5H9NA

Crystal structure of ltbp1 y114a mutant in complex with leukotriene c4
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
154
structure length
154
Chain Sequence
b'VTSIPTGCNALSGKIMSGFDANRFFTGDWYLTHSRDSEVPVRCEKYQTGSNLQLNFNGKNGDVKCSGSTVSGNQGFYSFQCTTTSGGSFTSYMAVVETDYANYALLYRCGLAGSTTPKDNFLLFNRQSSGEIPAGLSTKLNQLELTSLNKLGCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipocalin AI-4
publication title Structure and Ligand-Binding Mechanism of a Cysteinyl Leukotriene-Binding Protein from a Blood-Feeding Disease Vector.
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 33
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03973 Triabin Triabin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5h9nA00
4KIIA 4LZVA 2WWPA 4RUUA 1U0XA 1S44A 2FR2A 4GETA 1AQBA 1HMSA 2L5PA 1I05A 3U9PC 3B2IA 3PH6A 1LF7A 3APWA 5KICA 1B56A 1S7DA 2FLJA 5EDCA 1MVGA 1SXUA 3BU9A 3S26A 1IKEA 1FTPA 1JV4A 4GNYA 1KZWA 1O8VA 2RCQA 3FEPA 2NNEA 4AZPA 4XMHA 5BVTA 4YFPA 1G85A 4M7MA 1KT3A 3FR2A 5D47A 2QM9A 4LKTA 2CZTA 2XSTA 1CBSA 1E02A 2L67A 1I06A 3UEWA 2Q9SA 1YP6A 1QWDA 5AQ6A 5HZQA 4ZGUA 4M6SA 4TKJA 3FR4A 3BSZE 3ZQ3A 4Y0RA 2ASNX 3C78X 5LJGA 4IAWA 1QABE 3NX2A 1GT3A 2WR6A 1LPJA 1LIDA 2P8GA 1P6PA 2HZQA 3B2LA 3O2YA 3PP6A 4YDBA 4IBAA 2LBVA 2A2UA 5LKEA 1FELA 5KHPA 2WQ9A 4QGWA 1CBRA 2ALLX 1EPAA 3HWFA 2AT8X 5D48A 3C76X 1YWAA 3KQ0A 4HPBA 1DF3A 1I4UA 3BDRA 3AKMA 2OFMX 5D45A 5D4AA 1SA8A 2A3FX 2G7BA 3HWDA 3P6HA 1X71A 2N93A 5IO6A 4ZH6A 4CK4A 4GKCA 5H9NA 4UU3A 1EW3A 3KFIA 2RD7C 1TOUA 3SAOA 1VPRA 2ACOA 3TGCA 1NP4A 3STNA 1LIFA 3P6DA 4YFRA 1PBOA 1CBQA 2FWVA 2AT6X 4N7DA 3IFBA 1MX8A 3VG3A 3KFFA 2WEWA 4NLJA 1ZNDA 3VG4A 4QZUA 2GC9A 3P6GA 4YBPA 5F7GA 1S2PA 2KT4B 1I04A 3PECA 5IO5A 3RSWA 1JJJA 1XKIA 1LIBA 3B2HA 2AT0X 1PM1X 1DZKA 5BVSA 2LB6A 2GJ5A 2OVDA 3B2KA 4XMEA 1LICA 3WJFA 1DZMA 1OBQA 2R73A 3FA9A 2WEXA 1MUPA 1VYGA 4GRJA 2CBRA 5HA0A 5B29A 2OVEA 1GKAA 4UU2A 1BWYA 1G74A 1T8VA 1ICNA 4AZMA 4O9SA 5HBSA 2JU8A 4EXZA 2FS7A 4N7CA 1CBIA 3NR3A 1VYFA 1TVQA 1D2UA 2AKQA 5LJCA 4ZJ0A 1E00A 1BEBA 1EQDA 5HZ6A 4YMYA 3EMMA 1BRQA 2JU7A 2RCTA 5HCDC 2W2FA 4AZOA 3ZUOA 1JBHA 1KT7A 3B2JA 1ZNKA 1NGLA 3FA8A 4XMCA 1T0VA 2LFOA 1IIUA 1AVGI 3EM0A 3HWGA 4GNWA 1IKJA 1DC9A 4XMGA 1ADLA 1ML7A 1HN2A 2R56A 1GXAA 3K3LA 4MVLA 3Q6LA 1TW4A 2JOZA 1CJ5A 4YBUA 3HK1A 1SY3A 4D6BA 5EDBA 5D8JA 4QZTA 3I0AA 2W2AA 3P6FA 2RQ0A 1QFVA 4IAXA 2O62A 1DV9A 1Z24A 2NNQA 1IFCA 2HZRA 5KIDA 1BLRA 3WBGA 3FW4A 4AZRA 3O19A 2YG2A 3CQRA 3CR6A 5K06A 3VG7A 1X8OA 1LNMA 4QAEA 1BSOA 5H9AA 3F9DA 5C0NA 5HTDA 1FDQA 1MDCA 4OMXA 1G7NA 3HWEA 1ZNGA 3D97A 4HFOA 2CZUA 3APVA 2QO6A 4DQ3A 4I3CA 3CBSA 1SY2A 