5H9EK

Crystal structure of e. coli cascade bound to a pam-containing dsdna target (32-nt spacer) at 3.20 angstrom resolution.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
199
structure length
139
Chain Sequence
b'MYLSVIIAWSRDLYQLHQGLWHDFLFHVECHVLLQSAQMSTAVATVIQVEFQLQVGVPLYFRLRANPIIKEAEQIAWLQRKLGNAARVEDVHPISERPQYKIQTVCFEGVLTINAPALIDLVQQGIGPMGCGLLSLAPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
publication title Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Immune system/rna
total genus 21
structure length 139
sequence length 199
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5h9eK02
4QYZK 2Y8YA 4DZDA 2Y8WA 3QRQA 5H9FK 5H9EK 5CD4A 2Y9HA 3QRRA 1WJ9A 4U7UD 3QRPA
chains in the Genus database with same CATH superfamily
5B0AA 2LQJA 4HR2A 3VAFA 2VPWB 2F4FA 4TKTA 4USHA 1FNOA 1LWCB 4RLEA 3OUYB 2DYAA 4OHYA 2WVCA 3CUNA 3MFHA 1S9EA 4EZ6A 4KV8A 2CPIA 2HZVA 2XNRA 2UVUA 5KFWA 2P5VA 1U0SA 1WI8A 1S1XA 3U02A 1AFIA 2XULA 5KFSA 1DFDA 1UCNA 2VD3A 2HWTA 2R7OA 1WUUA 1F9HA 4DV7J 4NCAA 2H1YA 3TRGA 3AODA 4LF7J 2ZUGA 4GKJF 3KNAA 4LF6F 4H4OA 5A0YA 2MKHA 4TLQA 2KRRA 1U49A 1YZ7A 2OSQA 5KT6A 5HMZA 1S79A 4P2XA 4F04B 1MMDA 4YUDA 4L76A 2ZD1A 3DU6A 1N34J 3OLAA 2BW2A 5ETTA 5F0UA 1RHKB 3NS6A 3OR1A 2ZH2A 2MQ8A 4ZITA 1UW4A 4ZCMA 3MD1A 4OYAA 2PMHA 4IH5A 4NEYA 4OYXA 1FFSB 2YTCA 1RHQB 3SSQA 1J5EJ 1O0PA 1TV6B 1M5KC 2M5YA 1P1TA 1R89A 4A8FA 2G1DA 3QNWB 1GT8A 4O3OA 4DG1A 1RWMB 2RMLA 3WDOA 1F5AA 2PGCA 1HQ2A 2YNFA 3JS9A 4LF9J 2FB0A 4QPXA 3SZ2A 1FVSA 2X1GA 3C6TB 3UI3A 4DCPB 5EWGA 1IBKJ 4EWTA 2DKOB 1JLGB 2QLXA 1U6BA 3HCXA 4DV6F 4EBDA 4HDHA 3N28A 5E3AA 1VQYA 4DPXA 1V6HA 2VODA 3W5XA 2XZDB 4FVCA 1KOOA 1F6TA 1Q5VA 5HVFA 3JYTA 2GO8A 3K57A 3OHAA 3KDOA 1UKUA 3G6VA 3GIJA 1D9AA 1S9FA 5C7PA 3JSMB 5JMNA 4WU3A 2QA4S 1JIHA 1S49A 3EGWB 4FYDA 3R7NB 4PPZA 2YBVA 3QRPA 1ZZFA 2HQ3A 3KK1A 4U7UD 4ZA1A 2ZJRQ 4OI1A 3W61A 3UR0A 3X1LB 4WP8A 4CRJA 1VBKA 4ZIVA 1VRUB 1W25A 2BXJA 4F0KA 1T02A 5FLXY 4DX7A 1D3WA 3BPSP 5HK4A 2HNZA 4C4WA 1T0TV 3DKDA 4Q8EA 1TP7A 4J9VA 4BHQA 2KN4A 2JEJA 2UU9F 2GMLA 5HQLA 3FBBA 2W9BA 5IZHA 3P49B 3TX0A 3M9OB 1YDLA 3HF5A 2DHXA 1UA0A 2ZC4A 4J5OA 5THWA 4H4MA 2CQ3A 3NP5A 3CJQA 1R8BA 2FJAB 2OELA 2BW7A 1ZYQA 2XLIA 5AXKA 4ECWA 3M7VA 4ZOSA 4MKAA 3SQGB 2OP5A 1WF0A 1VHFA 3KG4A 2HAIA 3W62A 3B78A 4QU7A 2HS4A 1S0OA 2UVRA 3KLEB 5H9EJ 3D68A 5L39A 4RW8A 3W9JA 5L46A 2PSZA 4DPOA 1KTVA 2ZZNA 3BB5A 4ZKAA 4X4UA 2M4MA 3HFZB 3W64A 1HL6A 5IM0B 4F4XA 2Z8QA 2DNYA 4M5MA 1T9YA 3IWLA 2J6UA 3AY0A 5SZTA 3CD0A 4KPYA 4ZN3A 4LVOP 2MGZB 1EKSA 1QUVA 1T03A 2CNLB 4DR4F 2BQ3A 3BGOP 4MIAA 1DARA 1HQUA 2VA3A 2ACMA 1J5OB 2GHPA 4L74A 3BBFA 1FCAA 2H4WB 1WHXA 2OHDA 1Z2LA 1KVKA 4OZ1A 3RU0A 4AL5A 5M2PA 1NSQA 1GH8A 2O67A 4Y2IA 1VRTA 4WIQA 2AJQA 4OYBA 4FBUA 2UV8G 3CJTA 4Z37A 5HROB 2HMIB 1DTTA 3E3XA 2ACYA 4I56A 4C7QA 2B7CB 5E33A 3I4HX 2LMIA 4UOGA 5H9EK 2Q6CA 4LSNB 4IQXA 2LQBA 3KG1A 2DNPA 2DPJA 1T8EA 2C2OB 4OI6A 2BV3A 1FFWB 3FCHA 1LOUA 4DLEA 1TZ0A 4KT0C 4MYUA 1NKEA 2FJBB 2XMVA 4C8MA 5K14A 1FF2A 1S99A 2CWXA 2ZWOA 2F8MA 4EUVA 1N54B 1UMJA 2PEBA 4OV6A 4MK8A 1M5SA 1U1QA 1UVMA 2DISA 5A8WB 1JLAA 4ZS6A 1RT7A 3I31A 1UEVA 2CVIA 1HNVB 1NSPA 3CMES 3KMSA 2Q1LA 4ECQA 3WIUA 4X4PA 1REGX 2EK6A 2J9CA 4QCLA 4CO4A 3IBFB 1ZZNA 2E1PA 1DTQB 3GJTB 4UTGA 2DVIA 2BOAA 5BXIA 1YGYA 3OTEA 4YS2A 2G2ZA 3I82A 4DFPA 1URRA 2E5IA 1XJWB 1RTIB 5ETMA 5ETPA 2V63A 3M2UA 4JYAF 4OHXA 4TYBA 4F25A 2UUCJ 4IG0A 3TA2A 3H98A 3NNCA 1U48A 4GKKF 2ZWPA 2B4VA 3H4DA 1UFWA 1M1KT 3CIMA 2LU2A 4OL8A 1D8YA 3HHLD 4WKYA 2XMUA 1PIEA 4NLPA 3MPDA 1WF1A 1Q82T 3BKTA 1NH8A 1NZAA 4U96A 3CCUS 5B09A 1XMBA 5KFDA 5B0GA 1ZTTA 4MAKA 2M8DB 4C8YA 1I94F 1XNRF 2VKRA 3M6VA 3DI6B 4OQJA 2E1MC 1JNRB 4FZVA 2YNGB 4DBQA 3UW1A 4K4TA 3NCQA 3R3TA 2GGPB 4U8YA 1Y0HA 1NM2A 2VG5B 1RWOB 1K0TA 3GFXA 2MQOA 4C8KA 5JJBA 5J1NA 3DRRA 3W5ZA 1RA7A 2HFUA 3DLKA 4R0EA 1S4FA 3BREA 4UOFA 3HHNB 4CLTA 5KFOA 4M5DA 3TZZA 2VC1A 4NCGA 2YWWA 3I56S 3LOUA 1YLXA 4K5RA 4V19X 1MN7A 3PZPA 4GVLA 5BJRA 4I6WA 5K8PA 4DS5A 1XC9A 3KG0A 4M5IA 5KFYA 1U4BA 2J7UA 4CYUB 5GADU 1PYOB 1UPPA 1RE1B 1Z1ZA 2V68A 3TWZA 5DZ7A 3QO9A 2YWFA 3T9NA 4HACA 2H48B 3DLJA 5CCMA 4N5SA 5IFMA 1PSDA 3ILIA 1GXLA 4KKOB 3IR7B 2R7SA 2HS3A 3P5TL 1V5IB 2DXEA 2GQCA 3GILA 4DR6J 5K5MA 3CGIA 3AB4B 1FXRA 1UVJA 3R5DA 2R8HA 4Y2CA 5F3ZA 2D3OR 1FKOB 2CJAA 5DZ6A 5I3UB 3BZQA 2OJ3A 4X4NA 5L9XA 3KKFA 2GCFA 3A8IA 3O1LA 1RXOB 1BXNA 4B3OB 2MZJA 2HGMA 7FD1A 5A2QU 1FTRA 2HK3A 3M2VB 3AOAA 4PABA 2RKIA 1CC7A 4UOHA 2LQ8A 4LREA 3OW2R 2VC0A 1H72C 2BE7D 2Y0BB 1TKXB 3RJMB 2RF2A 3PJ9A 5KG3A 3KLIB 4QWEA 1TVRB 4LRAA 2HQDA 1PGZA 1VK8A 2Q79A 3M1VA 2K1RB 4AUKA 2HVHA 1T9WA 4B3MJ 5DS7A 1T9XA 3F41A 3DU5A 4IH7A 3TJAA 1Y00A 5T14A 5F8JA 1UTAA 2CZVC 3BDEA 2W9CB 1OY9A 5CZXA 4DV5J 1CVJA 4JV5J 2RUGA 4JI1J 1DBDA 1Y5NB 3V2UC 1FERA 3VAHA 3NWGA 4CLFA 4R5PB 2PD1A 4WTOB 1UPMB 2XY5A 1GX6A 4I6YA 1A9NB 2BJ1A 1HBMB 1ULRA 2BKOA 3BM7A 2V4JA 1L3SA 3Q8SB 3FBFA 4EBEA 5BR8F 2DNOA 4NZ6A 4URGA 3RR8A 3MUMP 4O4GB 1DJ0A 5HP1B 5D4LA 4TY8B 4DV1F 3PHEA 4FF1A 1HNIA 3HO1A 3FSIA 2NSCA 4WIIA 4ZPVR 4U95A 3D5MA 3AHPA 3OXLA 4JI8J 1T95A 2KXNB 1IBLF 1B7FA 3NAIA 2QYGA 4KC5A 4OZJA 2DJWA 4Q0BB 2BANB 1O6XA 5KG0A 3CULA 1PAUB 3PO4A 2GMJA 1NK0A 3BSAA 4RNNA 5J2MA 5FDLB 3MOJB 3DLEA 1QAJA 5D0RA 2XSJA 2W8KA 4J91A 1QE1A 3MURP 5E41A 1OY6A 2WSEC 4NXNF 3GIIA 1FJCA 2AX0A 4M1KA 3R27A 2XSFA 5T7LB 4EMDA 2MKCA 3O8WA 4HTJA 4OLPA 3LP2B 1BQNA 3B4MA 4M94A 1GX5A 1VC6A 2W4CA 1WC5A 2W2MP 1RSCA 4PQAA 2F9DA 1XR7A 2A18A 2PEHA 3D4JA 5B0CA 4P7VA 2BJEA 1KQFB 5D3GB 1FDNA 1IWGA 3PACA 4YHHJ 3T1YJ 5KFRA 3L3CA 5I42B 4W92B 2BJ3A 1XR5A 3TJ9A 1T05B 2FDNA 2KZMA 2RT3A 5AT1B 3MCOA 4O3PA 2IBKA 3BKUA 5I4MA 3CJ5A 2HBYB 2R7TA 3G6XA 1HI8A 1VQKS 2C3YA 4DV0J 4ZIWA 4F26A 4Q8FA 2W01A 3GU0A 1FWPA 1JWWA 1YTYA 1N5SA 3KUGA 4F3MA 4RUHA 1KP6A 4B17A 5F9LA 3MCSA 2R2SA 1AUDA 4KJIA 3MM6B 2EBEA 1EP4A 1TMJA 4HT7A 3F56A 1IR2A 3ZZYA 3G4SS 4HYKA 1V3ZA 3HX9A 4FYWB 2MZSA 2ZOFA 1R7IA 2N3LA 4OX7A 2GZOA 4QWBA 3D66A 2IY5B 2QLFB 1AZSB 2CPYA 4RPFA 5C42B 5IQ6A 2IJNA 4N41A 3I0RA 5C25A 2UXDF 1VYAA 3FQKA 2F4VJ 1HIYA 3PIPQ 2R8JA 1U8WA 1NHKL 3RB3A 2JLFA 1WOOA 3VTIA 2XI2A 4LVNP 2DH8A 1Q7LB 3DGPB 2ZDOA 1E6VB 2XZTB 1WG5A 2UUTA 1RCOB 4XPEA 2CADA 1WC4A 4FS2A 3BGRB 4RUCA 1AXQA 4FNHA 2VOOA 2O1PA 5B08A 1K8AT 2OPQB 5J1EB 3CCWA 2RU3A 2BKNA 1AW0A 3N4WA 2PN6A 2RVJA 2P8IA 5KG7A 2M52A 2E5GA 3E8OA 2D7SA 3UD3P 4PXBA 3ILJA 1FD8A 3P96A 2ASJA 4KFBA 4K5SA 2HVIA 3TVZA 3T3FA 3WC0A 2QFIA 3OTOJ 3FBEA 1F2HA 1R3NA 5B0DA 1JLCB 3KJVA 5F8MA 5GAEU 2QSFA 2OAUA 3C14B 5KFXA 1NK9A 4UY8T 1H6KX 3EZ5A 2PDAA 3PW5A 3I55S 3CJ4A 3K5OA 2EWHA 2CPHA 1C1BB 2EG1A 2ERRA 4Z7YA 3OPKA 3NS7B 2AU0A 4M5GA 3MR7A 2MQMA 2XC9A 3M30A 4K4ZA 4Q5VA 1HMVB 4KPCA 1R0BG 1WDDA 2EKYA 4DV6J 1IQZA 4NXMF 5B0BA 2CQCA 2QV6A 1EB0A 5KG1A 5C5JA 2HVDA 1TK8A 1Q0NA 4OZ2A 3SFUA 1VQMS 2DHSA 1TKTA 1JK9B 5CXTA 4A8KA 5FIIA 4G1IA 1VLOA 1G2EA 1PC5A 1SV5B 1JKHA 3WQPA 3AOCA 4YDXA 1H38A 3AJ2A 2WONB 5HLFB 4KGVB 2ALYB 4DR3J 1RU1A 2OLWA 4I2PA 1CPZA 2YQ3A 3ETMA 3MECB 1RCXB 3IXQA 3VZIA 1NBEB 3HZGA 5CQGA 1LWCA 3HULA 1RWNB 4PR6A 3SCLE 3OUYA 4KH1B 3CCQS 5D78A 1GAOA 3TW0A 3IG1A 1S7IA 2V34A 1NDKA 3CXCR 3KTQA 2GIFA 1OS5A 3VGVA 3IWXA 5D4PA 2G9OA 1FDAA 1JLFB 4X84A 2HBZB 1XMQF 4DV2J 2MJNA 1CJUA 1NUEA 4DQQA 2Y1RI 4KHPJ 2C22A 5LMNJ 4JI2F 3JTNA 4JP8A 1R6YA 2QT7A 4DL6A 3S01A 1YQHA 2HIQA 3ENVA 4K4VA 3FC9A 4LFCJ 4EYHB 2FVQA 1SJFA 1UVKA 3L09A 4A48A 2B5JA 3FJ2A 1Y9OA 2ZH3A 4PZVA 3PX0A 4ZPAA 5GMDA 1UEUA 3Q86A 3G82A 3CJ2A 1TV6A 2LP4A 1TR0A 4IRCA 4DCOB 1IR1A 2MHEA 3PCOB 1ZM2A 3W2VB 2B3TB 3CCRS 5KT7A 2FHJD 3C6TA 5G0RB 1KBRA 2C3PA 2IM1A 2FGOA 1JLGA 3SCIE 3CD7A 2HHHJ 5SUHA 4LBPA 2D41A 1VBXA 2HHWA 2ZZMA 1QTNB 2N3OA 4KGZB 4FNIA 1RT1B 1AFJA 4RNFA 3SBMA 3T6BA 1YJNS 1HHSA 4N77A 4P72A 5ADZA 2MQLA 2ZH1A 4DR4J 2FHJA 2KG1A 1CJVB 1TFYA 1IKXB 3TOQA 3HHEA 3KFWX 1NJIT 3I9V9 4DX5A 1B0PA 2R8KA 4TXSA 3MXHP 1P9QC 5KFLA 2M2BA 3JSMA 5HQMA 2YX7A 2GVDB 2Y1JA 2RRNA 1DZ5A 1UZDA 4IFVB 1NEEA 2XI3A 2LEAA 4TQSA 1OY8A 3GYGA 1SJQA 1HYSB 2U1AA 2MQPA 3VALA 1NNDA 2B8PA 1XMOF 1VRUA 1FEHA 2W2OP 3SEOA 4OYZA 2F7VA 2CPEA 3QLHB 2BQUA 1PBAA 4FPIA 1HR0F 3DHXA 4ECXA 3MEEB 3Q8VA 4ZCIA 4USJC 3ZXWA 2VFRA 3H2LA 1U6ZA 4ITSA 1IM6A 2OPRB 4Y00A 4M5HA 1EKRA 1RBLA 4WYLA 4F0HA 1GNKA 5D15A 1DURA 2LA4A 5KG4A 1X0PA 1LK5A 4IQMA 2HHUA 5A6PA 1TK0A 2W9AA 1HNZF 1FEEA 3MCNA 2I2YA 2WK4A 3G71S 3HSZA 3R5JB 4M5NA 1Z2ZA 2DNKA 2RE1A 3BS9A 2HQGA 2PI4A 4FS1A 3W7BA 4ECYA 1V9OA 2XMKA 4LBIA 4X65J 1IKYA 1VOMA 1O8BA 4USKA 2AJFE 2FGCA 2C2ZB 1X4AA 3R2DJ 3ZZRA 4O3NA 1AA1B 2HFVA 3LGNA 4X66J 1URNA 2GHWA 2GFFA 2X51A 2BMBA 1JX4A 2EC2A 5E3CA 5K8OA 3KLEA 3M8QB 4DFJA 3OSPA 3HI9A 2Y8WA 3CPWR 2VDHA 1S59A 4ZVSB 3J7YU 3LPYA 4G1PA 4HL9A 4YB5A 3WX4A 1TUGB 2XLKA 4JYAJ 1XR6A 1NK7A 5IM0A 2HPUA 1NZ8A 3B82A 4DQRA 1TAUA 4O3RA 2MGZA 1BQMA 1YWXA 5EWFA 3Q0AA 1QSSA 2YNIB 1SH2A 3TP2A 2HSEB 4IUFA 3VGUA 3HSGA 2XHCA 1WHYA 2WVFA 4YR3A 2XBPA 1XWLA 3CCTA 3IBCB 3A3NB 2B7BB 2JHEA 3Q8YA 1HQEB 5KT5A 2MZ1A 2OTJS 3BGLA 4Y6IA 1FRKA 4F2SA 1HFEL 4K4SA 3ZFVA 5L1KA 4LF8F 5HROA 2D9PA 2HMIA 3F44A 4B9NA 2B0GA 1MMNA 5IQQA 3CE8A 2CQBA 1C4AA 3D3BJ 4ANDA 2JOQA 2Y0SD 3VVTA 3IFEA 1NJXA 3OBIA 1LWXA 2DIUA 4DV7F 2IA6A 3UE2A 4LF7F 3NS5A 3P6YC 1VFJA 3TVYA 2UXBJ 3DYAB 1QDUB 2W2NP 1X4HA 3FRZA 2DXFA 2L08A 4LR8A 2E7WA 1QY7A 4U8VA 3CF5Q 1HBNB 2QTWA 2N82B 4ECSA 3JQKA 4M8LA 7FDRA 2CAJA 3R2CJ 2HRUA 2PC6A 2MQQA 2OD6A 2CQIA 3PDNA 1HWLA 3GR0A 1U2RA 2EXUA 1HNVA 4J9KA 1FRMA 3DDKA 4ZPWR 1J5EF 1UFLA 4FKXA 3T1AA 4WF9Q 2VUGA 1PCAA 2G2OA 2OEJA 3PW0A 5DLFA 4NYZA 3N79A 1FNMA 1DTQA 4LF9F 3DOMB 3MCMA 4A8MP 4RW6B 2A2DA 2ZOMA 4DF4A 4JV0A 3HP6A 3CB4A 1IBKF 1RTDB 3MAQA 4MT1A 2QSWA 1FO1A 2YWHA 5F3TA 2R2UA 2KYXA 1RTIA 3DLGB 1S6OA 5IT9Y 3NGSA 3D6TB 4JI6F 2VA2A 4P74A 4ILRA 3D1OA 4CTAA 4FXWA 1SL1A 4DX8H 4R8UA 4B3SF 1B3TA 4USIA 4KIAA 2VFVA 5GADI 1RAIB 2RHQB 2WAQD 1I6JA 3DRYA 1FK9A 1BWVA 4CLLA 3UVJB 1X4EA 2WCXA 2OKQA 2PMWA 3DI6A 3KHGA 4YR0A 2K7KA 1UL3A 3FSXA 4J9LA 2DHAA 2F3JA 2YNGA 2GGPA 4B3TJ 1MROA 1U6FA 3LH2S 2ALZA 1X5PA 1E6YA 