFA 2B6AA 1VHIA 2YNHB 5J2MB 2XC9A 4QR2A 1NDKA 2B56A 2M0GB 3DFEA 4F0MA 5ETQA 2ZEJA 5IQQA 5LMNJ 2B7CB 1KLMB 5B0FA 3RTVA 2OPQA 2H5JB 4S0MA 1T05A 1X7VA 2ASLA 4F4XA 3V6DA 3DLKB 2AYBA 2E1MC 3I6PA 5CXTA 4JI5F 1R8CA 3FJ2A 2BUNA 3U1MA 3THVA 1PKUA 4ETXA 3OXGA 3M2VA 4ZVHA 3QWPA 2GMHA 3GLJA 4I69A 3TANA 2AYGA 1KHVA 1WF1A 1VQNS 1UEVA 1RBOB 2YWEA 3IN5A 1C0UB 1SUQA 2XMUA 1RAFB 1UVIA 4NLQA 2VD3A 1YIJS 4AL7A 3C6UA 1TAQA 1NNDA 3QYYA 1RE1B 4MTPA 3J7ZT 4I0WA 3IXQA 1IQTA 3JTNA 1BQXA 2MLYA 3R5CA 1SB6A 2CZ9A 1YQHA 4G1QA 5IS2A 4AQYF 2IA0A 2RKIB 2J76E 4AXIA 1S79A 4ER8A 3AXMA 3W63A 4AD6A 3CXCR 4F4WA 4YHHF 1HBMB 3R27A 2JJ4D 2WB1D 1T9VA 1S0OA 4JI5J 1QLNA 2DHGA 2I6WA 3M6VA 1P6TA 8AT1B 3FUYA 4K5SA 2VB6A 4DSEA 2Z57B 2UU9F 3D3CJ 4L73A 2J0QD 5AE3A 3H59A 3R8YA 1CS4B 4L3NA 3Q23A 4KJIA 1UAWA 3KHHA 3IP0A 1HA1A 2F5GA 1TKXB 5DLGA 5J2PB 3Q2TC 4F26A 3ENAA 3PIOQ 4USTA 1LWCA 1CC8A 4OHWA 1NK9A 2CJYB 3KLIA 2VU5A 5DZ7A 1J5OA 1Z2ZA 1NHVA 3HDSA 4ZVGA 4NLPA 3NXZA 4ICLA 4A46A 1PBAA 1G3OA 2L9NA 3UN5A 4ILRA 3VAIA 3SI8A 1FJEB 5L46A 2JEFA 3PW2A 2MHEA 1OWXA 2JDJA 2WOMB 3ZXWA 4DCOB 3JSMA 4UUXA 2ZBQA 3W5XA 4L3KA 2J8SA 2QLXA 4DL5A 2E7WA 2M8DB 1KVKA 4AQYJ 2NXNA 1UEUA 1FX2A 2IM3A 5LSLA 2QX0A 4QYZK 2ILZA 1T95A 1U8SA 4YHHJ 1R7IA 2DHAA 5F8IA 3F41A 3JS9A 1YJWS 3NWRA 2CUYA 4ZCMA 3A3OB 3OR2A 4YP3A 2UU9J 4JOUA 4K4WA 1U45A 3VVUA 4P10A 1FD8A 1S1UB 4C8LA 1NUEA 4A48A 2W2PP 4O4GB 5A8RA 2O5DA 2MZ1A 2BANA 1IM4A 3L7PA 4KFBA 5HP1B 2K3KA 2ZZTA 2QC3A 3K59A 1RTHB 1TV6B 4DG1A 1RTDB 4KE5A 3I4HX 1AB8A 4HL9A 1F1BB 2Y0SD 2DNGA 2FIUA 4C9DA 2CWXA 4X64F 3GFZA 1JLAB 1SH3A 1BQMB 1QVGR 1N33F 3W62A 1O5JA 1RSCA 4LR7A 5DQHA 1DY3A 2GHPA 1N52B 1RT3A 2DD8S 3LP1A 3NL0A 4L75A 1TVRA 1RXOB 5HQMA 4WFNQ 4YR0A 4JI3F 2QV6A 1AA1B 2J6SA 2DNMA 3V6DB 1SKSA 1K9MT 3ET6A 3NMAA 3UQSA 4ED1A 3PYFA 3FMWA 4KHMA 4LJMA 1X8DA 1WF0A 4FYVB 4Q5VA 2NCKL 1TL7B 4Y3CA 3ISNC 4DPWA 4F8RA 3M8QB 5A8KA 2OEMA 1W25A 4FKXA 4CLLA 4QIEA 1VFJA 1C4AA 4QWCA 1N54B 1XERA 5HQLA 1N32F 4ETZA 1OQ6A 1P27B 4CCHA 3NOGA 2HFUA 4X64J 1SUQB 5GADI 3ZZPA 2PN6A 1JXEA 4EWTA 2IC3B 1N33J 2RH3A 3R1HA 1XR6A 2MKSA 2YBVA 2ZH7A 2C28A 2RILA 5L39A 3MM6A 3CCSS 1S0VA 4DXLA 1H2VZ 1QAJA 3QFWA 2XB2D 3VAGA 1UWBA 1TL1B 2MEWA 3MMCA 3SBMA 4JI3J 2FHKA 3M30A 2XZWA 1TQLA 4RX6A 3EVOA 2YKPA 1G7CB 2RRNA 3HSDA 3VF0B 3CJ0A 3MHYA 1HD0A 2MLZA 4QOTA 1RT2A 2ADCA 2ZD1A 3BM7A 3LWLA 2BKNA 4WZQA 1WC4A 3CCJS 2A6OA 3M9MB 3JTOA 4C3MA 2C3PA 1FDDA 2QA2A 3KDOA 1NJYA 4K4UA 2R7XA 1N32J 3TUPA 1DLOA 1SXLA 1LWCB 2L41A 3D1HA 1PG5B 2EC2A 1TMMA 1J5OB 1B70B 2LU2A 4FPRA 4LRAA 2PD1A 3A4TA 4NZ7A 1FRIA 2E9RX 4F3MA 4OMFG 1SQGA 1N8RT 2XMKA 5HATA 2RDIA 5HANA 4ZIVA 4LVOP 3VR1A 1ACMB 1NZAA 1WD6A 4ID5A 4C0BA 4ED6A 3AH6A 3JSMB 3IRWP 1PC4A 1OYDA 2XYPB 2XO7A 1TR0A 5AXMA 4N77A 1BGXT 4QPTA 3MPWA 2HPUA 3EUNA 1X5TA 4DPYA 5F3ZA 4YR2A 2UXDF 4DSLA 5FJ4A 4WBFA 2A1BA 3GQCA 2AX1A 2ZH8A 5L1JA 2DITA 3OR2B 4LUBA 5B7WA 3KHLA 2RDJA 1IVZA 2FC8A 2J9EA 4Q44A 4OJGA 2K06A 5IC4B 5IZHA 4QIFA 1ZBTA 4ZP7A 3CC7S 3M32A 2OEJA 1JLCB 4U7UK 1SJ3P 2X3GA 1G4CA 3PM9A 3H8YA 2BJ8A 2AJFE 2GIQA 1NJXA 2VUGA 4C97A 1ZM3A 4HHHA 1HNVB 1KP6A 2V0NA 2CZ4A 3LOUA 2YKOA 5K8NA 1YJVA 3K57A 1REVA 1UCNA 2V4JA 3MAHA 2ZH6A 2V69A 3TNVA 3N0VA 2HSEB 1FVQA 1C1BA 1GQEA 1U1MA 3LP1B 2V63A 3NLCA 2UUWA 2UXDJ 3FEXB 1LFPA 3C6TA 1WDTA 3IG1A 1RQ0A 4RBTA 1NK0A 2C2RA 2HZCA 1X5PA 2VBXA 3ET6B 4M8LA 2H4WB 1Q8KA 2V2ZA 1FESA 4A8XA 1MMLA 1Q82T 3PYGA 4OLPA 1FK9A 4RNNA 1Q0NA 2KB2A 2M2BA 2WTFA 1S12A 5KFGA 1FDNA 4C3LA 1NAQA 2FDNA 3UD4P 2F9DA 1L3TA 2ZKUA 5I3UA 5HLFA 4DR1F 2A2CA 3OT9A 2GMJA 5D0EA 1RT5B 2DGUA 4J9UE 1YBTA 1MN7A 5LXYA 3O2IA 1FFGB 3ITHA 4NYOA 1PYOB 1U0HB 2R2UA 1FTCA 2HURA 5KFEA 3G6ES 4O3SA 3CMQA 1F2GA 3QLHB 3PIPQ 3HM9A 4ZVFA 5THWA 2HWHA 1S6PA 2RRBA 3HSZA 1H98A 4Q8FA 5H9EJ 5EWGA 4XO0A 2MY8A 1R8HA 4M5JA 2YTCA 2IYGA 4OYZA 4P7TA 4EK2A 1SVDA 1RB0A 4OZ3A 2K1RA 2HW3A 3IR7B 2VPXB 1T3NA 1UJ4A 2QLWA 1RT2B 4W90B 3DLEB 2IAJB 2NUHA 3PW7A 1FKAF 2ZC3A 3OQ2A 4LSLB 2W9AA 1ZH5A 1HW8A 3N6NA 4F25A 3AA8A 3D54A 4MIAA 4DR1J 2BR0A 4PG7A 1DLOB 4K50A 4LMZA 4BWJA 2B3TB 2F8EX 1NU4A 4YQWA 1RAJA 2NPFA 3ZO7A 2IHR1 1IWAA 1NK8A 1LV5A 4DSIA 3DU6A 1XJWB 1NCLA 2I38A 3BKUA 3A8JA 4O44A 3MMBB 4X4OA 4LF5F 1Y5IB 2B4UA 4B9SA 5MAOA 4OI1A 3H0PA 4ZMMA 2HIQA 3DYAA 2DGOA 2HRTA 4M1KA 3GYNA 3DGVA 4IH7A 4DMZA 2WBRA 3F73A 4YB1P 4WU3A 4MFBA 3GG1A 2ZJQQ 3VQSA 3J81U 1U48A 3TARA 1QUPA 1U24A 2NSBA 1CVJA 2WVCA 2WVFA 2V8DA 3EPIA 4ZLJA 3GIIA 4QWEA 1X4GA 1CJKA 5F9LA 2KM8B 1UZHA 2EK6A 3NNHA 1T03B 3K5MA 3M32B 1JLGA 4U9RA 5KFFA 2ZC4A 3CJ4A 2BQRA 1TKTA 3T5LA 3H90A 4LF5J 2KVQE 2LDIA 3TZWA 2VBZA 2CQ4A 1SPBP 2VV5A 3QFHA 2BVZA 3ZZOA 1T9WA 1LNQA 3KLFA 1AYEA 4JI7J 2PIIA 4C8OA 2DHSA 1C1BB 4PCQA 4ITSA 1QAYA 5K20B 3BB5A 1DFDA 4ZP9A 1HI0P 1QVFR 1LXJA 2GIFA 2EXUA 3MI7X 3IG1B 2CZVC 3M05A 4LREA 3PV8A 3PZPA 1MN9A 3LP2A 4OV1A 1IBLF 3P96A 3EGWB 2HAFA 2EEYA 2QN6B 2PE8A 3V81A 1UFWA 3GIRA 4DR2F 4WU2A 3RAQA 3TUJC 1YWXA 1D9DA 3PHTA 4Y2IA 2BACA 3BPSP 4ECXA 2I8EA 2IM1A 4R25A 2DNPA 3TX0A 1N5YA 1RTIA 4BC9A 4O3RA 2JSXA 2AJQA 3B8HA 3RB4A 5I3UB 4LBPA 3VWSA 2ZITA 3D9BA 3HKZD 4A8SA 4ED8A 3MCNA 3A3NB 1XIQA 3H4DA 2XMVA 3PRVA 3CIZA 2LQJA 1RHRB 4NRUA 3DOMA 2M52A 2GZOA 1S6PB 5FDLA 4B08A 4IOBA 2DCUB 3HK2A 4ZVSB 1FWLA 3B54A 2BOPA 3H5YA 2YQ0A 3Q2SC 4JV5F 3KK1A 2HRYA 3QIDA 3M8YA 4DR6F 4OHVA 4ZLLA 3EZ5A 2XI3A 1S97A 1IBLJ 3MECB 2VQFJ 1Q7YT 2Q6CA 1RISA 4X65F 3THTA 2HQIA 3OVAA 1WI8A 9ATCB 4DR2J 3KJQB 2WONA 4ECVA 2MXYA 5E41A 1GNKA 2VASA 3FZ2A 1T9XA 5HO4A 2YPZA 4V19J 1Y00A 2NS1B 2CJAA 4KGMA 4NEYA 4PRFA 5K8OA 3RJMB 5KFTA 3RU0A 3G8QA 3N6MA 3PJWA 4NLUA 5DS7A 3BYRA 1UJ5A 2ZZMA 2GCFA 3Q89A 4PWDA 1N6QA 1HNZF 4W98A 2HFVA 1XMOF 3OR1A 3BN4A 3B4DA 2DXFA 3LP0A 1VHFA 2E1PA 5KG0A 3R97A 2C42A 2JX2A 3LAKA 3NGDA 1NH7A 4L74A 1Q1KA 1T02A 3DYAB 3GR1A 4JV5J 1S1XA 2LA4A 4DR6J 1RWVB 1JLBA 2IDEA 4N41A 2FJDB 2C3YA 2H5EA 1SJRA 4OLOA 4DR3F 3GV7B 2MZRA 4X65J 4PXEA 3JYTA 4RW6B 4RWXA 2E7VA 4MFBB 4WK3A 2BE2B 4I4BA 1JXVA 2UXBF 4JI8F 1TZ0A 4NXMF 1GTHA 2KXNB 2BE9B 1NSAA 2CA9A 2DT9A 3H40A 2ZH9A 3H5SA 2C2KB 1TAUA 3JXOA 4I1TA 4NLXA 1RACB 3PRDA 5E2QA 1HWKA 4Y0FA 2XYGB 5D4NA 3OLBA 3HHDA 5LM7E 1BLUA 1D8ZA 3MD1A 4IG0A 1T11A 4KIAA 3G9CA 2HHWA 3I5BA 2N7CA 2C3MA 3A3PB 3KUGA 4KT0C 1VMBA 4GMKA 3HVTA 1FNXH 3GSIA 4N76A 1X4CA 4CLTA 4DV7F 4R0EA 1HNZJ 1XMOJ 1ZZNA 1TKTB 3IS9B 2XHCA 5KFAA 2P5VA 1R31A 2IJFA 5JXSA 5DDRC 4NZ0A 5KFSA 1K8AT 4WP9A 2HBZB 4CO2A 2V2QA 4RBVA 4OZNA 3AFGA 3HVRA 4A8FA 1UFKA 1XK8A 3QWUA 1U1QA 1WEYA 2VG5B 2GFFA 4J9QA 4DR3J 1XBWA 1RLCL 4KAIA 4J9MA 3CJ3A 1IBCB 3K8VA 1TKDA 2BKPA 3BZQA 3US5A 2JLGA 4DR5F 5EWFA 2LEAA 2FC9A 4JI8J 2UXBJ 1SCJB 2DNQA 3LP2B 1CJTA 3T1AA 4TU9A 2ZBIA 4EYHB 4I67A 2QA1A 2MQQA 4EBEA 2W25A 4OZLA 1H7XA 3C66A 2MSSA 3G71S 4K59A 5U47A 3KJFB 2DNRA 4J9PA 1DQ9A 5KT7A 2ASDA 4MYUA 2FZGB 1N5YB 2KN4A 4CYUB 1X0PA 3D1QA 4ZCKA 3RUBL 5GADU 3VHQA 2GJ2A 3GFXA 4MKYA 3M1VB 3D5MA 2O66A 2I5JA 4XPCA 1Q81T 3UCZP 4DV7J 2RF2A 2VG6A 3LPYA 2MKJA 3KG0A 5C25A 2XMTA 1HD1A 4QYRA 1PSDA 2W2QP 2APOA 5KT3A 4RU2A 4GO5X 3D6FB 3FKBA 4BBYA 2GGPA 4GRSA 2XY6A 1G2EA 1RWPB 2DTJA 2AT1B 4KR0B 1GX5A 3BQ2A 4DL6A 3FBEA 4YN3B 2CQIA 4DLGA 2XHWA 2I2YA 2EWHA 3R5AA 3N6LA 2K8GA 2NXEA 3HFZB 2CADA 5IT4A 2YKQA 4DR5J 1FKOA 2V6AA 2YNIA 1K47A 2YKMA 2CQPA 1YK9A 1PYSB 3DMJB 1TUGB 1FXDA 3A13A 2V8GA 1DZ5A 2D7SA 2BQUA 5C24B 4KB7A 2JNJA 2WBMA 1S1VA 4WIIA 1RLDA 3MAAB 2VKZG 1D0EA 1JK9B 2G2YA 2HWTA 4DX6A 1ICEB 3GR0A 3F56A 1FE4A 3TVKA 3KK3A 2CNKB 1FEEA 3GE9A 3FRZA 1F3FA 3PJ9A 4C8ZA 1J2VA 3DRRA 3GU0A 2Z0GA 4NWBA 2IFXA 2NR0A 3W2VA 2OSRA 4ALZA 3D4JA 4V19X 3CJ2A 3QAUA 3CJQA 3VQTA 2JFDA 3OR1B 1K0VA 2KDOA 3GG0A 4DR4F 3GSDA 3HT0A 2P6SA 1Y3JA 5GAHI 1JLFA 1RK8A 5GMDA 5B0EA 1WTBA 1S1XB 3CJTA 4B9VA 5CCMA 2KHCA 1BE4A 5GAGI 5DG8A 4WZMA 1F9EB 1BQNB 3LGHA 4EI2A 3QT7A 5DG9A 1S48A 4OHYA 2J9DA 2R7WA 2J0XA 1RGVA 2EFOA 3VV2B 4QU7A 4DFPA 1FF2A 2HZVA 3TUIC 2W7AA 5SUHA 4WFZA 4IOAQ 1WHWA 4M94A 6FDRA 3SXLA 4RUAA 4JI4F 2HHQA 3D0GE 5EWEA 2WVEA 4IG0B 1WOOA 1M5SA 3BGFA 1R6YA 3DRPB 2W8KA 2HBQB 5KFZA 4C2MA 2RQCA 4LRBA 5A0YA 2DR5A 3R3TA 2MZJA 5D0HA 1EQMA 1EJ7L 2XG8A 3KK2A 5HJYA 4P2XA 2LQ9A 3IFEA 2B4OA 3I0SA 1YG0A 1V9OA 3ZZYA 4DR4J 1M1GA 2A3JA 4ECZA 4I2QA 2JC1A 5DLFA 3BF4A 2P6TA 1X0FA 5KG1A 4CLSA 2KJWA 3GCXP 4DS5A 2V94A 2C2OB 2DXEA 1E6YB 4CLUA 1WKKA 5GVQA 4U8VA 1L5UA 3T41A 3LALA 4LSNA 4M5KA 2HFNA 1Q95G 2X1FA 4U8YA 4B02A 1YX2A 4YEAA 3MUMP 1RCOB 3EWGA 1CC7A 3VGUA 1A7GE 4ILLA 1VBXA 3KG4A 2AV5A 4NCGA 1N4LA 4L72B 2VKRA 1UTAA 2N4DA 2G2OA 1I1GA 3HJVA 1LK7A 2ZDPA 2R8JA 4JI4J 4ZPDA 2DGSA 4ANEA 1UKUA 3QJLA 1VRTA 5BJRA 3AD7C 4XAKA 4C98A 1VIOA 4D3HA 3MMAB 2IYIA 5C7PA 4B9MA 4WYLA 4C8YA 4QU6A 2V4QA 1M90T 3KYLA 2VG6B 4PQUA 5C25B 2F1FA 1X9MA 3MXHP 5ETMA 1APSA 3FBCA 2VC0A 3IRXA 4QIGA 4AT1B 1LWXA 2C2ZB 5KT6A 3GILA 2QYGA 2RNEA 3P6YC 2PFFB 4ELVA 3LO3A 2Z30B 1AT1B 3AB4B 4PG5A 4E2FB 4UY85 1ZOTA 3VAHA 5ETVA 4TKTA 2C3UA 3IBWA 1JWWA 1Z4UA 1FKOB 1GXLA 2YNIB 1WKJA 2MKIA 3FZBA 2ZVSA 3OLAA 2R8IA 2ZH2A 1B7YB 4CM2A 4UQTA 5C42B 2ATLA 3PVXA 2QL7B 4OZ0A 3SCIE 2Q43A 1VQMS 2MGZB 3GJTB 2KG0A 4TU7A 1WSRA 2ROEA 1X4BA 3IGNA 1NHUA 3KK3B 3W65A 4IR9A 2H5IB 3E01A 1XEZA 1L3VA 3NOCA 3I96A 1WC6A 2W4DA 3SCKE 1FFWB 2OPRA 5IXUA 5J1EB 2V8HA 4GC6A 3CMAS 2C3OA 2PDAA 5D4OA 4DPTA 5KFWA 2FPHX 2PO4A 2X7IA 2KZMA 3PEHA 5HVGA 3GJRB 3EGVA 3GV5B 2WVDA 1O6XA 3OXFA 2PMZD 1X5OA 1S0NA 3Q8UA 1H3DA 4FXDA 2QG9B 3SQOP 1C0TB 4DL7A 3MCMA 4PQAA 2QGFB 3POTA 2HZAA 4QWBA 1MROB 1FD2A 5IT0A 1LEOA 3WC2A 4CO3A 2ZWOA 3J7A1 2ERRA 2HWIA 4MYTA 4ZVRB 1R3NA 2F4VF 2W01A 1PBUA 5A8WB 3VAMA 3W9JA 1JLQB 3BPDA 1S1TB 2R3VA 3NRBA 4ZLPA 4FF2A 1JKHB 2J7WA 1FXLA 4X4NA 2QL9B 4ECQA 1CPZA 3CEDA 4WFBQ 1DAXA 1M5KC 3BSOA 3KLGA 2FLNA 4YFUA 3BH6B 1SIWB 3KXDA 3MUTP 1U8WA 2CAJA 3PDNA 4EZ6A 2OD6A 3J81Y 5A0YB 3SV4A 4R8UB 2GVDA 2FB0A 3HD2A 2CVEA 2O3DA 4WXOA 3I0SB 4FDFA 4PUOB 4U6PA 3IGVA 3O1LA 1IN0A 1TK5A 2FVSA 4M5HA 4B3TF 4H4KA 