1QG5A 4I9SA 4RUNA 3APXA 4NLIA 4ALBA 4YGHA 1QY1A 1EPBA 1DZPA 4NNTA 5HZ8A 1E5PA 3BLGA 3P6CA 3BS2A 3KZAA 4DQ4A 1U18A 5EEDA 1ZNEA 2FR3A 3EBWA 1ZNLA 4ALOA 3GAQA 5DPQA 1RLBE 1N0SA 4ZCBA 4ARHA 2F73A 1SY1A 3NQ3A 1AB0A 2PY1A 4I3DA 2QO5A 1D3SA 4EFGA 1BM5A 1R0UA 2R74A 1L6MA 2L9CA 4BVMA 1AELA 5LJBA 1EIOA 5L8NA 1IFBA 1DZJA 1UREA 1YP7A 2CBSA 4TQ2A 1SXXA 3NADA 1GX8A 3AKNA 1IW2A 5LKFA 2FS6A 3KFGA 5HCEC 5HZ5A 3WJBA 2AT5X 2DM5A 1KT4A 3FA6A 3JS1A 2CM9A 3PEDA 1FENA 4PSQA 2AL0X 3L4RA 3C77X 4NNSA 2WSJA 4QYPA 1ACDA 1GT1A 4HPCA 4MVKA 4OMWA 4ORRA 1B4MA 4Y0SA 2AH7X 4ZHGA 4A1HA 3IA8A 2POAA 1YWBA 4TNNA 2KTDA 5F1EA 5F6BA 2OVAA 1X8UA 1GKAB 1KQWA 1X89A 3BY0A 5HAEA 2Q2MA 4ORYA 4YKOA 1QY0A 4D6AA 1TOWA 2A13A 1KT6A 3ELZA 2AMMX 2LBAA 2A0AA 3PPTA 1ALBA 2L68A 3EBKA 4NYQA 4LZUA 4TKBA 1O1UA 1LFOA 1A18A 3I17A 3F8AA 1KOIA 5HWZA 5FAZA 4R0BA 3RZYA 3TGAA 1OBPA 4ZHDA 4ORSA 4IB6A 3O22A 5EZ2A 1BJ7A 2ANSA 1T68X 5H9KA 2X46A 2NNDA 4ES7A 1YIVA 3WVMA 1GM6A 1ICMA 1U17A 3BX8A 4BQUA 4ZFXA 3JSQA 4IB7A 3VG6A 4I9RA 4EDEA 1HBQA 3P6EA 1PMPA 1QY2A 1G5WA 4HPAA 5H9LA 2IFBA 3FLLA 1A2DA 3D95A 1PEEA 3TF6A 4GE1A 1A57A 1MX7A 1TXLA 1GT5A 4AZQA 3EYCA 1OPAA 1KGLA 1FE3A 2OZQA 1YWDA 4ORWA 4TLJA 5HTEA 2Q39A 2Q2PA 2QO4A 1EIIA 5H8TA 1EALA 4ODDA 3FENA 4BOEA 5HCCC 4IB8A 3TZSA 4YCHA 2BLGA 1H91A 1YWCA 4OS3A 2FTBA 4YKMA 1UZ2X 1BBPA 4AW8A 5BVQA 1RBPA 3WJDA 3D96A 1OPBA 5IO7A 4WBKA 3NX1A 1OBUA 1X8NA 4EEJA 2ACPX 4YCEA 5FENA 1KZXA 4GH7A 1FEMA 2JU3A 3DTQA 3NPOA 3T1DA 4ZHCA 3FIQA 1EUOA 4ORXA 4IMOA 5B27A 5HZ9A 4K19A 1JYDA 4QGXA 2HYSA 1JYJA 4OS8A 4MVIA 2CM4A 2WUTA 4NP1A 3CWKA 4HPDA 2HNXA 5CE4A 4IMNA 4TKHA 5LJKA 5EPQA 2K23A 1SY0A 3WJCA 4A8ZA 3FEKA 3NQ9A 1DFVA 4ZR2A 2Q4NA 3BRNA 5LJEA 1EXSA 5LJHA 2LKKA 1BSYA 4ORUA 1NP1A 3CMPA 2HMBA 2NP1A 5F58A 2RA6A 4XMDA 5L8IA 3WJEA 1JJXA 4YDAA 3CBCA 2K62A 1OEEA 4QYNA 2A2GA 5DG4A 3WJGA 2E4JA 3G7XA 1HMTA 1OEKA 2HLVA 4IB9A 4XMFA 3U03A 1GT4A 1LIEA 1KQXA 3FR5A 1HBPA 4Y0QA 4YFQA 4QGVA 4A1YA 3VG2A 1X8PA 2G79A 2QOSC 3MVFA 4YH0A 4AYHA 2FT9A 3STMX 1GGLA 3ELXA 1KT5A 3BU1A 4OS0A 1O1VA 2W2BA 1X8QA 3WXQA 4AZNA 1ZNHA 3QKGA 1BSQA 1LKEA 4ZHHA 5FFHA 3UEXA 4TJZA 1E06A 3FELA 5JR8A 3CQNA 1ERXA 1SXYA 5L8OA 2MM3A 1BRPA 4NYRA 2AT3X 3DSZA 1OEJA 3FW5A 1SXWA 3FMZA 1A3YA 3OJYC 1QFTA 2FRSA 2JN3A 4ZH9A 4Y0PA 1YUPA 3APUA 4WFUA 4A60A 3KFHA 1CRBA 1HMRA 3MBTA 3U0DA 4LKPA 5F6ZA 1ZRYA 4YGZA 3BX7A 3VG5A 2X45A 1B0OA 2WQAE 1HQPA 4ZHFA 3STKA 1GX9A 1ERBA 1KXOA 1XCAA 2XKLA 1JZUA 2EU7X 5EEEA 5LJDA 2GTFX 5HA1A 4YGGA 3NP1A 4WFVA 2MJIA 4I3BA 3PH5A 2G78A 3TGBA 2OFRX 3UEUA 1QQSA 3FA7A 3ZUIA 1B8EA 2MO5A 3UEVA
chains in the Genus database with same CATH superfamily