2VG5A 1SIZA 3AOBA 3UN2A 1PO6A 3N9UC 1IKWB 4ZJLA 1WF2A 2IMOA 4WE1A 1VR6A 3S6EA 1O5JA 4ZLPA 2MSTA 2UUAJ 3PR5B 4ED6A 1WHVA 4XDCA 2ZBRA 2V94A 4YP3A 4ICLA 2XMWA 2YWEA 1KHWA 2BKPA 4ZP6A 1IBLJ 3EICA 4B9MA 4DF8A 4DN9A 5LSOA 1U09A 4ED8A 1T3OA 1VDHA 1U8SA 3QIPB 5ETLA 1DRZA 2XYHB 2LFVA 1FI4A 3CDAA 3FCVA 3M9MB 4NASA 4LRCA 3N01A 4B9TA 2JX2A 3K58A 4TU8A 4USUA 1ZS6A 1RABB 4YB7A 2RQMA 1VHIA 1GEHA 3GPAA 4AE5A 4DS4A 1S0NA 2C3MA 1PJ7A 3MUTP 3H5UA 2AGPA 4EBCA 1RK8A 4E2FB 3MAAB 1TKDA 4JI5J 3QT7A 3S7RA 4CLZA 1LFWA 2E5LJ 4DV3F 1VS3A 2JWNA 1XK8A 5I3UA 1PBUA 4EEYA 2QZ8A 3ZO7A 3LO3A 3DCAA 4B3OA 3C6UB 4URQU 4BDPA 4ZJOA 3MWBA 2JL9A 1N33J 4LIWA 2RDIA 3LPEA 2DH7A 4ELUA 2CRLA 5AXLA 2B9XA 3QFWA 2A10A 4FPRA 1TKXA 3G8QA 3ICLA 4ZMMA 1TVRA 5MAOA 2FYXA 3OFEA 3FEZA 1MLAA 2A6OA 3L7OA 1BGXT 8ATCB 2ILZA 3JXOA 4LQ3A 2W9CA 3ZZZA 2L3MA 4NWBA 4BWJA 1RKJA 2MPUA 2P6SA 3GG0A 2QGFB 4B9UA 3O2IA 3L95X 2KVQE 2ILYA 4RR5A 3M6WA 1YI2S 3CWJA 4YOEA 2EFVA 3SIPB 2QG9B 3UDVA 1FRXA 1M1GA 2HHPA 1MWZA 2UZAA 2YKNA 4WBFA 3D6MB 2LEPA 2M7SA 1S1WB 2KI2A 2H5JB 1HBMA 1MNEA 1RAHB 2IFXA 3NRBA 1N32J 3W9IA 2EPIA 2DITA 1TAQA 3OR2A 1SH3A 4EZ9A 4O4GA 3J7Z5 1HBOB 1RWPB 3JAMY 2Y3YA 2V2ZA 3TNVA 4H4KA 4LRBA 5KFNA 2YKPA 5D0EA 4ID5A 4U6PA 5LT5A 2Z0GA 3EJMA 3PRBA 2JRSA 2C3UA 4Q0BA 2WBRA 3MM5A 2VV5A 4WFBQ 1D0EA 2IRXA 4C3KA 1M0SA 1OQ3A 4RU2A 6FD1A 2C2KB 1Z4UA 2OEKA 4F4ZA 5KT3A 1LQ9A 4CDIA 2A0FB 1N6QB 3H5YA 4C8ZA 3GE9A 1BE4A 5RUBA 1RACB 4QWCA 4CM2A 3LWLA 2CIMA 5T7LA 3THVA 3I96A 2XMJA 4PQUB 4JV2A 1RAFB 4OZ3A 2I6WA 3IO1A 3LP2A 5CZVA 4NLXA 4ID8A 1NU4A 4WFXA 1AROP 4YEAA 2X3GA 3ZZOA 2ZHAA 1RWXB 3W8GA 2BACA 5CYJA 3ZZUA 5A2QY 5IXUA 4OLOA 7AT1B 4NLTA 2HGLA 9RUBA 1EAYC 4IG3B 5I42A 2AIRB 4RW7B 2UUCF 3SXLA 2R2TA 2KTQA 2CJBA 3O6QA 5BYRA 3JQMA 2XYPB 1RZMA 2NXEA 4O23A 1J27A 3GZ7A 4AT1B 1LW0A 4J90A 3PYDA 1QAXA 3M2RB 2MMYA 3JB9k 3A3PB 4ES2A 3DRSB 2ZH5A 2V2VA 2FLNA 2BJ7A 3VQSA 1TQLA 2Z30B 3H20A 3G96A 3TQ1A 4OHWA 2OSRA 5ETSA 4FXVA 5JUMA 3GV8B 1U1OA 4C8NA 1M5OC 4FF2A 3WIVA 4WP3A 1F9FA 3UN3A 3CMAS 2XZWA 3ET6B 4BC7A 1S7HA 1W26A 3MM6A 4G1QA 1LNQA 2FY8A 2K2PA 3C8YA 1IBMJ 3D3CJ 2JVRA 1Y11A 2RILA 4I2QB 3LGMA 3H5XA 3I0SB 4FN5A 3NGKA 5GAEI 4LIRA 1K1QA 3CEDA 1AZSA 3KK2B 4DL0C 5LJ3Y 4CT9A 5C42A 1B7YB 3IRWP 4C3MA 4I64A 1BD6A 2W25A 2CJ9A 5J2NB 4DU7A 3PYEA 3QJJA 3HHDA 1RDRA 1WTBA 3H0PA 5I3PA 3DGPA 2PE8A 1E6VA 2WB4A 5L1LA 1OO0B 3BGRA 3TAMB 3UQSA 4OYMA 2B4PA 1X9MA 3W1YC 2OPQA 4N56A 4DR7F 3CCES 4DL7A 1N36J 5CYQA 4DWIA 3RB4A 4WFZA 2FJEB 4CLYA 1RAAB 1FRIA 4X62F 2HYIB 4DR6F 3BH7B 4DR2J 3LP1B 2HFSA 1S57A 1LW2A 4DZDA 3J80Y 2FHKA 3DMJB 3OJUA 2WSFC 4CLKA 1FVQA 2H54B 2JLGA 1BWEA 2LXUA 4CQ1A 1WOSA 4OHVA 4XTTA 4YFUA 1JLQA 3V4IB 3VAJA 5GMEA 4NEZA 3CJ0A 4QOTA 3EMTA 3DOLB 2AEMA 2IM3A 2XCAA 3C14A 4FDFA 3I87A 5KFVA 2HNDB 2FPHX 3MTKA 1JLBA 2EFQA 3G2XA 2ADCA 5KFUA 3UNYA 3NMAA 1UA1A 4ZVHA 3H5SA 1R31A 3IS9B 3DHWC 1F60B 3NLCA 1GK8A 2OFHX 3I32A 4IFYB 2IVFB 1KLMB 1VCTA 1CEZA 5JVGQ 2BE9B 3FMBA 5A8KA 4CLUA 2ZE2A 5KT2A 1HMVA 1ZBTA 4G3IA 1S1VA 4C11A 2DO4A 2DGTA 1UW9A 3AA9A 3J81Y 3CO0P 1KQGB 1WEZA 1I1GA 2Z58B 4KTQA 3QZ8A 1H73A 4PG5A 1AB8A 4F7VA 3PEHA 1ZM4A 1VJQA 4DV5F 2QE5A 5KFIA 2A6MA 1MW7A 4JV5F 4JI1F 1RWKB 2L9DA 1BHNA 2J76E 1KHVA 3EPGA 2CNNB 2PT0A 2D3ZA 4PRFA 3M32B 5LOQA 5L1JA 3JSRA 4DI6A 1C0TA 2VQFF 1N52B 3EDRB 2WONA 4U7UK 3E51A 1WNEA 3TA0A 2WW8A 2ZITA 4F4KA 2W7AA 2CQ1A 3K8WA 2PA3A 3W2WB 1U1NA 2NREA 3M6UA 2XCPA 4GRSA 4RU9A 4NLSA 4DSIA 4FP9A 2WVDA 1HR0J 5FLXU 4IO9Q 2BBEA 2RNEA 4JI8F 2OPPA 2QMXA 3IP0A 4KSEB 2FJDB 1DY3A 2RS8A 3ULHA 4Q2LA 1WSRA 2XO7A 4X4RA 1S6PA 5A0YB 5IC6B 2LXIA 1H74A 2IM2A 3MM8A 2DXDA 3FSYA 2EG2A 2RD5C 3CO9A 3FEYB 2GIQA 2RUSA 3R7BB 3QJLA 4P2MA 5D4NA 1D9FA 3EYZA 1S0MA 3Q83A 5H1SV 3OR1B 1R0AA 1Q16B 2CUYA 4A8XA 1S6QB 2CKWA 2XS2A 1FXLA 1HNXJ 2BE2B 2YX4A 3SCKE 3N6NA 2ZM6J 2V8VA 2AEFA 4ECZA 3RG6A 4D3HA 2MKYA 1HHQA 4EI2A 4YHHF 2JC0A 3T1YF 2WRMA 1RAEB 3PW7A 3W3SA 4PXEA 3UD5A 1FRJA 2OH2A 2JFDA 1HWUA 1F1BB 2YNFB 2JC1A 2VQEJ 3SI8A 1HW9A 1PYTA 3RBXA 2BQRA 1AUSL 3BR9A 1LK7A 2V8GA 4DV0F 2RQCA 2ZH8A 1UWBB 4H54A 4Y2MA 5KAKA 2V0NA 3FRYA 2E44A 3VQTA 4B9SA 1RJJA 2MXYA 2D3O1 1OPIA 1RT1A 4K59A 3QMQA 5KG5A 1RT5B 1SC4B 2VG7B 1KLNA 1CJVA 3QAEA 3JYTB 1UVIA 1IKXA 2V2QA 4Z2XA 2Q43A 3FZ2A 4QYZJ 2VFSA 3IAS9 2VDIA 3H2VE 2VPXB 3QJPA 3QSYB 3VGSA 2UV8A 5ETKA 2C3OA 2X7IA 4I69A 1KS2A 1TU0B 2GVDA 1YITS 2CZ4A 1IWAA 3KK1B 3F73A 4IFVA 2F4VF 4QIWD 3NGRA 1S6UA 1R8CA 4O4RA 4LF8J 5F8NA 1KVIA 2DRDA 4ZLJA 1WG1A 4DEZA 1VQ6S 1WDTA 1WEYA 2RRBA 4W98A 2ZNZA 2VBXA 2BDPA 2ZH4A 1RT3A 1TL5A 3GCWP 5HSPA 2OPRA 2NZCA 3ZNJ1 4NYPA 3BJYA 2ROPA 2XLJA 2W9BB 2CYYA 4Q44A 4K0KJ 1KD1T 3AQOA 1KQKA 1DLOB 5KFFA 1T94A 4NLUA 3CT9A 1RUSA 2JEIA 4H4MB 2GV1A 3VGTA 2BOPA 1RT2A 3OTOF 2FD2A 1CULB 2J6SA 4LR7A 3IN5A 4QYZK 4LFBJ 1OYDA 3T1HJ 1KRPA 1IBCB 3GTYX 4HT5A 2K3IA 4DUZJ 5LSRA 2QA1A 2NXUA 4I7FA 3CCJS 1FA0A 4UY85 1PJ5A 1NH7A 2EEYA 3ISND 4OX8A 4CLSA 5ETOA 4KBIA 2ZJQQ 3PRDA 4QZVB 1QLNA 3BQ0A 4PG8A 2FQQB 4LJMA 3QWUA 3GSDA 4U9RA 2FLPA 2CDQA 4QR2A 4JI6J 1S1UA 1A6LA 4RW4B 1HBUB 2Z4PA 3CJRA 2NYIA 3G9CA 2CZ9A 4HVZA 3MPVA 1YRUA 1RTHA 3NOCA 4WYWA 2UVWA 4B3SJ 5DDRC 2GAHC 1HQUB 2FHMA 2Y8YA 4Y28C 4F50A 1VQSA 2X1FA 2MSSA 3MMBA 2XHWA 3V81B 4DJBA 1Q78A 4WKRA 4KHMA 4DR3F 1BMQB 3L4BC 5C2CA 4MYTA 1U1MA 3QT8A 4OYOA 1L5UA 1XN9A 3AJDA 3HHKA 5K8MA 5ETQA 3HKZD 4FF3A 2YKOA 4YY3J 2Y9HA 1DTTB 1WACA 2QX0A 3D0HE 1N8RT 1YG0A 5DQGA 4ECUA 1SQGA 3LUYA 4IOBA 5B7WA 1QVFR 4EU0A 1TL4A 3PX6A 4DV2F 2UXCF 3CJSA 1Q86T 5CHCB 4OJGA 2YKQA 4ED7A 3ELHA 4KHPF 4KO0B 2NXNA 5LMNF 3N6LA 1IJFB 2R42A 2R4FA 2CFXA 3IWNC 1PC4A 2VJVA 3CNQP 4FYYB 3W9HA 4F67A 4YMEA 1PKUA 3WHIA 5K14B 4P9SA 2YWKA 1F3VA 3ZC4A 5A8RA 4LFCF 4QR0A 2VG6A 5KFPA 3TO8A 2EFOA 1ZM3A 3DGVA 3OFGA 3NOGA 1JLAB 1NK6A 1NSKL 2ZKTA 3HK2A 3DM2B 1B99A 4IR1A 2MQNA 1RLCL 3IGVA 4NLQA 4XK8C 2W4DA 3TJ8A 3W66A 4RJVA 2OO4A 2QFJA 4DV3J 2L9WA 2H5EA 3L7UA 1HLWA 2DTJA 2XEXA 1VQ8S 3PEJA 2CQPA 2MB0B 3DOMA 3VV2B 1TL1A 4RW6A 1BUXA 5CCLA 4WFNQ 3MZIA 5AJ3J 2YX1A 1G4CA 2HHHF 3GONA 3Q22A 1FFGB 1U1RA 5J2PA 4LBHA 3DLGA 1ZAWA 2R7RA 4P2FA 3AFGA 3FCWA 1F0XA 2V9KA 1RYSA 2BJ8A 1HD1A 3NBPA 3EUNA 5IV3A 2IC3A 4W90B 2V8DA 4DUYJ 1REVB 1XTZA 2DHHA 1BY9A 3ZTRA 2W2QP 2HHSA 2XNQA 1LWFB 5LMUJ 4GVBB 2CPDA 3UVJA 1Q7YT 5HATA 2V4QA 1UETA 2V8HA 2EI5A 4PKDB 4M5KA 2FJWA 2MZRA 3OV7A 2AX1A 3QT6A 2AKWB 2KKHA 4MFBB 3DRRB 1SH0A 2AQ4A 1IKWA 3EXCX 2UUBJ 1MMLA 2K8GA 1YJVA 2M70A 1K0VA 3C2PA 4M5DB 4ED1A 5HMXA 4O3QA 4DV4J 1IKVA 3S1TA 1S9GB 1WC1A 3R5GA 8RUCA 3OFFA 2BR0A 1ZAVA 3M8SA 2VKZG 4WPAA 2QL5B 5KOXA 3VCDA 1C0UA 3DRXA 1NJYA 2HWIA 3KLFB 3QIPA 2I8EA 3NAHA 1YJTA 3KJQB 2ZHBA 2OTLS 2CJXB 3P8BB 4JI4J 5F41A 4X65F 1ACMB 4HACB 1VC0A 3EM1A 1SUQB 2GQQA 4J9PA 1I51B 2AZ1A 4E98A 4X66F 2WBMA 4DUTA 1ZOTA 4TU9A 1N5YB 3TX8A 4ENOA 3MAAA 2IPOB 2HNYB 3GMGA 1SKWA 4CCHA 5HMWA 4NI2B 3X3UA 4KGXB 3NNAA 2A1BA 2J9DA 2DR5A 1JLEB 3QT5A 3DLBA 4RL1A 4USMA 3ZNUA 1S48A 2AEJA 3W60A 4ZP9A 3PTWA 3KHLA 3MF5A 1N88A 1OMSA 1U45A 2RSQA 3MD3A 4ZHRA 2LECA 1CJTA 2FY1A 4FKYA 4LFAJ 1IXKA 2AJ1A 2HBQB 1U2CA 1YJ9S 4LF4F 1QJHA 1WOPA 5L8RC 2IHR1 1HWKA 4M5JA 4L3NA 3D6HB 2YXLA 3UDCA 3BSOA 4C97A 3B8HA 1RT4B 1TFWA 3M1VB 4I6AA 3TUIC 1GXUA 4A8QA 1RLDA 2DEIA 1B70B 1HPZA 3NWRA 1WKJA 2MLZA 3ZZPA 1X5TA 4OYWA 1RHMB 2EBGA 3AJ1A 1VC5A 3HHLA 2J7WA 4CH1A 2FTRA 1YBUA 4CNZA 1KQSR 2GA7A 1YRXA 3R5BA 4E0DA 2KJVA 3T5HA 1X9WA 5BYSA 2I1RA 2P9EA 4QW8A 2VH7A 2YKMA 2ZKUA 3U1MA 4AQYJ 5ETNA 5EUHA 2K7JA 2V8PA 1ROFA 3MFIA 2K3KA 2UXBF 1S1WA 3UDLA 2J7KA 4PXCA 1IM4A 2DEJA 2J8AA 3CCSS 1F2GA 2G1HA 2HGNA 4ED4A 1HNIB 1RHJB 2M3DA 1WD6A 1VQ4S 2I38A 2HVEA 2CQGA 4C6AA 4DR7J 2KFNA 3LW5C 2ZOGA 3DLLQ 3GP9A 4A8SA 4TN2A 4DN0A 4BS2A 2L9NA 4X62J 1CS4A 3DLEB 4DSFA 3BN7A 5KFTA 4ZVFA 1NK4A 1N6QA 3C15A 2F8EX 1FKPB 2CQ2A 4X4SA 5ITHA 2WOMB 3PRVA 4RNMA 5HVHA 3DFEA 3U27A 1R43A 4PWDB 2KM8B 2GC8A 3TUJC 2DNQA 1K73T 4Y2AA 1DAXA 2H51B 4NA3A 4WXOA 1N56A 1XQIA 3MR2A 2IDLA 2IJFA 5DG8A 5KFGA 4IG3A 1BC6A 4FVMA 4RW7A 4LF1A 4ZPTR 2W4PA 4IDKB 3L7PA 1CQMA 5HANA 2B9YA 2NLWA 3DDNA 1RT6A 4ANEA 2E7VA 3D1QA 2ASDA 2M88A 3BGUA 3M2RA 2E1RA 3KMQA 5GAHI 4FBTA 2CNOB 1U25A 3GYNA 1R0CB 1C1CB 1F5CA 4ED0A 3OL9A 2CPZA 3OL7A 2NQPA 1BLUA 3LF0A 2DGVA 2I9SA 1RA6A 5IT0A 4QWAA 4UW2A 4WXWA 2BYCA 3HT0A 2MJUA 5L9NA 3BEGB 2OPSB 1EJ7L 3ILLA 4B3TF 2VQFJ 3D0GE 3VVUA 4EYIB 1NHUA 2CQ4A 4I2QA 1TL7B 1N5VA 4ZLLA 4LF5J 1Q4RA 3VAKA 3IBWA 3I0RB 3KK2A 1B0TA 5IC4B 1A7GE 4CM0A 4LSLA 3FQLA 1S1TB 2UUAF 1ZH5A 3WBZA 2NS1B 3J81j 1UWAA 2WB1D 4DQSA 2ZH9A 3GFZA 4OZLA 4OIXA 4UQTA 4ETZA 4QIFA 3CJKA 3PR4A 4ZPCA 3SDEB 2R7UA 2B6AB 3TAMA 2B51A 4F4YA 2VBWA 5CD4H 1M5VC 1AT1B 5F8LA 4BCAA 5F8GA 3QQCD 4CLPA 1GMVA 5DRKA 3QWPA 3RAXA 3IRXA 1IQTA 2MEWA 1IR0A 1Q8IA 1HI1A 4GC6A 3LQVA 4C48A 3GCXP 5AE1A 4JI5F 2EVZA 2P9CA 4V1Ak 1NDCA 2E5LF 1YHQS 2G2YA 3CDUA 4P75A 4XO0A 3FFIB 1SVDA 4IH6A 3KJVB 1F9EB 3V4IA 2QMUB 4JBCA 2BJ9A 3GFHA 2YPZA 3DOLA 2POKA 1VGYA 4DZ6A 1VJWA 2HFOA 1N33F 3BSCA 2HNDA 1FX4A 2XTJP 1VISA 2HK2A 1R6VA 4N8NA 4X4QA 4C0OC 2H9ZA 1I3OB 1N0VC 2RHSB 3IS9A 1FJ7A 4IFYA 5DDQC 5J2QB 1KLMA 3UNGC 1S77D 4QIGA 3GB0A 4F3QA 3I5CA 4CZCA 4J9QA 3CDEA 2XS7A 1X5OA 1TK5A 3MMAB 3EXYA 2R7XA 1T3NA 4KE5A 4J9UE 2CG4A 1TKTB 3NCRA 4ZCKA 2JEGA 1KDNA 2KT5A 4F2RA 3PV8A 5FJ4A 2MLYA 4RNHA 3U1LA 3SV3A 4Q43A 3DLHA 2KYZA 1JKHB 2DBBA 3M32A 3TAPA 3EVOA 5C24B 3QRQA 2AT1B 4ECTA 4HDGA 3M8PB 4CP5A 3R8YA 4I2PB 2SXLA 2VOPA 2J9EA 4TQRA 3D54A 3LTOA 4ES3A 3ZTPA 2UVVA 4F3OA 3C66A 1N32F 4CWBA 3UO0A 3W2WA 4TYAA 2OD4A 1SB6A 1QAIA 1S76D 5HL7Q 3IG1B 1RU2A 2ZFHA 2VHGA 4B08A 1P8GA 2ZZTA 1G6BA 3V6KA 4IKAA 2QO3A 3OQ2A 2EW9A 4NLGA 4NL5A 1RB0A 3GJQB 1CJUB 4XAKA 3H59A 1EARA 1RTZA 5KFBA 1SC1B 1YZ6A 4NRUA 2GIRA 3MOZA 1JXVA 4O44B 3UWTA 2YQ1A 5DGAA 3V4MA 1H98A 2KXHA 3V6HA 4UF4A 2J0SD 5AE3A 4J9SA 3CCVS 2ZC3A 1Y5IB 3UDEA 1RQ0A 2DB1A 4QW9A 5DM6Q 3PVXA 2ZUAA 2GHVC 3UD4P 1A0OB 3KWMA 2B5JB 1Q5YA 3PKYA 3D7SB 1RBAA 2R8IA 1S6QA 3OTBA 2Z2MA 1SQEA 3BBBA 3CC4S 4NCBA 1HNWJ 2BE2A 2KZZA 2QMWA 2XGPA 3A13A 3G82B 1AYEA 3EX7B 2ZBPA 2WSCC 2HEKA 3BR8A 2BM0A 4HKQA 1T11A 2VPYB 