3ZTOA 2IDLA 4KTQA 4C8NA 1V5IB 4WFXA 3S1TA 2COLA 2B5JB 1OSDA 1P9QC 1GMWA 4D3GA 4QQBA 5EUHA 2F4VJ 4LSNB 3QZ7A 4KGZB 3BKTA 2MQMA 1CJUA 4P52A 3HZEA 4F04B 1MG7A 5LSRA 3RW7A 3HKWA 1S49A 4R5PA 1KQGB 3L09A 2IRUA 1EP4A 3ILLA 1UETA 4NCGB 4P72A 4GVLA 4YB5A 2ZUGA 5I4MA 2H9ZA 4ID8A 3DI6A 4P73A 2F63A 4JI0F 5IFMA 4ES2A 4I2PB 1FJ7A 2AD9A 2GHWA 4N7TA 3DOKA 4DX5A 3MPDA 5RUBA 2RVJA 4HVZA 4DV6F 4F4ZA 4X4SA 3TW0A 2WAQD 3O3LA 1YZ6A 4FXVA 3M2RA 2LU1A 3FGVA 2XMJA 1S9EA 1M5PC 1WC0A 5AE1A 3IRXB 2J9DE 2RHSB 1VBZA 2DGVA 1VJQA 2LQ8A 1FE0A 1Y3KA 4JBCA 4B3TJ 2YH1A 5KG5A 5D3GA 1I6JA 2BMBA 2OPSB 1NDCA 1UA1A 2CJKA 4Q7AA 3G6VA 4FS1A 4PXDA 3HHLC 1HQ2A 3NGSA 1IKVA 2OJ3A 5H9EK 2MSTA 2OFHX 2FZKB 2JL9A 3H2VE 5KFRA 1CSJA 3GCWP 2ZKTA 3DM2A 3UNGC 5ETSA 1RT1A 2R2RA 1SBRA 1D9FA 2OGUA 1R89A 4JI0J 4ZCIA 1EQ0A 1ZAXA 4LF8F 2U2FA 2D74B 3AJ2A 4IDKA 3RGIA 4OYAA 1TKZA 3G82A 3DOLA 3RB0A 2BA9A 3W2WA 4DV6J 1EKRA 2FJVA 4I7FA 5JVGQ 1R0AB 3ISND 2BX6A 3CDEA 4OI6A 4LIWA 3QGPA 4WJBA 2OPRB 1TL4A 2G0JA 1MW7A 4ED5A 5LXRA 4NLGA 2FD2A 1YVFA 4HACA 3J7Z5 2HLTA 1RKJA 2HNYA 1VQ9S 1Y5NB 1Y0HA 2DYAA 3MEDA 1Q8LA 3V4MA 5D4LA 3K0JA 3SIPB 2MHNA 5KFKA 2YWHA 1S7IA 2DCLA 1FDBA 1DTTA 4Y2CA 3M6XA 2W7PA 5CAAA 4LFCF 2FHMA 3LAMA 1HR0F 4RNHA 4LF8J 3OD2A 2XSFA 2CDRB 1DBDA 1T9YA 1B0PA 5HBMB 5BR8F 1N5QA 2X1GA 5KTQA 3KLGB 1DARA 1CLFA 1TTHB 2QA4S 2RRAA 2C2MB 2X1AA 2OEKA 5F8LA 5EX0A 4YUDA 3R6LB 2KT2A 2RB7A 1Q86T 1NM2A 1PC5A 1KNZA 4OI4A 2Q66A 3BBCA 3KFWX 5E3AA 1WC5A 4ECUA 4PWWA 1K73T 4K2JA 1E6VA 4L76A 3DGPB 2VA2A 2GO8A 2W4CA 3D66A 4OX8A 2VJVA 2R7SA 4K4XA 2EW9A 2POKA 5DQGA 2HIYA 3KUEA 3SSSA 2CDQA 3SDEA 4I6AA 3SYZA 2LCWA 1HQUA 4RW7B 3TQEA 1FTRA 4H4OA 1CQNA 2VODA 4QJVA 1IKWA 4F50A 2GA7A 4HLBA 5ETTA 1XMQF 1KFDA 2BJ3A 4DOZA 3ZZ0A 2M70A 2LEPA 1HR0J 3LA0A 1AZSB 1GH8A 1VCTA 1URNA 2YXLA 5K14B 5BR8J 5ETPA 1O0PA 2GS8A 2CPZA 1HI1A 3QRRA 2Q6BA 2BM0A 3JSYA 3MCSA 2KVIA 4UY8T 2VDIA 3DOKB 4DL2A 5H9FJ 2V9KA 2E7XA 1RYSA 3BO2A 4ZP6A 1WUUA 3TWZA 3PJXA 2I1RA 3K5PA 1IKXB 2RS8A 3M2RB 4A8QA 4W92B 1S9EB 1IBKJ 5T14A 1JNRB 2AKWB 3FCWA 5CZXA 2E5IA 2GJIA 2LQ5A 3HHEA 2ZOMA 3AJDA 4DV1F 1P1LA 2ALZA 5B08A 2CPYA 2HNZA 1TFWA 3C14A 1IKVB 1XMQJ 4QW9A 4LF4F 1U25A 2HQ3A 2AF6A 3KLEA 5HJXA 3P45B 1S99A 2R9LA 4KKOA 5G4DA 3Q8QB 1JMTA 3IBFB 1RT1B 4CLZA 2LDYA 4YS2A 4P7VA 4DFMA 3MR5A 1VGYA 4M5MA 1TKZB 3G82B 1RABB 1DURA 2IRYA 4CM0A 4DV0F 1FO1A 4K4TA 1HNIA 4IO9Q 3WC0A 4PG4A 3E3XA 3ZTRA 5FIIA 4Q0BB 5KFPA 4ZIWA 2NXJA 1MMDA 1T8EA 4USVA 3L3CA 3HLUA 3B6BA 3PR5B 4YB7A 5KFLA 3HPOA 1QE1B 3I9V9 1B99A 3NKYA 5HROA 3QPIA 2BRKA 3W9HA 3G96A 5M2RA 4DV1J 2XNRA 3H2UB 3J80U 4MT1A 4CLKA 4IFVA 3U1LA 3IBCB 3FBBA 1YKWA 3DRXA 4HT7A 2IRXA 4CZCA 2BZ2A 4LF4J 5D78A 1D1UA 1XQIA 3H98A 1RTJB 2YX4A 1DTTB 1R27B 3BGOP 4RNOA 3ZTPA 1Y5LB 3KNGA 4URGA 2ZHAA 4NOHA 3HHKA 1RT7A 2YNGB 3TA1A 2FJEB 1HQEA 1S9GA 5ETKA 2UUTA 4P2FA 4WIQA 2A2DA 2XO6A 1RWKB 2YH0A 4F4AA 1SV5B 1LW0A 4DV0J 4WWSA 1RCXB 3TZZA 1UPMB 2RIJA 1NSPA 2YKAA 4A8KA 4G1PA 4PYAA 1J27A 4TQSA 3JQJA 1S7HA 3MEGB 1Q53A 2OD4A 3TUZC 3ETOA 2FHOB 4MJKA 1LWEB 1VRUA 3HULA 2CKWA 1N88A 2AU0A 1JIHA 2XS5A 3CW2C 3D6MB 5E7OB 3O5TB 3KG1A 3FDSA 2VDHA 1RAGB 3KLHB 4I6YA 3Q22A 2PMHA 4HT5A 4OZJA 3G8SA 4QYZJ 2QE5A 4X62F 3WZ0A 1O51A 3KJVB 1WHYA 2OMLA 2HHTA 4TN2A 3IC1A 4ZPAA 3MEEA 2DVIA 4FKYA 1NB2A 1DTQA 1S59A 3BDEA 2IVFB 3JSBA 4KV8B 3UFCX 1RHMB 5LJ5Y 2JLEA 4DUTA 2HVEA 2QTWA 2J8AA 4OV6A 3ILIA 4B3RF 4AXJA 5CYQA 3U1NA 4J9LA 4URQU 1SC4B 5CYMB 2NZ4A 1U6ZA 1FERA 2QL5B 2MQ8A 2OPPB 4UW2A 5DM6Q 4ED4A 3EXYA 3PW4A 1MSWD 2NYIA 3OVBA 4NLSA 1Q5YA 4X62J 2HNZB 3SV3A 3FEYB 4M5NA 4J9OA 3R7NB 4ZDNA 2HAIA 4OYPA 3EVWA 2K2PA 2Z56B 2OLWA 3BGRB 2HS3A 3OPKA 2XGQA 4UF4A 3DU5A 3KLEB 2YWKA 4CO1A 4O0IA 4E0DA 4F0HA 2KT3A 2HNDA 5KFJA 1FCAA 2E29A 3I56S 5IWAF 1U2RA 1O8BA 4JP8A 1UWAA 3ZZUA 4PKDB 4JI1F 2EI5A 4DL4A 1GMVA 4KGXB 3W7BA 4OYMA 4B3RJ 2Y1LB 4PXCA 1HBOB 2OTJS 6AT1B 4DF4A 2WVBA 1YRXA 4RW8A 1J5EF 4ELUA 1YJRA 5CCLA 1PILA 4BWMA 4C11A 2JHEA 4Y2KA 2R8GA 5D0GA 1QM9A 1B0VA 3M8SA 2GIRA 3CCRS 2D1CA 1ZS6A 4FYYB 3QGIA 2V68A 1W2IA 4DR7F 4UUWA 3D0HE 3ZFVA 4PR6A 4IFYA 1LFWA 3CD0A 4DL0C 2PI5A 3KJNB 3QJPA 2HYIB 3MF5A 4O3QA 1A6LA 2XYHB 3V4IB 3T9NA 3OJUA 1Q79A 1BHNA 4A8WA 3M8PB 2CJQA 1DJ0A 1T3OA 3J7YU 4Y34A 2EBGA 3CIMA 4OYWA 5DM7Q 4EU0A 5IWAJ 1SKUB 2R7OA 1GMUA 3IWLA 3BREA 4JI1J 3M8ZA 2DKOB 1HBNB 2GJFA 3BH7B 1WHVA 2GVZA 4LBHA 4Q45A 1J5EJ 5B0DA 2JC0A 2FVPA 4RZRA 1LW0B 1IKYA 1Z1ZA 3ELHA 1RHKB 3W60A 2YVSA 2V4RA 4WTOB 1QUVA 3I0RA 4LSZB 2CPJA 3ZNUA 2VFVA 4J5OA 3W66A 2LYVA 1MWQA 2ZHOA 4DR7J 2X3DA 5J2NB 1AW0A 2H65B 2HFZA 3CCUS 5IM0A 3C16B 1YHQS 3DLLQ 1RWNB 3UE2A 1UZDA 4Z7CA 1FX4A 3MM8B 1HI8A 1B4SA 2HQFA 1C1CB 3EZOA 2D9OA 2RE1A 4USKA 4CDIA 2K3IA 1HYSB 2KYXA 4FYXB 3N79A 4HHUA 1FWKA 3DC2A 2GMLA 2A10A 2RU3A 3BR9A 2QFJA 3MEEB 2DY9A 2VH7A 2R42A 5F9NA 1VBKA 1X31C 2B6AB 4P9SA 4UT4A 1HIYA 3O6QA 2BQ3A 4TYBA 2IMOA 5KFCA 4CTAA 1KBRA 2FUG9 2DR6A 2VL1A 2E66A 3FFIA 4LF2A 3DN9A 2QSFA 4FF3A 4J9SA 5F8GA 1K0TA 4JI2F 2OPQB 5CYQB 2P8IA 2PMWA 3NNCA 4DX7A 2MZQA 1T05B 2LEBA 4KHRA 3BN7A 4LFAF 2FGOA 4ZVOB 4Z7YA 5T41A 1WJ9A 2XLKA 3K5NA 2MQOA 3LGNA 4EZ9A 2EBEA 2VIHA 1QD1A 2WHOA 1NXIA 2GO9A 2CPEA 3T3FA 2IVMA 1X4FA 5I42A 2RHQB 1BWEA 2RQKA 1NDLA 5E33A 2CJBA 3M2VB 2GQ2A 1ZTTA 4QCLA 3I55S 4C48A 2AP6A 4V1Ak 4CT9A 1EX8A 4USMA 1TL3A 4JV2A 3DRSA 4NX9A 2FLLA 3OUYA 4CLYA 1FVSA 4TY8A 2HGNA 3W5ZA 3C6UB 1UFLA 4JI6F 2AGPA 1RHJB 4FXWA 1YBAA 4BLGA 4NMLA 2IM2A 3PX0A 4OJ3A 2Z2LA 3U02A 4G1QB 4JI2J 3S7RA 3IWNC 3AOCA 4O0NA 4LFAJ 1S4FA 3CUNA 4B17A 2DB1A 2HGMA 4QR0A 5J2QA 1PGZA 2YNFA 4CLWA 4C11B 3C46A 1N56A 4RLEA 3UCUP 3DXBA 4C0OC 3NAIA 2F9JA 2EG2A 2XMMA 2ZBRA 1IJFB 4KGVB 3S8SA 2GAHC 2FVRA 3QGGA 3VAKA 1EHWA 2I9SA 2ACYA 1XNRF 2J6UA 2HRUA 1S6QA 1RP5A 1RWOB 2FVQA 1B3TA 3HHLA 1QSSA 4LVNP 3MFIA 2FJBB 3KLIB 3MM9A 5ETLA 2QZ8A 3CJ5A 4ICLB 4OFZA 4G3IA 1EZZB 3HI9A 3R7BB 3TZYA 3H20A 4KQZA 2CYYA 3G86A 1WC3A 4JI6J 1SKRA 1RADB 3HFKA 2DGQA 3K5LA 4KH1B 3HO1A 1WOPA 2J7UA 2KXFA 3MTJA 4Y00A 4JV1A 2VA3A 3E51A 2QLBB 4URSA 1NLKL 1RDRA 4O23A 4KC5A 4FS2A 2E9ZA 5AE2A 4PABA 2XM3A 2VICA 3RB3A 3I0RB 3D6TB 4OX6A 4CI0B 1U1LA 2GX8A 4Q43A 2BE7D 2RT3A 3RBZA 5L8RC 1XNRJ 3ULHA 3UDCA 3L7UA 3AQOA 5A8RB 2M8HA 3T6BA 4RW9A 2BANB 4B3OA 4KFBB 5D15A 2XTJP 3TAQA 2DH8A 2EK1A 4HI2A 3Q8SB 1WTFA 3BYPA 4F4YA 1S6OA 3THPA 2SXLA 4OZ5A 2X51A 4ZHRA 4DG1B 3P4UB 2VC1A 3KWMA 3R2DJ 1BD6A 1XR7A 4FPIA 2QEXS 2G1HA 4IYQA 2GQCA 3LGMA 3KHGA 5A6WA 2ZBCA 1NDPA 2A0FB 3BJYA 2EC0A 1HHSA 2W1BA 1RT3B 3WIVA 4IUFA 4ZVTB 1D3WA 1CEZA 3FFIB 3OTEA 2HHVA 1TVRB 2AJ4A 5DRKA 1LW2A 4RO0A 2D9PA 1SC6A 1Q16B 2KRBA 4CO5A 2A6MA 1G1XA 3PX4A 2ATCB 1Q5VA 3MPUB 4B9NA 4ZPCA 2F40A 4RW4A 1R0BG 1WWHA 3W61A 5HAOA 4Y2AA 5GAEU 1LXNA 3G2XA 5BXIA 2W2MP 1OIAA 4EUVA 4FYDA 2XMAA 2YNHA 5A8KB 2L08A 1FHTA 1YJUA 1TMJA 5L9NA 5ETOA 2DR8A 2ROGA 3BGUA 1FRHA 2E5LF 2RAQA 4YR3A 1VQ4S 3IAM9 1KLMA 2DNLA 3LH2S 3TAMA 3U27A 4TY8B 1XC9A 2DPIA 3CGIA 3DLKA 3TR5A 3TZXA 4HI1A 2DISA 3NMRA 1WI6A 3MM6B 4ZITA 4HH1A 1F2HA 3AHPA 1GX6A 4MK8A 4E8UA 1UWBB 2AJ2A 3MMCB 3UWTA 2PFDA 3M30B 1WG1A 4G65A 5L1LA 2ZM6F 1KQKA 1LOUA 1VQ8S 2YNFB 2QYCA 1F9FA 1WHXA 3GIKA 3CSKA 2DRAA 5JVHQ 1PAUB 2ZD1B 3A8KA 2R2SA 1XWLA 3DLHA 5C2CA 3UDVA 1GTEA 2JZ5A 3PACA 2VJUA 1RT6A 5D8HB 3UD3P 3DDKA 3ENVA 3VCDA 2BKOA 5KG4A 1ZYQA 4CLPA 1GK8A 1EIYB 1UMJA 3HHLB 4CH7A 2L9WA 2E5LJ 4FZVA 2K7KA 4EFAC 2MZTA 3AOBA 4DHVA 2D69A 4F3OA 1RBLA 4J9NA 2XY7A 2YKNA 2L9DA 3J80Y 4ID5B 1HBMA 1UVMA 2LXUA 2XY5A 4ZJLA 4C0HA 3G6XA 4RKUC 4H4KC 2MMYA 3FK4A 4JI7F 3DNCA 1H0HB 4XIUA 4NLOA 4X4TA 1S72S 2HGLA 2V67A 2ZM6J 3IMQJ 1TKXA 4PXBA 5J2PA 1WF2A 2MKCA 2ZNZA 3BSAA 2XI2A 2AZ1A 2BOAA 1B7FA 2WRMA 2M3DA 4X4UA 5E3QA 1QY7A 1LQ9A 1N5SA 4ZVUB 1LK5A 1R8PA 2AGOA 2UUAF 2B8PA 2KFZA 4C3KA 2N4CA 1OY6A 5B0GA 2UUBF 3FBFA 2CJ9A 3ZZRA 3BEGB 3MWBA 3TQ1A 5B0BA 1NK6A 4WF9Q 2WSCC 3CDBA 2UP1A 4DV5J 4DEZA 3GV8B 5LSOA 1UJ6A 4TLQA 3OHAA 1Y11A 3WX8A 4H4MA 2AEFA 2M4MA 4USJC 2QLFB 2PC6A 1V3ZA 1NJZA 3OBIA 2CQ2A 3SQGA 3V6HA 3CCQS 2XGPA 1NKBA 4HKQA 1REVB 3CTRA 2V4JB 1U49A 3VZIA 2AGQA 4FNHA 2N3OA 3QZ8A 3L4BC 2LVWA 1S1UA 2AX0A 2B0GA 1DQAA 2H48B 3OL6A 3C6TB 1NZ8A 2GW8A 2GV1A 2JVRA 3B4MA 3QJJA 5J1NA 5H9FK 4ECTA 1TUWA 2VQFF 1TV6A 3TJAA 1RTDA 2UUAJ 3CULA 2IJNA 3GPAA 3MTKA 3H7HB 2UUBJ 3FCVA 1GXUA 2FTRA 4BHQA 3NAHA 4Y28C 1JLAA 1TU0B 3PYDA 3PO5A 3HMJG 3FEZA 3NP5A 1FK9B 3NS6A 4OZ1A 2B8QA 3QQCD 2KYZA 4ZVEA 3LWMA 1RTZA 5HLFB 1JQGA 4LBIA 5EN1A 1H2UX 2LA6A 5EHHA 3BQ0A 2H51B 1Q78A 5HMYA 3FC9A 4AE5A 1SC3B 4K4SA 3ITHB 3TAMB 4DJBA 3TOQA 3OSNA 2Z4PA 5BYSA 2JRSA 2Y0BB 2CVIA 2V8VA 1U26A 3BSNA 1ELOA 2DNKA 4ECRA 1CJVA 4CO4A 1DQ8A 1YJNS 4M63A 3CE8A 2RMLA 4K8RA 3WBZA 1TL7A 1WDDA 3KTQA 2OMOA 3R5BA 4KHPF 3HZGA 3W8GA 3M8QA 3P5TL 5AXKA 3EGZA 2R7UA 2FVCA 1TK0A 1KC8T 3HX9A 1T7PA 2MKHA 2K1RB 4RWWA 4DLEA 1U6FA 5FLXU 1GXTA 1QTNB 2LQBA 2V5HG 3BDPA 2IC3A 3CNQP 3AD8C 1RT6B 2CQGA 4KRWA 4MKAA 3C15A 2CPIA 3PRBA 2HG4A 1VYAA 5AT1B 1U7LA 3A12A 1RAEB 3JQKA 1C2PA 1U1NA 2XS2A 1H73A 3GZ7A 1IR2A 3CCZA 1X9SA 2E44A 3R2CJ 1NKEA 1TL1A 5DDPC 2GNKA 1FRMA 2YQ1A 2YKNB 3HHLD 1RT4A 2XWYA 4O44B 3IM9A 2EFVA 3HF5A 3R7SB 6FD1A 1YI2S 3WHIA 1KWMA 1S10A 2IIHA 5E5NA 4K7QA 1TUVA 1WEZA 5KG3A 1KVIA 4LT6A 3HP6A 4KHPJ 2B7BB 5K5MA 2D3OR 2YX7A 3OFFA 1FRLA 2Z2ZA 4NCBA 1X5SA 3OTDA 4DSJA 1YITS 1F6TA 3OJSA 2AMCB 1S77D 4A8MP 4Z2XA 4DUYF 3IM8A 5KFXA 2J0SD 1VQLS 3FSYA 3BR8A 1CJKB 2YQ3A 5B0AA 3JB9k 3BBBA 1MU2A 4M5LA 1KTVA 2Y9HA 1ZETA 2AYEA 4NXNF 1VBYA 4RU9A 2YWWA 3LW5C 1JLGB 2DIVA 1NHKL 4HHJA 1KD1T 4H4MB 3WQPA 4NPOA 4NLRA 7FD1A 3VZHA 2XQCA 1IM6A 2ZH1A 3CCLS 4N8NA 3W3SA 2BEFA 3D67A 2V2VA 3SQGB 4P75A 2DK2A 2N3LA 3KLFB 8ATCB 4DBQA 3CJRA 1YZ7A 4ED3A 4NA3A 3CF5Q 1M0SA 3CCVS 2ZE2A 3T5HA 5KOXA 5F0UA 2O1PA 2E5HA 4USHA 4ZPBA 2BDPA 1VRQC 3D1OA 3J7AN 3UI3A 2IPOB 3OL9A 4TU8A 2P2CB 3LF0A 3W5YA 1JLCA 2AJ1A 4W4MA 3C19A 5F8HA 4DUYJ 2LECA 5DGBA 3V81B 1VQSA 2EG1A 1VC5A 4ATNA 2OFGX 1U1KA 