4KIIA 4LZVA 2FKGA 2C1QA 3S60A 5L3YA 1MEPA 1SRIA 1U0XA 2F01A 2WWPA 4RUUA 1S44A 1VYOA 2FR2A 2X8FA 4GETA 1WUBA 1AQBA 1HMSA 2L5PA 1I05A 4O4UA 2RTEB 4MIRA 3U9PC 3B2IA 3PH6A 1VWBB 1N43A 3PDFA 1LF7A 4BX6B 3APWA 1VWCB 3WZOA 1SWRA 5KICA 2OL8O 1B56A 2OVSA 3SLOA 1S7DA 2FLJA 5EDCA 2IZAA 1MVGA 1SXUA 3BU9A 3S26A 1IKEA 1SWEA 1LCVA 2X55A 1FTPA 1JV4A 3HOEA 4GNYA 1KZWA 1O8VA 2RCQA 3FEPA 2NNEA 1SWOA 4AZPA 4XMHA 5BVTA 1RAVA 4YFPA 1G85A 2BS5A 2Y3FA 3E3CA 4M7MA 4U8UM 1KT3A 3FR2A 2RTOB 5D47A 2QM9A 2OFBA 4LKTA 1SWUA 2CZTA 2XSTA 1CBSA 1E02A 2L67A 1SWSA 1AVEA 1I06A 4QQ1A 2X8SA 1RSTB 5FQ8E 2Q9SA 3UEWA 2LA7A 3FYFA 3OD9A 1YP6A 1WBIA 1QWDA 3SLJA 5AQ6A 5HZQA 3RKGA 2OF8A 4ZGUA 4M6SA 4TKJA 2ZAGA 3FR4A 1VWHB 4L1NA 3BSZE 3ZQ3A 2IZKA 4Y0RA 4GK9A 4INNA 3CKGA 2ASNX 3C78X 2OY5O 5LJGA 4IAWA 2RTNB 1QABE 3NX2A 1GT3A 2WR6A 1LPJA 1LIDA 2P8GA 1P6PA 2HZQA 3B2LA 3O2YA 3PP6A 4KCAA 4IBAA 4YDBA 2LBVA 2A2UA 5LKEA 1FELA 5KHPA 2WQ9A 4QGWA 2RTJA 1VWGB 1CBRA 2ALLX 1EPAA 3HWFA 2AT8X 3RDQA 5D48A 3C76X 3ZI8A 1YWAA 3KQ0A 4HPBA 1DF3A 1I4UA 3BDRA 3VU1A 3AKMA 3AUMO 2OFMX 2X8TA 5D45A 1SRJA 4GGRA 5D4AA 1SA8A 2A3FX 2G7BA 3HWDA 3N91A 1NQMA 3P6HA 1X71A 3VHHA 2N93A 4Z27A 1SWGA 4GU8A 4ZH6A 3RDUA 4CK4A 4GKCA 5B10O 5H9NA 4UU3A 5IO6A 4NW4A 4CV7A 1RXKA 1EW3A 2RTMA 3QQ2A 3KFIA 2RD7C 1JMXA 1TOUA 4QNIA 1VPRA 3SAOA 2ACOA 3TGCA 1NP4A 2BSZA 1HQQA 4JNJA 3STNA 1LIFA 3P6DA 4YFRA 1PBOA 1CBQA 4GD9A 2FWVA 2AT6X 4FBVA 4N7DA 3IFBA 4GJSA 1JMZA 1MX8A 3VG3A 3KFFA 5IRAA 2GH7A 2WEWA 4NLJA 3D4RA 1ZNDA 4Z2PA 3CKFA 3VG4A 4NV8A 4QZUA 2GC9A 3P6GA 1AVDA 2RTGB 1S2PA 2JMBA 1Y0GA 2KT4B 5F7GA 4YBPA 1KL5A 1I04A 3PECA 5IO5A 1VWOB 3RSWA 1XKIA 1JJJA 1LIBA 3B2HA 1SWDA 2AT0X 3GE2A 4GGZA 1PM1X 1DZKA 2IZEB 2F09A 5BVSA 4ML7B 2DJGA 2LB6A 1RXJA 2GJ5A 2OL7A 2OVDA 3B2KA 4XMEA 1LICA 5AEOA 3FDCA 1EI5A 3WJFA 4COTA 3WYPA 1NDJA 1DZMA 1OBQA 1VWJB 2R73A 1SWAA 3FA9A 3WYQA 5CE4A 2WEXA 1MUPA 1VYGA 4GRJA 2CBRA 5HA0A 5B29A 2OVEA 1GKAA 4UU2A 1BWYA 4CSBA 1G74A 1T8VA 1UYNX 4KC8A 1K24A 1SWLA 1ICNA 4AZMA 4O9SA 5HBSA 2JU8A 4EXZA 2FS7A 4N7CA 1CBIA 2UYWA 1HY2A 3EW2A 3NR3A 4CPHA 3OBLA 1SLFB 1VYFA 1TVQA 1D2UA 1SWTA 4JO6A 1SWKA 2AKQA 1Y55X 5IXGA 5LJCA 4ZJ0A 1E00A 1BEBA 4GUZA 1EQDA 5HZ6A 1Y53X 1SLEB 4YMYA 2X34A 3PQUA 3EMMA 1BRQA 1N9YA 2JU7A 2RCTA 5HCDC 2W2FA 3ZW1B 3ZUOA 4AZOA 3RE5A 1JBHA 1KT7A 3B2JA 4BX7A 4DCBA 1OSPO 1ZNKA 2BS6A 1NGLA 1SWQA 3FA8A 2Y32A 4OKAA 1HXZA 1T0VA 4XMCA 2LFOA 1IIUA 1VWLB 1I78A 2G5LA 2GTLO 1AVGI 3EM0A 2VFCA 3D9WA 3HWGA 2QOMA 4MVEA 4GNWA 1IKJA 1DC9A 1NQNA 1ADLA 1ML7A 1HN2A 2R56A 4XMGA 1STRB 1GXAA 2OFAA 3ZW0A 1JJUA 1SWPA 3K3LA 3EC5A 4MVLA 3ZW0B 3Q6LA 1TW4A 2JOZA 5K68A 2MHDA 1CJ5A 2Z4HA 2OY7A 2AF5A 