4HTIA 2AV5A 4B9VA 2CDRB 3RB0A 3ADAC 4QIVA 2ATCB 5E5NA 1U02A 1UWBA 4P10A 3TVKA 4OJ1A 3GLJA 1XBWA 4OZ5A 4RW9B 3UN5A 1YIJS 4O0NA 5CH7B 3CMQA 1D8ZA 4J37A 1RT5A 3IR5B 2UUWA 2MY7A 2VG7A 3ENAA 3KLVA 2NUUG 1SJ1A 1IBMF 2LQ9A 1EHWA 4NLYA 1U24A 3WX8A 1LWEB 2EFGA 5EX3A 1YX2A 1X4FA 1ZPVA 1IJEB 5CA5A 3BKFA 1ZA1B 4GO7X 3BDPA 1VQNS 4RBTA 4OX9J 4NOHA 2MKSA 2J0WA 4Y34A 1P27B 2LEBA 4F8RA 4JI7J 3K7RA 3THPA 2DNRA 4NLWA 2H65B 3FEXB 2R7WA 4C98A 5B0FA 2UXCJ 2HWHA 3BF4A 1TMMA 2XWYA 3RZAA 3KLGB 1IVZA 2J8SA 1X4GA 1N36F 3D6FB 1GQEA 2KHCA 4KR0B 2KM8C 5LXRA 4DR2F 2IVMA 2LVWA 4AFFA 3VAMA 3QFHA 3NKYA 3Q89A 3PJWA 1DLOA 4YN3B 9ATCB 4X4TA 3A8JA 2ZNYA 2XY6A 2O5DA 1Y7PA 4ANCA 3VZHA 4P6QA 3BO4A 2KFZA 1CULA 1K47A 3KNGA 3N0VA 5LJ5Y 1IKYB 1W7WA 3G86A 2DNLA 5D4OA 3DNCA 4P2SA 2KXFA 4ZPBA 4NZ7A 1JXLA 1SKSA 2NPFA 1U26A 4DSKA 3NL0A 4CT8A 3W8PA 4CO5A 2JZ5A 3BBCA 1ZA2B 4DSJA 1U0HB 2GJFA 2D1CA 2ZH6A 4A8WA 2DRAA 2F9JA 3MR3A 1FXDA 5F8IA 1CJKB 3HJFA 1NK8A 2RU9A 5IT9U 2B4UA 4NLOA 4L3KA 1WKKA 1KR4A 5JXSA 3SQOP 4X4OA 4RW4A 1HBUA 3QIDA 3P45B 1RKIA 1YVFA 3OVSA 4ZVRB 1BQMB 1KONA 2FVCA 3EVMA 3CDBA 4LF2A 3W65A 4UQGA 4WFAQ 2VPZB 3MDFA 3KK3B 3NNHA 3PFOA 3TZXA 3A4TA 3V81A 2WW4A 3J7A1 4I67A 3ENQA 2FZGB 2Q3PA 2DR9A 4BWMA 1D09B 2KT3A 4Q2MA 4P73A 2JNJA 2B9EA 2CPJA 2CJKA 4IO1A 3PW2A 1P1LA 2V6AA 3ITHB 3HVRA 2RB7A 1S72S 4KHRA 5KFQA 3OL8A 4TU7A 4ZK7M 4A8YA 1ZM9A 4PWUA 4BBYA 3U7JA 3NY0A 2WHOA 2HLUA 4Z7CA 1MWYA 4X2BA 3J7ZT 1VBYA 4ZP7A 4RZRA 2E29A 1N5QA 4KO0A 3NGUA 5CABA 3HPOA 2AWZA 3ZTSA 1NB7A 2COLA 1YKWA 2FVRA 4ZVEA 4LQ9A 1SC6A 2KJWA 4L73A 2FZCB 3BV8A 2LDIA 1PJ6A 2P9GA 3AD7C 3G8SA 3QRRA 2ZBCA 2M9KA 2HHTA 1HNXF 3SQGA 2XS5A 4DR5F 3ETOA 3BN4A 1FTCA 2ZM6F 3KHRA 3QGGA 1KSPA 3DM2A 1QD1A 1S12A 4A47A 1WC0A 2IA0A 2IVYA 4CH7A 1SJRA 3GWCA 2PIIA 1OIAA 3G87A 3RB6A 4Q45A 6FDRA 3RBDA 4CNYA 4DPYA 5J1PA 2DHGA 4DL4A 2VQEF 3TYTA 4NLRA 1W2IA 2HHQA 2V5HG 3W63A 4LRFA 3P4UB 4HH1A 1X5SA 4URSA 1FJEB 3N6MA 3OTCA 4LF4J 1Q79A 1OSCA 3K5NA 3O44A 1ITPA 1D9DA 3IC1A 4CTAB 1J5OA 1Q81T 2FC9A 2CQDA 1REVA 3R5CA 4R8UB 4MK9A 4K4YA 1VLYA 3HSDA 4OI3A 3GIMA 4ED3A 2DNZA 2GVZB 3I5AA 4CI0B 4JOUA 1U1KA 2ZVSA 1HI0P 1B64A 2O01C 1FK9B 1LWFA 2HS0A 3D2WA 4GVBA 3V6DB 4FXDA 1HD0A 2MTLA 1QSLA 4RUBA 3KUEA 3RGIA 2WTFA 2W1BA 4DR1F 1VIXA 2ZBQA 5F8HA 3FMWA 2DGUA 2MYFA 1MROB 2GQ2A 3MEGB 2F1FA 3HXMA 1E6YB 4MFBA 4LSNA 2C28A 1NRKA 1SKRA 4KYZA 4RWWA 1GXTA 5AXMA 4F36A 4WE1B 1M5HA 2FLLA 3M8WA 1X9SA 4C3LA 4QPTA 3M9NB 3DOKB 2J0QD 4K0KF 3MM7B 1S9GA 1TTHB 4P7TA 3JAMU 2G0JA 4ICLB 4PWWA 3C19A 3TUPA 5EDWA 1OSDA 1QVGR 3VR1A 1APSA 3LP0B 3QZ7A 1Y3KA 3KLFA 4TVAB 5A8WA 2JDJA 5D8HB 2V50A 3GJRB 4LFBF 2V4RA 1LV5A 2GMHA 4XDDA 3N5BA 3NGTA 3T1HF 4JB8B 3OTDA 3D28A 1WJ9A 3SMZA 5HN0A 4JI3F 3AD9C 1SUQA 1JQGA 5HBMB 4DUZF 4O3SA 3NGDA 4DL2A 2ATLA 3K8VA 1H7XA 4ZVQB 1N5YA 3PHTA 4UZBA 2HNYA 2N4DA 4NRTA 4C0HA 4NI2A 2AGOA 2HFNA 2AHOB 5E7OB 1VK3A 3KDNA 1JLEA 5ETVA 1FX2A 2DCLA 3EZUA 2RH3A 3EGNA 4F02A 4B3RJ 2R9LA 1SJ4P 2OIHA 3MM9B 4K4WA 2N7YA 1TUVA 4BLGA 3SSRA 2VFTA 4RO0A 3TR5A 4QWDA 4USVA 5IWAF 3LGHA 2CQ0A 1VIOA 1RT4A 1J2VA 2GJIA 4PUOB 2DNHA 4NA1A 2I5JB 4WZQA 3THTA 1S10A 4Y65A 2DK2A 5JVHQ 2BJDA 4K7QA 1JJCB 4YY3F 1XIQA 2BM1A 2XMTA 1OPZA 1GTEA 3RW6A 1CSJA 1NO8A 5L1IA 3CD6S 1OJ4A 4ILMA 4GMKA 1RP5A 3EZOA 1KOHA 2ADBA 4ZLNA 3CIZA 3AH6A 2V69A 4AL6A 2QL7B 4CO0A 2YKNB 1X7VA 2IRYA 1ELOA 4K4UA 2AD9A 2FJVA 2VZ9A 2DR7A 4QIEA 2AP6A 1NJZA 3OR2B 3TEGA 4NA2A 1XEZA 3N5FA 2DGXA 1EETB 5DM7Q 4ATNA 1FD2A 4CYUA 2VF3A 3IR6B 3HKWA 4X64J 4ID5B 2O66A 2F40A 4QBUA 2GJ2A 5T41A 3MM5B 1EX8A 2PO4A 3PJXA 2BA9A 4KKOA 5K8NA 3R97A 3CSKA 3PW4A 1LXJA 2HW3A 2BVZA 3SSSA 3J80U 3TARA 3QPIA 4KB7A 1FKOA 3K5PA 1FKPA 1JB0C 5DLGA 5KFCA 2WOMA 2N4CA 4AYBD 3GV5B 2HRTA 3AB2B 5AJ3F 4PWDA 2G0IA 4USWA 4MKYA 4O0IA 3M2VA 2YH0A 5F9NA 1VQOS 5HMYA 4A8OA 2DGOA 1XNQJ 4ZVOB 2PI5A 3RW7A 3I6PA 1NKCA 1R8PA 3KLIA 4MK7A 2NSBA 4JI0J 3B4DA 4DUYF 1JXEA 2G4BA 1S97A 4LMZA 3H4BA 2K1RA 4IDKA 2Q6BA 5GAGU 2E1CA 3WC2A 1LW0B 3BYRA 5DDPC 2YWGA 1NAQA 3J81U 2GW8A 2NCKL 4PPDA 1DQ9A 5LMUF 4NYOA 2IDEA 5KT4A 3KJNB 4U7CA 1EZZB 1LXNA 1C1CA 4Y0FA 2CXEA 2ZEJA 2FC8A 2XYGB 3HVTB 3DRPB 4R5PA 4G1QB 1YK9A 2ZHOA 2FHOB 3FGVA 4QQBA 2AGQA 2HHVA 1FJGJ 4UT4A 3T5LA 3GIKA 5KFZA 1FRHA 2OPSA 4YB6A 4KRWA 4PYAA 3CC2S 4MKBA 1TL7A 3RBZA 2UUBF 4MTPA 4QJVA 1VQ7S 3QGHA 4RUAA 1GMUA 4AL7A 4DV4F 2AJ2A 4MMOA 4MJKA 5FD1A 3I5BA 2LU1A 5HP1A 4TY8A 1S1TA 3GYXB 3SCJE 2APOA 2KT2A 4DFKA 4KGMA 3QBCA 3E01B 5DG9A 3UPFA 2BRLA 4LSZB 1SXLA 2BANA 2D69A 3SDEA 4GKJJ 3TZYA 2B6AA 3CD5A 3PXGa 5CYMB 2B56A 4LF6J 5FDLA 3POTB 1R8AA 4JI4F 4OYPA 2R7QA 2QLWA 4ZVUB 5CYQB 4ETXA 2R3VA 4PCQA 1SKUB 3ISNC 3LWMA 4DXLA 4DMZA 3QAUA 1LW2B 1WSVA 5DETA 1I5OB 3DXSX 2FZKB 2G0CA 3G6YA 2C42A 1V3RA 4IOAQ 2DR6A 1RYRA 4J7CA 3T41A 2BUNA 1S0VA 2AW0A 2E9TA 3NMRA 4UZCA 5IT4A 1JLQB 3FFIA 4CO2A 3G8TA 1RAGB 5D3GA 2DNGA 3C16B 1UVLA 1EQ0A 3O5TB 2X1AA 1JLBB 3PNIA 3PKMA 4LFAF 3K89A 1T05A 2MKJA 3MR5A 2AYMA 2MHNA 1S4EA 2CQHA 4NPOA 1SI9A 4EO8A 2Y1LB 3MMCB 2KHDA 2R2RA 4IOCQ 2H5IB 5A8KB 3CCMS 5J2QA 1WHWA 2ZE2B 4QR1A 3O3LA 4W4MA 3H40A 1S1VB 3Q24A 4C11B 1WKLA 3A3OB 1RI7A 2IAJB 4WFYA 3MMAA 2VB6A 5U47A 2J0XA 3T6JA 3LANA 3UCUP 2IRUA 2DIVA 1LFPA 2QL9B 1P9YA 1IN0A 3RBEA 2L41A 2QRRA 3I4PA 2HVZA 2Z2ZA 4S0MA 3ZTQA 3TA1A 3K5LA 1N48A 3HFVA 5C24A 6AT1B 4ZDNA 4B02A 1TKZB 1C0TB 4D3GA 4AQYF 4PG6A 3M8PA 4EGLA 2A2CA 2E9ZA 2MLXA 3ZZ0A 1Y4ZB 2OEMA 3K59A 2VBYA 5HVGA 3T9ZA 1K1SA 5C2GA 1KVJA 4ZVPB 3IM9A 1YJWS 2Z57B 3HM9A 4A4JA 1RAJA 4OYIA 2DCUB 2IYGA 2OPPB 1SQFA 4F4AA 1VI7A 2AJ0A 5J1EA 4DPUA 1MU2B 3W5YA 3DXBA 3M6XA 4L75A 2UU9J 2W7OA 1S6PB 1FDDA 3TZWA 4HEA9 3UCZP 3EVWA 5IS2A 8AT1B 3L9ZA 3KLHB 3MM8B 1YBTA 5H9FJ 4O44A 1S5ZA 2L48A 3MEDB 4G65A 2B4OA 4OZNA 5MLCV 2KU7A 2DRBA 1WELA 2RDDA 3RTVA 3PG9A 3EGZA 1IUJA 4DFMA 1RTJB 1R0AB 1JLCA 1RWWB 1F3FA 2RQ4A 4WWSA 2VIHA 4NLDA 5LXYA 3JQJA 4TY9A 4WZMA 1YSJA 2C2MB 1YJ7A 3C3LA 2QYCA 1DHMA 2JLEA 1C1BA 3DC2A 1PAEX 2Z2YB 3FBCA 3G6ES 2VBZA 4C8LA 2LCWA 3HLUA 1DQ8A 3PO5A 3KHHA 2DY9A 2C1EB 1N5TA 2OUGA 4X4VA 3CW2C 4ECRA 4BC9A 4RW9A 4F0MA 2W8LA 2QIFA 2DNMA 3FKBA 2LDYA 1MSWD 3VWSA 4YR2A 2YNHB 2ASYA 2QA4G 2KDOA 1SV5A 2HQFA 5AE2A 1FKAF 2EK1A 5H9FK 4DDFA 2YPYA 3BH6B 2VICA 1F5BA 1VBZA 1RHRB 1TL3B 1G7CB 5GVQA 2D9OA 1Q8BA 5HLFA 3LALA 1ZPWX 4AXJA 2R8GA 1JJ4A 3MECA 2NR0A 2Z56B 2MKIA 1LWEA 5I3QA 3BPDA 2E5HA 4H4KC 4K8RA 5L38A 4LF5F 3AQPA 3UCGA 1FNXH 4P52A 3GR1A 4HHHA 4LRDA 5LL6d 1S9EB 5E0OA 4KV8B 4IRKA 1KN6A 1PILA 3R9LA 3TQEA 4RBVA 5D77A 4L72B 1S1XB 2RJZA 2BABA 5HQ8A 3K17A 1JLFA 3ENWA 1QSYA 4MIWA 2KO1A 3QYYA 4OHZA 1JJ2R 4MIBA 4H4OB 3EPIA 1QTMA 2DR8A 1RT3B 4J9OA 3KLGA 4ERDA 1QUPA 2UP1A 5HJXA 3R1HA 2YVSA 2HURA 4LUBA 2E9RX 1FT8A 4HHUA 1C4CA 1T9TA 2ZD1B 2BZ2A 2V2KA 3HT3A 1H2VZ 1Q1KA 1UFKA 2W2PP 4JUZA 1LKZA 1RT2B 2LQ5A 1B0VA 1Q8KA 1SCJB 2V9WA 4DR5J 1NCLA 3PIOQ 1YBAA 2GS8A 4WCEQ 2RRAA 1UVNA 1X60A 1R27B 4IR9A 3ONQA 4MH8A 5LSLA 2PA8D 2KRBA 4DG1B 2HRYA 4I7FB 1C2PA 1MG7A 3W2VA 4K50A 4ALZA 2IMWP 2AYEA 4OI0A 4HH0A 3CJ8A 4OZ0A 1U0HA 5G0RA 4I4BA 3IMQJ 4OI2A 2AYGA 1L3KA 5CAAA 4HI2A 1CJKA 4CIOA 4DU8A 2XG8A 2A3JA 5LM7E 2PFFB 1S1UB 4GC7A 1UAWA 2ZVIA 3P3DA 4N47A 2GO9A 2ABYA 3OLBA 4FYVB 4GKKJ 5GMKa 1SIWB 1FESA 1RTHB 1HW8A 2JSXA 4OI4A 1H0HB 1RWUA 3MGJA 4ED2A 4R25A 3MMBB 3FVYA 2OMOA 3KK3A 2JFKA 1VQ5S 5KFJA 1ICEB 1I94J 1XNRJ 5K20B 4N76A 1NKBA 2IYIA 2JH3A 4OV1A 1HYSA 4DR1J 2B9WA 1FHTA 2CWKA 4GO5X 3ITHA 3H8YA 2H3EB 2XB2D 3QLHA 4KH0B 4WU2A 2HNZB 1ZAXA 3TAQA 3MEEA 2XY7A 1N4LA 3D1HA 1VQPS 1Y3JA 3QATA 3J7YI 4ZCLA 2D74B 3D67A 1KTQA 3BQ1A 2YQ0A 4DOZA 1GMWD 1BQXA 3VHQA 2I0XA 2CPFA 5D0GA 1B4SA 1RBOB 2HBRB 1UJ6A 3IA0A 3PM9A 3K5MA 1VMBA 3HZEA 1G1XA 3FUYA 2ROGA 5A8RB 2VG6B 1N34F 5EN1A 1GMWA 5IOLA 4KAIA 3FNNA 5HAOA 1D1UA 3TANA 2LYVA 2XMAA 5EGYA 4JI3J 1UEKA 5EWEA 3T5JA 5ETRA 3GQCA 1HNWF 3AXMA 1RAOA 4I68A 2B8QA 4DQIA 2MDAA 2C2DA 2P6TA 4EK2A 2MKKA 4P71A 3GJSB 2XO6A 4ECVA 3HD2A 4K2JA 2HIYA 3M8QA 4RW8B 2O3DA 3OXGA 3M8YA 2IIHA 4WP9A 2OGUA 1TL1B 4QU6A 2F65A 1WC6A 1YJUA 2OMLA 3SFGA 2IBOA 5EX0A 1QAYA 4AD6A 4PG7A 4DCJB 5J2PB 3QSIA 3FDSA 5G4DA 4CO1A 4CH0S 1WG4A 1SPBP 1T03B 2E7XA 1NPKA 3NBPB 5IWAJ 2IC3B 2YNIA 2QN6B 2ZDPA 4RKUC 2VASA 2MZQA 2HZAA 4QYRA 2DO0A 3P5BP 2GVZA 3BGFA 4E8UA 5M2RA 2VFUA 1VRTB 1HQEA 1H3DA 4PG4A 1X8DA 3S8SA 3OHBA 4NMLA 2FUG9 3V6DA 4ES1A 2VL1A 3MAHA 4OX9F 2DPIA 5DJBA 1HWIA 4JI7F 1Q53A 1NK5A 2NYHA 3Q8UA 2EKNA 1SBRA 1T7PA 3MEGA 4HI1A 1V5VA 5D6GA 1JJHA 2J5AA 3CC7S 3DYAA 3AXKA 2U2FA 2V67A 3OFHA 1W2BR 2CA9A 1FRLA 5BR8J 1IKVB 3T19A 3DOKA 2XGQA 4DV1J 3I9ZA 4G6VB 2DNNA 3CCLS 2NPIA 1HBNA 1HHTP 1KNZA 3MM7A 3GSIA 5KOWA 3US5A 4ELTA 1C0UB 4K4XA 3FZBA 3LP0A 1GFWB 2D3UA 2X3DA 1RT7B 3IGNA 3U1NA 1R8HA 4YB1P 1SL0A 2M0GB 1JMTA 4C9DA 2VJUA 2NXCA 4NZ0A 3OXFA 5EHHA 5F0WA 3MPWA 1WWHA 3DDIA 3NXZA 3WZ0A 4NXNJ 2MZTA 3KUHA 5HBMA 4WK1A 2HAFA 1KEKA 3SV4A 3NG8A 2F63A 4YDDB 3Q8QB 2QEXS 4XPCA 1CLFA 1U2FA 4Y3CA 1RTDA 2HLTA 4UOCA 3VF0B 2FLOA 5KFEA 1OQ6A 3GV7B 3MHYA 1SL2A 4CO3A 3MR6A 3EGVA 3M2UB 2DGQA 1CBKA 3K0JA 1QM9A 2ZH7A 4OJ3A 4ZHRB 2RS2A 3UFCX 1CJTB 2ZJPQ 4ZVGA 4PAAA 3BSNA 4IG0B 4KGKA 3AA8A 2JVOA 1VQLS 1VQ9S 3MTJA 3MM9A 1UJ4A 2CPXA 3H2UB 5KG6A 1Q95G 5A76A 2EFNA 4OX6A 2AYBA 1WEXA 1FWLA 5KFAA 5KFKA 3BO3A 4PYDA 3MI7X 1CC8A 4CLWA 1HPZB 4ZPDA 4FYXB 4PUOA 4ILLA 2FVSA 2DGSA 2C2NA 2I5JA 4ED5A 1X31C 2HQIA 1X4CA 3B54A 1LEOA 2YY3A 3HHLB 3KYLA 2NUHA 2BEFA 1Y5LB 4I1TA 2W7PA 2CVEA 4RWXA 4EO6A 3RYLA 3Q2SC 3DLKB 1X4BA 2G13A 2YKMB 3HVAA 1H2TZ 3RR7A 3EE3A 4NCGB 3JSBA 2KVIA 3LA0A 2UXDJ 3JSYA 3DN9A 5E3QA 3RUBL 1FWKA 1YRTA 3PX4A 4N8OA 4FF4A 1HARA 2DY1A 1WI6A 1EETA 1O51A 2H4YB 4ZJQA 3AT1B 4Q7AA 3QO9B 1V3SA 1HWJA 5KTQA 5GAGI 3C46A 3V5RA 1HA1A 2J9DE 3ZZTA 2B43A 3MPYA 1KC8T 1CS4B 3MUVP 3UR3C 1MN9A 4ZN1A 1M90T 2VONA 1CG2A 3LAMA 4UUXA 2FJXA 2XM3A 1EIYB 3C15B 2LA6A 3K2YA 2YH1A 1SC3B 1PYSB 3MMJA 2LKZA 2VU5A 3FK4A 2FVPA 2M8HA 4ZP8A 2RQKA 3JTPA 1M5PC 3M05A 2DGWA 3C6UA 3MPUB 1KKHA 1HKAA 2RKIB 1EQMA 4J9RA 1DQAA 1FE4A 3EDQB 5HJYA 3BYPA 4WK3A 3V6JA 2ASLA 2BX6A 3QGPA 4NMXA 3PFEA 1FE0A 2ROEA 3A8EA 3PYFA 1YJRA 