1NSKL 4FYWB 3H25A 3H42A 3SFUA 1EKSA 1FDAA 1HNVA 3F44A 4KO0A 1XNQF 1RTIB 1VJWA 4ERDA 1I94F 2P9CA 4NXNJ 5D77A 3JQMA 5M2UA 2ALYB 3AAWB 1U4BA 4QBUA 4JYAF 4WXWA 4RNFA 2NYHA 1RHUB 2D3ZA 2VQEF 2R7QA 1MLAA 3CD6S 4C8KA 4NASA 1GAOA 3GJSB 1PIEA 2F8HA 5D6GA 2YWFA 1XTZA 5SZTA 2ASYA 4N56A 1SJFA 4MAKA 1S6UA 3HHNB 3DOMB 1SQFA 5FDLB 4UQGA 2BJDA 4HTIA 1CJVB 3KOAA 1RZMA 2R8KA 3MD3A 4DSKA 2M5YA 5BYQA 2V50A 1NEEA 3KK1B 2FQQB 1QSYA 4GVBA 3JAMU 3B78A 1U1PA 1H6KX 1HL6A 1JB0C 1HKAA 1SH2A 2CXEA 4BCAA 2MPUA 2BABA 1RT5A 1RAOA 1KQSR 4C7QA 2BJEA 3K17A 4NZ6A 3ILOA 2WONB 3O44A 1NK4A 2MZSA 1SJ4P 1U0HA 3ZNJ1 4N5SA 1IXKA 1X60A 1XNQJ 3QLHA 4CP5A 1I94J 3C15B 4UOFA 4RNMA 2OELA 3R1LA 1WKLA 1KOOA 1OPZA 2AEMA 3VGTA 4JYAJ 1FKPA 1DHMA 2VQEJ 3KMSA 2QIFA 5KFMA 3AY0A 5E3PA 4UOCA 2XWXA 1WACA 2LP4A 2G0IA 3V6KA 4AFFA 3K2YA 4PWDB 1N6QB 1RT4B 3N5BA 4I6WA 2NXUA 3LP0B 1KR4A 2MKKA 1Q4RA 3TI0A 3OTCA 4ZS6A 4NLWA 2H54B 2WW8A 2XCAA 2Y8YA 2KXHA 3DLEA 3M6WA 3QSYB 3PCOB 2IAJA 4ANDA 1M1KT 3MPYA 2KTQA 5DJBA 2C22A 2PA3A 1JLBB 4WCEQ 4LSLA 5ETNA 3KUHA 5KFQA 3FQLA 2DH9A 3GONA 1VK8A 4OYOA 3OFEA 3OFHA 4G1IA 3JYTB 2DO4A 1BUXA 4ZVPB 4LRFA 5CD4H 4EMDA 1VIXA 4P2MA 4ZPWR 2F7VA 1HLWA 2HLUA 1VISA 2MKYA 4LF6F 3QO9A 4WP8A 3UPFA 2DR9A 3Q8RB 3AJ1A 3MMBA 4R0JA 1PCAA 4O3OA 1EETA 2VONA 1MU2B 5KG2A 5LMUF 2HMIA 2FZCB 1FA0A 2DY1A 3RR8A 1NJIT 1QJHA 2HBRB 2DHXA 2OAUA 3GP9A 5LT5A 1MWZA 3GYGA 5DO2A 3HVTB 3C2PA 4MIWA 4NLYA 2JOQA 2R7VA 5DGAA 3ENQA 1R6VA 3B82A 2KU7A 1JJ2R 4OYIA 5A2QY 2ZWPA 1PO6A 3UDLA 1RWMB 4PPZA 1JJCB 1TELA 2ZVIA 1QSLA 1RWXB 4DFKA 2WB4A 4IR1A 1V5VA 3PFEA 1U2FA 3SSQA 2Q3PA 2ZE2B 1XN9A 2ZDOA 2NREA 2XBPA 1X9WA 4KPCA 5E3RA 1KS2A 4USUA 2KO1A 1AFIA 3N9UC 2KH9A 3VALA 1T03A 2O67A 1TK8A 1CJTB 1OO0B 1U2CA 1I3OB 3QBCA 1ZA2B 4KBIA 4LF6J 3GFHA 3NCRA 5D4PA 5I3PA 2IVYA 3GB0A 1ROFA 4KYZA 3T1YF 2W7OA 4CNZA 4IRCA 2B9WA 3HVAA 3L7OA 2Y8WA 1SC1B 2DXDA 4QIVA 1H2TZ 1YRUA 4PEOA 5LMUJ 4LRCA 4U67Q 3AA9A 4KO0B 1VQ5S 1HBUA 4DUZF 4NI2A 1WG5A 3PTWA 3R5JB 3CD5A 4FP9A 2I5JB 5IOLA 4OYXA 2C1EB 3T9ZA 4IG3A 3JSRA 2RF2B 3E8OA 3TRGA 2XCPA 1NRKA 1HHQA 5CQGA 2Z8QA 1IJEB 2BJ1A 1U0SA 1WG4A 2H1YA 3CCES 1S57A 2GGPB 4ZOSA 2UVVA 4HDHA 1ZM2A 4N47A 4DU7A 5L9XA 1HNWF 1VQ7S 3UVJA 2Y1RI 2OI2A 2BBEA 1HWJA 4X4RA 4DQPA 2DEJA 2LMIA 4MK9A 2JWNA 4RR5A 3ZTSA 1RUSA 4GVBB 5CH7B 2P9GA 4C4WA 3AODA 1UVKA 2CIMA 2YKMB 5LOQA 3HCXA 4HEA9 1PYTA 2Q1LA 2UUCF 2PEBA 3GMGA 4IOCQ 3T1YJ 4UZCA 4TLRA 4ELTA 4B9UA 1S1VB 4YB6A 5EX3A 4DUZJ 5ADZA 4DZDA 5KFNA 2L3MA 1JXLA 2IY5B 5EGYA 1TP7A 4NL5A 5JJBA 1FKPB 1X4AA 3DRRB 3DCAA 5KFBA 3UD5A 3UR3C 4M5GA 4KY3A 4KH0B 2W4PA 3W2VB 2DNYA 3EDRB 5FD1A 3M7VA 3MECA 4U7CA 3S01A 3OXLA 2QMUB 2H4YB 1HNWJ 1SL1A 2C2EA 3OVSA 1M5OC 3JTPA 3CWJA 1JLFB 4IO1A 3RZAA 5ETRA 2UV8A 4CRJA 4MKBA 8RUCA 2XNQA 5F0WA 2AYMA 2HS4A 2HK2A 3NGUA 1VK3A 3PG9A 4RL1A 2G0CA 3VGSA 2UUCJ 1WSVA 3RAMA 1Z2LA 4OI2A 5IQ6A 4OL8A 4TVAB 2OP5A 2CQ0A 3D68A 3KNAA 4DI6A 2DIUA 1AUDA 3QO9B 3MR2A 4X4VA 2W8LA 1EB0A 1EETB 1BXNA 1W2BR 3EVMA 1RAAB 4GC7A 1R8AA 3H5UA 1SJQA 2HMIB 2FLPA 3PEJA 1HARA 2LKZA 2DPJA 1PJ7A 3TEGA 2FJWA 3MR3A 2UVWA 2XZDB 4NYZA 4QWAA 3KK2B 4J9RA 4NA1A 2FYXA 3DDIA 2EKYA 2HQCA 1UP1A 5JMNA 4RW6A 4K5RA 3IA0A 2G1DA 2BE2A 4I2QB 2DEIA 2OUGA 1T0TV 4F36A 4KPYA 1RWUA 2EPIA 1KFSA 1V3RA 5IV4A 2W9BA 4GKKF 4QIWD 2UZAA 3Q8PB 4CT8A 4GO7X 3V2UC 3MAQA 1G6BA 3HFVA 2BXJA 4NCAA 1BMQB 5KT4A 3NS5A 1P9YA 3W64A 3ZZZA 3QT6A 1IWGA 2UVUA 7FDRA 3IS9A 5CHCB 3CJ8A 4WTYA 3BQ1A 3W9IA 3ADAC 3M6UA 2OTLS 1VRTB 3EPGA 2QT7A 3T5KA 1T9UA 1HBUB 1WC1A 4NI2B 3CJKA 2R2TA 1VLYA 4NE9C 1OS5A 4DCJB 4WPAA 2VG5A 4IG3B 4PQUB 5HSPA 2HFOA 3DDNA 2CQBA 3BGLA 2R7RA 4P71A 3AB2B 4ED0A 5IT9U 3N4WA 2XLJA 1V6HA 3X3UA 1WNEA 2OIHA 1LWFA 3A8EA 3T6JA 2LXIA 2R8HA 1NO8A 1R0CB 3UVJB 1N0UA 5H1SV 5IC6B 2VFTA 4A8OA 4GKKJ 4OIXA 3A1YG 2ZJRQ 2M9KA 3D28A 4M5IA 3MCOA 4CYUA 4DDFA 4DCPB 5E0OA 3A8IA 3M1VA 2D41A 1NSQA 3FMBA 3PHEA 4XDDA 3D3BJ 2DRDA 3GIMA 1HHTP 5F8NA 3IO1A 3L9ZA 2DBBA 3F0NA 4UOHA 3IAS9 4DQQA 2HBYB 2LXFA 3T5JA 2KJVA 4DN0A 4P2SA 2QJ3A 2Y3YA 3E01B 2C2DA 3DLJA 2AEJA 4LQ3A 5CZVA 5FLXY 4NYPA 5B0CA 1JLEA 2KHDA 2G4BA 1IR0A 1JNZB 4FF4A 1VQOS 2M88A 4FN5A 3DMJA 4ES3A 3HVWA 1P8GA 1CULA 4IH5A 2EFNA 1U47A 4F02A 2QA4G 2VPWB 3HD1A 3K89A 4CNYA 1RU2A 5C24A 2IBKA 3ETMA 3POTB 3QATA 1JX4A 3NGKA 3MAAA 3H4BA 2VOPA 3K8WA 1HW9A 1KKHA 2EFGA 1C4CA 4FBUA 1KTQA 1UVNA 3DKDA 3PW5A 1UEKA 5KFIA 4EEYA 2AZ3A 4NA2A 1YJTA 4PPDA 1VOMA 4F7VA 3O8WA 3D6HB 4DQIA 1UPPA 5T7LA 3C8YA 3SMZA 3CCMS 4K4ZA 5GMKa 5HK4A 3BBFA 4ECWA 1RHQB 1A9NB 4ZLNA 1WORA 3CDAA 3FVYA 4F67A 4U7UD 4I56A 3G87A 3K5OA 1YBUA 1ZAWA 5HL7Q 3EDQB 2Q79A 2E1RA 3GYXB 3QGHA 3OTOF 2GVDB 4EBCA 3PX6A 1BQNA 1ULRA 1CQMA 3AQPA 2RDDA 2CG4A 1IBKF 1HMVA 1OY8A 1HPZA 2ZHBA 2PGCA 2HVHA 4L6V3 2BW2A 3J81j 4HDGA 3DHXA 1NJWA 4F3QA 2W2OP 2QO3A 2RUGA 3G4SS 2ZNYA 2JEIA 2J6TA 2XSJA 2W9BB 2QLJB 3EZUA 1QTMA 4BS2A 4EYIB 3DRPA 1UW9A 5F8JA 3NEKA 4UOGA 3H2LA 5KT5A 1CJUB 2RD5C 3NGRA 4R5PB 4GKJF 3EMTA 1EP4B 3CO0P 4O4RA 4UZBA 1KDNA 3DI6B 3RG6A 2JFKA 3VTIA 1Y10A 4USIA 2BRLA 2FHJA 3PXGa 2VF3A 3PYEA 5HI7A 2ZH5A 2N7YA 2BJ9A 3CJKB 3R6GB 3I5CA 3OTOJ 1E6YA 2HHHF 4AL5A 3QNWB 2L48A 3EJMA 1M1HA 3ZZTA 3LANA 1F9HA 2HFSA 5BYRA 3PW0A 1SL2A 3HXMA 3NG8A 1QAIA 1H38A 1HWLA 4MMOA 4NXMJ 4J91A 1RI7A 5L1IA 2MQNA 2W9CA 3I9ZA 1LWFB 5M2PA 5D3GB 3PNIA 3OW2R 5C2GA 4DZ6A 1Q8BA 2WSEC 4UTGA 3IWXA 3CCWA 1YSJA 4OX7A 2D3UA 1B0TA 2M7SA 4USWA 1KRPA 1OPIA 2YPYA 3MMAA 4QZVB 4B9LA 4OHZA 4ZJQA 2VHGA 4GKJJ 3DM2B 1S9FA 1B64A 3Q83A 5KT2A 1FNMA 4MK7A 1YDLA 2HVIA 1VQYA 3CO9A 3FNNA 2E5GA 2CQ3A 4A8YA 2CPFA 1F60B 3JAMY 4IDKB 4J9KA 1QAXA 3OL7A 2RQMA 3CD7A 1U6BA 3DOLB 3W2WB 3M9NB 2WSFC 1W26A 2DRBA 2HHHJ 2DO0A 4I7FB 1UA0A 1BY9A 3UN2A 1JLEB 4RJVA 1ZA1B 5GAHU 5DZ6A 3MDFA 5MLCV 5CA5A 3MPVA 4DWIA 4F0KA 1H74A 4MH8A 3K7RA 4B3SF 5C42A 4HACB 2HNYB 3MURP 1CULB 4WKYA 2WK4A 5GAGU 1VI7A 3MEDB 2GQQA 1TFYA 2G13A 3MM7A 1Y4ZB 2MGZA 3SFGA 3GFYA 1Y9OA 3TA2A 1F3VA 2R4FA 4XK8C 3V6JA 1W7WA 1XMBA 1AROP 1M5HA 1UW4A 3AOAA 2QSWA 3BV8A 4NEZA 1FEHA 3AT1B 5J1EA 5T7LB 3PKMA 2B51A 3KMQA 4OZ2A 3V5RA 3EYZA 5F3TA 2DHHA 3FQKA 2ZZNA 1KSPA 4M95A 1HWIA 4DPOA 3I31A 2NXCA 1IQZA 4LQ9A 1GFWB 5KOWA 4DF8A 2AWZA 1NBEB 4PAAA 2GC8A 1L3KA 5ITHA 1C0TA 4U95A 2DR7A 1MROA 3WIUA 1BWVA 4IQMA 2WZ1A 2AQ4A 4LFBF 1E6VB 5HMWA 2NSCA 2PEHA 3NNAA 2YX1A 3H5XA 4EBDA 3KLVA 4B3SJ 2ZOGA 4C8MA 4X2BA 3EXCX 3NWGA 4DU8A 2LFVA 3I87A 5A8WA 1HMVB 1HPZB 4ZA1A 1JLQA 3M2UA 1S1TA 2F4FA 2VZ9A 3SDEB 2DNOA 1JKHA 4IRKA 3KHRA 1ZZFA 1HQUB 2X1BA 2HQDA 5DDOC 3R5DA 2AIRB 2B43A 2XSJB 4H4OB 2PT0A 1FJGF 1IKWB 1UVLA 1FRKA 2VBYA 2VFUA 2DJWA 3PFOA 3ZTQA 4OX9F 4MKVA 3R5GA 1GMWD 4R8UA 1UVJA 4A4JA 1NMEB 2UV8G 4Q8EA 2CPXA 1NK5A 1MMNA 4PUOA 4WE1A 1VC6A 1Y7PA 5LJ3Y 3RBDA 1N5TA 2OSQA 4P74A 2KL8A 4LIRA 1WOSA 2VFRA 2JEJA 3U7JA 4LFBJ 1FNOA 2B5JA 2ASJA 2VPYB 4YMEA 4IH6A 2HHUA 2EFQA 3MMJA 4LF9F 3MR6A 1RA6A 1YTYA 5DETA 4FF1A 2GAGC 3OFGA 4YDDB 1I51B 2CRLA 2F3JA 4P6QA 1AUSL 1AFJA 1MWYA 4C6AA 2UXCF 2W9CB 4O3PA 1SQEA 1GT8A 2NZCA 2ILYA 3OL8A 4TXSA 4WKRA 1PJ5A 5D0RA 2ZJPQ 4ZP8A 3QT5A 1FJGJ 4ANCA 2I0XA 4I2PA 3C14B 4JB8B 3L95X 2J5AA 2DH7A 2BV3A 1S0MA 1RU1A 2G2ZA 4OX9J 4QR1A 3S6EA 1A0OB 2CJXB 2B9YA 3MOZA 4KKOB 5K8PA 1VQ6S 1F5CA 1R43A 1U09A 5HVHA 2Y1JA 4HR2A 4N8OA 1H7WA 5L1KA 3T19A 3RYLA 1P1TA 4WP3A 1RJJA 3ICLA 1D9AA 1NPKA 4I68A 3DLGA 4EGLA 2B4VA 4ES1A 3HT3A 2OPSA 2PI4A 3WX4A 4DV3F 5HN0A 1HNIB 2WW4A 3N01A 5C5JA 4LF9J 2FLOA 3VGVA 2MTLA 4J37A 3W1YC 3IR6B 2DNNA 4MIBA 2UXCJ 2J9CA 5HROB 1YJ7A 4AL6A 2ZH3A 2BM1A 3LQVA 4QPXA 1VC0A 4TYAA 3GWCA 4PG8A 1N0VC 2AHOB 2BYCA 4IFVB 2HQGA 3MM7B 4OJ1A 2JVOA 1FRXA 4I64A 5KAKA 1KEKA 1FXRA 1VDHA 3CDWA 1NPPA 2HEKA 4PZVA 3QT8A 4LR8A 4YY3F 1URRA 3BS9A 2HHSA 1YRTA 1EAYC 3KKFA 1R0AA 4NLVA 5KFOA 3OHBA 3DXSX 3VAJA 5L38A 3GJQB 1RT7B 4DFJA 1HQEB 3P3DA 2ZBPA 1S9GB 3EICA 1FJCA 2Y1IA 3DHWC 4Y65A 2E5JA 3ISZA 2CQCA 4DV3J 1KLNA 2QFIA 3TJ8A 2HHPA 2VOOA 2CNNB 1K44A 3CCTA 3PR4A 1FFSB 3BO3A 3PY8A 4K2XA 4DV4F 1SIZA 2W24A 4DV2F 4XTTA 1XR5A 2CWKA 1K1SA 2KT5A 2P9EA 1VRUB 1WEXA 2E1CA 1IUJA 4CLFA 4ZN3A 4Z37A 2HHXA 2IM0A 3X1LB 3M2UB 4RPFA 2BJ7A 2E1AA 2RQ4A 2ACMA 2IBOA 3J7YI 3ONQA 4BDPA 4F2SA 2RS2A 3QRQA 2Z58B 3UDEA 9RUBA 5KFUA 3QIPA 4IKAA 4OQJA 3M4XA 4YY3J 5HBMA 5DG7A 4E98A 1RAIB 2ADBA 3LPEA 4NLTA 4U96A 3RB6A 1D09B 2KFYA 2FJAB 2V34A 4ILMA 2V8PA 2KI2A 4NLDA 1ZAVA 3DGPA 1DTQB 3IR5B 4IRDA 4XDCA 4A47A 5AXNA 1ZTWA 4WE1B 3CMES 4CQ1A 3RBEA 2MLXA 1I5OB 5F8MA 2FJXA 1KONA 1VLOA 2VG7A 4DV4J 3ILJA 2CQ1A 4DV2J 4TY9A 4LF7F 3M8WA 1NH8A 4RW7A 4ENOA 2FHJD 3TYTA 5B09A 3E2EA 3I82A 4YDXA 2B9XA 4Q2LA 2CPHA 3EE3A 3K58A 2LLZA 2FY8A 4K0KF 1KHWA 3NBPA 2GHVC 3HSGA 2MDAA 4M5DA 2CQDA 2F8MA 3CC4S 3UCGA 3MEKA 3W8PA 1VR6A 4F2RA 1AZSA 4XPEA 4LRDA 5HMZA 3CJSA 4IQXA 5CYJA 5K14A 4Q2MA 1VS3A 1M5VC 1KOHA 2CG8A 1OQ3A 5IT9Y 2H3EB 2JH3A 3VVTA 2JEGA 1RWWB 2FGCA 3NY0A 2HNDB 1RYRA 2AJ0A 1IKXA 3UR0A 4J7CA 1JJ4A 3N28A 4ZPTR 1IR1A 2D3O1 3DLGB 1S5ZA 4RW8B 3QMQA 1KQFB 4JV0A 5DDQC 4LF7J 1RAHB 1FWPA 2CQHA 1S1WA 2JLFA 3BSCA 5GMEA 4DX8H 3RBXA 2PA8D 3MGJA 2OH2A 4ZN1A 4OHXA 1LKZA 1NKCA 5A6PA 1ZM9A 5HQ8A 4K0KJ 3RRKA 2QMWA 3TVZA 4EO8A 2VPZB 4CIOA 2KFNA 3SSRA 2Z2MA 3TAPA 4IFYB 5A76A 2YWGA 5JUMA 2XS7A 1L3UA 2A18A 2MB0B 4Y2MA 1SI9A 4CH1A 5G0RA 3CT9A 1KVJA 1U02A 4HH0A 4DL3A 2V9WA 1PJ6A 5CD4A 3D2WA 4Q0BA 2OO4A 4LR9A 5EDWA 2MQLA 3DLBA 3P8BB 4X4QA 2G9OA 2F65A 2HKEA 3T1HF 1QE1A 2GVZB 4CH0S 2EKNA 5IV3A 3EGNA 2V2KA 3MM5A 1F5AA 1IKYB 2B4PA 5DQIA 1OSCA 3UN3A 2KRRA 3AXKA 2E9TA 2KM8C 3M8RA 2NLWA 3Q24A 4TNOA 2VFSA 2ZOFA 1SJ1A 2B9EA 4OI0A 1PAEX 1ZM4A 1RTJA 3RRHA 2HVZA 2QRRA 2DNHA 1F0XA 5A2QU 5IM0B 3EM1A 3EX7B 3PKYA 2XULA 4RUHA 3TP2A 1N48A 2HS0A 1Q7LB 2YNGA 3BO4A 5E3CA 2EVZA 2XMWA 3SCLE 4K4YA 3QIPB 1N36F 3Q86A 1KN6A 2CNLB 1YGYA 1SV5A 1OMSA 2N82B 1IBMF 4FNIA 2ZH4A 3QRPA 4CO0A 2KZZA 3HJFA 4TQRA 2ABYA 1QDUB 3MEGA 3UNYA 3D7SB 3T1HJ 4OYBA 4KGKA 3R9LA 4BC7A 1LWEA 3GTYX 3MFHA 4CTAB 1U1OA 4F4KA 2IMWP 3TA0A 3KDNA 3D0IE 4CWBA 1N34F 5F41A 4DQSA 2VG7B 1HNXF 3KLHA 1D8YA 4AUKA 3FSIA 2MJUA 2EFPA 4QW8A 3CPWR 2IA6A 5AJ3F 3SEOA 1FRJA 3KJVA 4DPXA 1CBKA 1X4EA 5I42B 3LUYA 3NBPB 3OV7A 3LTOA 4LFCJ 4ZCLA 3I5AA 4M5DB 2BW7A 1WELA 5K9FA 4HTJA 4DSFA 3DRYA 1RBAA 2NQPA 5J2MA 2MY7A 4KV8A 1N36J 1FT8A 2YY3A 1CG2A 3MZIA 1TL3B 4LF1A 5HVFA 3N5FA 3DRSB 4PG6A 1ZPVA 4ECYA 4ECSA 1IBMJ 1SH0A 1U1RA 3OUYB 1RKIA 1DRZA 4WK1A 4ZJOA 3Q0AA 5CYMA 1T94A 2NUUG 2RJZA 3FSXA 4B9TA 4OJHA 2KKHA 4WYWA 1X4HA 1SL0A 2PSZA 4HYKA 1BC6A 2OPPA 3TEHB 3NS7B 1N34J 2OHDA 4WFYA 3P49B 3OSPA 2RU9A 2NPIA 1HNXJ 1VQKS 1F5BA 5I3QA 5GAEI 3RW6A 4FVCA 1S1WB 4J90A 5J2QB 5AJ3J 4RUCA 3BKFA 4PWUA 4ZVQB 2K7JA 2WCXA 1C0UA 1OJ4A 3BGRA 1MNEA 4Y6IA 3SZ2A 1ZPWX 3ZC4A 1V3SA 4B3MF 1S6QB 1T9TA 5KFVA 4NMXA 3G8TA 3UW1A 4ZPVR 1UL3A 1JJHA 3TX8A 1OYEA 1RA7A 3CVKA 4YOEA 1REGX 3FRYA 2IJRA 1R8BA 4DV5F 2DGWA 3MM9B 3QAEA 2O01C 3CC2S 2XLIA 3NGTA 4X66F 1HBOA 2QMXA 5G0RB 1K1QA 1S4EA 4G6VB 3CB4A 2RKIA 3NCQA 4H54A 3MUVP 1Q8IA 3GIJA 2VBWA 5HMXA 3C3LA 5KFDA 3RR7A 3MR7A 4EO6A 4NRTA 2XEXA 4FVMA 1ITPA 1YLXA 1GEHA 2DNZA 1L3SA 3MM5B 1CS4A 3NCPA 4QWDA 3PO4A 3OTBA 3V4IA 4DS4A 3FCHA 3TO8A 3QSIA 3RAXA 2CPDA 3M8PA 3TJ9A 4RUBA 4RBUA 2Z2YB 2J7KA 2ZUAA 3Q8YA 2OKQA 4B3MJ 4K4VA 2HVDA 2J0WA 7AT1B 3MOJB 2UVRA 5J1PA 4RW9B 5KFHA 2WOMA 4B3OB 1HFEL 1HBNA 3AD9C 3ENWA 4KSEB 3SCJE 3M9OB 4AYBD 4DN9A 4X66J 3RRGA 1SKWA 4ZHRB