4BX5A 4DNEA 1JQPA 4YBUA 3HK1A 2IZGB 1SY3A 4D6BA 2A5CA 1VWIB 4GDZA 5D8JA 4QZTA 3HTYA 2W2AA 3I0AA 3P6FA 2M4LA 5EDBA 4CDFA 2RQ0A 1KFFA 1QFVA 2IZLB 4IAXA 3RDSA 2O62A 3MM0A 4I95A 1DV9A 1Z24A 2MWHA 4ID2A 2BC3A 3WZPA 2NNQA 1IFCA 2HZRA 4FBOA 3NQKA 5KIDA 1BLRA 3WBGA 2HKDA 3FW4A 3LHNA 4AZRA 3O19A 2YG2A 3CQRA 2BHVA 3CR6A 5K06A 3VG7A 1X8OA 4EKVA 1LNMA 3F6ZB 4QAEA 1VWRB 1BSOA 2RTKA 5H9AA 3F9DA 5C0NA 2CAMA 5HTDA 1FDQA 2UZ2A 1MDCA 4OMXA 1G7NA 3HWEA 1ZNGA 3D97A 4HFOA 4EQAC 3X00A 3T6FA 3FIDA 3H3IA 2CZUA 3APVA 2QO6A 4DQ3A 4I3CA 3CBSA 1SY2A 1QG5A 4I9SA 4RUNA 2IZCB 2VFBA 3APXA 4B55A 4NLIA 1SRFA 4MISA 4YGHA 4ALBA 1QY1A 3T2WA 1EPBA 1DZPA 4NNTA 5HZ8A 3SOTA 1E5PA 3BLGA 3KVNA 1STPA 2RTFB 3BS2A 3KZAA 3P6CA 4DQ4A 1U18A 3NBXX 5EEDA 1STSB 1ZNEA 2FR3A 3EBWA 1ZNLA 1VWEB 1N9MA 1RSUB 2KD2A 1RLBE 1N0SA 3GAQA 5DPQA 4ZCBA 4ALOA 4ARHA 2F73A 1SY1A 5B5FA 4O4OA 3NQ3A 1AB0A 2PY1A 4I3DA 2OY1O 1I9HA 3VHMA 2QO5A 4U3QA 1D3SA 1LDQA 4EFGA 1BM5A 3MX7A 1R0UA 4FGIB 3WOVA 2GTLN 2R74A 3RBYA 1L6MA 2L9CA 4GJVA 3RY2A 4BVMA 1AELA 1DF8A 5LJBA 1EIOA 5L8NA 3ZZVA 1IFBA 1DZJA 1UREA 1LDOA 1YP7A 2CBSA 1SXXA 2ZAIA 3LTWA 4KT5A 3NADA 4LQZA 1GX8A 3AKNA 1IW2A 2PI3O 2RTDB 5LKFA 2FS6A 3KFGA 5HCEC 4CPFA 3WJBA 5HZ5A 2AT5X 2Y3EA 2DM5A 1KT4A 2X32A 3FA6A 3JS1A 4Z6JA 1PBYA 2RTRB 2CM9A 3PEDA 1FENA 2WPUA 4PSQA 2AL0X 3L4RA 3C77X 4I60A 3VHIA 4NNSA 2WSJA 4JGLA 4QYPA 1ACDA 1GT1A 4HPCA 4MVKA 4OMWA 4ORRA 4C5PA 1B4MA 4Y0SA 2AH7X 4ZHGA 3SZJA 4A1HA 3IA8A 4CPEA 2IZBA 2POAA 1YWBA 4TNNA 5CHKA 4CDEA 2KTDA 5F1EA 3MG5A 5F6BA 2RTAA 2OVAA 1LELA 1NC9A 3T6LA 1X8UA 1GKAB 1KQWA 1X89A 3BY0A 4O3WA 5HAEA 2Q2MA 1SRHA 2OY8A 4ORYA 1QY0A 4OEMA 4YKOA 4D6AA 2X4MA 2OL6O 1TOWA 2A13A 4KC7A 1KT6A 3ELZA 2AMMX 4ZGFA 2LBAA 2A0AA 4YVBA 3PPTA 1ALBA 2L68A 3EBKA 4NYQA 4LZUA 4WHIA 5IRUA 4CPHB 4TKBA 1O1UA 1LFOA 1W4TA 1A18A 3PQSA 3I17A 3F8AA 1KOIA 3VGWA 5HWZA 5FAZA 4R0BA 3RZYA 2IZFB 3TGAA 1OBPA 4ZHDA 2KTSA 4ORSA 4IB6A 3O22A 5EZ2A 1BJ7A 2ANSA 1T68X 4U8UO 5H9KA 1KL3A 2X46A 2NNDA 4ES7A 1VWAB 2RTPB 1YIVA 3WVMA 4BX7B 1GM6A 1ICMA 1U17A 3BX8A 4BQUA 5AJCA 4ZFXA 3JSQA 4FBRA 4IB7A 4O3XB 1VWKB 2Z4IA 3JQOA 4I6SA 4QRLA 2G8CO 3VG6A 5IRWA 1VWQB 4I9RA 4EDEA 1HBQA 1HXLA 1SLDB 1PMPA 1UYOX 2FHNX 2JGSA 3P6EA 1QY2A 1G5WA 1Y9TA 4HPAA 5H9LA 3T2XA 2IFBA 3FLLA 1A2DA 3D95A 1PEEA 3TF6A 4GE1A 2RTBB 1MK5A 2C1SA 4GGTA 4BBOA 1A57A 1MX7A 1TXLA 1N4JA 4Z2VA 1GT5A 4AZQA 3EYCA 1OPAA 3VPJE 4BX5B 1KGLA 1FE3A 3RDXA 2OZQA 1YWDA 4ORWA 4TLJA 5HTEA 3RDOA 2X56A 2Q39A 2IZDB 2Q2PA 2QO4A 3SLTA 5F2BA 1EIIA 5H8TA 1EALA 4ODDA 3FENA 4BOEA 5HCCC 2IZIA 4IB8A 3TZSA 3V8UA 1VWFB 4KH8A 4YCHA 5JD2A 2BLGA 4BX6A 1H91A 3HPEA 1YWCA 4L3RA 3SZIA 4OS3A 