1GTHA 2RF2B 2C2RA 5K9FA 3KOAA 4Y2KA 4ER8A 4K2XA 3M8ZA 2KG0A 3RAQA 5DGBA 1U1PA 3OL6A 4NE9C 4NXMJ 2BRKA 1RT6B 1U1LA 1N0UA 3CJ3A 3EWGA 1P6TA 2HG4A 2Y1IA 3Q8RB 3GFYA 1RHUB 2Z2LA 5B0EA 4PEOA 2LLZA 4J9MA 3LAKA 2P2CB 4C8OA 3NCPA 2DT9A 1K44A 4TNOA 4LR9A 3ZTOA 3BO2A 3HVTA 3DRPA 3CDWA 3OT9A 4M95A 2DH9A 1FDBA 3H90A 1NSAA 5DQHA 4R0JA 2V4JB 3M8RA 3BQ2A 1U47A 3VAIA 5DG7A 4IYQA 2WZ1A 4OJHA 4LSLB 4DQPA 2LXFA 1HBOA 1T9UA 5E3PA 4LT6A 3HDSA 5DDOC 2HQCA 4OMFG 3CJKB 3E01A 1XMQJ 2WVEA 2F8HA 2C2EA 4PXDA 4IRDA 2IM0A 5J2MB 2HZCA 1L3TA 2CJYB 5CYMA 4TLRA 5GAHU 3POTA 2XSJB 4JI2J 2AMCB 3RRKA 2WVBA 2KFYA 2OFGX 2JEFA 2GNKA 1QE1B 3H42A 3IRXB 4I0WA 2E5JA 1TELA 3D9BA 3R1LA 1ZTWA 1NHVA 4MKVA 1NJWA 1NMEB 1NDLA 3PYGA 1SJ3P 3NEKA 4PQUA 2F5GA 1BQNB 3A8KA 4OFZA 2XMMA 4F4WA 3GG1A 2JJ4D 4B9LA 5M2UA 1NPRA 3D0IE 5E3RA 3C16A 3ISZA 3QGIA 2OI2A 4B3RF 2AJ4A 2N7CA 4ELVA 2NZ4A 1PG5B 3AD8C 2K06A 1L3UA 3HJVA 4USTA 1CQNA 1G3OA 3MMCA 3B6BA 3J7AN 2QA2A 2ZBIA 3Q8PB 3KXDA 4B3MF 1RWVB 3DRSA 4N7TA 1ZETA 2IAJA 5DQIA 1RGVA 1Y10A 1VRQC 4KQZA 5BYQA 3ILOA 4DX6A 4DSEA 3ET6A 1EP4B 3E2EA 5IV4A 2EC0A 2R7VA 2QLJB 3M4XA 2KL8A 1U7LA 4HLBA 5CD4A 3VAGA 3R7SB 2X1BA 5KFHA 2IJRA 3I0SA 1NLKL 1TKZA 3KJFB 3IAM9 1K9MT 5C25B 3OD2A 1TUWA 3PY8A 3CCZA 2RIJA 4XIUA 3TUZC 1L3VA 5J2NA 1KFDA 4HHJA 3H25A 3HFKA 5HI7A 5D0HA 4DL5A 3HVWA 2Q66A 2J6TA 3OVBA 2GAGC 1XMOJ 3HSJA 4DLGA 4NX9A 2GX8A 4RBUA 1OYEA 2E1AA 1NPPA 4UUWA 5KG2A 2PFDA 4X64F 1WC3A 3AAWB 1T9VA 3R6LB 2W24A 2HFZA 1UJ5A 1MU2A 5HO4A 4DL3A 2NXJA 3F0NA 3R6GB 5DO2A 1X4DA 5AXNA 1NXIA 3RRHA 3GIRA 4KY3A 4WJBA 3KLHA 3LP1A 3H7HB 1M1HA 2XQCA 2AF6A 2YKAA 4C2MA 3CTRA 4KFBB 3CVKA 1HNZJ 3DMJA 3MEDA 3SYZA 1OWXA 3HD1A 1WTFA 1Q8LA 2HKEA 1NB2A 4A46A 2CG8A 2KB2A 1RTJA 2MY8A 2XWXA 4AXIA 3JTOA 2RAQA 3TEHB 1JNZB 4C0BA 2KH9A 3OVAA 5E2QA 1H7WA 1XNQF 4V19J 1KWMA 1RADB 3OJSA 1UZHA 4J9NA 2HHXA 4DPWA 4DPTA 2CJQA 2E66A 3A12A 4U67Q 3M30B 4RNOA 2PMZD 4JI0F 3OSNA 4YQWA 3T5KA 2RDJA 4NLVA 1X0FA 3HHLC 3RRGA 3TI0A 2DD8S 1KFSA 4L6V3 2QLBB 4JV1A 1RISA 5A6WA 1UP1A 4WTYA 4DSLA 4M5LA 3MEKA 2FIUA 2EFPA 3Q23A 3RAMA 4ZVTB 1H2UX 3IM8A 5KFMA 2YNHA 2AZ3A 4DHVA 3HMJG 3A1YG 2QJ3A 1NDPA 2QC3A 2CNKB 4M63A 1FJGF 4RX6A 1WORA 1XERA 1TL3A 3Q2TC 4EFAC 3R5AA 1MWQA
chains in the Genus database with same CATH topology
4QYZK 2Y8YA 4DZDA 2Y8WA 3QRQA 5H9FK 5H9EK 5CD4A 2Y9HA 3QRRA 1WJ9A 4U7UD 3QRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QYZ K;  2Y8Y A;  4DZD A;  2Y8W A;  3QRQ A;  5H9F K;  5H9E K;  5CD4 A;  2Y9H A;  3QRR A;  1WJ9 A;  4U7U D;  3QRP A; 
#chains in the Genus database with same CATH topology
 5B0A A;  2LQJ A;  4HR2 A;  3VAF A;  2VPW B;  2F4F A;  4TKT A;  4USH A;  1FNO A;  1LWC B;  4RLE A;  3OUY B;  2DYA A;  4OHY A;  2WVC A;  3CUN A;  3MFH A;  1S9E A;  4EZ6 A;  4KV8 A;  2CPI A;  2HZV A;  2XNR A;  2UVU A;  5KFW A;  2P5V A;  1U0S A;  1WI8 A;  1S1X A;  3U02 A;  1AFI A;  2XUL A;  5KFS A;  1DFD A;  1UCN A;  2VD3 A;  2HWT A;  2R7O A;  1WUU A;  1F9H A;  4DV7 J;  4NCA A;  2H1Y A;  3TRG A;  3AOD A;  4LF7 J;  2ZUG A;  4GKJ F;  3KNA A;  4LF6 F;  4H4O A;  5A0Y A;  2MKH A;  4TLQ A;  2KRR A;  1U49 A;  1YZ7 A;  2OSQ A;  5KT6 A;  5HMZ A;  1S79 A;  4P2X A;  4F04 B;  1MMD A;  4YUD A;  4L76 A;  2ZD1 A;  3DU6 A;  1N34 J;  3OLA A;  2BW2 A;  5ETT A;  5F0U A;  1RHK B;  3NS6 A;  3OR1 A;  2ZH2 A;  2MQ8 A;  4ZIT A;  1UW4 A;  4ZCM A;  3MD1 A;  4OYA A;  2PMH A;  4IH5 A;  4NEY A;  4OYX A;  1FFS B;  2YTC A;  1RHQ B;  3SSQ A;  1J5E J;  1O0P A;  1TV6 B;  1M5K C;  2M5Y A;  1P1T A;  1R89 A;  4A8F A;  2G1D A;  3QNW B;  1GT8 A;  4O3O A;  4DG1 A;  1RWM B;  2RML A;  3WDO A;  1F5A A;  2PGC A;  1HQ2 A;  2YNF A;  3JS9 A;  4LF9 J;  2FB0 A;  4QPX A;  3SZ2 A;  1FVS A;  2X1G A;  3C6T B;  3UI3 A;  4DCP B;  5EWG A;  1IBK J;  4EWT A;  2DKO B;  1JLG B;  2QLX A;  1U6B A;  3HCX A;  4DV6 F;  4EBD A;  4HDH A;  3N28 A;  5E3A A;  1VQY A;  4DPX A;  1V6H A;  2VOD A;  3W5X A;  2XZD B;  4FVC A;  1KOO A;  1F6T A;  1Q5V A;  5HVF A;  3JYT A;  2GO8 A;  3K57 A;  3OHA A;  3KDO A;  1UKU A;  3G6V A;  3GIJ A;  1D9A A;  1S9F A;  5C7P A;  3JSM B;  5JMN A;  4WU3 A;  2QA4 S;  1JIH A;  1S49 A;  3EGW B;  4FYD A;  3R7N B;  4PPZ A;  2YBV A;  3QRP A;  1ZZF A;  2HQ3 A;  3KK1 A;  4U7U D;  4ZA1 A;  2ZJR Q;  4OI1 A;  3W61 A;  3UR0 A;  3X1L B;  4WP8 A;  4CRJ A;  1VBK A;  4ZIV A;  1VRU B;  1W25 A;  2BXJ A;  4F0K A;  1T02 A;  5FLX Y;  4DX7 A;  1D3W A;  3BPS P;  5HK4 A;  2HNZ A;  4C4W A;  1T0T V;  3DKD A;  4Q8E A;  1TP7 A;  4J9V A;  4BHQ A;  2KN4 A;  2JEJ A;  2UU9 F;  2GML A;  5HQL A;  3FBB A;  2W9B A;  5IZH A;  3P49 B;  3TX0 A;  3M9O B;  1YDL A;  3HF5 A;  2DHX A;  1UA0 A;  2ZC4 A;  4J5O A;  5THW A;  4H4M A;  2CQ3 A;  3NP5 A;  3CJQ A;  1R8B A;  2FJA B;  2OEL A;  2BW7 A;  1ZYQ A;  2XLI A;  5AXK A;  4ECW A;  3M7V A;  4ZOS A;  4MKA A;  3SQG B;  2OP5 A;  1WF0 A;  1VHF A;  3KG4 A;  2HAI A;  3W62 A;  3B78 A;  4QU7 A;  2HS4 A;  1S0O A;  2UVR A;  3KLE B;  5H9E J;  3D68 A;  5L39 A;  4RW8 A;  3W9J A;  5L46 A;  2PSZ A;  4DPO A;  1KTV A;  2ZZN A;  3BB5 A;  4ZKA A;  4X4U A;  2M4M A;  3HFZ B;  3W64 A;  1HL6 A;  5IM0 B;  4F4X A;  2Z8Q A;  2DNY A;  4M5M A;  1T9Y A;  3IWL A;  2J6U A;  3AY0 A;  5SZT A;  3CD0 A;  4KPY A;  4ZN3 A;  4LVO P;  2MGZ B;  1EKS A;  1QUV A;  1T03 A;  2CNL B;  4DR4 F;  2BQ3 A;  3BGO P;  4MIA A;  1DAR A;  1HQU A;  2VA3 A;  2ACM A;  1J5O B;  2GHP A;  4L74 A;  3BBF A;  1FCA A;  2H4W B;  1WHX A;  2OHD A;  1Z2L A;  1KVK A;  4OZ1 A;  3RU0 A;  4AL5 A;  5M2P A;  1NSQ A;  1GH8 A;  2O67 A;  4Y2I A;  1VRT A;  4WIQ A;  2AJQ A;  4OYB A;  4FBU A;  2UV8 G;  3CJT A;  4Z37 A;  5HRO B;  2HMI B;  1DTT A;  3E3X A;  2ACY A;  4I56 A;  4C7Q A;  2B7C B;  5E33 A;  3I4H X;  2LMI A;  4UOG A;  5H9E K;  2Q6C A;  4LSN B;  4IQX A;  2LQB A;  3KG1 A;  2DNP A;  2DPJ A;  1T8E A;  2C2O B;  4OI6 A;  2BV3 A;  1FFW B;  3FCH A;  1LOU A;  4DLE A;  1TZ0 A;  4KT0 C;  4MYU A;  1NKE A;  2FJB B;  2XMV A;  4C8M A;  5K14 A;  1FF2 A;  1S99 A;  2CWX A;  2ZWO A;  2F8M A;  4EUV A;  1N54 B;  1UMJ A;  2PEB A;  4OV6 A;  4MK8 A;  1M5S A;  1U1Q A;  1UVM A;  2DIS A;  5A8W B;  1JLA A;  4ZS6 A;  1RT7 A;  3I31 A;  1UEV A;  2CVI A;  1HNV B;  1NSP A;  3CME S;  3KMS A;  2Q1L A;  4ECQ A;  3WIU A;  4X4P A;  1REG X;  2EK6 A;  2J9C A;  4QCL A;  4CO4 A;  3IBF B;  1ZZN A;  2E1P A;  1DTQ B;  3GJT B;  4UTG A;  2DVI A;  2BOA A;  5BXI A;  1YGY A;  3OTE A;  4YS2 A;  2G2Z A;  3I82 A;  4DFP A;  1URR A;  2E5I A;  1XJW B;  1RTI B;  5ETM A;  5ETP A;  2V63 A;  3M2U A;  4JYA F;  4OHX A;  4TYB A;  4F25 A;  2UUC J;  4IG0 A;  3TA2 A;  3H98 A;  3NNC A;  1U48 A;  4GKK F;  2ZWP A;  2B4V A;  3H4D A;  1UFW A;  1M1K T;  3CIM A;  2LU2 A;  4OL8 A;  1D8Y A;  3HHL D;  4WKY A;  2XMU A;  1PIE A;  4NLP A;  3MPD A;  1WF1 A;  1Q82 T;  3BKT A;  1NH8 A;  1NZA A;  4U96 A;  3CCU S;  5B09 A;  1XMB A;  5KFD A;  5B0G A;  1ZTT A;  4MAK A;  2M8D B;  4C8Y A;  1I94 F;  1XNR F;  2VKR A;  3M6V A;  3DI6 B;  4OQJ A;  2E1M C;  1JNR B;  4FZV A;  2YNG B;  4DBQ A;  3UW1 A;  4K4T A;  3NCQ A;  3R3T A;  2GGP B;  4U8Y A;  1Y0H A;  1NM2 A;  2VG5 B;  1RWO B;  1K0T A;  3GFX A;  2MQO A;  4C8K A;  5JJB A;  5J1N A;  3DRR A;  3W5Z A;  1RA7 A;  2HFU A;  3DLK A;  4R0E A;  1S4F A;  3BRE A;  4UOF A;  3HHN B;  4CLT A;  5KFO A;  4M5D A;  3TZZ A;  2VC1 A;  4NCG A;  2YWW A;  3I56 S;  3LOU A;  1YLX A;  4K5R A;  4V19 X;  1MN7 A;  3PZP A;  4GVL A;  5BJR A;  4I6W A;  5K8P A;  4DS5 A;  1XC9 A;  3KG0 A;  4M5I A;  5KFY A;  1U4B A;  2J7U A;  4CYU B;  5GAD U;  1PYO B;  1UPP A;  1RE1 B;  1Z1Z A;  2V68 A;  3TWZ A;  5DZ7 A;  3QO9 A;  2YWF A;  3T9N A;  4HAC A;  2H48 B;  3DLJ A;  5CCM A;  4N5S A;  5IFM A;  1PSD A;  3ILI A;  1GXL A;  4KKO B;  3IR7 B;  2R7S A;  2HS3 A;  3P5T L;  1V5I B;  2DXE A;  2GQC A;  3GIL A;  4DR6 J;  5K5M A;  3CGI A;  3AB4 B;  1FXR A;  1UVJ A;  3R5D A;  2R8H A;  4Y2C A;  5F3Z A;  2D3O R;  1FKO B;  2CJA A;  5DZ6 A;  5I3U B;  3BZQ A;  2OJ3 A;  4X4N A;  5L9X A;  3KKF A;  2GCF A;  3A8I A;  3O1L A;  1RXO B;  1BXN A;  4B3O B;  2MZJ A;  2HGM A;  7FD1 A;  5A2Q U;  1FTR A;  2HK3 A;  3M2V B;  3AOA A;  4PAB A;  2RKI A;  1CC7 A;  4UOH A;  2LQ8 A;  4LRE A;  3OW2 R;  2VC0 A;  1H72 C;  2BE7 D;  2Y0B B;  1TKX B;  3RJM B;  2RF2 A;  3PJ9 A;  5KG3 A;  3KLI B;  4QWE A;  1TVR B;  4LRA A;  2HQD A;  1PGZ A;  1VK8 A;  2Q79 A;  3M1V A;  2K1R B;  4AUK A;  2HVH A;  1T9W A;  4B3M J;  5DS7 A;  1T9X A;  3F41 A;  3DU5 A;  4IH7 A;  3TJA A;  1Y00 A;  5T14 A;  5F8J A;  1UTA A;  2CZV C;  3BDE A;  2W9C B;  1OY9 A;  5CZX A;  4DV5 J;  1CVJ A;  4JV5 J;  2RUG A;  4JI1 J;  1DBD A;  1Y5N B;  3V2U C;  1FER A;  3VAH A;  3NWG A;  4CLF A;  4R5P B;  2PD1 A;  4WTO B;  1UPM B;  2XY5 A;  1GX6 A;  4I6Y A;  1A9N B;  2BJ1 A;  1HBM B;  1ULR A;  2BKO A;  3BM7 A;  2V4J A;  1L3S A;  3Q8S B;  3FBF A;  4EBE A;  5BR8 F;  2DNO A;  4NZ6 A;  4URG A;  3RR8 A;  3MUM P;  4O4G B;  1DJ0 A;  5HP1 B;  5D4L A;  4TY8 B;  4DV1 F;  3PHE A;  4FF1 A;  1HNI A;  3HO1 A;  3FSI A;  2NSC A;  4WII A;  4ZPV R;  4U95 A;  3D5M A;  3AHP A;  3OXL A;  4JI8 J;  1T95 A;  2KXN B;  1IBL F;  1B7F A;  3NAI A;  2QYG A;  4KC5 A;  4OZJ A;  2DJW A;  4Q0B B;  2BAN B;  1O6X A;  5KG0 A;  3CUL A;  1PAU B;  3PO4 A;  2GMJ A;  1NK0 A;  3BSA A;  4RNN A;  5J2M A;  5FDL B;  3MOJ B;  3DLE A;  1QAJ A;  5D0R A;  2XSJ A;  2W8K A;  4J91 A;  1QE1 A;  3MUR P;  5E41 A;  1OY6 A;  2WSE C;  4NXN F;  3GII A;  1FJC A;  2AX0 A;  4M1K A;  3R27 A;  2XSF A;  5T7L B;  4EMD A;  2MKC A;  3O8W A;  4HTJ A;  4OLP A;  3LP2 B;  1BQN A;  3B4M A;  4M94 A;  1GX5 A;  1VC6 A;  2W4C A;  1WC5 A;  2W2M P;  1RSC A;  4PQA A;  2F9D A;  1XR7 A;  2A18 A;  2PEH A;  3D4J A;  5B0C A;  4P7V A;  2BJE A;  1KQF B;  5D3G B;  1FDN A;  1IWG A;  3PAC A;  4YHH J;  3T1Y J;  5KFR A;  3L3C A;  5I42 B;  4W92 B;  2BJ3 A;  1XR5 A;  3TJ9 A;  1T05 B;  2FDN A;  2KZM A;  2RT3 A;  5AT1 B;  3MCO A;  4O3P A;  2IBK A;  3BKU A;  5I4M A;  3CJ5 A;  2HBY B;  2R7T A;  3G6X A;  1HI8 A;  1VQK S;  2C3Y A;  4DV0 J;  4ZIW A;  