chains in the Genus database with same CATH topology
3QRPA 3QRRA 2Y8WA 4QYZK 2Y9HA 2Y8YA 3QRQA 4U7UD 5H9FK 1WJ9A 5CD4A 4DZDA 5H9EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRP A;  3QRR A;  2Y8W A;  4QYZ K;  2Y9H A;  2Y8Y A;  3QRQ A;  4U7U D;  5H9F K;  1WJ9 A;  5CD4 A;  4DZD A;  5H9E K; 
#chains in the Genus database with same CATH topology
 3CDU A;  1TL5 A;  3G6Y A;  5K8M A;  5KG7 A;  1YJ9 S;  2CNO B;  4X4P A;  1H72 C;  2DGT A;  2KG1 A;  1S76 D;  5LL6 d;  1OY9 A;  4WFA Q;  5LMN F;  4DQR A;  2MJN A;  2W2N P;  4ZKA A;  3I32 A;  3UO0 A;  2ZFH A;  5KG6 A;  3HSJ A;  4JUZ A;  1NK7 A;  3WDO A;  4FBT A;  1VQP S;  3TVY A;  5KFY A;  4ED2 A;  2AW0 A;  5J2N A;  2XZT B;  4DPU A;  1FI4 A;  2FY1 A;  2DGX A;  1NB7 A;  3C16 A;  4ZK7 M;  2RSQ A;  4O4G A;  2MQP A;  4OI3 A;  4X84 A;  3P5B P;  1LW2 B;  5HP1 A;  1HWU A;  3MM8 A;  3VAF A;  3Q8V A;  5AXL A;  1C1C A;  5CAB A;  2RUS A;  2ROP A;  4PYD A;  1RTH A;  4O3N A;  1NPR A;  4RW4 B;  2C2N A;  1EAR A;  1HYS A;  2HK3 A;  4J9V A;  2CFX A;  1X4D A;  4ED7 A;  3I4P A;  1N5V A;  2U1A A;  2R7T A;  1AXQ A;  1BQM A;  2MYF A;  2B6A A;  1VHI A;  2YNH B;  5J2M B;  2XC9 A;  4QR2 A;  1NDK A;  2B56 A;  2M0G B;  3DFE A;  4F0M A;  5ETQ A;  2ZEJ A;  5IQQ A;  5LMN J;  2B7C B;  1KLM B;  5B0F A;  3RTV A;  2OPQ A;  2H5J B;  4S0M A;  1T05 A;  1X7V A;  2ASL A;  4F4X A;  3V6D A;  3DLK B;  2AYB A;  2E1M C;  3I6P A;  5CXT A;  4JI5 F;  1R8C A;  3FJ2 A;  2BUN A;  3U1M A;  3THV A;  1PKU A;  4ETX A;  3OXG A;  3M2V A;  4ZVH A;  3QWP A;  2GMH A;  3GLJ A;  4I69 A;  3TAN A;  2AYG A;  1KHV A;  1WF1 A;  1VQN S;  1UEV A;  1RBO B;  2YWE A;  3IN5 A;  1C0U B;  1SUQ A;  2XMU A;  1RAF B;  1UVI A;  4NLQ A;  2VD3 A;  1YIJ S;  4AL7 A;  3C6U A;  1TAQ A;  1NND A;  3QYY A;  1RE1 B;  4MTP A;  3J7Z T;  4I0W A;  3IXQ A;  1IQT A;  3JTN A;  1BQX A;  2MLY A;  3R5C A;  1SB6 A;  2CZ9 A;  1YQH A;  4G1Q A;  5IS2 A;  4AQY F;  2IA0 A;  2RKI B;  2J76 E;  4AXI A;  1S79 A;  4ER8 A;  3AXM A;  3W63 A;  4AD6 A;  3CXC R;  4F4W A;  4YHH F;  1HBM B;  3R27 A;  2JJ4 D;  2WB1 D;  1T9V A;  1S0O A;  4JI5 J;  1QLN A;  2DHG A;  2I6W A;  3M6V A;  1P6T A;  8AT1 B;  3FUY A;  4K5S A;  2VB6 A;  4DSE A;  2Z57 B;  2UU9 F;  3D3C J;  4L73 A;  2J0Q D;  5AE3 A;  3H59 A;  3R8Y A;  1CS4 B;  4L3N A;  3Q23 A;  4KJI A;  1UAW A;  3KHH A;  3IP0 A;  1HA1 A;  2F5G A;  1TKX B;  5DLG A;  5J2P B;  3Q2T C;  4F26 A;  3ENA A;  3PIO Q;  4UST A;  1LWC A;  1CC8 A;  4OHW A;  1NK9 A;  2CJY B;  3KLI A;  2VU5 A;  5DZ7 A;  1J5O A;  1Z2Z A;  1NHV A;  3HDS A;  4ZVG A;  4NLP A;  3NXZ A;  4ICL A;  4A46 A;  1PBA A;  1G3O A;  2L9N A;  3UN5 A;  4ILR A;  3VAI A;  3SI8 A;  1FJE B;  5L46 A;  2JEF A;  3PW2 A;  2MHE A;  1OWX A;  2JDJ A;  2WOM B;  3ZXW A;  4DCO B;  3JSM A;  4UUX A;  2ZBQ A;  3W5X A;  4L3K A;  2J8S A;  2QLX A;  4DL5 A;  2E7W A;  2M8D B;  1KVK A;  4AQY J;  2NXN A;  1UEU A;  1FX2 A;  2IM3 A;  5LSL A;  2QX0 A;  4QYZ K;  2ILZ A;  1T95 A;  1U8S A;  4YHH J;  1R7I A;  2DHA A;  5F8I A;  3F41 A;  3JS9 A;  1YJW S;  3NWR A;  2CUY A;  4ZCM A;  3A3O B;  3OR2 A;  4YP3 A;  2UU9 J;  4JOU A;  4K4W A;  1U45 A;  3VVU A;  4P10 A;  1FD8 A;  1S1U B;  4C8L A;  1NUE A;  4A48 A;  2W2P P;  4O4G B;  5A8R A;  2O5D A;  2MZ1 A;  2BAN A;  1IM4 A;  3L7P A;  4KFB A;  5HP1 B;  2K3K A;  2ZZT A;  2QC3 A;  3K59 A;  1RTH B;  1TV6 B;  4DG1 A;  1RTD B;  4KE5 A;  3I4H X;  1AB8 A;  4HL9 A;  1F1B B;  2Y0S D;  2DNG A;  2FIU A;  4C9D A;  2CWX A;  4X64 F;  3GFZ A;  1JLA B;  1SH3 A;  1BQM B;  1QVG R;  1N33 F;  3W62 A;  1O5J A;  1RSC A;  4LR7 A;  5DQH A;  1DY3 A;  2GHP A;  1N52 B;  1RT3 A;  2DD8 S;  3LP1 A;  3NL0 A;  4L75 A;  1TVR A;  1RXO B;  5HQM A;  4WFN Q;  4YR0 A;  4JI3 F;  2QV6 A;  1AA1 B;  2J6S A;  2DNM A;  3V6D B;  1SKS A;  1K9M T;  3ET6 A;  3NMA A;  3UQS A;  4ED1 A;  3PYF A;  3FMW A;  4KHM A;  4LJM A;  1X8D A;  1WF0 A;  4FYV B;  4Q5V A;  2NCK L;  1TL7 B;  4Y3C A;  3ISN C;  4DPW A;  4F8R A;  3M8Q B;  5A8K A;  2OEM A;  1W25 A;  4FKX A;  4CLL A;  4QIE A;  1VFJ A;  1C4A A;  4QWC A;  1N54 B;  1XER A;  5HQL A;  1N32 F;  4ETZ A;  1OQ6 A;  1P27 B;  4CCH A;  3NOG A;  2HFU A;  4X64 J;  1SUQ B;  5GAD I;  3ZZP A;  2PN6 A;  1JXE A;  4EWT A;  2IC3 B;  1N33 J;  2RH3 A;  3R1H A;  1XR6 A;  2MKS A;  2YBV A;  2ZH7 A;  2C28 A;  2RIL A;  5L39 A;  3MM6 A;  3CCS S;  1S0V A;  4DXL A;  1H2V Z;  1QAJ A;  3QFW A;  2XB2 D;  3VAG A;  1UWB A;  1TL1 B;  2MEW A;  3MMC A;  3SBM A;  4JI3 J;  2FHK A;  3M30 A;  2XZW A;  1TQL A;  4RX6 A;  3EVO A;  2YKP A;  1G7C B;  2RRN A;  3HSD A;  3VF0 B;  3CJ0 A;  3MHY A;  1HD0 A;  2MLZ A;  4QOT A;  1RT2 A;  2ADC A;  2ZD1 A;  3BM7 A;  3LWL A;  2BKN A;  4WZQ A;  1WC4 A;  3CCJ S;  2A6O A;  3M9M B;  3JTO A;  4C3M A;  2C3P A;  1FDD A;  2QA2 A;  3KDO A;  1NJY A;  4K4U A;  2R7X A;  1N32 J;  3TUP A;  1DLO A;  1SXL A;  1LWC B;  2L41 A;  3D1H A;  1PG5 B;  2EC2 A;  1TMM A;  1J5O B;  1B70 B;  2LU2 A;  4FPR A;  4LRA A;  2PD1 A;  3A4T A;  4NZ7 A;  1FRI A;  2E9R X;  4F3M A;  4OMF G;  1SQG A;  1N8R T;  2XMK A;  5HAT A;  2RDI A;  5HAN A;  4ZIV A;  4LVO P;  3VR1 A;  1ACM B;  1NZA A;  1WD6 A;  4ID5 A;  4C0B A;  4ED6 A;  3AH6 A;  3JSM B;  3IRW P;  1PC4 A;  1OYD A;  2XYP B;  2XO7 A;  1TR0 A;  5AXM A;  4N77 A;  1BGX T;  4QPT A;  3MPW A;  2HPU A;  3EUN A;  1X5T A;  4DPY A;  5F3Z A;  4YR2 A;  2UXD F;  4DSL A;  5FJ4 A;  4WBF A;  2A1B A;  3GQC A;  2AX1 A;  2ZH8 A;  5L1J A;  2DIT A;  3OR2 B;  4LUB A;  5B7W A;  3KHL A;  2RDJ A;  1IVZ A;  2FC8 A;  2J9E A;  4Q44 A;  4OJG A;  2K06 A;  5IC4 B;  5IZH A;  4QIF A;  1ZBT A;  4ZP7 A;  3CC7 S;  3M32 A;  2OEJ A;  1JLC B;  4U7U K;  1SJ3 P;  2X3G A;  1G4C A;  3PM9 A;  3H8Y A;  2BJ8 A;  2AJF E;  2GIQ A;  1NJX A;  2VUG A;  4C97 A;  1ZM3 A;  4HHH A;  1HNV B;  1KP6 A;  2V0N A;  2CZ4 A;  3LOU A;  2YKO A;  5K8N A;  1YJV A;  3K57 A;  1REV A;  1UCN A;  2V4J A;  3MAH A;  2ZH6 A;  2V69 A;  3TNV A;  3N0V A;  2HSE B;  1FVQ A;  1C1B A;  1GQE A;  1U1M A;  3LP1 B;  2V63 A;  3NLC A;  2UUW A;  2UXD J;  3FEX B;  1LFP A;  3C6T A;  1WDT A;  3IG1 A;  1RQ0 A;  4RBT A;  1NK0 A;  2C2R A;  2HZC A;  1X5P A;  2VBX A;  3ET6 B;  4M8L A;  2H4W B;  1Q8K A;  2V2Z A;  1FES A;  4A8X A;  1MML A;  1Q82 T;  3PYG A;  4OLP A;  1FK9 A;  4RNN A;  1Q0N A;  2KB2 A;  2M2B A;  2WTF A;  1S12 A;  5KFG A;  1FDN A;  4C3L A;  1NAQ A;  2FDN A;  3UD4 P;  2F9D A;  1L3T A;  2ZKU A;  5I3U A;  5HLF A;  4DR1 F;  2A2C A;  3OT9 A;  2GMJ A;  5D0E A;  1RT5 B;  2DGU A;  4J9U E;  1YBT A;  1MN7 A;  5LXY A;  3O2I A;  1FFG B;  3ITH A;  4NYO A;  1PYO B;  1U0H B;  2R2U A;  1FTC A;  2HUR A;  5KFE A;  3G6E S;  4O3S A;  3CMQ A;  1F2G A;  3QLH B;  3PIP Q;  3HM9 A;  4ZVF A;  5THW A;  2HWH A;  1S6P A;  2RRB A;  3HSZ A;  1H98 A;  4Q8F A;  5H9E J;  5EWG A;  4XO0 A;  2MY8 A;  1R8H A;  4M5J A;  2YTC A;  2IYG A;  4OYZ A;  4P7T A;  4EK2 A;  1SVD A;  1RB0 A;  4OZ3 A;  2K1R A;  2HW3 A;  3IR7 B;  2VPX B;  1T3N A;  1UJ4 A;  2QLW A;  1RT2 B;  4W90 B;  3DLE B;  2IAJ B;  2NUH A;  3PW7 A;  1FKA F;  2ZC3 A;  3OQ2 A;  4LSL B;  2W9A A;  1ZH5 A;  1HW8 A;  3N6N A;  4F25 A;  3AA8 A;  3D54 A;  4MIA A;  4DR1 J;  2BR0 A;  4PG7 A;  1DLO B;  4K50 A;  4LMZ A;  4BWJ A;  2B3T B;  2F8E X;  1NU4 A;  4YQW A;  1RAJ A;  2NPF A;  3ZO7 A;  2IHR 1;  1IWA A;  1NK8 A;  1LV5 A;  4DSI A;  3DU6 A;  1XJW B;  1NCL A;  2I38 A;  3BKU A;  3A8J A;  4O44 A;  3MMB B;  4X4O A;  4LF5 F;  1Y5I B;  2B4U A;  4B9S A;  5MAO A;  4OI1 A;  3H0P A;  4ZMM A;  2HIQ A;  3DYA A;  2DGO A;  2HRT A;  4M1K A;  3GYN A;  3DGV A;  4IH7 A;  4DMZ A;  2WBR A;  3F73 A;  4YB1 P;  4WU3 A;  4MFB A;  3GG1 A;  2ZJQ Q;  3VQS A;  3J81 U;  1U48 A;  3TAR A;  1QUP A;  1U24 A;  2NSB A;  1CVJ A;  2WVC A;  2WVF A;  2V8D A;  3EPI A;  4ZLJ A;  3GII A;  4QWE A;  1X4G A;  1CJK A;  5F9L A;  2KM8 B;  1UZH A;  2EK6 A;  3NNH A;  1T03 B;  3K5M A;  3M32 B;  1JLG A;  4U9R A;  5KFF A;  2ZC4 A;  3CJ4 A;  2BQR A;  1TKT A;  3T5L A;  3H90 A;  4LF5 J;  2KVQ E;  2LDI A;  3TZW A;  2VBZ A;  2CQ4 A;  1SPB P;  2VV5 A;  3QFH A;  2BVZ A;  3ZZO A;  1T9W A;  1LNQ A;  3KLF A;  1AYE A;  4JI7 J;  2PII A;  4C8O A;  2DHS A;  1C1B B;  4PCQ A;  4ITS A;  1QAY A;  5K20 B;  3BB5 A;  1DFD A;  4ZP9 A;  1HI0 P;  1QVF R;  1LXJ A;  2GIF A;  2EXU A;  3MI7 X;  3IG1 B;  2CZV C;  3M05 A;  4LRE A;  3PV8 A;  3PZP A;  1MN9 A;  3LP2 A;  4OV1 A;  1IBL F;  3P96 A;  3EGW B;  2HAF A;  2EEY A;  2QN6 B;  2PE8 