2FTBA 4YKMA 1UZ2X 3ZWEA 1JIWI 1SWFA 1BBPA 4Z28A 4AW8A 4BCSA 5BVQA 1RBPA 3WJDA 3D96A 1OPBA 5IO7A 4WBKA 3NX1A 5CYBA 1OBUA 1X8NA 2KW1A 4EEJA 2ACPX 4YCEA 4CDDA 3ZW2A 1SWJA 1PTSA 5FENA 2FKJA 4BGFA 1VWMB 1KZXA 3Q34A 4GH7A 1RXHA 1FEMA 4O3YA 2JU3A 3DTQA 3NPOA 3T1DA 3VE2A 2I5ZO 2A5BA 4ZHCA 4CPIA 3FIQA 5CSEA 1EUOA 2I5VO 4IMOA 2FGSA 4ORXA 4K19A 5B27A 5HZ9A 1JYDA 1SRGA 2HYSA 1JYJA 4GZVA 4OS8A 4QGXA 4HWMA 4MVIA 2CM4A 2GTLM 2RTHB 2WUTA 3AEHA 5AJBA 4NP1A 3CWKA 4HPDA 1LCZA 2HNXA 4IMNA 2FHLA 4TKHA 1LUQA 2C4IA 2QMIA 5FQ6E 5LJKA 5EPQA 1MM9A 4OELA 2K23A 1SY0A 3WJCA 1Y9LA 4FQBB 4A8ZA 3FEKA 4MEEA 4U8UN 3NQ9A 1DFVA 4ZR2A 4GDAA 2MF6A 2Q4NA 3BRNA 2OYBO 5LJEA 1EXSA 5LJHA 2RTIB 2LKKA 1BSYA 4ORUA 1NP1A 3CMPA 2HMBA 2NP1A 4IRWA 5F58A 2RA6A 4XMDA 5L8IA 3WJEA 1SWHA 4Y59A 1JJXA 4PJ2A 4YDAA 1Y52X 1FJ1E 3CBCA 2K62A 2RTLA 1OEEA 4QYNA 2A2GA 5DG4A 2BT9A 4O4SA 3WJGA 2E4JA 1N7YA 3G7XA 4Z2OA 5B2AO 1HMTA 1OEKA 2HLVA 4IB9A 1SWCA 4XMFA 1GT4A 1SMPI 3U03A 1SREA 1LIEA 1KQXA 3RDMA 1SWBA 5K67A 3FR5A 1HBPA 4Y0QA 4YFQA 3S5XA 2RN4A 4QGVA 4A1YA 3PK2A 4NV7A 3VG2A 1SWNA 2IZHB 1X8PA 2G79A 3P24A 1IJ8A 2QOSC 4BJ8A 3RWXA 3MVFA 4YH0A 4AYHA 4TQ2A 3WZNA 2FT9A 3STMX 1GGLA 3ELXA 1KT5A 2JW1A 3VE1A 3BU1A 1E2TA 4OS0A 3OE3A 5BYPA 1O1VA 2W2BA 1X8QA 1K3BA 3WXQA 4ON1A 4AZNA 1ZNHA 4U9CA 1GX3A 3QKGA 1BSQA 1LKEA 2OF9A 3HOLA 5FFHA 3UEXA 4TJZA 1E06A 3FELA 4ZHHA 2ZSCA 5JR8A 3CQNA 1ERXA 4JHQA 1SXYA 5L8OA 2MM3A 1BRPA 4NYRA 4U46A 2AT3X 4Y5DA 3RY1A 3S5VA 3DSZA 1OEJA 3FW5A 1SXWA 3UAQA 2YMSA 3FMZA 1VWPB 1A3YA 4CDCA 3OJYC 1QFTA 2FRSA 2JN3A 5B3MO 4ZH9A 4Y0PA 1YUPA 3APUA 4WFUA 2RTQB 4A60A 3KFHA 4O49A 1CRBA 1MOYA 1HMRA 3MBTA 3U0DA 4LKPA 3LV4A 3RE6A 1VWNB 5F6ZA 1NBXA 1ZRYA 4YGZA 3BX7A 2DJFA 3VG5A 2X45A 3WZQA 1B0OA 5FQ7E 2WQAE 1HQPA 1LCWA 2RTCB 1W5RA 3STKA 1GX9A 1ERBA 1KXOA 1KL4A 1XCAA 2XKLA 4ZHFA 1JZUA 1SLGB 2EU7X 5EEEA 5LJDA 2GTFX 2QCBA 5HA1A 4YGGA 3NP1A 3SZHA 4WFVA 2MJIA 4I3BA 3ZW1A 3PH5A 2G78A 1W6FA 3TGBA 3P02A 2OFRX 5B5GA 3EW1A 2VDFA 4IABA 2AVIA 5B11O 2A8GA 4O3ZA 3UEUA 1QQSA 3FA7A 4O4XA 3ZUIA 1B8EA 2MO5A 2IZJA 3UEVA 1VWDB
chains in the Genus database with same CATH topology
4KIIA 4LZVA 3S60A 2WWPA 4RUUA 1U0XA 1S44A 2FR2A 2X8FA 4GETA 1AQBA 1HMSA 2L5PA 1I05A 4O4UA 3U9PC 4MIRA 3B2IA 3PH6A 1LF7A 3APWA 5KICA 1B56A 2OVSA 1S7DA 2FLJA 5EDCA 1MVGA 1SXUA 3BU9A 3S26A 1IKEA 1FTPA 1JV4A 3HOEA 4GNYA 1KZWA 1O8VA 2RCQA 3FEPA 2NNEA 4AZPA 4XMHA 5BVTA 4YFPA 1G85A 2BS5A 3E3CA 4M7MA 4U8UM 1KT3A 3FR2A 5D47A 2QM9A 4LKTA 2CZTA 2XSTA 1CBSA 1E02A 2L67A 1I06A 4QQ1A 2X8SA 5FQ8E 3UEWA 2Q9SA 2LA7A 3FYFA 3OD9A 1YP6A 1QWDA 5AQ6A 5HZQA 3RKGA 4ZGUA 4M6SA 4TKJA 2ZAGA 3FR4A 4L1NA 3BSZE 3ZQ3A 