4F26 A;  4Q8F A;  2W01 A;  3GU0 A;  1FWP A;  1JWW A;  1YTY A;  1N5S A;  3KUG A;  4F3M A;  4RUH A;  1KP6 A;  4B17 A;  5F9L A;  3MCS A;  2R2S A;  1AUD A;  4KJI A;  3MM6 B;  2EBE A;  1EP4 A;  1TMJ A;  4HT7 A;  3F56 A;  1IR2 A;  3ZZY A;  3G4S S;  4HYK A;  1V3Z A;  3HX9 A;  4FYW B;  2MZS A;  2ZOF A;  1R7I A;  2N3L A;  4OX7 A;  2GZO A;  4QWB A;  3D66 A;  2IY5 B;  2QLF B;  1AZS B;  2CPY A;  4RPF A;  5C42 B;  5IQ6 A;  2IJN A;  4N41 A;  3I0R A;  5C25 A;  2UXD F;  1VYA A;  3FQK A;  2F4V J;  1HIY A;  3PIP Q;  2R8J A;  1U8W A;  1NHK L;  3RB3 A;  2JLF A;  1WOO A;  3VTI A;  2XI2 A;  4LVN P;  2DH8 A;  1Q7L B;  3DGP B;  2ZDO A;  1E6V B;  2XZT B;  1WG5 A;  2UUT A;  1RCO B;  4XPE A;  2CAD A;  1WC4 A;  4FS2 A;  3BGR B;  4RUC A;  1AXQ A;  4FNH A;  2VOO A;  2O1P A;  5B08 A;  1K8A T;  2OPQ B;  5J1E B;  3CCW A;  2RU3 A;  2BKN A;  1AW0 A;  3N4W A;  2PN6 A;  2RVJ A;  2P8I A;  5KG7 A;  2M52 A;  2E5G A;  3E8O A;  2D7S A;  3UD3 P;  4PXB A;  3ILJ A;  1FD8 A;  3P96 A;  2ASJ A;  4KFB A;  4K5S A;  2HVI A;  3TVZ A;  3T3F A;  3WC0 A;  2QFI A;  3OTO J;  3FBE A;  1F2H A;  1R3N A;  5B0D A;  1JLC B;  3KJV A;  5F8M A;  5GAE U;  2QSF A;  2OAU A;  3C14 B;  5KFX A;  1NK9 A;  4UY8 T;  1H6K X;  3EZ5 A;  2PDA A;  3PW5 A;  3I55 S;  3CJ4 A;  3K5O A;  2EWH A;  2CPH A;  1C1B B;  2EG1 A;  2ERR A;  4Z7Y A;  3OPK A;  3NS7 B;  2AU0 A;  4M5G A;  3MR7 A;  2MQM A;  2XC9 A;  3M30 A;  4K4Z A;  4Q5V A;  1HMV B;  4KPC A;  1R0B G;  1WDD A;  2EKY A;  4DV6 J;  1IQZ A;  4NXM F;  5B0B A;  2CQC A;  2QV6 A;  1EB0 A;  5KG1 A;  5C5J A;  2HVD A;  1TK8 A;  1Q0N A;  4OZ2 A;  3SFU A;  1VQM S;  2DHS A;  1TKT A;  1JK9 B;  5CXT A;  4A8K A;  5FII A;  4G1I A;  1VLO A;  1G2E A;  1PC5 A;  1SV5 B;  1JKH A;  3WQP A;  3AOC A;  4YDX A;  1H38 A;  3AJ2 A;  2WON B;  5HLF B;  4KGV B;  2ALY B;  4DR3 J;  1RU1 A;  2OLW A;  4I2P A;  1CPZ A;  2YQ3 A;  3ETM A;  3MEC B;  1RCX B;  3IXQ A;  3VZI A;  1NBE B;  3HZG A;  5CQG A;  1LWC A;  3HUL A;  1RWN B;  4PR6 A;  3SCL E;  3OUY A;  4KH1 B;  3CCQ S;  5D78 A;  1GAO A;  3TW0 A;  3IG1 A;  1S7I A;  2V34 A;  1NDK A;  3CXC R;  3KTQ A;  2GIF A;  1OS5 A;  3VGV A;  3IWX A;  5D4P A;  2G9O A;  1FDA A;  1JLF B;  4X84 A;  2HBZ B;  1XMQ F;  4DV2 J;  2MJN A;  1CJU A;  1NUE A;  4DQQ A;  2Y1R I;  4KHP J;  2C22 A;  5LMN J;  4JI2 F;  3JTN A;  4JP8 A;  1R6Y A;  2QT7 A;  4DL6 A;  3S01 A;  1YQH A;  2HIQ A;  3ENV A;  4K4V A;  3FC9 A;  4LFC J;  4EYH B;  2FVQ A;  1SJF A;  1UVK A;  3L09 A;  4A48 A;  2B5J A;  3FJ2 A;  1Y9O A;  2ZH3 A;  4PZV A;  3PX0 A;  4ZPA A;  5GMD A;  1UEU A;  3Q86 A;  3G82 A;  3CJ2 A;  1TV6 A;  2LP4 A;  1TR0 A;  4IRC A;  4DCO B;  1IR1 A;  2MHE A;  3PCO B;  1ZM2 A;  3W2V B;  2B3T B;  3CCR S;  5KT7 A;  2FHJ D;  3C6T A;  5G0R B;  1KBR A;  2C3P A;  2IM1 A;  2FGO A;  1JLG A;  3SCI E;  3CD7 A;  2HHH J;  5SUH A;  4LBP A;  2D41 A;  1VBX A;  2HHW A;  2ZZM A;  1QTN B;  2N3O A;  4KGZ B;  4FNI A;  1RT1 B;  1AFJ A;  4RNF A;  3SBM A;  3T6B A;  1YJN S;  1HHS A;  4N77 A;  4P72 A;  5ADZ A;  2MQL A;  2ZH1 A;  4DR4 J;  2FHJ A;  2KG1 A;  1CJV B;  1TFY A;  1IKX B;  3TOQ A;  3HHE A;  3KFW X;  1NJI T;  3I9V 9;  4DX5 A;  1B0P A;  2R8K A;  4TXS A;  3MXH P;  1P9Q C;  5KFL A;  2M2B A;  3JSM A;  5HQM A;  2YX7 A;  2GVD B;  2Y1J A;  2RRN A;  1DZ5 A;  1UZD A;  4IFV B;  1NEE A;  2XI3 A;  2LEA A;  4TQS A;  1OY8 A;  3GYG A;  1SJQ A;  1HYS B;  2U1A A;  2MQP A;  3VAL A;  1NND A;  2B8P A;  1XMO F;  1VRU A;  1FEH A;  2W2O P;  3SEO A;  4OYZ A;  2F7V A;  2CPE A;  3QLH B;  2BQU A;  1PBA A;  4FPI A;  1HR0 F;  3DHX A;  4ECX A;  3MEE B;  3Q8V A;  4ZCI A;  4USJ C;  3ZXW A;  2VFR A;  3H2L A;  1U6Z A;  4ITS A;  1IM6 A;  2OPR B;  4Y00 A;  4M5H A;  1EKR A;  1RBL A;  4WYL A;  4F0H A;  1GNK A;  5D15 A;  1DUR A;  2LA4 A;  5KG4 A;  1X0P A;  1LK5 A;  4IQM A;  2HHU A;  5A6P A;  1TK0 A;  2W9A A;  1HNZ F;  1FEE A;  3MCN A;  2I2Y A;  2WK4 A;  3G71 S;  3HSZ A;  3R5J B;  4M5N A;  1Z2Z A;  2DNK A;  2RE1 A;  3BS9 A;  2HQG A;  2PI4 A;  4FS1 A;  3W7B A;  4ECY A;  1V9O A;  2XMK A;  4LBI A;  4X65 J;  1IKY A;  1VOM A;  1O8B A;  4USK A;  2AJF E;  2FGC A;  2C2Z B;  1X4A A;  3R2D J;  3ZZR A;  4O3N A;  1AA1 B;  2HFV A;  3LGN A;  4X66 J;  1URN A;  2GHW A;  2GFF A;  2X51 A;  2BMB A;  1JX4 A;  2EC2 A;  5E3C A;  5K8O A;  3KLE A;  3M8Q B;  4DFJ A;  3OSP A;  3HI9 A;  2Y8W A;  3CPW R;  2VDH A;  1S59 A;  4ZVS B;  3J7Y U;  3LPY A;  4G1P A;  4HL9 A;  4YB5 A;  3WX4 A;  1TUG B;  2XLK A;  4JYA J;  1XR6 A;  1NK7 A;  5IM0 A;  2HPU A;  1NZ8 A;  3B82 A;  4DQR A;  1TAU A;  4O3R A;  2MGZ A;  1BQM A;  1YWX A;  5EWF A;  3Q0A A;  1QSS A;  2YNI B;  1SH2 A;  3TP2 A;  2HSE B;  4IUF A;  3VGU A;  3HSG A;  2XHC A;  1WHY A;  2WVF A;  4YR3 A;  2XBP A;  1XWL A;  3CCT A;  3IBC B;  3A3N B;  2B7B B;  2JHE A;  3Q8Y A;  1HQE B;  5KT5 A;  2MZ1 A;  2OTJ S;  3BGL A;  4Y6I A;  1FRK A;  4F2S A;  1HFE L;  4K4S A;  3ZFV A;  5L1K A;  4LF8 F;  5HRO A;  2D9P A;  2HMI A;  3F44 A;  4B9N A;  2B0G A;  1MMN A;  5IQQ A;  3CE8 A;  2CQB A;  1C4A A;  3D3B J;  4AND A;  2JOQ A;  2Y0S D;  3VVT A;  3IFE A;  1NJX A;  3OBI A;  1LWX A;  2DIU A;  4DV7 F;  2IA6 A;  3UE2 A;  4LF7 F;  3NS5 A;  3P6Y C;  1VFJ A;  3TVY A;  2UXB J;  3DYA B;  1QDU B;  2W2N P;  1X4H A;  3FRZ A;  2DXF A;  2L08 A;  4LR8 A;  2E7W A;  1QY7 A;  4U8V A;  3CF5 Q;  1HBN B;  2QTW A;  2N82 B;  4ECS A;  3JQK A;  4M8L A;  7FDR A;  2CAJ A;  3R2C J;  2HRU A;  2PC6 A;  2MQQ A;  2OD6 A;  2CQI A;  3PDN A;  1HWL A;  3GR0 A;  1U2R A;  2EXU A;  1HNV A;  4J9K A;  1FRM A;  3DDK A;  4ZPW R;  1J5E F;  1UFL A;  4FKX A;  3T1A A;  4WF9 Q;  2VUG A;  1PCA A;  2G2O A;  2OEJ A;  3PW0 A;  5DLF A;  4NYZ A;  3N79 A;  1FNM A;  1DTQ A;  4LF9 F;  3DOM B;  3MCM A;  4A8M P;  4RW6 B;  2A2D A;  2ZOM A;  4DF4 A;  4JV0 A;  3HP6 A;  3CB4 A;  1IBK F;  1RTD B;  3MAQ A;  4MT1 A;  2QSW A;  1FO1 A;  2YWH A;  5F3T A;  2R2U A;  2KYX A;  1RTI A;  3DLG B;  1S6O A;  5IT9 Y;  3NGS A;  3D6T B;  4JI6 F;  2VA2 A;  4P74 A;  4ILR A;  3D1O A;  4CTA A;  4FXW A;  1SL1 A;  4DX8 H;  4R8U A;  4B3S F;  1B3T A;  4USI A;  4KIA A;  2VFV A;  5GAD I;  1RAI B;  2RHQ B;  2WAQ D;  1I6J A;  3DRY A;  1FK9 A;  1BWV A;  4CLL A;  3UVJ B;  1X4E A;  2WCX A;  2OKQ A;  2PMW A;  3DI6 A;  3KHG A;  4YR0 A;  2K7K A;  1UL3 A;  3FSX A;  4J9L A;  2DHA A;  2F3J A;  2YNG A;  2GGP A;  4B3T J;  1MRO A;  1U6F A;  3LH2 S;  2ALZ A;  1X5P A;  1E6Y A;  2VG5 A;  1SIZ A;  3AOB A;  3UN2 A;  1PO6 A;  3N9U C;  1IKW B;  4ZJL A;  1WF2 A;  2IMO A;  4WE1 A;  1VR6 A;  3S6E A;  1O5J A;  4ZLP A;  2MST A;  2UUA J;  3PR5 B;  4ED6 A;  1WHV A;  4XDC A;  2ZBR A;  2V94 A;  4YP3 A;  4ICL A;  2XMW A;  2YWE A;  1KHW A;  2BKP A;  4ZP6 A;  1IBL J;  3EIC A;  4B9M A;  4DF8 A;  4DN9 A;  5LSO A;  1U09 A;  4ED8 A;  1T3O A;  1VDH A;  1U8S A;  3QIP B;  5ETL A;  1DRZ A;  2XYH B;  2LFV A;  1FI4 A;  3CDA A;  3FCV A;  3M9M B;  4NAS A;  4LRC A;  3N01 A;  4B9T A;  2JX2 A;  3K58 A;  4TU8 A;  4USU A;  1ZS6 A;  1RAB B;  4YB7 A;  2RQM A;  1VHI A;  1GEH A;  3GPA A;  4AE5 A;  4DS4 A;  1S0N A;  2C3M A;  1PJ7 A;  3MUT P;  3H5U A;  2AGP A;  4EBC A;  1RK8 A;  4E2F B;  3MAA B;  1TKD A;  4JI5 J;  3QT7 A;  3S7R A;  4CLZ A;  1LFW A;  2E5L J;  4DV3 F;  1VS3 A;  2JWN A;  1XK8 A;  5I3U A;  1PBU A;  4EEY A;  2QZ8 A;  3ZO7 A;  3LO3 A;  3DCA A;  4B3O A;  3C6U B;  4URQ U;  4BDP A;  4ZJO A;  3MWB A;  2JL9 A;  1N33 J;  4LIW A;  2RDI A;  3LPE A;  2DH7 A;  4ELU A;  2CRL A;  5AXL A;  2B9X A;  3QFW A;  2A10 A;  4FPR A;  1TKX A;  3G8Q A;  3ICL A;  4ZMM A;  1TVR A;  5MAO A;  2FYX A;  3OFE A;  3FEZ A;  1MLA A;  2A6O A;  3L7O A;  1BGX T;  8ATC B;  2ILZ A;  3JXO A;  4LQ3 A;  2W9C A;  3ZZZ A;  2L3M A;  4NWB A;  4BWJ A;  1RKJ A;  2MPU A;  2P6S A;  3GG0 A;  2QGF B;  4B9U A;  3O2I A;  3L95 X;  2KVQ E;  2ILY A;  4RR5 A;  3M6W A;  1YI2 S;  3CWJ A;  4YOE A;  2EFV A;  3SIP B;  2QG9 B;  3UDV A;  1FRX A;  1M1G A;  2HHP A;  1MWZ A;  2UZA A;  2YKN A;  4WBF A;  3D6M B;  2LEP A;  2M7S A;  1S1W B;  2KI2 A;  2H5J B;  1HBM A;  1MNE A;  1RAH B;  2IFX A;  3NRB A;  1N32 J;  3W9I A;  2EPI A;  2DIT A;  1TAQ A;  3OR2 A;  1SH3 A;  4EZ9 A;  4O4G A;  3J7Z 5;  1HBO B;  1RWP B;  3JAM Y;  2Y3Y A;  2V2Z A;  3TNV A;  4H4K A;  4LRB A;  5KFN A;  2YKP A;  5D0E A;  4ID5 A;  4U6P A;  5LT5 A;  2Z0G A;  3EJM A;  3PRB A;  2JRS A;  2C3U A;  4Q0B A;  2WBR A;  3MM5 A;  2VV5 A;  4WFB Q;  1D0E A;  2IRX A;  4C3K A;  1M0S A;  1OQ3 A;  4RU2 A;  6FD1 A;  2C2K B;  1Z4U A;  2OEK A;  4F4Z A;  5KT3 A;  1LQ9 A;  4CDI A;  2A0F B;  1N6Q B;  3H5Y A;  4C8Z A;  3GE9 A;  1BE4 A;  5RUB A;  1RAC B;  4QWC A;  4CM2 A;  3LWL A;  2CIM A;  5T7L A;  3THV A;  3I96 A;  2XMJ A;  4PQU B;  4JV2 A;  1RAF B;  4OZ3 A;  2I6W A;  3IO1 A;  3LP2 A;  5CZV A;  4NLX A;  4ID8 A;  1NU4 A;  4WFX A;  1ARO P;  4YEA A;  2X3G A;  3ZZO A;  2ZHA A;  1RWX B;  3W8G A;  2BAC A;  5CYJ A;  3ZZU A;  5A2Q Y;  5IXU A;  4OLO A;  7AT1 B;  4NLT A;  2HGL A;  9RUB A;  1EAY C;  4IG3 B;  5I42 A;  2AIR B;  4RW7 B;  2UUC F;  3SXL A;  2R2T A;  2KTQ A;  2CJB A;  3O6Q A;  5BYR A;  3JQM A;  2XYP B;  1RZM A;  2NXE A;  4O23 A;  1J27 A;  3GZ7 A;  4AT1 B;  1LW0 A;  4J90 A;  3PYD A;  1QAX A;  3M2R B;  2MMY A;  3JB9 k;  3A3P B;  4ES2 A;  3DRS B;  2ZH5 A;  2V2V A;  2FLN A;  2BJ7 A;  3VQS A;  1TQL A;  2Z30 B;  3H20 A;  3G96 A;  3TQ1 A;  4OHW A;  2OSR A;  5ETS A;  4FXV A;  5JUM A;  3GV8 B;  1U1O A;  4C8N A;  1M5O C;  4FF2 A;  3WIV A;  4WP3 A;  1F9F A;  3UN3 A;  3CMA S;  2XZW A;  3ET6 B;  4BC7 A;  1S7H A;  1W26 A;  3MM6 A;  4G1Q A;  1LNQ A;  2FY8 A;  2K2P A;  3C8Y A;  1IBM J;  3D3C J;  2JVR A;  1Y11 A;  2RIL A;  4I2Q B;  3LGM A;  3H5X A;  3I0S B;  4FN5 A;  3NGK A;  5GAE I;  4LIR A;  1K1Q A;  3CED A;  1AZS A;  3KK2 B;  4DL0 C;  5LJ3 Y;  4CT9 A;  5C42 A;  1B7Y B;  3IRW P;  4C3M A;  4I64 A;  1BD6 A;  2W25 A;  2CJ9 A;  5J2N B;  4DU7 A;  3PYE A;  3QJJ A;  3HHD A;  1RDR A;  1WTB A;  3H0P A;  5I3P A;  3DGP A;  2PE8 A;  1E6V A;  2WB4 A;  5L1L A;  1OO0 B;  3BGR A;  3TAM