A;  3V81 A;  1UFW A;  3GIR A;  4DR2 F;  4WU2 A;  3RAQ A;  3TUJ C;  1YWX A;  1D9D A;  3PHT A;  4Y2I A;  2BAC A;  3BPS P;  4ECX A;  2I8E A;  2IM1 A;  4R25 A;  2DNP A;  3TX0 A;  1N5Y A;  1RTI A;  4BC9 A;  4O3R A;  2JSX A;  2AJQ A;  3B8H A;  3RB4 A;  5I3U B;  4LBP A;  3VWS A;  2ZIT A;  3D9B A;  3HKZ D;  4A8S A;  4ED8 A;  3MCN A;  3A3N B;  1XIQ A;  3H4D A;  2XMV A;  3PRV A;  3CIZ A;  2LQJ A;  1RHR B;  4NRU A;  3DOM A;  2M52 A;  2GZO A;  1S6P B;  5FDL A;  4B08 A;  4IOB A;  2DCU B;  3HK2 A;  4ZVS B;  1FWL A;  3B54 A;  2BOP A;  3H5Y A;  2YQ0 A;  3Q2S C;  4JV5 F;  3KK1 A;  2HRY A;  3QID A;  3M8Y A;  4DR6 F;  4OHV A;  4ZLL A;  3EZ5 A;  2XI3 A;  1S97 A;  1IBL J;  3MEC B;  2VQF J;  1Q7Y T;  2Q6C A;  1RIS A;  4X65 F;  3THT A;  2HQI A;  3OVA A;  1WI8 A;  9ATC B;  4DR2 J;  3KJQ B;  2WON A;  4ECV A;  2MXY A;  5E41 A;  1GNK A;  2VAS A;  3FZ2 A;  1T9X A;  5HO4 A;  2YPZ A;  4V19 J;  1Y00 A;  2NS1 B;  2CJA A;  4KGM A;  4NEY A;  4PRF A;  5K8O A;  3RJM B;  5KFT A;  3RU0 A;  3G8Q A;  3N6M A;  3PJW A;  4NLU A;  5DS7 A;  3BYR A;  1UJ5 A;  2ZZM A;  2GCF A;  3Q89 A;  4PWD A;  1N6Q A;  1HNZ F;  4W98 A;  2HFV A;  1XMO F;  3OR1 A;  3BN4 A;  3B4D A;  2DXF A;  3LP0 A;  1VHF A;  2E1P A;  5KG0 A;  3R97 A;  2C42 A;  2JX2 A;  3LAK A;  3NGD A;  1NH7 A;  4L74 A;  1Q1K A;  1T02 A;  3DYA B;  3GR1 A;  4JV5 J;  1S1X A;  2LA4 A;  4DR6 J;  1RWV B;  1JLB A;  2IDE A;  4N41 A;  2FJD B;  2C3Y A;  2H5E A;  1SJR A;  4OLO A;  4DR3 F;  3GV7 B;  2MZR A;  4X65 J;  4PXE A;  3JYT A;  4RW6 B;  4RWX A;  2E7V A;  4MFB B;  4WK3 A;  2BE2 B;  4I4B A;  1JXV A;  2UXB F;  4JI8 F;  1TZ0 A;  4NXM F;  1GTH A;  2KXN B;  2BE9 B;  1NSA A;  2CA9 A;  2DT9 A;  3H40 A;  2ZH9 A;  3H5S A;  2C2K B;  1TAU A;  3JXO A;  4I1T A;  4NLX A;  1RAC B;  3PRD A;  5E2Q A;  1HWK A;  4Y0F A;  2XYG B;  5D4N A;  3OLB A;  3HHD A;  5LM7 E;  1BLU A;  1D8Z A;  3MD1 A;  4IG0 A;  1T11 A;  4KIA A;  3G9C A;  2HHW A;  3I5B A;  2N7C A;  2C3M A;  3A3P B;  3KUG A;  4KT0 C;  1VMB A;  4GMK A;  3HVT A;  1FNX H;  3GSI A;  4N76 A;  1X4C A;  4CLT A;  4DV7 F;  4R0E A;  1HNZ J;  1XMO J;  1ZZN A;  1TKT B;  3IS9 B;  2XHC A;  5KFA A;  2P5V A;  1R31 A;  2IJF A;  5JXS A;  5DDR C;  4NZ0 A;  5KFS A;  1K8A T;  4WP9 A;  2HBZ B;  4CO2 A;  2V2Q A;  4RBV A;  4OZN A;  3AFG A;  3HVR A;  4A8F A;  1UFK A;  1XK8 A;  3QWU A;  1U1Q A;  1WEY A;  2VG5 B;  2GFF A;  4J9Q A;  4DR3 J;  1XBW A;  1RLC L;  4KAI A;  4J9M A;  3CJ3 A;  1IBC B;  3K8V A;  1TKD A;  2BKP A;  3BZQ A;  3US5 A;  2JLG A;  4DR5 F;  5EWF A;  2LEA A;  2FC9 A;  4JI8 J;  2UXB J;  1SCJ B;  2DNQ A;  3LP2 B;  1CJT A;  3T1A A;  4TU9 A;  2ZBI A;  4EYH B;  4I67 A;  2QA1 A;  2MQQ A;  4EBE A;  2W25 A;  4OZL A;  1H7X A;  3C66 A;  2MSS A;  3G71 S;  4K59 A;  5U47 A;  3KJF B;  2DNR A;  4J9P A;  1DQ9 A;  5KT7 A;  2ASD A;  4MYU A;  2FZG B;  1N5Y B;  2KN4 A;  4CYU B;  1X0P A;  3D1Q A;  4ZCK A;  3RUB L;  5GAD U;  3VHQ A;  2GJ2 A;  3GFX A;  4MKY A;  3M1V B;  3D5M A;  2O66 A;  2I5J A;  4XPC A;  1Q81 T;  3UCZ P;  4DV7 J;  2RF2 A;  2VG6 A;  3LPY A;  2MKJ A;  3KG0 A;  5C25 A;  2XMT A;  1HD1 A;  4QYR A;  1PSD A;  2W2Q P;  2APO A;  5KT3 A;  4RU2 A;  4GO5 X;  3D6F B;  3FKB A;  4BBY A;  2GGP A;  4GRS A;  2XY6 A;  1G2E A;  1RWP B;  2DTJ A;  2AT1 B;  4KR0 B;  1GX5 A;  3BQ2 A;  4DL6 A;  3FBE A;  4YN3 B;  2CQI A;  4DLG A;  2XHW A;  2I2Y A;  2EWH A;  3R5A A;  3N6L A;  2K8G A;  2NXE A;  3HFZ B;  2CAD A;  5IT4 A;  2YKQ A;  4DR5 J;  1FKO A;  2V6A A;  2YNI A;  1K47 A;  2YKM A;  2CQP A;  1YK9 A;  1PYS B;  3DMJ B;  1TUG B;  1FXD A;  3A13 A;  2V8G A;  1DZ5 A;  2D7S A;  2BQU A;  5C24 B;  4KB7 A;  2JNJ A;  2WBM A;  1S1V A;  4WII A;  1RLD A;  3MAA B;  2VKZ G;  1D0E A;  1JK9 B;  2G2Y A;  2HWT A;  4DX6 A;  1ICE B;  3GR0 A;  3F56 A;  1FE4 A;  3TVK A;  3KK3 A;  2CNK B;  1FEE A;  3GE9 A;  3FRZ A;  1F3F A;  3PJ9 A;  4C8Z A;  1J2V A;  3DRR A;  3GU0 A;  2Z0G A;  4NWB A;  2IFX A;  2NR0 A;  3W2V A;  2OSR A;  4ALZ A;  3D4J A;  4V19 X;  3CJ2 A;  3QAU A;  3CJQ A;  3VQT A;  2JFD A;  3OR1 B;  1K0V A;  2KDO A;  3GG0 A;  4DR4 F;  3GSD A;  3HT0 A;  2P6S A;  1Y3J A;  5GAH I;  1JLF A;  1RK8 A;  5GMD A;  5B0E A;  1WTB A;  1S1X B;  3CJT A;  4B9V A;  5CCM A;  2KHC A;  1BE4 A;  5GAG I;  5DG8 A;  4WZM A;  1F9E B;  1BQN B;  3LGH A;  4EI2 A;  3QT7 A;  5DG9 A;  1S48 A;  4OHY A;  2J9D A;  2R7W A;  2J0X A;  1RGV A;  2EFO A;  3VV2 B;  4QU7 A;  4DFP A;  1FF2 A;  2HZV A;  3TUI C;  2W7A A;  5SUH A;  4WFZ A;  4IOA Q;  1WHW A;  4M94 A;  6FDR A;  3SXL A;  4RUA A;  4JI4 F;  2HHQ A;  3D0G E;  5EWE A;  2WVE A;  4IG0 B;  1WOO A;  1M5S A;  3BGF A;  1R6Y A;  3DRP B;  2W8K A;  2HBQ B;  5KFZ A;  4C2M A;  2RQC A;  4LRB A;  5A0Y A;  2DR5 A;  3R3T A;  2MZJ A;  5D0H A;  1EQM A;  1EJ7 L;  2XG8 A;  3KK2 A;  5HJY A;  4P2X A;  2LQ9 A;  3IFE A;  2B4O A;  3I0S A;  1YG0 A;  1V9O A;  3ZZY A;  4DR4 J;  1M1G A;  2A3J A;  4ECZ A;  4I2Q A;  2JC1 A;  5DLF A;  3BF4 A;  2P6T A;  1X0F A;  5KG1 A;  4CLS A;  2KJW A;  3GCX P;  4DS5 A;  2V94 A;  2C2O B;  2DXE A;  1E6Y B;  4CLU A;  1WKK A;  5GVQ A;  4U8V A;  1L5U A;  3T41 A;  3LAL A;  4LSN A;  4M5K A;  2HFN A;  1Q95 G;  2X1F A;  4U8Y A;  4B02 A;  1YX2 A;  4YEA A;  3MUM P;  1RCO B;  3EWG A;  1CC7 A;  3VGU A;  1A7G E;  4ILL A;  1VBX A;  3KG4 A;  2AV5 A;  4NCG A;  1N4L A;  4L72 B;  2VKR A;  1UTA A;  2N4D A;  2G2O A;  1I1G A;  3HJV A;  1LK7 A;  2ZDP A;  2R8J A;  4JI4 J;  4ZPD A;  2DGS A;  4ANE A;  1UKU A;  3QJL A;  1VRT A;  5BJR A;  3AD7 C;  4XAK A;  4C98 A;  1VIO A;  4D3H A;  3MMA B;  2IYI A;  5C7P A;  4B9M A;  4WYL A;  4C8Y A;  4QU6 A;  2V4Q A;  1M90 T;  3KYL A;  2VG6 B;  4PQU A;  5C25 B;  2F1F A;  1X9M A;  3MXH P;  5ETM A;  1APS A;  3FBC A;  2VC0 A;  3IRX A;  4QIG A;  4AT1 B;  1LWX A;  2C2Z B;  5KT6 A;  3GIL A;  2QYG A;  2RNE A;  3P6Y C;  2PFF B;  4ELV A;  3LO3 A;  2Z30 B;  1AT1 B;  3AB4 B;  4PG5 A;  4E2F B;  4UY8 5;  1ZOT A;  3VAH A;  5ETV A;  4TKT A;  2C3U A;  3IBW A;  1JWW A;  1Z4U A;  1FKO B;  1GXL A;  2YNI B;  1WKJ A;  2MKI A;  3FZB A;  2ZVS A;  3OLA A;  2R8I A;  2ZH2 A;  1B7Y B;  4CM2 A;  4UQT A;  5C42 B;  2ATL A;  3PVX A;  2QL7 B;  4OZ0 A;  3SCI E;  2Q43 A;  1VQM S;  2MGZ B;  3GJT B;  2KG0 A;  4TU7 A;  1WSR A;  2ROE A;  1X4B A;  3IGN A;  1NHU A;  3KK3 B;  3W65 A;  4IR9 A;  2H5I B;  3E01 A;  1XEZ A;  1L3V A;  3NOC A;  3I96 A;  1WC6 A;  2W4D A;  3SCK E;  1FFW B;  2OPR A;  5IXU A;  5J1E B;  2V8H A;  4GC6 A;  3CMA S;  2C3O A;  2PDA A;  5D4O A;  4DPT A;  5KFW A;  2FPH X;  2PO4 A;  2X7I A;  2KZM A;  3PEH A;  5HVG A;  3GJR B;  3EGV A;  3GV5 B;  2WVD A;  1O6X A;  3OXF A;  2PMZ D;  1X5O A;  1S0N A;  3Q8U A;  1H3D A;  4FXD A;  2QG9 B;  3SQO P;  1C0T B;  4DL7 A;  3MCM A;  4PQA A;  2QGF B;  3POT A;  2HZA A;  4QWB A;  1MRO B;  1FD2 A;  5IT0 A;  1LEO A;  3WC2 A;  4CO3 A;  2ZWO A;  3J7A 1;  2ERR A;  2HWI A;  4MYT A;  4ZVR B;  1R3N A;  2F4V F;  2W01 A;  1PBU A;  5A8W B;  3VAM A;  3W9J A;  1JLQ B;  3BPD A;  1S1T B;  2R3V A;  3NRB A;  4ZLP A;  4FF2 A;  1JKH B;  2J7W A;  1FXL A;  4X4N A;  2QL9 B;  4ECQ A;  1CPZ A;  3CED A;  4WFB Q;  1DAX A;  1M5K C;  3BSO A;  3KLG A;  2FLN A;  4YFU A;  3BH6 B;  1SIW B;  3KXD A;  3MUT P;  1U8W A;  2CAJ A;  3PDN A;  4EZ6 A;  2OD6 A;  3J81 Y;  5A0Y B;  3SV4 A;  4R8U B;  2GVD A;  2FB0 A;  3HD2 A;  2CVE A;  2O3D A;  4WXO A;  3I0S B;  4FDF A;  4PUO B;  4U6P A;  3IGV A;  3O1L A;  1IN0 A;  1TK5 A;  2FVS A;  4M5H A;  4B3T F;  4H4K A;  3ZTO A;  2IDL A;  4KTQ A;  4C8N A;  1V5I B;  4WFX A;  3S1T A;  2COL A;  2B5J B;  1OSD A;  1P9Q C;  1GMW A;  4D3G A;  4QQB A;  5EUH A;  2F4V J;  4LSN B;  3QZ7 A;  4KGZ B;  3BKT A;  2MQM A;  1CJU A;  4P52 A;  3HZE A;  4F04 B;  1MG7 A;  5LSR A;  3RW7 A;  3HKW A;  1S49 A;  4R5P A;  1KQG B;  3L09 A;  2IRU A;  1EP4 A;  3ILL A;  1UET A;  4NCG B;  4P72 A;  4GVL A;  4YB5 A;  2ZUG A;  5I4M A;  2H9Z A;  4ID8 A;  3DI6 A;  4P73 A;  2F63 A;  4JI0 F;  5IFM A;  4ES2 A;  4I2P B;  1FJ7 A;  2AD9 A;  2GHW A;  4N7T A;  3DOK A;  4DX5 A;  3MPD A;  5RUB A;  2RVJ A;  4HVZ A;  4DV6 F;  4F4Z A;  4X4S A;  3TW0 A;  2WAQ D;  3O3L A;  1YZ6 A;  4FXV A;  3M2R A;  2LU1 A;  3FGV A;  2XMJ A;  1S9E A;  1M5P C;  1WC0 A;  5AE1 A;  3IRX B;  2J9D E;  2RHS B;  1VBZ A;  2DGV A;  1VJQ A;  2LQ8 A;  1FE0 A;  1Y3K A;  4JBC A;  4B3T J;  2YH1 A;  5KG5 A;  5D3G A;  1I6J A;  2BMB A;  2OPS B;  1NDC A;  1UA1 A;  2CJK A;  4Q7A A;  3G6V A;  4FS1 A;  4PXD A;  3HHL C;  1HQ2 A;  3NGS A;  1IKV A;  2OJ3 A;  5H9E K;  2MST A;  2OFH X;  2FZK B;  2JL9 A;  3H2V E;  5KFR A;  1CSJ A;  3GCW P;  2ZKT A;  3DM2 A;  3UNG C;  5ETS A;  1RT1 A;  2R2R A;  1SBR A;  1D9F A;  2OGU A;  1R89 A;  4JI0 J;  4ZCI A;  1EQ0 A;  1ZAX A;  4LF8 F;  2U2F A;  2D74 B;  3AJ2 A;  4IDK A;  3RGI A;  4OYA A;  1TKZ A;  3G82 A;  3DOL A;  3RB0 A;  2BA9 A;  3W2W A;  4DV6 J;  1EKR A;  2FJV A;  4I7F A;  5JVG Q;  1R0A B;  3ISN D;  2BX6 A;  3CDE A;  4OI6 A;  4LIW A;  3QGP A;  4WJB A;  2OPR B;  1TL4 A;  2G0J A;  1MW7 A;  4ED5 A;  5LXR A;  4NLG A;  2FD2 A;  1YVF A;  4HAC A;  3J7Z 5;  2HLT A;  1RKJ A;  2HNY A;  1VQ9 S;  1Y5N B;  1Y0H A;  2DYA A;  3MED A;  1Q8L A;  3V4M A;  5D4L A;  3K0J A;  3SIP B;  2MHN A;  5KFK A;  2YWH A;  1S7I A;  2DCL A;  1FDB A;  1DTT A;  4Y2C A;  3M6X A;  2W7P A;  5CAA A;  4LFC F;  2FHM A;  3LAM A;  1HR0 F;  4RNH A;  4LF8 J;  3OD2 A;  2XSF A;  2CDR B;  1DBD A;  1T9Y A;  1B0P A;  5HBM B;  5BR8 F;  1N5Q A;  2X1G A;  5KTQ A;  3KLG B;  1DAR A;  1CLF A;  1TTH B;  2QA4 S;  2RRA A;  2C2M B;  2X1A A;  2OEK A;  5F8L A;  5EX0 A;  4YUD A;  3R6L B;  2KT2 A;  2RB7 A;  1Q86 T;  1NM2 A;  1PC5 A;  1KNZ A;  4OI4 A;  2Q66 A;  3BBC A;  3KFW X;  5E3A A;  1WC5 A;  4ECU A;  4PWW A;  1K73 T;  4K2J A;  1E6V A;  4L76 A;  3DGP B;  2VA2 A;  2GO8 A;  2W4C A;  3D66 A;  4OX8 A;  2VJV A;  2R7S A;  4K4X A;  2EW9 A;  