4Y0RA 4GK9A 4INNA 2ASNX 3C78X 5LJGA 4IAWA 1QABE 3NX2A 1GT3A 2WR6A 1LPJA 1LIDA 2P8GA 1P6PA 2HZQA 3B2LA 3O2YA 3PP6A 4KCAA 4IBAA 4YDBA 2LBVA 2A2UA 5LKEA 1FELA 5KHPA 2WQ9A 4QGWA 1CBRA 2ALLX 1EPAA 3HWFA 2AT8X 5D48A 3C76X 3ZI8A 1YWAA 3KQ0A 4HPBA 1DF3A 1I4UA 3BDRA 3VU1A 3AKMA 2OFMX 2X8TA 5D45A 5D4AA 1SA8A 2A3FX 2G7BA 3HWDA 3N91A 3P6HA 1X71A 2N93A 4GU8A 4ZH6A 4CK4A 5IO6A 4GKCA 5H9NA 4UU3A 4NW4A 4CV7A 1EW3A 3KFIA 2RD7C 1TOUA 4QNIA 3SAOA 1VPRA 2ACOA 3TGCA 1NP4A 3STNA 1LIFA 3P6DA 4YFRA 1PBOA 1CBQA 2FWVA 2AT6X 4FBVA 4N7DA 3IFBA 1MX8A 3VG3A 3KFFA 2WEWA 4NLJA 3D4RA 1ZNDA 3VG4A 4QZUA 2GC9A 3P6GA 4YBPA 5F7GA 1S2PA 2JMBA 2KT4B 1I04A 3PECA 5IO5A 3RSWA 1JJJA 1XKIA 1LIBA 3B2HA 2AT0X 3GE2A 1PM1X 1DZKA 2F09A 5BVSA 4ML7B 2LB6A 2GJ5A 2OVDA 3B2KA 4XMEA 5AEOA 1LICA 1EI5A 3WJFA 4COTA 1DZMA 1OBQA 2R73A 3FA9A 2WEXA 1MUPA 1VYGA 4GRJA 2CBRA 5HA0A 5B29A 2OVEA 1GKAA 4UU2A 1BWYA 4CSBA 1G74A 1T8VA 4KC8A 1ICNA 4AZMA 4O9SA 5HBSA 2JU8A 4EXZA 2FS7A 4N7CA 1CBIA 3NR3A 3OBLA 1VYFA 1TVQA 1D2UA 2AKQA 5LJCA 4ZJ0A 1E00A 1BEBA 1EQDA 5HZ6A 4YMYA 3PQUA 3EMMA 1BRQA 2JU7A 2RCTA 5HCDC 2W2FA 3ZW1B 3ZUOA 4AZOA 1JBHA 1KT7A 3B2JA 1ZNKA 2BS6A 1NGLA 3FA8A 4XMCA 1T0VA 2LFOA 1IIUA 2GTLO 1AVGI 3EM0A 3HWGA 4MVEA 4GNWA 1IKJA 1DC9A 4XMGA 1ADLA 1ML7A 1HN2A 2R56A 3ZW0A 1GXAA 3K3LA 3ZW0B 4MVLA 3Q6LA 1TW4A 2JOZA 2MHDA 1CJ5A 2Z4HA 4YBUA 3HK1A 1SY3A 4D6BA 5EDBA 4GDZA 5D8JA 4QZTA 3HTYA 2W2AA 3I0AA 3P6FA 2M4LA 2RQ0A 1QFVA 4IAXA 2O62A 4I95A 1DV9A 1Z24A 2MWHA 4ID2A 2NNQA 1IFCA 2HZRA 4FBOA 3NQKA 5KIDA 1BLRA 3WBGA 3FW4A 3LHNA 4AZRA 3O19A 2YG2A 3CQRA 2BHVA 3CR6A 5K06A 3VG7A 1X8OA 1LNMA 3F6ZB 4QAEA 1BSOA 5H9AA 3F9DA 5C0NA 5HTDA 1FDQA 1MDCA 4OMXA 1G7NA 3HWEA 1ZNGA 3D97A 4HFOA 4EQAC 3H3IA 2CZUA 3APVA 2QO6A 4DQ3A 4I3CA 3CBSA 1SY2A 1QG5A 4I9SA 4RUNA 3APXA 4NLIA 4MISA 4ALBA 4YGHA 1QY1A 1EPBA 1DZPA 4NNTA 5HZ8A 3SOTA 1E5PA 3BLGA 3P6CA 3BS2A 3KZAA 4DQ4A 1U18A 3NBXX 5EEDA 1ZNEA 2FR3A 3EBWA 1ZNLA 2KD2A 4ALOA 3GAQA 5DPQA 1RLBE 1N0SA 4ZCBA 4ARHA 2F73A 1SY1A 4O4OA 3NQ3A 1AB0A 2PY1A 4I3DA 2QO5A 4U3QA 1D3SA 4EFGA 1BM5A 3MX7A 1R0UA 4FGIB 3WOVA 2GTLN 2R74A 3RBYA 1L6MA 2L9CA 4BVMA 1AELA 5LJBA 1EIOA 5L8NA 3ZZVA 1IFBA 1DZJA 1UREA 1YP7A 2CBSA 2ZAIA 1SXXA 4KT5A 4LQZA 4TQ2A 3NADA 1GX8A 3AKNA 1IW2A 5LKFA 2FS6A 3KFGA 5HCEC 5HZ5A 3WJBA 2AT5X 2DM5A 1KT4A 3FA6A 3JS1A 2CM9A 3PEDA 1FENA 4PSQA 2AL0X 3L4RA 3C77X 4NNSA 2WSJA 4JGLA 4QYPA 1ACDA 1GT1A 4HPCA 4MVKA 4OMWA 4ORRA 1B4MA 4Y0SA 2AH7X 4ZHGA 4A1HA 3IA8A 2POAA 1YWBA 4TNNA 2KTDA 5F1EA 5F6BA 2OVAA 1X8UA 1GKAB 1KQWA 1X89A 3BY0A 4O3WA 5HAEA 2Q2MA 4ORYA 4YKOA 1QY0A 4D6AA 4KC7A 1TOWA 2A13A 1KT6A 3ELZA 2AMMX 4ZGFA 2LBAA 2A0AA 3PPTA 