B;  3UQS A;  4OYM A;  2B4P A;  1X9M A;  3W1Y C;  2OPQ A;  4N56 A;  4DR7 F;  3CCE S;  4DL7 A;  1N36 J;  5CYQ A;  4DWI A;  3RB4 A;  4WFZ A;  2FJE B;  4CLY A;  1RAA B;  1FRI A;  4X62 F;  2HYI B;  4DR6 F;  3BH7 B;  4DR2 J;  3LP1 B;  2HFS A;  1S57 A;  1LW2 A;  4DZD A;  3J80 Y;  2FHK A;  3DMJ B;  3OJU A;  2WSF C;  4CLK A;  1FVQ A;  2H54 B;  2JLG A;  1BWE A;  2LXU A;  4CQ1 A;  1WOS A;  4OHV A;  4XTT A;  4YFU A;  1JLQ A;  3V4I B;  3VAJ A;  5GME A;  4NEZ A;  3CJ0 A;  4QOT A;  3EMT A;  3DOL B;  2AEM A;  2IM3 A;  2XCA A;  3C14 A;  4FDF A;  3I87 A;  5KFV A;  2HND B;  2FPH X;  3MTK A;  1JLB A;  2EFQ A;  3G2X A;  2ADC A;  5KFU A;  3UNY A;  3NMA A;  1UA1 A;  4ZVH A;  3H5S A;  1R31 A;  3IS9 B;  3DHW C;  1F60 B;  3NLC A;  1GK8 A;  2OFH X;  3I32 A;  4IFY B;  2IVF B;  1KLM B;  1VCT A;  1CEZ A;  5JVG Q;  2BE9 B;  3FMB A;  5A8K A;  4CLU A;  2ZE2 A;  5KT2 A;  1HMV A;  1ZBT A;  4G3I A;  1S1V A;  4C11 A;  2DO4 A;  2DGT A;  1UW9 A;  3AA9 A;  3J81 Y;  3CO0 P;  1KQG B;  1WEZ A;  1I1G A;  2Z58 B;  4KTQ A;  3QZ8 A;  1H73 A;  4PG5 A;  1AB8 A;  4F7V A;  3PEH A;  1ZM4 A;  1VJQ A;  4DV5 F;  2QE5 A;  5KFI A;  2A6M A;  1MW7 A;  4JV5 F;  4JI1 F;  1RWK B;  2L9D A;  1BHN A;  2J76 E;  1KHV A;  3EPG A;  2CNN B;  2PT0 A;  2D3Z A;  4PRF A;  3M32 B;  5LOQ A;  5L1J A;  3JSR A;  4DI6 A;  1C0T A;  2VQF F;  1N52 B;  3EDR B;  2WON A;  4U7U K;  3E51 A;  1WNE A;  3TA0 A;  2WW8 A;  2ZIT A;  4F4K A;  2W7A A;  2CQ1 A;  3K8W A;  2PA3 A;  3W2W B;  1U1N A;  2NRE A;  3M6U A;  2XCP A;  4GRS A;  4RU9 A;  4NLS A;  4DSI A;  4FP9 A;  2WVD A;  1HR0 J;  5FLX U;  4IO9 Q;  2BBE A;  2RNE A;  4JI8 F;  2OPP A;  2QMX A;  3IP0 A;  4KSE B;  2FJD B;  1DY3 A;  2RS8 A;  3ULH A;  4Q2L A;  1WSR A;  2XO7 A;  4X4R A;  1S6P A;  5A0Y B;  5IC6 B;  2LXI A;  1H74 A;  2IM2 A;  3MM8 A;  2DXD A;  3FSY A;  2EG2 A;  2RD5 C;  3CO9 A;  3FEY B;  2GIQ A;  2RUS A;  3R7B B;  3QJL A;  4P2M A;  5D4N A;  1D9F A;  3EYZ A;  1S0M A;  3Q83 A;  5H1S V;  3OR1 B;  1R0A A;  1Q16 B;  2CUY A;  4A8X A;  1S6Q B;  2CKW A;  2XS2 A;  1FXL A;  1HNX J;  2BE2 B;  2YX4 A;  3SCK E;  3N6N A;  2ZM6 J;  2V8V A;  2AEF A;  4ECZ A;  3RG6 A;  4D3H A;  2MKY A;  1HHQ A;  4EI2 A;  4YHH F;  2JC0 A;  3T1Y F;  2WRM A;  1RAE B;  3PW7 A;  3W3S A;  4PXE A;  3UD5 A;  1FRJ A;  2OH2 A;  2JFD A;  1HWU A;  1F1B B;  2YNF B;  2JC1 A;  2VQE J;  3SI8 A;  1HW9 A;  1PYT A;  3RBX A;  2BQR A;  1AUS L;  3BR9 A;  1LK7 A;  2V8G A;  4DV0 F;  2RQC A;  2ZH8 A;  1UWB B;  4H54 A;  4Y2M A;  5KAK A;  2V0N A;  3FRY A;  2E44 A;  3VQT A;  4B9S A;  1RJJ A;  2MXY A;  2D3O 1;  1OPI A;  1RT1 A;  4K59 A;  3QMQ A;  5KG5 A;  1RT5 B;  1SC4 B;  2VG7 B;  1KLN A;  1CJV A;  3QAE A;  3JYT B;  1UVI A;  1IKX A;  2V2Q A;  4Z2X A;  2Q43 A;  3FZ2 A;  4QYZ J;  2VFS A;  3IAS 9;  2VDI A;  3H2V E;  2VPX B;  3QJP A;  3QSY B;  3VGS A;  2UV8 A;  5ETK A;  2C3O A;  2X7I A;  4I69 A;  1KS2 A;  1TU0 B;  2GVD A;  1YIT S;  2CZ4 A;  1IWA A;  3KK1 B;  3F73 A;  4IFV A;  2F4V F;  4QIW D;  3NGR A;  1S6U A;  1R8C A;  4O4R A;  4LF8 J;  5F8N A;  1KVI A;  2DRD A;  4ZLJ A;  1WG1 A;  4DEZ A;  1VQ6 S;  1WDT A;  1WEY A;  2RRB A;  4W98 A;  2ZNZ A;  2VBX A;  2BDP A;  2ZH4 A;  1RT3 A;  1TL5 A;  3GCW P;  5HSP A;  2OPR A;  2NZC A;  3ZNJ 1;  4NYP A;  3BJY A;  2ROP A;  2XLJ A;  2W9B B;  2CYY A;  4Q44 A;  4K0K J;  1KD1 T;  3AQO A;  1KQK A;  1DLO B;  5KFF A;  1T94 A;  4NLU A;  3CT9 A;  1RUS A;  2JEI A;  4H4M B;  2GV1 A;  3VGT A;  2BOP A;  1RT2 A;  3OTO F;  2FD2 A;  1CUL B;  2J6S A;  4LR7 A;  3IN5 A;  4QYZ K;  4LFB J;  1OYD A;  3T1H J;  1KRP A;  1IBC B;  3GTY X;  4HT5 A;  2K3I A;  4DUZ J;  5LSR A;  2QA1 A;  2NXU A;  4I7F A;  3CCJ S;  1FA0 A;  4UY8 5;  1PJ5 A;  1NH7 A;  2EEY A;  3ISN D;  4OX8 A;  4CLS A;  5ETO A;  4KBI A;  2ZJQ Q;  3PRD A;  4QZV B;  1QLN A;  3BQ0 A;  4PG8 A;  2FQQ B;  4LJM A;  3QWU A;  3GSD A;  4U9R A;  2FLP A;  2CDQ A;  4QR2 A;  4JI6 J;  1S1U A;  1A6L A;  4RW4 B;  1HBU B;  2Z4P A;  3CJR A;  2NYI A;  3G9C A;  2CZ9 A;  4HVZ A;  3MPV A;  1YRU A;  1RTH A;  3NOC A;  4WYW A;  2UVW A;  4B3S J;  5DDR C;  2GAH C;  1HQU B;  2FHM A;  2Y8Y A;  4Y28 C;  4F50 A;  1VQS A;  2X1F A;  2MSS A;  3MMB A;  2XHW A;  3V81 B;  4DJB A;  1Q78 A;  4WKR A;  4KHM A;  4DR3 F;  1BMQ B;  3L4B C;  5C2C A;  4MYT A;  1U1M A;  3QT8 A;  4OYO A;  1L5U A;  1XN9 A;  3AJD A;  3HHK A;  5K8M A;  5ETQ A;  3HKZ D;  4FF3 A;  2YKO A;  4YY3 J;  2Y9H A;  1DTT B;  1WAC A;  2QX0 A;  3D0H E;  1N8R T;  1YG0 A;  5DQG A;  4ECU A;  1SQG A;  3LUY A;  4IOB A;  5B7W A;  1QVF R;  4EU0 A;  1TL4 A;  3PX6 A;  4DV2 F;  2UXC F;  3CJS A;  1Q86 T;  5CHC B;  4OJG A;  2YKQ A;  4ED7 A;  3ELH A;  4KHP F;  4KO0 B;  2NXN A;  5LMN F;  3N6L A;  1IJF B;  2R42 A;  2R4F A;  2CFX A;  3IWN C;  1PC4 A;  2VJV A;  3CNQ P;  4FYY B;  3W9H A;  4F67 A;  4YME A;  1PKU A;  3WHI A;  5K14 B;  4P9S A;  2YWK A;  1F3V A;  3ZC4 A;  5A8R A;  4LFC F;  4QR0 A;  2VG6 A;  5KFP A;  3TO8 A;  2EFO A;  1ZM3 A;  3DGV A;  3OFG A;  3NOG A;  1JLA B;  1NK6 A;  1NSK L;  2ZKT A;  3HK2 A;  3DM2 B;  1B99 A;  4IR1 A;  2MQN A;  1RLC L;  3IGV A;  4NLQ A;  4XK8 C;  2W4D A;  3TJ8 A;  3W66 A;  4RJV A;  2OO4 A;  2QFJ A;  4DV3 J;  2L9W A;  2H5E A;  3L7U A;  1HLW A;  2DTJ A;  2XEX A;  1VQ8 S;  3PEJ A;  2CQP A;  2MB0 B;  3DOM A;  3VV2 B;  1TL1 A;  4RW6 A;  1BUX A;  5CCL A;  4WFN Q;  3MZI A;  5AJ3 J;  2YX1 A;  1G4C A;  2HHH F;  3GON A;  3Q22 A;  1FFG B;  1U1R A;  5J2P A;  4LBH A;  3DLG A;  1ZAW A;  2R7R A;  4P2F A;  3AFG A;  3FCW A;  1F0X A;  2V9K A;  1RYS A;  2BJ8 A;  1HD1 A;  3NBP A;  3EUN A;  5IV3 A;  2IC3 A;  4W90 B;  2V8D A;  4DUY J;  1REV B;  1XTZ A;  2DHH A;  1BY9 A;  3ZTR A;  2W2Q P;  2HHS A;  2XNQ A;  1LWF B;  5LMU J;  4GVB B;  2CPD A;  3UVJ A;  1Q7Y T;  5HAT A;  2V4Q A;  1UET A;  2V8H A;  2EI5 A;  4PKD B;  4M5K A;  2FJW A;  2MZR A;  3OV7 A;  2AX1 A;  3QT6 A;  2AKW B;  2KKH A;  4MFB B;  3DRR B;  1SH0 A;  2AQ4 A;  1IKW A;  3EXC X;  2UUB J;  1MML A;  2K8G A;  1YJV A;  2M70 A;  1K0V A;  3C2P A;  4M5D B;  4ED1 A;  5HMX A;  4O3Q A;  4DV4 J;  1IKV A;  3S1T A;  1S9G B;  1WC1 A;  3R5G A;  8RUC A;  3OFF A;  2BR0 A;  1ZAV A;  3M8S A;  2VKZ G;  4WPA A;  2QL5 B;  5KOX A;  3VCD A;  1C0U A;  3DRX A;  1NJY A;  2HWI A;  3KLF B;  3QIP A;  2I8E A;  3NAH A;  1YJT A;  3KJQ B;  2ZHB A;  2OTL S;  2CJX B;  3P8B B;  4JI4 J;  5F41 A;  4X65 F;  1ACM B;  4HAC B;  1VC0 A;  3EM1 A;  1SUQ B;  2GQQ A;  4J9P A;  1I51 B;  2AZ1 A;  4E98 A;  4X66 F;  2WBM A;  4DUT A;  1ZOT A;  4TU9 A;  1N5Y B;  3TX8 A;  4ENO A;  3MAA A;  2IPO B;  2HNY B;  3GMG A;  1SKW A;  4CCH A;  5HMW A;  4NI2 B;  3X3U A;  4KGX B;  3NNA A;  2A1B A;  2J9D A;  2DR5 A;  1JLE B;  3QT5 A;  3DLB A;  4RL1 A;  4USM A;  3ZNU A;  1S48 A;  2AEJ A;  3W60 A;  4ZP9 A;  3PTW A;  3KHL A;  3MF5 A;  1N88 A;  1OMS A;  1U45 A;  2RSQ A;  3MD3 A;  4ZHR A;  2LEC A;  1CJT A;  2FY1 A;  4FKY A;  4LFA J;  1IXK A;  2AJ1 A;  2HBQ B;  1U2C A;  1YJ9 S;  4LF4 F;  1QJH A;  1WOP A;  5L8R C;  2IHR 1;  1HWK A;  4M5J A;  4L3N A;  3D6H B;  2YXL A;  3UDC A;  3BSO A;  4C97 A;  3B8H A;  1RT4 B;  1TFW A;  3M1V B;  4I6A A;  3TUI C;  1GXU A;  4A8Q A;  1RLD A;  2DEI A;  1B70 B;  1HPZ A;  3NWR A;  1WKJ A;  2MLZ A;  3ZZP A;  1X5T A;  4OYW A;  1RHM B;  2EBG A;  3AJ1 A;  1VC5 A;  3HHL A;  2J7W A;  4CH1 A;  2FTR A;  1YBU A;  4CNZ A;  1KQS R;  2GA7 A;  1YRX A;  3R5B A;  4E0D A;  2KJV A;  3T5H A;  1X9W A;  5BYS A;  2I1R A;  2P9E A;  4QW8 A;  2VH7 A;  2YKM A;  2ZKU A;  3U1M A;  4AQY J;  5ETN A;  5EUH A;  2K7J A;  2V8P A;  1ROF A;  3MFI A;  2K3K A;  2UXB F;  1S1W A;  3UDL A;  2J7K A;  4PXC A;  1IM4 A;  2DEJ A;  2J8A A;  3CCS S;  1F2G A;  2G1H A;  2HGN A;  4ED4 A;  1HNI B;  1RHJ B;  2M3D A;  1WD6 A;  1VQ4 S;  2I38 A;  2HVE A;  2CQG A;  4C6A A;  4DR7 J;  2KFN A;  3LW5 C;  2ZOG A;  3DLL Q;  3GP9 A;  4A8S A;  4TN2 A;  4DN0 A;  4BS2 A;  2L9N A;  4X62 J;  1CS4 A;  3DLE B;  4DSF A;  3BN7 A;  5KFT A;  4ZVF A;  1NK4 A;  1N6Q A;  3C15 A;  2F8E X;  1FKP B;  2CQ2 A;  4X4S A;  5ITH A;  2WOM B;  3PRV A;  4RNM A;  5HVH A;  3DFE A;  3U27 A;  1R43 A;  4PWD B;  2KM8 B;  2GC8 A;  3TUJ C;  2DNQ A;  1K73 T;  4Y2A A;  1DAX A;  2H51 B;  4NA3 A;  4WXO A;  1N56 A;  1XQI A;  3MR2 A;  2IDL A;  2IJF A;  5DG8 A;  5KFG A;  4IG3 A;  1BC6 A;  4FVM A;  4RW7 A;  4LF1 A;  4ZPT R;  2W4P A;  4IDK B;  3L7P A;  1CQM A;  5HAN A;  2B9Y A;  2NLW A;  3DDN A;  1RT6 A;  4ANE A;  2E7V A;  3D1Q A;  2ASD A;  2M88 A;  3BGU A;  3M2R A;  2E1R A;  3KMQ A;  5GAH I;  4FBT A;  2CNO B;  1U25 A;  3GYN A;  1R0C B;  1C1C B;  1F5C A;  4ED0 A;  3OL9 A;  2CPZ A;  3OL7 A;  2NQP A;  1BLU A;  3LF0 A;  2DGV A;  2I9S A;  1RA6 A;  5IT0 A;  4QWA A;  4UW2 A;  4WXW A;  2BYC A;  3HT0 A;  2MJU A;  5L9N A;  3BEG B;  2OPS B;  1EJ7 L;  3ILL A;  4B3T F;  2VQF J;  3D0G E;  3VVU A;  4EYI B;  1NHU A;  2CQ4 A;  4I2Q A;  1TL7 B;  1N5V A;  4ZLL A;  4LF5 J;  1Q4R A;  3VAK A;  3IBW A;  3I0R B;  3KK2 A;  1B0T A;  5IC4 B;  1A7G E;  4CM0 A;  4LSL A;  3FQL A;  1S1T B;  2UUA F;  1ZH5 A;  3WBZ A;  2NS1 B;  3J81 j;  1UWA A;  2WB1 D;  4DQS A;  2ZH9 A;  3GFZ A;  4OZL A;  4OIX A;  4UQT A;  4ETZ A;  4QIF A;  3CJK A;  3PR4 A;  4ZPC A;  3SDE B;  2R7U A;  2B6A B;  3TAM A;  2B51 A;  4F4Y A;  2VBW A;  5CD4 H;  1M5V C;  1AT1 B;  5F8L A;  4BCA A;  5F8G A;  3QQC D;  4CLP A;  1GMV A;  5DRK A;  3QWP A;  3RAX A;  3IRX A;  1IQT A;  2MEW A;  1IR0 A;  1Q8I A;  1HI1 A;  4GC6 A;  3LQV A;  4C48 A;  3GCX P;  5AE1 A;  4JI5 F;  2EVZ A;  2P9C A;  4V1A k;  1NDC A;  2E5L F;  1YHQ S;  2G2Y A;  3CDU A;  4P75 A;  4XO0 A;  3FFI B;  1SVD A;  4IH6 A;  3KJV B;  1F9E B;  3V4I A;  2QMU B;  4JBC A;  2BJ9 A;  3GFH A;  2YPZ A;  3DOL A;  2POK A;  1VGY A;  4DZ6 A;  1VJW A;  2HFO A;  1N33 F;  3BSC A;  2HND A;  1FX4 A;  2XTJ P;  1VIS A;  2HK2 A;  1R6V A;  4N8N A;  4X4Q A;  4C0O C;  2H9Z A;  1I3O B;  1N0V C;  2RHS B;  3IS9 A;  1FJ7 A;  4IFY A;  5DDQ C;  5J2Q B;  1KLM A;  3UNG C;  1S77 D;  4QIG A;  3GB0 A;  4F3Q A;  3I5C A;  4CZC