2POK A;  5DQG A;  2HIY A;  3KUE A;  3SSS A;  2CDQ A;  3SDE A;  4I6A A;  3SYZ A;  2LCW A;  1HQU A;  4RW7 B;  3TQE A;  1FTR A;  4H4O A;  1CQN A;  2VOD A;  4QJV A;  1IKW A;  4F50 A;  2GA7 A;  4HLB A;  5ETT A;  1XMQ F;  1KFD A;  2BJ3 A;  4DOZ A;  3ZZ0 A;  2M70 A;  2LEP A;  1HR0 J;  3LA0 A;  1AZS B;  1GH8 A;  1VCT A;  1URN A;  2YXL A;  5K14 B;  5BR8 J;  5ETP A;  1O0P A;  2GS8 A;  2CPZ A;  1HI1 A;  3QRR A;  2Q6B A;  2BM0 A;  3JSY A;  3MCS A;  2KVI A;  4UY8 T;  2VDI A;  3DOK B;  4DL2 A;  5H9F J;  2V9K A;  2E7X A;  1RYS A;  3BO2 A;  4ZP6 A;  1WUU A;  3TWZ A;  3PJX A;  2I1R A;  3K5P A;  1IKX B;  2RS8 A;  3M2R B;  4A8Q A;  4W92 B;  1S9E B;  1IBK J;  5T14 A;  1JNR B;  2AKW B;  3FCW A;  5CZX A;  2E5I A;  2GJI A;  2LQ5 A;  3HHE A;  2ZOM A;  3AJD A;  4DV1 F;  1P1L A;  2ALZ A;  5B08 A;  2CPY A;  2HNZ A;  1TFW A;  3C14 A;  1IKV B;  1XMQ J;  4QW9 A;  4LF4 F;  1U25 A;  2HQ3 A;  2AF6 A;  3KLE A;  5HJX A;  3P45 B;  1S99 A;  2R9L A;  4KKO A;  5G4D A;  3Q8Q B;  1JMT A;  3IBF B;  1RT1 B;  4CLZ A;  2LDY A;  4YS2 A;  4P7V A;  4DFM A;  3MR5 A;  1VGY A;  4M5M A;  1TKZ B;  3G82 B;  1RAB B;  1DUR A;  2IRY A;  4CM0 A;  4DV0 F;  1FO1 A;  4K4T A;  1HNI A;  4IO9 Q;  3WC0 A;  4PG4 A;  3E3X A;  3ZTR A;  5FII A;  4Q0B B;  5KFP A;  4ZIW A;  2NXJ A;  1MMD A;  1T8E A;  4USV A;  3L3C A;  3HLU A;  3B6B A;  3PR5 B;  4YB7 A;  5KFL A;  3HPO A;  1QE1 B;  3I9V 9;  1B99 A;  3NKY A;  5HRO A;  3QPI A;  2BRK A;  3W9H A;  3G96 A;  5M2R A;  4DV1 J;  2XNR A;  3H2U B;  3J80 U;  4MT1 A;  4CLK A;  4IFV A;  3U1L A;  3IBC B;  3FBB A;  1YKW A;  3DRX A;  4HT7 A;  2IRX A;  4CZC A;  2BZ2 A;  4LF4 J;  5D78 A;  1D1U A;  1XQI A;  3H98 A;  1RTJ B;  2YX4 A;  1DTT B;  1R27 B;  3BGO P;  4RNO A;  3ZTP A;  1Y5L B;  3KNG A;  4URG A;  2ZHA A;  4NOH A;  3HHK A;  1RT7 A;  2YNG B;  3TA1 A;  2FJE B;  1HQE A;  1S9G A;  5ETK A;  2UUT A;  4P2F A;  4WIQ A;  2A2D A;  2XO6 A;  1RWK B;  2YH0 A;  4F4A A;  1SV5 B;  1LW0 A;  4DV0 J;  4WWS A;  1RCX B;  3TZZ A;  1UPM B;  2RIJ A;  1NSP A;  2YKA A;  4A8K A;  4G1P A;  4PYA A;  1J27 A;  4TQS A;  3JQJ A;  1S7H A;  3MEG B;  1Q53 A;  2OD4 A;  3TUZ C;  3ETO A;  2FHO B;  4MJK A;  1LWE B;  1VRU A;  3HUL A;  2CKW A;  1N88 A;  2AU0 A;  1JIH A;  2XS5 A;  3CW2 C;  3D6M B;  5E7O B;  3O5T B;  3KG1 A;  3FDS A;  2VDH A;  1RAG B;  3KLH B;  4I6Y A;  3Q22 A;  2PMH A;  4HT5 A;  4OZJ A;  3G8S A;  4QYZ J;  2QE5 A;  4X62 F;  3WZ0 A;  1O51 A;  3KJV B;  1WHY A;  2OML A;  2HHT A;  4TN2 A;  3IC1 A;  4ZPA A;  3MEE A;  2DVI A;  4FKY A;  1NB2 A;  1DTQ A;  1S59 A;  3BDE A;  2IVF B;  3JSB A;  4KV8 B;  3UFC X;  1RHM B;  5LJ5 Y;  2JLE A;  4DUT A;  2HVE A;  2QTW A;  2J8A A;  4OV6 A;  3ILI A;  4B3R F;  4AXJ A;  5CYQ A;  3U1N A;  4J9L A;  4URQ U;  1SC4 B;  5CYM B;  2NZ4 A;  1U6Z A;  1FER A;  2QL5 B;  2MQ8 A;  2OPP B;  4UW2 A;  5DM6 Q;  4ED4 A;  3EXY A;  3PW4 A;  1MSW D;  2NYI A;  3OVB A;  4NLS A;  1Q5Y A;  4X62 J;  2HNZ B;  3SV3 A;  3FEY B;  4M5N A;  4J9O A;  3R7N B;  4ZDN A;  2HAI A;  4OYP A;  3EVW A;  2K2P A;  2Z56 B;  2OLW A;  3BGR B;  2HS3 A;  3OPK A;  2XGQ A;  4UF4 A;  3DU5 A;  3KLE B;  2YWK A;  4CO1 A;  4O0I A;  4E0D A;  4F0H A;  2KT3 A;  2HND A;  5KFJ A;  1FCA A;  2E29 A;  3I56 S;  5IWA F;  1U2R A;  1O8B A;  4JP8 A;  1UWA A;  3ZZU A;  4PKD B;  4JI1 F;  2EI5 A;  4DL4 A;  1GMV A;  4KGX B;  3W7B A;  4OYM A;  4B3R J;  2Y1L B;  4PXC A;  1HBO B;  2OTJ S;  6AT1 B;  4DF4 A;  2WVB A;  1YRX A;  4RW8 A;  1J5E F;  4ELU A;  1YJR A;  5CCL A;  1PIL A;  4BWM A;  4C11 A;  2JHE A;  4Y2K A;  2R8G A;  5D0G A;  1QM9 A;  1B0V A;  3M8S A;  2GIR A;  3CCR S;  2D1C A;  1ZS6 A;  4FYY B;  3QGI A;  2V68 A;  1W2I A;  4DR7 F;  4UUW A;  3D0H E;  3ZFV A;  4PR6 A;  4IFY A;  1LFW A;  3CD0 A;  4DL0 C;  2PI5 A;  3KJN B;  3QJP A;  2HYI B;  3MF5 A;  4O3Q A;  1A6L A;  2XYH B;  3V4I B;  3T9N A;  3OJU A;  1Q79 A;  1BHN A;  4A8W A;  3M8P B;  2CJQ A;  1DJ0 A;  1T3O A;  3J7Y U;  4Y34 A;  2EBG A;  3CIM A;  4OYW A;  5DM7 Q;  4EU0 A;  5IWA J;  1SKU B;  2R7O A;  1GMU A;  3IWL A;  3BRE A;  4JI1 J;  3M8Z A;  2DKO B;  1HBN B;  2GJF A;  3BH7 B;  1WHV A;  2GVZ A;  4LBH A;  4Q45 A;  1J5E J;  5B0D A;  2JC0 A;  2FVP A;  4RZR A;  1LW0 B;  1IKY A;  1Z1Z A;  3ELH A;  1RHK B;  3W60 A;  2YVS A;  2V4R A;  4WTO B;  1QUV A;  3I0R A;  4LSZ B;  2CPJ A;  3ZNU A;  2VFV A;  4J5O A;  3W66 A;  2LYV A;  1MWQ A;  2ZHO A;  4DR7 J;  2X3D A;  5J2N B;  1AW0 A;  2H65 B;  2HFZ A;  3CCU S;  5IM0 A;  3C16 B;  1YHQ S;  3DLL Q;  1RWN B;  3UE2 A;  1UZD A;  4Z7C A;  1FX4 A;  3MM8 B;  1HI8 A;  1B4S A;  2HQF A;  1C1C B;  3EZO A;  2D9O A;  2RE1 A;  4USK A;  4CDI A;  2K3I A;  1HYS B;  2KYX A;  4FYX B;  3N79 A;  4HHU A;  1FWK A;  3DC2 A;  2GML A;  2A10 A;  2RU3 A;  3BR9 A;  2QFJ A;  3MEE B;  2DY9 A;  2VH7 A;  2R42 A;  5F9N A;  1VBK A;  1X31 C;  2B6A B;  4P9S A;  4UT4 A;  1HIY A;  3O6Q A;  2BQ3 A;  4TYB A;  2IMO A;  5KFC A;  4CTA A;  1KBR A;  2FUG 9;  2DR6 A;  2VL1 A;  2E66 A;  3FFI A;  4LF2 A;  3DN9 A;  2QSF A;  4FF3 A;  4J9S A;  5F8G A;  1K0T A;  4JI2 F;  2OPQ B;  5CYQ B;  2P8I A;  2PMW A;  3NNC A;  4DX7 A;  2MZQ A;  1T05 B;  2LEB A;  4KHR A;  3BN7 A;  4LFA F;  2FGO A;  4ZVO B;  4Z7Y A;  5T41 A;  1WJ9 A;  2XLK A;  3K5N A;  2MQO A;  3LGN A;  4EZ9 A;  2EBE A;  2VIH A;  1QD1 A;  2WHO A;  1NXI A;  2GO9 A;  2CPE A;  3T3F A;  2IVM A;  1X4F A;  5I42 A;  2RHQ B;  1BWE A;  2RQK A;  1NDL A;  5E33 A;  2CJB A;  3M2V B;  2GQ2 A;  1ZTT A;  4QCL A;  3I55 S;  4C48 A;  2AP6 A;  4V1A k;  4CT9 A;  1EX8 A;  4USM A;  1TL3 A;  4JV2 A;  3DRS A;  4NX9 A;  2FLL A;  3OUY A;  4CLY A;  1FVS A;  4TY8 A;  2HGN A;  3W5Z A;  3C6U B;  1UFL A;  4JI6 F;  2AGP A;  1RHJ B;  4FXW A;  1YBA A;  4BLG A;  4NML A;  2IM2 A;  3PX0 A;  4OJ3 A;  2Z2L A;  3U02 A;  4G1Q B;  4JI2 J;  3S7R A;  3IWN C;  3AOC A;  4O0N A;  4LFA J;  1S4F A;  3CUN A;  4B17 A;  2DB1 A;  2HGM A;  4QR0 A;  5J2Q A;  1PGZ A;  2YNF A;  4CLW A;  4C11 B;  3C46 A;  1N56 A;  4RLE A;  3UCU P;  3DXB A;  4C0O C;  3NAI A;  2F9J A;  2EG2 A;  2XMM A;  2ZBR A;  1IJF B;  4KGV B;  3S8S A;  2GAH C;  2FVR A;  3QGG A;  3VAK A;  1EHW A;  2I9S A;  2ACY A;  1XNR F;  2J6U A;  2HRU A;  1S6Q A;  1RP5 A;  1RWO B;  2FVQ A;  1B3T A;  3HHL A;  1QSS A;  4LVN P;  3MFI A;  2FJB B;  3KLI B;  3MM9 A;  5ETL A;  2QZ8 A;  3CJ5 A;  4ICL B;  4OFZ A;  4G3I A;  1EZZ B;  3HI9 A;  3R7B B;  3TZY A;  3H20 A;  4KQZ A;  2CYY A;  3G86 A;  1WC3 A;  4JI6 J;  1SKR A;  1RAD B;  3HFK A;  2DGQ A;  3K5L A;  4KH1 B;  3HO1 A;  1WOP A;  2J7U A;  2KXF A;  3MTJ A;  4Y00 A;  4JV1 A;  2VA3 A;  3E51 A;  2QLB B;  4URS A;  1NLK L;  1RDR A;  4O23 A;  4KC5 A;  4FS2 A;  2E9Z A;  5AE2 A;  4PAB A;  2XM3 A;  2VIC A;  3RB3 A;  3I0R B;  3D6T B;  4OX6 A;  4CI0 B;  1U1L A;  2GX8 A;  4Q43 A;  2BE7 D;  2RT3 A;  3RBZ A;  5L8R C;  1XNR J;  3ULH A;  3UDC A;  3L7U A;  3AQO A;  5A8R B;  2M8H A;  3T6B A;  4RW9 A;  2BAN B;  4B3O A;  4KFB B;  5D15 A;  2XTJ P;  3TAQ A;  2DH8 A;  2EK1 A;  4HI2 A;  3Q8S B;  1WTF A;  3BYP A;  4F4Y A;  1S6O A;  3THP A;  2SXL A;  4OZ5 A;  2X51 A;  4ZHR A;  4DG1 B;  3P4U B;  2VC1 A;  3KWM A;  3R2D J;  1BD6 A;  1XR7 A;  4FPI A;  2QEX S;  2G1H A;  4IYQ A;  2GQC A;  3LGM A;  3KHG A;  5A6W A;  2ZBC A;  1NDP A;  2A0F B;  3BJY A;  2EC0 A;  1HHS A;  2W1B A;  1RT3 B;  3WIV A;  4IUF A;  4ZVT B;  1D3W A;  1CEZ A;  3FFI B;  3OTE A;  2HHV A;  1TVR B;  2AJ4 A;  5DRK A;  1LW2 A;  4RO0 A;  2D9P A;  1SC6 A;  1Q16 B;  2KRB A;  4CO5 A;  2A6M A;  1G1X A;  3PX4 A;  2ATC B;  1Q5V A;  3MPU B;  4B9N A;  4ZPC A;  2F40 A;  4RW4 A;  1R0B G;  1WWH A;  3W61 A;  5HAO A;  4Y2A A;  5GAE U;  1LXN A;  3G2X A;  5BXI A;  2W2M P;  1OIA A;  4EUV A;  4FYD A;  2XMA A;  2YNH A;  5A8K B;  2L08 A;  1FHT A;  1YJU A;  1TMJ A;  5L9N A;  5ETO A;  2DR8 A;  2ROG A;  3BGU A;  1FRH A;  2E5L F;  2RAQ A;  4YR3 A;  1VQ4 S;  3IAM 9;  1KLM A;  2DNL A;  3LH2 S;  3TAM A;  3U27 A;  4TY8 B;  1XC9 A;  2DPI A;  3CGI A;  3DLK A;  3TR5 A;  3TZX A;  4HI1 A;  2DIS A;  3NMR A;  1WI6 A;  3MM6 B;  4ZIT A;  4HH1 A;  1F2H A;  3AHP A;  1GX6 A;  4MK8 A;  4E8U A;  1UWB B;  2AJ2 A;  3MMC B;  3UWT A;  2PFD A;  3M30 B;  1WG1 A;  4G65 A;  5L1L A;  2ZM6 F;  1KQK A;  1LOU A;  1VQ8 S;  2YNF B;  2QYC A;  1F9F A;  1WHX A;  3GIK A;  3CSK A;  2DRA A;  5JVH Q;  1PAU B;  2ZD1 B;  3A8K A;  2R2S A;  1XWL A;  3DLH A;  5C2C A;  3UDV A;  1GTE A;  2JZ5 A;  3PAC A;  2VJU A;  1RT6 A;  5D8H B;  3UD3 P;  3DDK A;  3ENV A;  3VCD A;  2BKO A;  5KG4 A;  1ZYQ A;  4CLP A;  1GK8 A;  1EIY B;  1UMJ A;  3HHL B;  4CH7 A;  2L9W A;  2E5L J;  4FZV A;  2K7K A;  4EFA C;  2MZT A;  3AOB A;  4DHV A;  2D69 A;  4F3O A;  1RBL A;  4J9N A;  2XY7 A;  2YKN A;  2L9D A;  3J80 Y;  4ID5 B;  1HBM A;  1UVM A;  2LXU A;  2XY5 A;  4ZJL A;  4C0H A;  3G6X A;  4RKU C;  4H4K C;  2MMY A;  3FK4 A;  4JI7 F;  3DNC A;  1H0H B;  4XIU A;  4NLO A;  4X4T A;  1S72 S;  2HGL A;  2V67 A;  2ZM6 J;  3IMQ J;  1TKX A;  4PXB A;  5J2P A;  1WF2 A;  2MKC A;  2ZNZ A;  3BSA A;  2XI2 A;  2AZ1 A;  2BOA A;  1B7F A;  2WRM A;  2M3D A;  4X4U A;  5E3Q A;  1QY7 A;  1LQ9 A;  1N5S A;  4ZVU B;  1LK5 A;  1R8P A;  2AGO A;  2UUA F;  2B8P A;  2KFZ A;  4C3K A;  2N4C A;  1OY6 A;  5B0G A;  2UUB F;  3FBF A;  2CJ9 A;  3ZZR A;  3BEG B;  3MWB A;  3TQ1 A;  5B0B A;  1NK6 A;  4WF9 Q;  2WSC C;  3CDB A;  2UP1 A;  4DV5 J;  4DEZ A;  3GV8 B;  5LSO A;  1UJ6 A;  4TLQ A;  3OHA A;  1Y11 A;  3WX8 A;  4H4M A;  2AEF A;  2M4M A;  4USJ C;  2QLF B;  2PC6 A;  1V3Z A;  1NJZ A;  3OBI A;  2CQ2 A;  3SQG A;  3V6H A;  3CCQ S;  2XGP A;  1NKB A;  4HKQ A;  1REV B;  3CTR A;  2V4J B;  1U49 A;  3VZI A;  2AGQ A;  4FNH A;  2N3O A;  3QZ8 A;  3L4B C;  2LVW A;  1S1U A;  2AX0 A;  2B0G A;  1DQA A;  2H48 B;  3OL6 A;  3C6T B;  1NZ8 A;  2GW8 A;  2GV1 A;  2JVR A;  3B4M A;  3QJJ A;  5J1N A;  5H9F K;  4ECT A;  1TUW A;  2VQF