1ALBA 2L68A 3EBKA 4NYQA 4LZUA 4WHIA 4TKBA 1O1UA 1LFOA 1A18A 3PQSA 3I17A 3F8AA 1KOIA 5HWZA 5FAZA 4R0BA 3RZYA 3TGAA 1OBPA 4ZHDA 2KTSA 4ORSA 4IB6A 3O22A 5EZ2A 1BJ7A 2ANSA 1T68X 4U8UO 5H9KA 2X46A 2NNDA 4ES7A 1YIVA 3WVMA 1GM6A 1ICMA 1U17A 3BX8A 4BQUA 5AJCA 4ZFXA 3JSQA 4FBRA 4IB7A 4O3XB 2Z4IA 3JQOA 4QRLA 4I6SA 3VG6A 4I9RA 4EDEA 1HBQA 3P6EA 1PMPA 1QY2A 1G5WA 1Y9TA 4HPAA 5H9LA 2IFBA 3FLLA 1A2DA 3D95A 1PEEA 3TF6A 4GE1A 1A57A 1MX7A 1TXLA 1GT5A 4AZQA 3EYCA 1OPAA 3VPJE 1KGLA 1FE3A 2OZQA 1YWDA 4ORWA 4TLJA 5HTEA 2Q39A 2Q2PA 2QO4A 1EIIA 5H8TA 1EALA 4ODDA 3FENA 4BOEA 5HCCC 4IB8A 3TZSA 3V8UA 4KH8A 4YCHA 2BLGA 1H91A 1YWCA 4L3RA 4OS3A 2FTBA 4YKMA 1UZ2X 3ZWEA 1JIWI 1BBPA 4AW8A 5BVQA 1RBPA 3WJDA 3D96A 1OPBA 5IO7A 4WBKA 3NX1A 5CYBA 1OBUA 1X8NA 2KW1A 4EEJA 2ACPX 4YCEA 3ZW2A 5FENA 1KZXA 4GH7A 1FEMA 4O3YA 2JU3A 3DTQA 3NPOA 3T1DA 3VE2A 4ZHCA 3FIQA 1EUOA 4ORXA 4IMOA 5B27A 5HZ9A 4K19A 1JYDA 4GZVA 2HYSA 1JYJA 4OS8A 4QGXA 4HWMA 4MVIA 2CM4A 2GTLM 2WUTA 5AJBA 4NP1A 3CWKA 4HPDA 2HNXA 5CE4A 4IMNA 4TKHA 2QMIA 5FQ6E 5LJKA 5EPQA 2K23A 1SY0A 3WJCA 1Y9LA 4FQBB 4A8ZA 3FEKA 4U8UN 3NQ9A 1DFVA 4ZR2A 2Q4NA 3BRNA 5LJEA 1EXSA 5LJHA 2LKKA 1BSYA 4ORUA 1NP1A 3CMPA 2HMBA 2NP1A 5F58A 2RA6A 4XMDA 5L8IA 3WJEA 1JJXA 4PJ2A 4YDAA 3CBCA 2K62A 1OEEA 4QYNA 2A2GA 5DG4A 2BT9A 4O4SA 3WJGA 2E4JA 3G7XA 1HMTA 1OEKA 2HLVA 4IB9A 4XMFA 3U03A 1GT4A 1SMPI 1LIEA 1KQXA 3FR5A 1HBPA 4Y0QA 4YFQA 3S5XA 2RN4A 4QGVA 4A1YA 3VG2A 1X8PA 2G79A 3P24A 2QOSC 3RWXA 3MVFA 4YH0A 4AYHA 2FT9A 3STMX 1GGLA 3ELXA 1KT5A 2JW1A 3VE1A 3BU1A 4OS0A 3OE3A 5BYPA 1O1VA 2W2BA 1X8QA 3WXQA 4ON1A 4AZNA 1ZNHA 4U9CA 3QKGA 1BSQA 1LKEA 4ZHHA 3HOLA 5FFHA 3UEXA 4TJZA 1E06A 3FELA 5JR8A 3CQNA 1ERXA 1SXYA 5L8OA 2MM3A 1BRPA 4NYRA 2AT3X 3S5VA 3DSZA 1OEJA 3FW5A 1SXWA 3UAQA 2YMSA 3FMZA 1A3YA 3OJYC 1QFTA 2FRSA 2JN3A 4ZH9A 4Y0PA 1YUPA 3APUA 4WFUA 4A60A 3KFHA 4O49A 1CRBA 1HMRA 3MBTA 3U0DA 4LKPA 3LV4A 5F6ZA 1ZRYA 4YGZA 3BX7A 3VG5A 2X45A 1B0OA 5FQ7E 2WQAE 1HQPA 4ZHFA 3STKA 1GX9A 1ERBA 1KXOA 1XCAA 2XKLA 1JZUA 2EU7X 5EEEA 5LJDA 2GTFX 5HA1A 4YGGA 3NP1A 4WFVA 2MJIA 4I3BA 3ZW1A 3PH5A 2G78A 3TGBA 3P02A 2OFRX 4IABA 4O3ZA 3UEUA 1QQSA 3FA7A 4O4XA 3ZUIA 1B8EA 2MO5A 3UEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KII A;  4LZV A;  2WWP A;  4RUU A;  1U0X A;  1S44 A;  2FR2 A;  4GET A;  1AQB A;  1HMS A;  2L5P A;  1I05 A;  3U9P C;  3B2I A;  3PH6 A;  1LF7 A;  3APW A;  5KIC A;  1B56 A;  1S7D A;  2FLJ A;  5EDC A;  1MVG A;  1SXU A;  3BU9 A;  3S26 A;  1IKE A;  1FTP A;  1JV4 A;  4GNY A;  1KZW A;  1O8V A;  2RCQ A;  3FEP A;  2NNE A;  4AZP A;  4XMH A;  5BVT A;  4YFP A;  1G85 A;  4M7M A;  1KT3 A;  3FR2 A;  