A;  4J9Q A;  3CDE A;  2XS7 A;  1X5O A;  1TK5 A;  3MMA B;  3EXY A;  2R7X A;  1T3N A;  4KE5 A;  4J9U E;  2CG4 A;  1TKT B;  3NCR A;  4ZCK A;  2JEG A;  1KDN A;  2KT5 A;  4F2R A;  3PV8 A;  5FJ4 A;  2MLY A;  4RNH A;  3U1L A;  3SV3 A;  4Q43 A;  3DLH A;  2KYZ A;  1JKH B;  2DBB A;  3M32 A;  3TAP A;  3EVO A;  5C24 B;  3QRQ A;  2AT1 B;  4ECT A;  4HDG A;  3M8P B;  4CP5 A;  3R8Y A;  4I2P B;  2SXL A;  2VOP A;  2J9E A;  4TQR A;  3D54 A;  3LTO A;  4ES3 A;  3ZTP A;  2UVV A;  4F3O A;  3C66 A;  1N32 F;  4CWB A;  3UO0 A;  3W2W A;  4TYA A;  2OD4 A;  1SB6 A;  1QAI A;  1S76 D;  5HL7 Q;  3IG1 B;  1RU2 A;  2ZFH A;  2VHG A;  4B08 A;  1P8G A;  2ZZT A;  1G6B A;  3V6K A;  4IKA A;  2QO3 A;  3OQ2 A;  2EW9 A;  4NLG A;  4NL5 A;  1RB0 A;  3GJQ B;  1CJU B;  4XAK A;  3H59 A;  1EAR A;  1RTZ A;  5KFB A;  1SC1 B;  1YZ6 A;  4NRU A;  2GIR A;  3MOZ A;  1JXV A;  4O44 B;  3UWT A;  2YQ1 A;  5DGA A;  3V4M A;  1H98 A;  2KXH A;  3V6H A;  4UF4 A;  2J0S D;  5AE3 A;  4J9S A;  3CCV S;  2ZC3 A;  1Y5I B;  3UDE A;  1RQ0 A;  2DB1 A;  4QW9 A;  5DM6 Q;  3PVX A;  2ZUA A;  2GHV C;  3UD4 P;  1A0O B;  3KWM A;  2B5J B;  1Q5Y A;  3PKY A;  3D7S B;  1RBA A;  2R8I A;  1S6Q A;  3OTB A;  2Z2M A;  1SQE A;  3BBB A;  3CC4 S;  4NCB A;  1HNW J;  2BE2 A;  2KZZ A;  2QMW A;  2XGP A;  3A13 A;  3G82 B;  1AYE A;  3EX7 B;  2ZBP A;  2WSC C;  2HEK A;  3BR8 A;  2BM0 A;  4HKQ A;  1T11 A;  2VPY B;  4HTI A;  2AV5 A;  4B9V A;  2CDR B;  3RB0 A;  3ADA C;  4QIV A;  2ATC B;  5E5N A;  1U02 A;  1UWB A;  4P10 A;  3TVK A;  4OJ1 A;  3GLJ A;  1XBW A;  4OZ5 A;  4RW9 B;  3UN5 A;  1YIJ S;  4O0N A;  5CH7 B;  3CMQ A;  1D8Z A;  4J37 A;  1RT5 A;  3IR5 B;  2UUW A;  2MY7 A;  2VG7 A;  3ENA A;  3KLV A;  2NUU G;  1SJ1 A;  1IBM F;  2LQ9 A;  1EHW A;  4NLY A;  1U24 A;  3WX8 A;  1LWE B;  2EFG A;  5EX3 A;  1YX2 A;  1X4F A;  1ZPV A;  1IJE B;  5CA5 A;  3BKF A;  1ZA1 B;  4GO7 X;  3BDP A;  1VQN S;  4RBT A;  4OX9 J;  4NOH A;  2MKS A;  2J0W A;  4Y34 A;  1P27 B;  2LEB A;  4F8R A;  4JI7 J;  3K7R A;  3THP A;  2DNR A;  4NLW A;  2H65 B;  3FEX B;  2R7W A;  4C98 A;  5B0F A;  2UXC J;  2HWH A;  3BF4 A;  1TMM A;  2XWY A;  3RZA A;  3KLG B;  1IVZ A;  2J8S A;  1X4G A;  1N36 F;  3D6F B;  1GQE A;  2KHC A;  4KR0 B;  2KM8 C;  5LXR A;  4DR2 F;  2IVM A;  2LVW A;  4AFF A;  3VAM A;  3QFH A;  3NKY A;  3Q89 A;  3PJW A;  1DLO A;  4YN3 B;  9ATC B;  4X4T A;  3A8J A;  2ZNY A;  2XY6 A;  2O5D A;  1Y7P A;  4ANC A;  3VZH A;  4P6Q A;  3BO4 A;  2KFZ A;  1CUL A;  1K47 A;  3KNG A;  3N0V A;  5LJ5 Y;  1IKY B;  1W7W A;  3G86 A;  2DNL A;  5D4O A;  3DNC A;  4P2S A;  2KXF A;  4ZPB A;  4NZ7 A;  1JXL A;  1SKS A;  2NPF A;  1U26 A;  4DSK A;  3NL0 A;  4CT8 A;  3W8P A;  4CO5 A;  2JZ5 A;  3BBC A;  1ZA2 B;  4DSJ A;  1U0H B;  2GJF A;  2D1C A;  2ZH6 A;  4A8W A;  2DRA A;  2F9J A;  3MR3 A;  1FXD A;  5F8I A;  1CJK B;  3HJF A;  1NK8 A;  2RU9 A;  5IT9 U;  2B4U A;  4NLO A;  4L3K A;  1WKK A;  1KR4 A;  5JXS A;  3SQO P;  4X4O A;  4RW4 A;  1HBU A;  3QID A;  3P45 B;  1RKI A;  1YVF A;  3OVS A;  4ZVR B;  1BQM B;  1KON A;  2FVC A;  3EVM A;  3CDB A;  4LF2 A;  3W65 A;  4UQG A;  4WFA Q;  2VPZ B;  3MDF A;  3KK3 B;  3NNH A;  3PFO A;  3TZX A;  3A4T A;  3V81 A;  2WW4 A;  3J7A 1;  4I67 A;  3ENQ A;  2FZG B;  2Q3P A;  2DR9 A;  4BWM A;  1D09 B;  2KT3 A;  4Q2M A;  4P73 A;  2JNJ A;  2B9E A;  2CPJ A;  2CJK A;  4IO1 A;  3PW2 A;  1P1L A;  2V6A A;  3ITH B;  3HVR A;  2RB7 A;  1S72 S;  4KHR A;  5KFQ A;  3OL8 A;  4TU7 A;  4ZK7 M;  4A8Y A;  1ZM9 A;  4PWU A;  4BBY A;  3U7J A;  3NY0 A;  2WHO A;  2HLU A;  4Z7C A;  1MWY A;  4X2B A;  3J7Z T;  1VBY A;  4ZP7 A;  4RZR A;  2E29 A;  1N5Q A;  4KO0 A;  3NGU A;  5CAB A;  3HPO A;  2AWZ A;  3ZTS A;  1NB7 A;  2COL A;  1YKW A;  2FVR A;  4ZVE A;  4LQ9 A;  1SC6 A;  2KJW A;  4L73 A;  2FZC B;  3BV8 A;  2LDI A;  1PJ6 A;  2P9G A;  3AD7 C;  3G8S A;  3QRR A;  2ZBC A;  2M9K A;  2HHT A;  1HNX F;  3SQG A;  2XS5 A;  4DR5 F;  3ETO A;  3BN4 A;  1FTC A;  2ZM6 F;  3KHR A;  3QGG A;  1KSP A;  3DM2 A;  1QD1 A;  1S12 A;  4A47 A;  1WC0 A;  2IA0 A;  2IVY A;  4CH7 A;  1SJR A;  3GWC A;  2PII A;  1OIA A;  3G87 A;  3RB6 A;  4Q45 A;  6FDR A;  3RBD A;  4CNY A;  4DPY A;  5J1P A;  2DHG A;  4DL4 A;  2VQE F;  3TYT A;  4NLR A;  1W2I A;  2HHQ A;  2V5H G;  3W63 A;  4LRF A;  3P4U B;  4HH1 A;  1X5S A;  4URS A;  1FJE B;  3N6M A;  3OTC A;  4LF4 J;  1Q79 A;  1OSC A;  3K5N A;  3O44 A;  1ITP A;  1D9D A;  3IC1 A;  4CTA B;  1J5O A;  1Q81 T;  2FC9 A;  2CQD A;  1REV A;  3R5C A;  4R8U B;  4MK9 A;  4K4Y A;  1VLY A;  3HSD A;  4OI3 A;  3GIM A;  4ED3 A;  2DNZ A;  2GVZ B;  3I5A A;  4CI0 B;  4JOU A;  1U1K A;  2ZVS A;  1HI0 P;  1B64 A;  2O01 C;  1FK9 B;  1LWF A;  2HS0 A;  3D2W A;  4GVB A;  3V6D B;  4FXD A;  1HD0 A;  2MTL A;  1QSL A;  4RUB A;  3KUE A;  3RGI A;  2WTF A;  2W1B A;  4DR1 F;  1VIX A;  2ZBQ A;  5F8H A;  3FMW A;  2DGU A;  2MYF A;  1MRO B;  2GQ2 A;  3MEG B;  2F1F A;  3HXM A;  1E6Y B;  4MFB A;  4LSN A;  2C28 A;  1NRK A;  1SKR A;  4KYZ A;  4RWW A;  1GXT A;  5AXM A;  4F36 A;  4WE1 B;  1M5H A;  2FLL A;  3M8W A;  1X9S A;  4C3L A;  4QPT A;  3M9N B;  3DOK B;  2J0Q D;  4K0K F;  3MM7 B;  1S9G A;  1TTH B;  4P7T A;  3JAM U;  2G0J A;  4ICL B;  4PWW A;  3C19 A;  3TUP A;  5EDW A;  1OSD A;  1QVG R;  3VR1 A;  1APS A;  3LP0 B;  3QZ7 A;  1Y3K A;  3KLF A;  4TVA B;  5A8W A;  2JDJ A;  5D8H B;  2V50 A;  3GJR B;  4LFB F;  2V4R A;  1LV5 A;  2GMH A;  4XDD A;  3N5B A;  3NGT A;  3T1H F;  4JB8 B;  3OTD A;  3D28 A;  1WJ9 A;  3SMZ A;  5HN0 A;  4JI3 F;  3AD9 C;  1SUQ A;  1JQG A;  5HBM B;  4DUZ F;  4O3S A;  3NGD A;  4DL2 A;  2ATL A;  3K8V A;  1H7X A;  4ZVQ B;  1N5Y A;  3PHT A;  4UZB A;  2HNY A;  2N4D A;  4NRT A;  4C0H A;  4NI2 A;  2AGO A;  2HFN A;  2AHO B;  5E7O B;  1VK3 A;  3KDN A;  1JLE A;  5ETV A;  1FX2 A;  2DCL A;  3EZU A;  2RH3 A;  3EGN A;  4F02 A;  4B3R J;  2R9L A;  1SJ4 P;  2OIH A;  3MM9 B;  4K4W A;  2N7Y A;  1TUV A;  4BLG A;  3SSR A;  2VFT A;  4RO0 A;  3TR5 A;  4QWD A;  4USV A;  5IWA F;  3LGH A;  2CQ0 A;  1VIO A;  1RT4 A;  1J2V A;  2GJI A;  4PUO B;  2DNH A;  4NA1 A;  2I5J B;  4WZQ A;  3THT A;  1S10 A;  4Y65 A;  2DK2 A;  5JVH Q;  2BJD A;  4K7Q A;  1JJC B;  4YY3 F;  1XIQ A;  2BM1 A;  2XMT A;  1OPZ A;  1GTE A;  3RW6 A;  1CSJ A;  1NO8 A;  5L1I A;  3CD6 S;  1OJ4 A;  4ILM A;  4GMK A;  1RP5 A;  3EZO A;  1KOH A;  2ADB A;  4ZLN A;  3CIZ A;  3AH6 A;  2V69 A;  4AL6 A;  2QL7 B;  4CO0 A;  2YKN B;  1X7V A;  2IRY A;  1ELO A;  4K4U A;  2AD9 A;  2FJV A;  2VZ9 A;  2DR7 A;  4QIE A;  2AP6 A;  1NJZ A;  3OR2 B;  3TEG A;  4NA2 A;  1XEZ A;  3N5F A;  2DGX A;  1EET B;  5DM7 Q;  4ATN A;  1FD2 A;  4CYU A;  2VF3 A;  3IR6 B;  3HKW A;  4X64 J;  4ID5 B;  2O66 A;  2F40 A;  4QBU A;  2GJ2 A;  5T41 A;  3MM5 B;  1EX8 A;  2PO4 A;  3PJX A;  2BA9 A;  4KKO A;  5K8N A;  3R97 A;  3CSK A;  3PW4 A;  1LXJ A;  2HW3 A;  2BVZ A;  3SSS A;  3J80 U;  3TAR A;  3QPI A;  4KB7 A;  1FKO A;  3K5P A;  1FKP A;  1JB0 C;  5DLG A;  5KFC A;  2WOM A;  2N4C A;  4AYB D;  3GV5 B;  2HRT A;  3AB2 B;  5AJ3 F;  4PWD A;  2G0I A;  4USW A;  4MKY A;  4O0I A;  3M2V A;  2YH0 A;  5F9N A;  1VQO S;  5HMY A;  4A8O A;  2DGO A;  1XNQ J;  4ZVO B;  2PI5 A;  3RW7 A;  3I6P A;  1NKC A;  1R8P A;  3KLI A;  4MK7 A;  2NSB A;  4JI0 J;  3B4D A;  4DUY F;  1JXE A;  2G4B A;  1S97 A;  4LMZ A;  3H4B A;  2K1R A;  4IDK A;  2Q6B A;  5GAG U;  2E1C A;  3WC2 A;  1LW0 B;  3BYR A;  5DDP C;  2YWG A;  1NAQ A;  3J81 U;  2GW8 A;  2NCK L;  4PPD A;  1DQ9 A;  5LMU F;  4NYO A;  2IDE A;  5KT4 A;  3KJN B;  4U7C A;  1EZZ B;  1LXN A;  1C1C A;  4Y0F A;  2CXE A;  2ZEJ A;  2FC8 A;  2XYG B;  3HVT B;  3DRP B;  4R5P A;  4G1Q B;  1YK9 A;  2ZHO A;  2FHO B;  3FGV A;  4QQB A;  2AGQ A;  2HHV A;  1FJG J;  4UT4 A;  3T5L A;  3GIK A;  5KFZ A;  1FRH A;  2OPS A;  4YB6 A;  4KRW A;  4PYA A;  3CC2 S;  4MKB A;  1TL7 A;  3RBZ A;  2UUB F;  4MTP A;  4QJV A;  1VQ7 S;  3QGH A;  4RUA A;  1GMU A;  4AL7 A;  4DV4 F;  2AJ2 A;  4MMO A;  4MJK A;  5FD1 A;  3I5B A;  2LU1 A;  5HP1 A;  4TY8 A;  1S1T A;  3GYX B;  3SCJ E;  2APO A;  2KT2 A;  4DFK A;  4KGM A;  3QBC A;  3E01 B;  5DG9 A;  3UPF A;  2BRL A;  4LSZ B;  1SXL A;  2BAN A;  2D69 A;  3SDE A;  4GKJ J;  3TZY A;  2B6A A;  3CD5 A;  3PXG a;  5CYM B;  2B56 A;  4LF6 J;  5FDL A;  3POT B;  1R8A A;  4JI4 F;  4OYP A;  2R7Q A;  2QLW A;  4ZVU B;  5CYQ B;  4ETX A;  2R3V A;  4PCQ A;  1SKU B;  3ISN C;  3LWM A;  4DXL A;  4DMZ A;  3QAU A;  1LW2 B;  1WSV A;  5DET A;  1I5O B;  3DXS X;  2FZK B;  2G0C A;  3G6Y A;  2C42 A;  1V3R A;  4IOA Q;  2DR6 A;  1RYR A;  4J7C A;  3T41 A;  2BUN A;  1S0V A;  2AW0 A;  2E9T A;  3NMR A;  4UZC A;  5IT4 A;  1JLQ B;  3FFI A;  4CO2 A;  3G8T A;  1RAG B;  5D3G A;  2DNG A;  3C16 B;  1UVL A;  1EQ0 A;  3O5T B;  2X1A A;  1JLB B;  3PNI A;  3PKM A;  4LFA F;  3K89 A;  1T05 A;  2MKJ A;  3MR5 A;  2AYM A;  2MHN A;  1S4E A;  2CQH A;  4NPO A;  1SI9 A;  4EO8 A;  2Y1L B;  3MMC B;  2KHD A;  2R2R A;  4IOC Q;  2H5I B;  5A8K B;  3CCM S;  5J2Q A;  1WHW A;  2ZE2 B;  4QR1 A;  3O3L A;  4W4M A;  3H40 A;  1S1V B;  3Q24 A;  4C11 B;  1WKL A;  3A3O B;  1RI7 A;  2IAJ B;  4WFY A;  3MMA A;  2VB6 A;  5U47 A;  2J0X A;  3T6J A;  3LAN A;  3UCU P;  2IRU A;  2DIV A;  1LFP A;  2QL9 B;  1P9Y A;  1IN0 A;  3RBE A;  2L41 A;  2QRR A;  3I4P A;  2HVZ A;  2Z2Z A;  4S0M A;  3ZTQ A;  3TA1 A;  3K5L A;  1N48 A;  3HFV A;  5C24 A;  6AT1 B;  4ZDN A;  4B02 A;  1TKZ B;  1C0T B;  4D3G A;  4AQY F;  4PG6 A;  3M8P A;  4EGL A;  2A2C A;  2E9Z A;  2MLX A;  3ZZ0 A;  1Y4Z B;  2OEM A;  3K59 A;  2VBY A;  5HVG A;  3T9Z A;  1K1S A;  5C2G A;  1KVJ A;  4ZVP B;  3IM9 A;  1YJW S;  2Z57 B;  3HM9 A;  4A4J A;  1RAJ A;  4OYI A;  2DCU B;  2IYG A;  2OPP B;  1SQF A;  4F4A A;  1VI7 A;  2AJ0 A;  5J1E A;  4DPU A;  1MU2 B;  3W5Y A;  3DXB A;  3M6X A;  4L75 A;  2UU9 J;  2W7O A;  1S6P B;  1FDD A;  3TZW A;  4HEA 9;  3UCZ P;  3EVW A;  5IS2 A;  8AT1 B;  3L9Z A;  3KLH B;  3MM8 B;  1YBT A;  5H9F J;  4O44 A;  1S5Z A;  2L48 A;  3MED B;  4G65 A;  2B4O A;  4OZN A;  5MLC V;  2KU7 A;  2DRB A;  