F;  1TV6 A;  3TJA A;  1RTD A;  2UUA J;  3CUL A;  2IJN A;  3GPA A;  3MTK A;  3H7H B;  2UUB J;  3FCV A;  1GXU A;  2FTR A;  4BHQ A;  3NAH A;  4Y28 C;  1JLA A;  1TU0 B;  3PYD A;  3PO5 A;  3HMJ G;  3FEZ A;  3NP5 A;  1FK9 B;  3NS6 A;  4OZ1 A;  2B8Q A;  3QQC D;  2KYZ A;  4ZVE A;  3LWM A;  1RTZ A;  5HLF B;  1JQG A;  4LBI A;  5EN1 A;  1H2U X;  2LA6 A;  5EHH A;  3BQ0 A;  2H51 B;  1Q78 A;  5HMY A;  3FC9 A;  4AE5 A;  1SC3 B;  4K4S A;  3ITH B;  3TAM B;  4DJB A;  3TOQ A;  3OSN A;  2Z4P A;  5BYS A;  2JRS A;  2Y0B B;  2CVI A;  2V8V A;  1U26 A;  3BSN A;  1ELO A;  2DNK A;  4ECR A;  1CJV A;  4CO4 A;  1DQ8 A;  1YJN S;  4M63 A;  3CE8 A;  2RML A;  4K8R A;  3WBZ A;  1TL7 A;  1WDD A;  3KTQ A;  2OMO A;  3R5B A;  4KHP F;  3HZG A;  3W8G A;  3M8Q A;  3P5T L;  5AXK A;  3EGZ A;  2R7U A;  2FVC A;  1TK0 A;  1KC8 T;  3HX9 A;  1T7P A;  2MKH A;  2K1R B;  4RWW A;  4DLE A;  1U6F A;  5FLX U;  1GXT A;  1QTN B;  2LQB A;  2V5H G;  3BDP A;  2IC3 A;  3CNQ P;  3AD8 C;  1RT6 B;  2CQG A;  4KRW A;  4MKA A;  3C15 A;  2CPI A;  3PRB A;  2HG4 A;  1VYA A;  5AT1 B;  1U7L A;  3A12 A;  1RAE B;  3JQK A;  1C2P A;  1U1N A;  2XS2 A;  1H73 A;  3GZ7 A;  1IR2 A;  3CCZ A;  1X9S A;  2E44 A;  3R2C J;  1NKE A;  1TL1 A;  5DDP C;  2GNK A;  1FRM A;  2YQ1 A;  2YKN B;  3HHL D;  1RT4 A;  2XWY A;  4O44 B;  3IM9 A;  2EFV A;  3HF5 A;  3R7S B;  6FD1 A;  1YI2 S;  3WHI A;  1KWM A;  1S10 A;  2IIH A;  5E5N A;  4K7Q A;  1TUV A;  1WEZ A;  5KG3 A;  1KVI A;  4LT6 A;  3HP6 A;  4KHP J;  2B7B B;  5K5M A;  2D3O R;  2YX7 A;  3OFF A;  1FRL A;  2Z2Z A;  4NCB A;  1X5S A;  3OTD A;  4DSJ A;  1YIT S;  1F6T A;  3OJS A;  2AMC B;  1S77 D;  4A8M P;  4Z2X A;  4DUY F;  3IM8 A;  5KFX A;  2J0S D;  1VQL S;  3FSY A;  3BR8 A;  1CJK B;  2YQ3 A;  5B0A A;  3JB9 k;  3BBB A;  1MU2 A;  4M5L A;  1KTV A;  2Y9H A;  1ZET A;  2AYE A;  4NXN F;  1VBY A;  4RU9 A;  2YWW A;  3LW5 C;  1JLG B;  2DIV A;  1NHK L;  4HHJ A;  1KD1 T;  4H4M B;  3WQP A;  4NPO A;  4NLR A;  7FD1 A;  3VZH A;  2XQC A;  1IM6 A;  2ZH1 A;  3CCL S;  4N8N A;  3W3S A;  2BEF A;  3D67 A;  2V2V A;  3SQG B;  4P75 A;  2DK2 A;  2N3L A;  3KLF B;  8ATC B;  4DBQ A;  3CJR A;  1YZ7 A;  4ED3 A;  4NA3 A;  3CF5 Q;  1M0S A;  3CCV S;  2ZE2 A;  3T5H A;  5KOX A;  5F0U A;  2O1P A;  2E5H A;  4USH A;  4ZPB A;  2BDP A;  1VRQ C;  3D1O A;  3J7A N;  3UI3 A;  2IPO B;  3OL9 A;  4TU8 A;  2P2C B;  3LF0 A;  3W5Y A;  1JLC A;  2AJ1 A;  4W4M A;  3C19 A;  5F8H A;  4DUY J;  2LEC A;  5DGB A;  3V81 B;  1VQS A;  2EG1 A;  1VC5 A;  4ATN A;  2OFG X;  1U1K A;  1NSK L;  4FYW B;  3H25 A;  3H42 A;  3SFU A;  1EKS A;  1FDA A;  1HNV A;  3F44 A;  4KO0 A;  1XNQ F;  1RTI B;  1VJW A;  4ERD A;  1I94 F;  2P9C A;  4NXN J;  5D77 A;  3JQM A;  5M2U A;  2ALY B;  3AAW B;  1U4B A;  4QBU A;  4JYA F;  4WXW A;  4RNF A;  2NYH A;  1RHU B;  2D3Z A;  2VQE F;  2R7Q A;  1MLA A;  3CD6 S;  4C8K A;  4NAS A;  1GAO A;  3GJS B;  1PIE A;  2F8H A;  5D6G A;  2YWF A;  1XTZ A;  5SZT A;  2ASY A;  4N56 A;  1SJF A;  4MAK A;  1S6U A;  3HHN B;  3DOM B;  1SQF A;  5FDL B;  4UQG A;  2BJD A;  4HTI A;  1CJV B;  3KOA A;  1RZM A;  2R8K A;  3MD3 A;  4DSK A;  2M5Y A;  5BYQ A;  2V50 A;  1NEE A;  3KK1 B;  2FQQ B;  1QSY A;  4GVB A;  3JAM U;  3B78 A;  1U1P A;  1H6K X;  1HL6 A;  1JB0 C;  1HKA A;  1SH2 A;  2CXE A;  4BCA A;  2MPU A;  2BAB A;  1RT5 A;  1RAO A;  1KQS R;  4C7Q A;  2BJE A;  3K17 A;  4NZ6 A;  3ILO A;  2WON B;  3O44 A;  1NK4 A;  2MZS A;  1SJ4 P;  1U0H A;  3ZNJ 1;  4N5S A;  1IXK A;  1X60 A;  1XNQ J;  3QLH A;  4CP5 A;  1I94 J;  3C15 B;  4UOF A;  4RNM A;  2OEL A;  3R1L A;  1WKL A;  1KOO A;  1OPZ A;  2AEM A;  3VGT A;  4JYA J;  1FKP A;  1DHM A;  2VQE J;  3KMS A;  2QIF A;  5KFM A;  3AY0 A;  5E3P A;  4UOC A;  2XWX A;  1WAC A;  2LP4 A;  2G0I A;  3V6K A;  4AFF A;  3K2Y A;  4PWD B;  1N6Q B;  1RT4 B;  3N5B A;  4I6W A;  2NXU A;  3LP0 B;  1KR4 A;  2MKK A;  1Q4R A;  3TI0 A;  3OTC A;  4ZS6 A;  4NLW A;  2H54 B;  2WW8 A;  2XCA A;  2Y8Y A;  2KXH A;  3DLE A;  3M6W A;  3QSY B;  3PCO B;  2IAJ A;  4AND A;  1M1K T;  3MPY A;  2KTQ A;  5DJB A;  2C22 A;  2PA3 A;  1JLB B;  4WCE Q;  4LSL A;  5ETN A;  3KUH A;  5KFQ A;  3FQL A;  2DH9 A;  3GON A;  1VK8 A;  4OYO A;  3OFE A;  3OFH A;  4G1I A;  3JYT B;  2DO4 A;  1BUX A;  4ZVP B;  4LRF A;  5CD4 H;  4EMD A;  1VIX A;  4P2M A;  4ZPW R;  2F7V A;  1HLW A;  2HLU A;  1VIS A;  2MKY A;  4LF6 F;  3QO9 A;  4WP8 A;  3UPF A;  2DR9 A;  3Q8R B;  3AJ1 A;  3MMB A;  4R0J A;  1PCA A;  4O3O A;  1EET A;  2VON A;  1MU2 B;  5KG2 A;  5LMU F;  2HMI A;  2FZC B;  1FA0 A;  2DY1 A;  3RR8 A;  1NJI T;  1QJH A;  2HBR B;  2DHX A;  2OAU A;  3GP9 A;  5LT5 A;  1MWZ A;  3GYG A;  5DO2 A;  3HVT B;  3C2P A;  4MIW A;  4NLY A;  2JOQ A;  2R7V A;  5DGA A;  3ENQ A;  1R6V A;  3B82 A;  2KU7 A;  1JJ2 R;  4OYI A;  5A2Q Y;  2ZWP A;  1PO6 A;  3UDL A;  1RWM B;  4PPZ A;  1JJC B;  1TEL A;  2ZVI A;  1QSL A;  1RWX B;  4DFK A;  2WB4 A;  4IR1 A;  1V5V A;  3PFE A;  1U2F A;  3SSQ A;  2Q3P A;  2ZE2 B;  1XN9 A;  2ZDO A;  2NRE A;  2XBP A;  1X9W A;  4KPC A;  5E3R A;  1KS2 A;  4USU A;  2KO1 A;  1AFI A;  3N9U C;  2KH9 A;  3VAL A;  1T03 A;  2O67 A;  1TK8 A;  1CJT B;  1OO0 B;  1U2C A;  1I3O B;  3QBC A;  1ZA2 B;  4KBI A;  4LF6 J;  3GFH A;  3NCR A;  5D4P A;  5I3P A;  2IVY A;  3GB0 A;  1ROF A;  4KYZ A;  3T1Y F;  2W7O A;  4CNZ A;  4IRC A;  2B9W A;  3HVA A;  3L7O A;  2Y8W A;  1SC1 B;  2DXD A;  4QIV A;  1H2T Z;  1YRU A;  4PEO A;  5LMU J;  4LRC A;  4U67 Q;  3AA9 A;  4KO0 B;  1VQ5 S;  1HBU A;  4DUZ F;  4NI2 A;  1WG5 A;  3PTW A;  3R5J B;  3CD5 A;  4FP9 A;  2I5J B;  5IOL A;  4OYX A;  2C1E B;  3T9Z A;  4IG3 A;  3JSR A;  2RF2 B;  3E8O A;  3TRG A;  2XCP A;  1NRK A;  1HHQ A;  5CQG A;  2Z8Q A;  1IJE B;  2BJ1 A;  1U0S A;  1WG4 A;  2H1Y A;  3CCE S;  1S57 A;  2GGP B;  4ZOS A;  2UVV A;  4HDH A;  1ZM2 A;  4N47 A;  4DU7 A;  5L9X A;  1HNW F;  1VQ7 S;  3UVJ A;  2Y1R I;  2OI2 A;  2BBE A;  1HWJ A;  4X4R A;  4DQP A;  2DEJ A;  2LMI A;  4MK9 A;  2JWN A;  4RR5 A;  3ZTS A;  1RUS A;  4GVB B;  5CH7 B;  2P9G A;  4C4W A;  3AOD A;  1UVK A;  2CIM A;  2YKM B;  5LOQ A;  3HCX A;  4HEA 9;  1PYT A;  2Q1L A;  2UUC F;  2PEB A;  3GMG A;  4IOC Q;  3T1Y J;  4UZC A;  4TLR A;  4ELT A;  4B9U A;  1S1V B;  4YB6 A;  5EX3 A;  4DUZ J;  5ADZ A;  4DZD A;  5KFN A;  2L3M A;  1JXL A;  2IY5 B;  5EGY A;  1TP7 A;  4NL5 A;  5JJB A;  1FKP B;  1X4A A;  3DRR B;  3DCA A;  5KFB A;  3UD5 A;  3UR3 C;  4M5G A;  4KY3 A;  4KH0 B;  2W4P A;  3W2V B;  2DNY A;  3EDR B;  5FD1 A;  3M7V A;  3MEC A;  4U7C A;  3S01 A;  3OXL A;  2QMU B;  2H4Y B;  1HNW J;  1SL1 A;  2C2E A;  3OVS A;  1M5O C;  3JTP A;  3CWJ A;  1JLF B;  4IO1 A;  3RZA A;  5ETR A;  2UV8 A;  4CRJ A;  4MKB A;  8RUC A;  2XNQ A;  5F0W A;  2AYM A;  2HS4 A;  2HK2 A;  3NGU A;  1VK3 A;  3PG9 A;  4RL1 A;  2G0C A;  3VGS A;  2UUC J;  1WSV A;  3RAM A;  1Z2L A;  4OI2 A;  5IQ6 A;  4OL8 A;  4TVA B;  2OP5 A;  2CQ0 A;  3D68 A;  3KNA A;  4DI6 A;  2DIU A;  1AUD A;  3QO9 B;  3MR2 A;  4X4V A;  2W8L A;  1EB0 A;  1EET B;  1BXN A;  1W2B R;  3EVM A;  1RAA B;  4GC7 A;  1R8A A;  3H5U A;  1SJQ A;  2HMI B;  2FLP A;  3PEJ A;  1HAR A;  2LKZ A;  2DPJ A;  1PJ7 A;  3TEG A;  2FJW A;  3MR3 A;  2UVW A;  2XZD B;  4NYZ A;  4QWA A;  3KK2 B;  4J9R A;  4NA1 A;  2FYX A;  3DDI A;  2EKY A;  2HQC A;  1UP1 A;  5JMN A;  4RW6 A;  4K5R A;  3IA0 A;  2G1D A;  2BE2 A;  4I2Q B;  2DEI A;  2OUG A;  1T0T V;  4F36 A;  4KPY A;  1RWU A;  2EPI A;  1KFS A;  1V3R A;  5IV4 A;  2W9B A;  4GKK F;  4QIW D;  2UZA A;  3Q8P B;  4CT8 A;  4GO7 X;  3V2U C;  3MAQ A;  1G6B A;  3HFV A;  2BXJ A;  4NCA A;  1BMQ B;  5KT4 A;  3NS5 A;  1P9Y A;  3W64 A;  3ZZZ A;  3QT6 A;  1IWG A;  2UVU A;  7FDR A;  3IS9 A;  5CHC B;  3CJ8 A;  4WTY A;  3BQ1 A;  3W9I A;  3ADA C;  3M6U A;  2OTL S;  1VRT B;  3EPG A;  2QT7 A;  3T5K A;  1T9U A;  1HBU B;  1WC1 A;  4NI2 B;  3CJK A;  2R2T A;  1VLY A;  4NE9 C;  1OS5 A;  4DCJ B;  4WPA A;  2VG5 A;  4IG3 B;  4PQU B;  5HSP A;  2HFO A;  3DDN A;  2CQB A;  3BGL A;  2R7R A;  4P71 A;  3AB2 B;  4ED0 A;  5IT9 U;  3N4W A;  2XLJ A;  1V6H A;  3X3U A;  1WNE A;  2OIH A;  1LWF A;  3A8E A;  3T6J A;  2LXI A;  2R8H A;  1NO8 A;  1R0C B;  3UVJ B;  1N0U A;  5H1S V;  5IC6 B;  2VFT A;  4A8O A;  4GKK J;  4OIX A;  3A1Y G;  2ZJR Q;  2M9K A;  3D28 A;  4M5I A;  3MCO A;  4CYU A;  4DDF A;  4DCP B;  5E0O A;  3A8I A;  3M1V A;  2D41 A;  1NSQ A;  3FMB A;  3PHE A;  4XDD A;  3D3B J;  2DRD A;  3GIM A;  1HHT P;  5F8N A;  3IO1 A;  3L9Z A;  2DBB A;  3F0N A;  4UOH A;  3IAS 9;  4DQQ A;  2HBY B;  2LXF A;  3T5J A;  2KJV A;  4DN0 A;  4P2S A;  2QJ3 A;  2Y3Y A;  3E01 B;  2C2D A;  3DLJ A;  2AEJ A;  4LQ3 A;  5CZV A;  5FLX Y;  4NYP A;  5B0C A;  1JLE A;  2KHD A;  2G4B A;  1IR0 A;  1JNZ B;  4FF4 A;  1VQO S;  2M88 A;  4FN5 A;  3DMJ A;  4ES3 A;  3HVW A;  1P8G A;  1CUL A;  4IH5 A;  2EFN A;  1U47 A;  4F02 A;  2QA4 G;  2VPW B;  3HD1 A;  3K89 A;  4CNY A;  1RU2 A;  5C24 A;  2IBK A;  3ETM A;  3POT B;  3QAT A;  1JX4 A;  3NGK A;  3MAA A;  3H4B A;  2VOP A;  3K8W A;  1HW9 A;  1KKH A;  2EFG A;  1C4C A;  4FBU A;  1KTQ A;  1UVN A;  3DKD A;  3PW5 A;  1UEK A;  5KFI A;  4EEY A;  2AZ3 A;  4NA2 A;  1YJT A;  4PPD A;  1VOM A;  4F7V A;  3O8W A;  3D6H B;  4DQI A;  1UPP A;  5T7L A;  3C8Y A;  3SMZ A;  3CCM S;  4K4Z A;  5GMK a;  5HK4 A;  3BBF A;  4ECW A;  1RHQ B;  1A9N B;  4ZLN A;  1WOR A;  3CDA A;  3FVY A;  4F67 A;  4U7U D;  4I56 A;  3G87 A;  3K5O A;  1YBU A;  1ZAW A;  5HL7 Q;  3EDQ B;  2Q79 A;  2E1R A;  3GYX B;  3QGH A;  3OTO F;  2GVD B;  4EBC A;  3PX6 A;  1BQN A;  1ULR A;  1CQM A;  3AQP A;  2RDD A;  2CG4 A;  1IBK F;  1HMV A;  1OY8 A;  1HPZ A;  2ZHB A;  2PGC A;  2HVH A;  4L6V 3;  2BW2 A;  3J81 j;  4HDG A;  3DHX A;  1NJW A;  4F3Q A;  2W2O P;  2QO3 A;  2RUG A;  3G4S S;  2ZNY A;  2JEI A;  2J6T A;  2XSJ A;  2W9B B;  2QLJ B;  3EZU A;  1QTM A;  4BS2 A;  4EYI B;  3DRP A;  