1WEL A;  2RDD A;  3RTV A;  3PG9 A;  3EGZ A;  1IUJ A;  4DFM A;  1RTJ B;  1R0A B;  1JLC A;  1RWW B;  1F3F A;  2RQ4 A;  4WWS A;  2VIH A;  4NLD A;  5LXY A;  3JQJ A;  4TY9 A;  4WZM A;  1YSJ A;  2C2M B;  1YJ7 A;  3C3L A;  2QYC A;  1DHM A;  2JLE A;  1C1B A;  3DC2 A;  1PAE X;  2Z2Y B;  3FBC A;  3G6E S;  2VBZ A;  4C8L A;  2LCW A;  3HLU A;  1DQ8 A;  3PO5 A;  3KHH A;  2DY9 A;  2C1E B;  1N5T A;  2OUG A;  4X4V A;  3CW2 C;  4ECR A;  4BC9 A;  4RW9 A;  4F0M A;  2W8L A;  2QIF A;  2DNM A;  3FKB A;  2LDY A;  1MSW D;  3VWS A;  4YR2 A;  2YNH B;  2ASY A;  2QA4 G;  2KDO A;  1SV5 A;  2HQF A;  5AE2 A;  1FKA F;  2EK1 A;  5H9F K;  4DDF A;  2YPY A;  3BH6 B;  2VIC A;  1F5B A;  1VBZ A;  1RHR B;  1TL3 B;  1G7C B;  5GVQ A;  2D9O A;  1Q8B A;  5HLF A;  3LAL A;  1ZPW X;  4AXJ A;  2R8G A;  1JJ4 A;  3MEC A;  2NR0 A;  2Z56 B;  2MKI A;  1LWE A;  5I3Q A;  3BPD A;  2E5H A;  4H4K C;  4K8R A;  5L38 A;  4LF5 F;  3AQP A;  3UCG A;  1FNX H;  4P52 A;  3GR1 A;  4HHH A;  4LRD A;  5LL6 d;  1S9E B;  5E0O A;  4KV8 B;  4IRK A;  1KN6 A;  1PIL A;  3R9L A;  3TQE A;  4RBV A;  5D77 A;  4L72 B;  1S1X B;  2RJZ A;  2BAB A;  5HQ8 A;  3K17 A;  1JLF A;  3ENW A;  1QSY A;  4MIW A;  2KO1 A;  3QYY A;  4OHZ A;  1JJ2 R;  4MIB A;  4H4O B;  3EPI A;  1QTM A;  2DR8 A;  1RT3 B;  4J9O A;  3KLG A;  4ERD A;  1QUP A;  2UP1 A;  5HJX A;  3R1H A;  2YVS A;  2HUR A;  4LUB A;  2E9R X;  1FT8 A;  4HHU A;  1C4C A;  1T9T A;  2ZD1 B;  2BZ2 A;  2V2K A;  3HT3 A;  1H2V Z;  1Q1K A;  1UFK A;  2W2P P;  4JUZ A;  1LKZ A;  1RT2 B;  2LQ5 A;  1B0V A;  1Q8K A;  1SCJ B;  2V9W A;  4DR5 J;  1NCL A;  3PIO Q;  1YBA A;  2GS8 A;  4WCE Q;  2RRA A;  1UVN A;  1X60 A;  1R27 B;  4IR9 A;  3ONQ A;  4MH8 A;  5LSL A;  2PA8 D;  2KRB A;  4DG1 B;  2HRY A;  4I7F B;  1C2P A;  1MG7 A;  3W2V A;  4K50 A;  4ALZ A;  2IMW P;  2AYE A;  4OI0 A;  4HH0 A;  3CJ8 A;  4OZ0 A;  1U0H A;  5G0R A;  4I4B A;  3IMQ J;  4OI2 A;  2AYG A;  1L3K A;  5CAA A;  4HI2 A;  1CJK A;  4CIO A;  4DU8 A;  2XG8 A;  2A3J A;  5LM7 E;  2PFF B;  1S1U B;  4GC7 A;  1UAW A;  2ZVI A;  3P3D A;  4N47 A;  2GO9 A;  2ABY A;  3OLB A;  4FYV B;  4GKK J;  5GMK a;  1SIW B;  1FES A;  1RTH B;  1HW8 A;  2JSX A;  4OI4 A;  1H0H B;  1RWU A;  3MGJ A;  4ED2 A;  4R25 A;  3MMB B;  3FVY A;  2OMO A;  3KK3 A;  2JFK A;  1VQ5 S;  5KFJ A;  1ICE B;  1I94 J;  1XNR J;  5K20 B;  4N76 A;  1NKB A;  2IYI A;  2JH3 A;  4OV1 A;  1HYS A;  4DR1 J;  2B9W A;  1FHT A;  2CWK A;  4GO5 X;  3ITH A;  3H8Y A;  2H3E B;  2XB2 D;  3QLH A;  4KH0 B;  4WU2 A;  2HNZ B;  1ZAX A;  3TAQ A;  3MEE A;  2XY7 A;  1N4L A;  3D1H A;  1VQP S;  1Y3J A;  3QAT A;  3J7Y I;  4ZCL A;  2D74 B;  3D67 A;  1KTQ A;  3BQ1 A;  2YQ0 A;  4DOZ A;  1GMW D;  1BQX A;  3VHQ A;  2I0X A;  2CPF A;  5D0G A;  1B4S A;  1RBO B;  2HBR B;  1UJ6 A;  3IA0 A;  3PM9 A;  3K5M A;  1VMB A;  3HZE A;  1G1X A;  3FUY A;  2ROG A;  5A8R B;  2VG6 B;  1N34 F;  5EN1 A;  1GMW A;  5IOL A;  4KAI A;  3FNN A;  5HAO A;  1D1U A;  3TAN A;  2LYV A;  2XMA A;  5EGY A;  4JI3 J;  1UEK A;  5EWE A;  3T5J A;  5ETR A;  3GQC A;  1HNW F;  3AXM A;  1RAO A;  4I68 A;  2B8Q A;  4DQI A;  2MDA A;  2C2D A;  2P6T A;  4EK2 A;  2MKK A;  4P71 A;  3GJS B;  2XO6 A;  4ECV A;  3HD2 A;  4K2J A;  2HIY A;  3M8Q A;  4RW8 B;  2O3D A;  3OXG A;  3M8Y A;  2IIH A;  4WP9 A;  2OGU A;  1TL1 B;  4QU6 A;  2F65 A;  1WC6 A;  1YJU A;  2OML A;  3SFG A;  2IBO A;  5EX0 A;  1QAY A;  4AD6 A;  4PG7 A;  4DCJ B;  5J2P B;  3QSI A;  3FDS A;  5G4D A;  4CO1 A;  4CH0 S;  1WG4 A;  1SPB P;  1T03 B;  2E7X A;  1NPK A;  3NBP B;  5IWA J;  2IC3 B;  2YNI A;  2QN6 B;  2ZDP A;  4RKU C;  2VAS A;  2MZQ A;  2HZA A;  4QYR A;  2DO0 A;  3P5B P;  2GVZ A;  3BGF A;  4E8U A;  5M2R A;  2VFU A;  1VRT B;  1HQE A;  1H3D A;  4PG4 A;  1X8D A;  3S8S A;  3OHB A;  4NML A;  2FUG 9;  3V6D A;  4ES1 A;  2VL1 A;  3MAH A;  4OX9 F;  2DPI A;  5DJB A;  1HWI A;  4JI7 F;  1Q53 A;  1NK5 A;  2NYH A;  3Q8U A;  2EKN A;  1SBR A;  1T7P A;  3MEG A;  4HI1 A;  1V5V A;  5D6G A;  1JJH A;  2J5A A;  3CC7 S;  3DYA A;  3AXK A;  2U2F A;  2V67 A;  3OFH A;  1W2B R;  2CA9 A;  1FRL A;  5BR8 J;  1IKV B;  3T19 A;  3DOK A;  2XGQ A;  4DV1 J;  3I9Z A;  4G6V B;  2DNN A;  3CCL S;  2NPI A;  1HBN A;  1HHT P;  1KNZ A;  3MM7 A;  3GSI A;  5KOW A;  3US5 A;  4ELT A;  1C0U B;  4K4X A;  3FZB A;  3LP0 A;  1GFW B;  2D3U A;  2X3D A;  1RT7 B;  3IGN A;  3U1N A;  1R8H A;  4YB1 P;  1SL0 A;  2M0G B;  1JMT A;  4C9D A;  2VJU A;  2NXC A;  4NZ0 A;  3OXF A;  5EHH A;  5F0W A;  3MPW A;  1WWH A;  3DDI A;  3NXZ A;  3WZ0 A;  4NXN J;  2MZT A;  3KUH A;  5HBM A;  4WK1 A;  2HAF A;  1KEK A;  3SV4 A;  3NG8 A;  2F63 A;  4YDD B;  3Q8Q B;  2QEX S;  4XPC A;  1CLF A;  1U2F A;  4Y3C A;  1RTD A;  2HLT A;  4UOC A;  3VF0 B;  2FLO A;  5KFE A;  1OQ6 A;  3GV7 B;  3MHY A;  1SL2 A;  4CO3 A;  3MR6 A;  3EGV A;  3M2U B;  2DGQ A;  1CBK A;  3K0J A;  1QM9 A;  2ZH7 A;  4OJ3 A;  4ZHR B;  2RS2 A;  3UFC X;  1CJT B;  2ZJP Q;  4ZVG A;  4PAA A;  3BSN A;  4IG0 B;  4KGK A;  3AA8 A;  2JVO A;  1VQL S;  1VQ9 S;  3MTJ A;  3MM9 A;  1UJ4 A;  2CPX A;  3H2U B;  5KG6 A;  1Q95 G;  5A76 A;  2EFN A;  4OX6 A;  2AYB A;  1WEX A;  1FWL A;  5KFA A;  5KFK A;  3BO3 A;  4PYD A;  3MI7 X;  1CC8 A;  4CLW A;  1HPZ B;  4ZPD A;  4FYX B;  4PUO A;  4ILL A;  2FVS A;  2DGS A;  2C2N A;  2I5J A;  4ED5 A;  1X31 C;  2HQI A;  1X4C A;  3B54 A;  1LEO A;  2YY3 A;  3HHL B;  3KYL A;  2NUH A;  2BEF A;  1Y5L B;  4I1T A;  2W7P A;  2CVE A;  4RWX A;  4EO6 A;  3RYL A;  3Q2S C;  3DLK B;  1X4B A;  2G13 A;  2YKM B;  3HVA A;  1H2T Z;  3RR7 A;  3EE3 A;  4NCG B;  3JSB A;  2KVI A;  3LA0 A;  2UXD J;  3JSY A;  3DN9 A;  5E3Q A;  3RUB L;  1FWK A;  1YRT A;  3PX4 A;  4N8O A;  4FF4 A;  1HAR A;  2DY1 A;  1WI6 A;  1EET A;  1O51 A;  2H4Y B;  4ZJQ A;  3AT1 B;  4Q7A A;  3QO9 B;  1V3S A;  1HWJ A;  5KTQ A;  5GAG I;  3C46 A;  3V5R A;  1HA1 A;  2J9D E;  3ZZT A;  2B43 A;  3MPY A;  1KC8 T;  1CS4 B;  3MUV P;  3UR3 C;  1MN9 A;  4ZN1 A;  1M90 T;  2VON A;  1CG2 A;  3LAM A;  4UUX A;  2FJX A;  2XM3 A;  1EIY B;  3C15 B;  2LA6 A;  3K2Y A;  2YH1 A;  1SC3 B;  1PYS B;  3MMJ A;  2LKZ A;  2VU5 A;  3FK4 A;  2FVP A;  2M8H A;  4ZP8 A;  2RQK A;  3JTP A;  1M5P C;  3M05 A;  2DGW A;  3C6U A;  3MPU B;  1KKH A;  1HKA A;  2RKI B;  1EQM A;  4J9R A;  1DQA A;  1FE4 A;  3EDQ B;  5HJY A;  3BYP A;  4WK3 A;  3V6J A;  2ASL A;  2BX6 A;  3QGP A;  4NMX A;  3PFE A;  1FE0 A;  2ROE A;  3A8E A;  3PYF A;  1YJR A;  1GTH A;  2RF2 B;  2C2R A;  5K9F A;  3KOA A;  4Y2K A;  4ER8 A;  4K2X A;  3M8Z A;  2KG0 A;  3RAQ A;  5DGB A;  1U1P A;  3OL6 A;  4NE9 C;  4NXM J;  2BRK A;  1RT6 B;  1U1L A;  1N0U A;  3CJ3 A;  3EWG A;  1P6T A;  2HG4 A;  2Y1I A;  3Q8R B;  3GFY A;  1RHU B;  2Z2L A;  5B0E A;  4PEO A;  2LLZ A;  4J9M A;  3LAK A;  2P2C B;  4C8O A;  3NCP A;  2DT9 A;  1K44 A;  4TNO A;  4LR9 A;  3ZTO A;  3BO2 A;  3HVT A;  3DRP A;  3CDW A;  3OT9 A;  4M95 A;  2DH9 A;  1FDB A;  3H90 A;  1NSA A;  5DQH A;  4R0J A;  2V4J B;  3M8R A;  3BQ2 A;  1U47 A;  3VAI A;  5DG7 A;  4IYQ A;  2WZ1 A;  4OJH A;  4LSL B;  4DQP A;  2LXF A;  1HBO A;  1T9U A;  5E3P A;  4LT6 A;  3HDS A;  5DDO C;  2HQC A;  4OMF G;  3CJK B;  3E01 A;  1XMQ J;  2WVE A;  2F8H A;  2C2E A;  4PXD A;  4IRD A;  2IM0 A;  5J2M B;  2HZC A;  1L3T A;  2CJY B;  5CYM A;  4TLR A;  5GAH U;  3POT A;  2XSJ B;  4JI2 J;  2AMC B;  3RRK A;  2WVB A;  2KFY A;  2OFG X;  2JEF A;  2GNK A;  1QE1 B;  3H42 A;  3IRX B;  4I0W A;  2E5J A;  1TEL A;  3D9B A;  3R1L A;  1ZTW A;  1NHV A;  4MKV A;  1NJW A;  1NME B;  1NDL A;  3PYG A;  1SJ3 P;  3NEK A;  4PQU A;  2F5G A;  1BQN B;  3A8K A;  4OFZ A;  2XMM A;  4F4W A;  3GG1 A;  2JJ4 D;  4B9L A;  5M2U A;  1NPR A;  3D0I E;  5E3R A;  3C16 A;  3ISZ A;  3QGI A;  2OI2 A;  4B3R F;  2AJ4 A;  2N7C A;  4ELV A;  2NZ4 A;  1PG5 B;  3AD8 C;  2K06 A;  1L3U A;  3HJV A;  4UST A;  1CQN A;  1G3O A;  3MMC A;  3B6B A;  3J7A N;  2QA2 A;  2ZBI A;  3Q8P B;  3KXD A;  4B3M F;  1RWV B;  3DRS A;  4N7T A;  1ZET A;  2IAJ A;  5DQI A;  1RGV A;  1Y10 A;  1VRQ C;  4KQZ A;  5BYQ A;  3ILO A;  4DX6 A;  4DSE A;  3ET6 A;  1EP4 B;  3E2E A;  5IV4 A;  2EC0 A;  2R7V A;  2QLJ B;  3M4X A;  2KL8 A;  1U7L A;  4HLB A;  5CD4 A;  3VAG A;  3R7S B;  2X1B A;  5KFH A;  2IJR A;  3I0S A;  1NLK L;  1TKZ A;  3KJF B;  3IAM 9;  1K9M T;  5C25 B;  3OD2 A;  1TUW A;  3PY8 A;  3CCZ A;  2RIJ A;  4XIU A;  3TUZ C;  1L3V A;  5J2N A;  1KFD A;  4HHJ A;  3H25 A;  3HFK A;  5HI7 A;  5D0H A;  4DL5 A;  3HVW A;  2Q66 A;  2J6T A;  3OVB A;  2GAG C;  1XMO J;  3HSJ A;  4DLG A;  4NX9 A;  2GX8 A;  4RBU A;  1OYE A;  2E1A A;  1NPP A;  4UUW A;  5KG2 A;  2PFD A;  4X64 F;  1WC3 A;  3AAW B;  1T9V A;  3R6L B;  2W24 A;  2HFZ A;  1UJ5 A;  1MU2 A;  5HO4 A;  4DL3 A;  2NXJ A;  3F0N A;  3R6G B;  5DO2 A;  1X4D A;  5AXN A;  1NXI A;  3RRH A;  3GIR A;  4KY3 A;  4WJB A;  3KLH A;  3LP1 A;  3H7H B;  1M1H A;  2XQC A;  2AF6 A;  2YKA A;  4C2M A;  3CTR A;  4KFB B;  3CVK A;  1HNZ J;  3DMJ A;  3MED A;  3SYZ A;  1OWX A;  3HD1 A;  1WTF A;  1Q8L A;  2HKE A;  1NB2 A;  4A46 A;  2CG8 A;  2KB2 A;  1RTJ A;  2MY8 A;  2XWX A;  4AXI A;  3JTO A;  2RAQ A;  3TEH B;  1JNZ B;  4C0B A;  2KH9 A;  3OVA A;  5E2Q A;  1H7W A;  1XNQ F;  4V19 J;  1KWM A;  1RAD B;  3OJS A;  1UZH A;  4J9N A;  2HHX A;  4DPW A;  4DPT A;  2CJQ A;  2E66 A;  3A12 A;  4U67 Q;  3M30 B;  4RNO A;  2PMZ D;  4JI0 F;  3OSN A;  4YQW A;  3T5K A;  2RDJ A;  4NLV A;  1X0F A;  3HHL C;  3RRG A;  3TI0 A;  2DD8 S;  1KFS A;  4L6V 3;  2QLB B;  4JV1 A;  1RIS A;  5A6W A;  1UP1 A;  4WTY A;  4DSL A;  4M5L A;  3MEK A;  2FIU A;  2EFP A;  3Q23 A;  3RAM A;  4ZVT B;  1H2U X;  3IM8 A;  5KFM A;  2YNH A;  2AZ3 A;  4DHV A;  3HMJ G;  3A1Y G;  2QJ3 A;  1NDP A;  2QC3 A;  2CNK B;  4M63 A;  1FJG F;  4RX6 A;  1WOR A;  1XER A;  1TL3 A;  3Q2T C;  4EFA C;  3R5A A;  1MWQ A; 
#chains in the Genus database with same CATH homology
 4QYZ K;  2Y8Y A;  4DZD A;  2Y8W A;  3QRQ A;  5H9F K;  5H9E K;  5CD4 A;  2Y9H A;  3QRR A;  1WJ9 A;  4U7U D;  3QRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...