1UW9 A;  5F8J A;  3NEK A;  4UOG A;  3H2L A;  5KT5 A;  1CJU B;  2RD5 C;  3NGR A;  4R5P B;  4GKJ F;  3EMT A;  1EP4 B;  3CO0 P;  4O4R A;  4UZB A;  1KDN A;  3DI6 B;  3RG6 A;  2JFK A;  3VTI A;  1Y10 A;  4USI A;  2BRL A;  2FHJ A;  3PXG a;  2VF3 A;  3PYE A;  5HI7 A;  2ZH5 A;  2N7Y A;  2BJ9 A;  3CJK B;  3R6G B;  3I5C A;  3OTO J;  1E6Y A;  2HHH F;  4AL5 A;  3QNW B;  2L48 A;  3EJM A;  1M1H A;  3ZZT A;  3LAN A;  1F9H A;  2HFS A;  5BYR A;  3PW0 A;  1SL2 A;  3HXM A;  3NG8 A;  1QAI A;  1H38 A;  1HWL A;  4MMO A;  4NXM J;  4J91 A;  1RI7 A;  5L1I A;  2MQN A;  2W9C A;  3I9Z A;  1LWF B;  5M2P A;  5D3G B;  3PNI A;  3OW2 R;  5C2G A;  4DZ6 A;  1Q8B A;  2WSE C;  4UTG A;  3IWX A;  3CCW A;  1YSJ A;  4OX7 A;  2D3U A;  1B0T A;  2M7S A;  4USW A;  1KRP A;  1OPI A;  2YPY A;  3MMA A;  4QZV B;  4B9L A;  4OHZ A;  4ZJQ A;  2VHG A;  4GKJ J;  3DM2 B;  1S9F A;  1B64 A;  3Q83 A;  5KT2 A;  1FNM A;  4MK7 A;  1YDL A;  2HVI A;  1VQY A;  3CO9 A;  3FNN A;  2E5G A;  2CQ3 A;  4A8Y A;  2CPF A;  1F60 B;  3JAM Y;  4IDK B;  4J9K A;  1QAX A;  3OL7 A;  2RQM A;  3CD7 A;  1U6B A;  3DOL B;  3W2W B;  3M9N B;  2WSF C;  1W26 A;  2DRB A;  2HHH J;  2DO0 A;  4I7F B;  1UA0 A;  1BY9 A;  3UN2 A;  1JLE B;  4RJV A;  1ZA1 B;  5GAH U;  5DZ6 A;  3MDF A;  5MLC V;  5CA5 A;  3MPV A;  4DWI A;  4F0K A;  1H74 A;  4MH8 A;  3K7R A;  4B3S F;  5C42 A;  4HAC B;  2HNY B;  3MUR P;  1CUL B;  4WKY A;  2WK4 A;  5GAG U;  1VI7 A;  3MED B;  2GQQ A;  1TFY A;  2G13 A;  3MM7 A;  1Y4Z B;  2MGZ A;  3SFG A;  3GFY A;  1Y9O A;  3TA2 A;  1F3V A;  2R4F A;  4XK8 C;  3V6J A;  1W7W A;  1XMB A;  1ARO P;  1M5H A;  1UW4 A;  3AOA A;  2QSW A;  3BV8 A;  4NEZ A;  1FEH A;  3AT1 B;  5J1E A;  5T7L B;  3PKM A;  2B51 A;  3KMQ A;  4OZ2 A;  3V5R A;  3EYZ A;  5F3T A;  2DHH A;  3FQK A;  2ZZN A;  1KSP A;  4M95 A;  1HWI A;  4DPO A;  3I31 A;  2NXC A;  1IQZ A;  4LQ9 A;  1GFW B;  5KOW A;  4DF8 A;  2AWZ A;  1NBE B;  4PAA A;  2GC8 A;  1L3K A;  5ITH A;  1C0T A;  4U95 A;  2DR7 A;  1MRO A;  3WIU A;  1BWV A;  4IQM A;  2WZ1 A;  2AQ4 A;  4LFB F;  1E6V B;  5HMW A;  2NSC A;  2PEH A;  3NNA A;  2YX1 A;  3H5X A;  4EBD A;  3KLV A;  4B3S J;  2ZOG A;  4C8M A;  4X2B A;  3EXC X;  3NWG A;  4DU8 A;  2LFV A;  3I87 A;  5A8W A;  1HMV B;  1HPZ B;  4ZA1 A;  1JLQ A;  3M2U A;  1S1T A;  2F4F A;  2VZ9 A;  3SDE B;  2DNO A;  1JKH A;  4IRK A;  3KHR A;  1ZZF A;  1HQU B;  2X1B A;  2HQD A;  5DDO C;  3R5D A;  2AIR B;  2B43 A;  2XSJ B;  4H4O B;  2PT0 A;  1FJG F;  1IKW B;  1UVL A;  1FRK A;  2VBY A;  2VFU A;  2DJW A;  3PFO A;  3ZTQ A;  4OX9 F;  4MKV A;  3R5G A;  1GMW D;  4R8U A;  1UVJ A;  4A4J A;  1NME B;  2UV8 G;  4Q8E A;  2CPX A;  1NK5 A;  1MMN A;  4PUO A;  4WE1 A;  1VC6 A;  1Y7P A;  5LJ3 Y;  3RBD A;  1N5T A;  2OSQ A;  4P74 A;  2KL8 A;  4LIR A;  1WOS A;  2VFR A;  2JEJ A;  3U7J A;  4LFB J;  1FNO A;  2B5J A;  2ASJ A;  2VPY B;  4YME A;  4IH6 A;  2HHU A;  2EFQ A;  3MMJ A;  4LF9 F;  3MR6 A;  1RA6 A;  1YTY A;  5DET A;  4FF1 A;  2GAG C;  3OFG A;  4YDD B;  1I51 B;  2CRL A;  2F3J A;  4P6Q A;  1AUS L;  1AFJ A;  1MWY A;  4C6A A;  2UXC F;  2W9C B;  4O3P A;  1SQE A;  1GT8 A;  2NZC A;  2ILY A;  3OL8 A;  4TXS A;  4WKR A;  1PJ5 A;  5D0R A;  2ZJP Q;  4ZP8 A;  3QT5 A;  1FJG J;  4ANC A;  2I0X A;  4I2P A;  3C14 B;  4JB8 B;  3L95 X;  2J5A A;  2DH7 A;  2BV3 A;  1S0M A;  1RU1 A;  2G2Z A;  4OX9 J;  4QR1 A;  3S6E A;  1A0O B;  2CJX B;  2B9Y A;  3MOZ A;  4KKO B;  5K8P A;  1VQ6 S;  1F5C A;  1R43 A;  1U09 A;  5HVH A;  2Y1J A;  4HR2 A;  4N8O A;  1H7W A;  5L1K A;  3T19 A;  3RYL A;  1P1T A;  4WP3 A;  1RJJ A;  3ICL A;  1D9A A;  1NPK A;  4I68 A;  3DLG A;  4EGL A;  2B4V A;  4ES1 A;  3HT3 A;  2OPS A;  2PI4 A;  3WX4 A;  4DV3 F;  5HN0 A;  1HNI B;  2WW4 A;  3N01 A;  5C5J A;  4LF9 J;  2FLO A;  3VGV A;  2MTL A;  4J37 A;  3W1Y C;  3IR6 B;  2DNN A;  4MIB A;  2UXC J;  2J9C A;  5HRO B;  1YJ7 A;  4AL6 A;  2ZH3 A;  2BM1 A;  3LQV A;  4QPX A;  1VC0 A;  4TYA A;  3GWC A;  4PG8 A;  1N0V C;  2AHO B;  2BYC A;  4IFV B;  2HQG A;  3MM7 B;  4OJ1 A;  2JVO A;  1FRX A;  4I64 A;  5KAK A;  1KEK A;  1FXR A;  1VDH A;  3CDW A;  1NPP A;  2HEK A;  4PZV A;  3QT8 A;  4LR8 A;  4YY3 F;  1URR A;  3BS9 A;  2HHS A;  1YRT A;  1EAY C;  3KKF A;  1R0A A;  4NLV A;  5KFO A;  3OHB A;  3DXS X;  3VAJ A;  5L38 A;  3GJQ B;  1RT7 B;  4DFJ A;  1HQE B;  3P3D A;  2ZBP A;  1S9G B;  3EIC A;  1FJC A;  2Y1I A;  3DHW C;  4Y65 A;  2E5J A;  3ISZ A;  2CQC A;  4DV3 J;  1KLN A;  2QFI A;  3TJ8 A;  2HHP A;  2VOO A;  2CNN B;  1K44 A;  3CCT A;  3PR4 A;  1FFS B;  3BO3 A;  3PY8 A;  4K2X A;  4DV4 F;  1SIZ A;  2W24 A;  4DV2 F;  4XTT A;  1XR5 A;  2CWK A;  1K1S A;  2KT5 A;  2P9E A;  1VRU B;  1WEX A;  2E1C A;  1IUJ A;  4CLF A;  4ZN3 A;  4Z37 A;  2HHX A;  2IM0 A;  3X1L B;  3M2U B;  4RPF A;  2BJ7 A;  2E1A A;  2RQ4 A;  2ACM A;  2IBO A;  3J7Y I;  3ONQ A;  4BDP A;  4F2S A;  2RS2 A;  3QRQ A;  2Z58 B;  3UDE A;  9RUB A;  5KFU A;  3QIP A;  4IKA A;  4OQJ A;  3M4X A;  4YY3 J;  5HBM A;  5DG7 A;  4E98 A;  1RAI B;  2ADB A;  3LPE A;  4NLT A;  4U96 A;  3RB6 A;  1D09 B;  2KFY A;  2FJA B;  2V34 A;  4ILM A;  2V8P A;  2KI2 A;  4NLD A;  1ZAV A;  3DGP A;  1DTQ B;  3IR5 B;  4IRD A;  4XDC A;  4A47 A;  5AXN A;  1ZTW A;  4WE1 B;  3CME S;  4CQ1 A;  3RBE A;  2MLX A;  1I5O B;  5F8M A;  2FJX A;  1KON A;  1VLO A;  2VG7 A;  4DV4 J;  3ILJ A;  2CQ1 A;  4DV2 J;  4TY9 A;  4LF7 F;  3M8W A;  1NH8 A;  4RW7 A;  4ENO A;  2FHJ D;  3TYT A;  5B09 A;  3E2E A;  3I82 A;  4YDX A;  2B9X A;  4Q2L A;  2CPH A;  3EE3 A;  3K58 A;  2LLZ A;  2FY8 A;  4K0K F;  1KHW A;  3NBP A;  2GHV C;  3HSG A;  2MDA A;  4M5D A;  2CQD A;  2F8M A;  3CC4 S;  3UCG A;  3MEK A;  3W8P A;  1VR6 A;  4F2R A;  1AZS A;  4XPE A;  4LRD A;  5HMZ A;  3CJS A;  4IQX A;  5CYJ A;  5K14 A;  4Q2M A;  1VS3 A;  1M5V C;  1KOH A;  2CG8 A;  1OQ3 A;  5IT9 Y;  2H3E B;  2JH3 A;  3VVT A;  2JEG A;  1RWW B;  2FGC A;  3NY0 A;  2HND B;  1RYR A;  2AJ0 A;  1IKX A;  3UR0 A;  4J7C A;  1JJ4 A;  3N28 A;  4ZPT R;  1IR1 A;  2D3O 1;  3DLG B;  1S5Z A;  4RW8 B;  3QMQ A;  1KQF B;  4JV0 A;  5DDQ C;  4LF7 J;  1RAH B;  1FWP A;  2CQH A;  1S1W A;  2JLF A;  3BSC A;  5GME A;  4DX8 H;  3RBX A;  2PA8 D;  3MGJ A;  2OH2 A;  4ZN1 A;  4OHX A;  1LKZ A;  1NKC A;  5A6P A;  1ZM9 A;  5HQ8 A;  4K0K J;  3RRK A;  2QMW A;  3TVZ A;  4EO8 A;  2VPZ B;  4CIO A;  2KFN A;  3SSR A;  2Z2M A;  3TAP A;  4IFY B;  5A76 A;  2YWG A;  5JUM A;  2XS7 A;  1L3U A;  2A18 A;  2MB0 B;  4Y2M A;  1SI9 A;  4CH1 A;  5G0R A;  3CT9 A;  1KVJ A;  1U02 A;  4HH0 A;  4DL3 A;  2V9W A;  1PJ6 A;  5CD4 A;  3D2W A;  4Q0B A;  2OO4 A;  4LR9 A;  5EDW A;  2MQL A;  3DLB A;  3P8B B;  4X4Q A;  2G9O A;  2F65 A;  2HKE A;  3T1H F;  1QE1 A;  2GVZ B;  4CH0 S;  2EKN A;  5IV3 A;  3EGN A;  2V2K A;  3MM5 A;  1F5A A;  1IKY B;  2B4P A;  5DQI A;  1OSC A;  3UN3 A;  2KRR A;  3AXK A;  2E9T A;  2KM8 C;  3M8R A;  2NLW A;  3Q24 A;  4TNO A;  2VFS A;  2ZOF A;  1SJ1 A;  2B9E A;  4OI0 A;  1PAE X;  1ZM4 A;  1RTJ A;  3RRH A;  2HVZ A;  2QRR A;  2DNH A;  1F0X A;  5A2Q U;  5IM0 B;  3EM1 A;  3EX7 B;  3PKY A;  2XUL A;  4RUH A;  3TP2 A;  1N48 A;  2HS0 A;  1Q7L B;  2YNG A;  3BO4 A;  5E3C A;  2EVZ A;  2XMW A;  3SCL E;  4K4Y A;  3QIP B;  1N36 F;  3Q86 A;  1KN6 A;  2CNL B;  1YGY A;  1SV5 A;  1OMS A;  2N82 B;  1IBM F;  4FNI A;  2ZH4 A;  3QRP A;  4CO0 A;  2KZZ A;  3HJF A;  4TQR A;  2ABY A;  1QDU B;  3MEG A;  3UNY A;  3D7S B;  3T1H J;  4OYB A;  4KGK A;  3R9L A;  4BC7 A;  1LWE A;  3GTY X;  3MFH A;  4CTA B;  1U1O A;  4F4K A;  2IMW P;  3TA0 A;  3KDN A;  3D0I E;  4CWB A;  1N34 F;  5F41 A;  4DQS A;  2VG7 B;  1HNX F;  3KLH A;  1D8Y A;  4AUK A;  3FSI A;  2MJU A;  2EFP A;  4QW8 A;  3CPW R;  2IA6 A;  5AJ3 F;  3SEO A;  1FRJ A;  3KJV A;  4DPX A;  1CBK A;  1X4E A;  5I42 B;  3LUY A;  3NBP B;  3OV7 A;  3LTO A;  4LFC J;  4ZCL A;  3I5A A;  4M5D B;  2BW7 A;  1WEL A;  5K9F A;  4HTJ A;  4DSF A;  3DRY A;  1RBA A;  2NQP A;  5J2M A;  2MY7 A;  4KV8 A;  1N36 J;  1FT8 A;  2YY3 A;  1CG2 A;  3MZI A;  1TL3 B;  4LF1 A;  5HVF A;  3N5F A;  3DRS B;  4PG6 A;  1ZPV A;  4ECY A;  4ECS A;  1IBM J;  1SH0 A;  1U1R A;  3OUY B;  1RKI A;  1DRZ A;  4WK1 A;  4ZJO A;  3Q0A A;  5CYM A;  1T94 A;  2NUU G;  2RJZ A;  3FSX A;  4B9T A;  4OJH A;  2KKH A;  4WYW A;  1X4H A;  1SL0 A;  2PSZ A;  4HYK A;  1BC6 A;  2OPP A;  3TEH B;  3NS7 B;  1N34 J;  2OHD A;  4WFY A;  3P49 B;  3OSP A;  2RU9 A;  2NPI A;  1HNX J;  1VQK S;  1F5B A;  5I3Q A;  5GAE I;  3RW6 A;  4FVC A;  1S1W B;  4J90 A;  5J2Q B;  5AJ3 J;  4RUC A;  3BKF A;  4PWU A;  4ZVQ B;  2K7J A;  2WCX A;  1C0U A;  1OJ4 A;  3BGR A;  1MNE A;  4Y6I A;  3SZ2 A;  1ZPW X;  3ZC4 A;  1V3S A;  4B3M F;  1S6Q B;  1T9T A;  5KFV A;  4NMX A;  3G8T A;  3UW1 A;  4ZPV R;  1UL3 A;  1JJH A;  3TX8 A;  1OYE A;  1RA7 A;  3CVK A;  4YOE A;  1REG X;  3FRY A;  2IJR A;  1R8B A;  4DV5 F;  2DGW A;  3MM9 B;  3QAE A;  2O01 C;  3CC2 S;  2XLI A;  3NGT A;  4X66 F;  1HBO A;  2QMX A;  5G0R B;  1K1Q A;  1S4E A;  4G6V B;  3CB4 A;  2RKI A;  3NCQ A;  4H54 A;  3MUV P;  1Q8I A;  3GIJ A;  2VBW A;  5HMX A;  3C3L A;  5KFD A;  3RR7 A;  3MR7 A;  4EO6 A;  4NRT A;  2XEX A;  4FVM A;  1ITP A;  1YLX A;  1GEH A;  2DNZ A;  1L3S A;  3MM5 B;  1CS4 A;  3NCP A;  4QWD A;  3PO4 A;  3OTB A;  3V4I A;  4DS4 A;  3FCH A;  3TO8 A;  3QSI A;  3RAX A;  2CPD A;  3M8P A;  3TJ9 A;  4RUB A;  4RBU A;  2Z2Y B;  2J7K A;  2ZUA A;  3Q8Y A;  2OKQ A;  4B3M J;  4K4V A;  2HVD A;  2J0W A;  7AT1 B;  3MOJ B;  2UVR A;  5J1P A;  4RW9 B;  5KFH A;  2WOM A;  4B3O B;  1HFE L;  1HBN A;  3AD9 C;  3ENW A;  4KSE B;  3SCJ E;  3M9O B;  4AYB D;  4DN9 A;  4X66 J;  3RRG A;  1SKW A;  4ZHR B; 
#chains in the Genus database with same CATH homology
 3QRP A;  3QRR A;  2Y8W A;  4QYZ K;  2Y9H A;  2Y8Y A;  3QRQ A;  4U7U D;  5H9F K;  1WJ9 A;  5CD4 A;  4DZD A;  5H9E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...