5D47 A;  2QM9 A;  4LKT A;  2CZT A;  2XST A;  1CBS A;  1E02 A;  2L67 A;  1I06 A;  3UEW A;  2Q9S A;  1YP6 A;  1QWD A;  5AQ6 A;  5HZQ A;  4ZGU A;  4M6S A;  4TKJ A;  3FR4 A;  3BSZ E;  3ZQ3 A;  4Y0R A;  2ASN X;  3C78 X;  5LJG A;  4IAW A;  1QAB E;  3NX2 A;  1GT3 A;  2WR6 A;  1LPJ A;  1LID A;  2P8G A;  1P6P A;  2HZQ A;  3B2L A;  3O2Y A;  3PP6 A;  4YDB A;  4IBA A;  2LBV A;  2A2U A;  5LKE A;  1FEL A;  5KHP A;  2WQ9 A;  4QGW A;  1CBR A;  2ALL X;  1EPA A;  3HWF A;  2AT8 X;  5D48 A;  3C76 X;  1YWA A;  3KQ0 A;  4HPB A;  1DF3 A;  1I4U A;  3BDR A;  3AKM A;  2OFM X;  5D45 A;  5D4A A;  1SA8 A;  2A3F X;  2G7B A;  3HWD A;  3P6H A;  1X71 A;  2N93 A;  5IO6 A;  4ZH6 A;  4CK4 A;  4GKC A;  5H9N A;  4UU3 A;  1EW3 A;  3KFI A;  2RD7 C;  1TOU A;  3SAO A;  1VPR A;  2ACO A;  3TGC A;  1NP4 A;  3STN A;  1LIF A;  3P6D A;  4YFR A;  1PBO A;  1CBQ A;  2FWV A;  2AT6 X;  4N7D A;  3IFB A;  1MX8 A;  3VG3 A;  3KFF A;  2WEW A;  4NLJ A;  1ZND A;  3VG4 A;  4QZU A;  2GC9 A;  3P6G A;  4YBP A;  5F7G A;  1S2P A;  2KT4 B;  1I04 A;  3PEC A;  5IO5 A;  3RSW A;  1JJJ A;  1XKI A;  1LIB A;  3B2H A;  2AT0 X;  1PM1 X;  1DZK A;  5BVS A;  2LB6 A;  2GJ5 A;  2OVD A;  3B2K A;  4XME A;  1LIC A;  3WJF A;  1DZM A;  1OBQ A;  2R73 A;  3FA9 A;  2WEX A;  1MUP A;  1VYG A;  4GRJ A;  2CBR A;  5HA0 A;  5B29 A;  2OVE A;  1GKA A;  4UU2 A;  1BWY A;  1G74 A;  1T8V A;  1ICN A;  4AZM A;  4O9S A;  5HBS A;  2JU8 A;  4EXZ A;  2FS7 A;  4N7C A;  1CBI A;  3NR3 A;  1VYF A;  1TVQ A;  1D2U A;  2AKQ A;  5LJC A;  4ZJ0 A;  1E00 A;  1BEB A;  1EQD A;  5HZ6 A;  4YMY A;  3EMM A;  1BRQ A;  2JU7 A;  2RCT A;  5HCD C;  2W2F A;  4AZO A;  3ZUO A;  1JBH A;  1KT7 A;  3B2J A;  1ZNK A;  1NGL A;  3FA8 A;  4XMC A;  1T0V A;  2LFO A;  1IIU A;  1AVG I;  3EM0 A;  3HWG A;  4GNW A;  1IKJ A;  1DC9 A;  4XMG A;  1ADL A;  1ML7 A;  1HN2 A;  2R56 A;  1GXA A;  3K3L A;  4MVL A;  3Q6L A;  1TW4 A;  2JOZ A;  1CJ5 A;  4YBU A;  3HK1 A;  1SY3 A;  4D6B A;  5EDB A;  5D8J A;  4QZT A;  3I0A A;  2W2A A;  3P6F A;  2RQ0 A;  1QFV A;  4IAX A;  2O62 A;  1DV9 A;  1Z24 A;  2NNQ A;  1IFC A;  2HZR A;  5KID A;  1BLR A;  3WBG A;  3FW4 A;  4AZR A;  3O19 A;  2YG2 A;  3CQR A;  3CR6 A;  5K06 A;  3VG7 A;  1X8O A;  1LNM A;  4QAE A;  1BSO A;  5H9A A;  3F9D A;  5C0N A;  5HTD A;  1FDQ A;  1MDC A;  4OMX A;  1G7N A;  3HWE A;  1ZNG A;  3D97 A;  4HFO A;  2CZU A;  3APV A;  2QO6 A;  4DQ3 A;  4I3C A;  3CBS A;  1SY2 A;  1QG5 A;  4I9S A;  4RUN A;  3APX A;  4NLI A;  4ALB A;  4YGH A;  1QY1 A;  1EPB A;  1DZP A;  4NNT A;  5HZ8 A;  1E5P A;  3BLG A;  3P6C A;  3BS2 A;  3KZA A;  4DQ4 A;  1U18 A;  5EED A;  1ZNE A;  2FR3 A;  3EBW A;  1ZNL A;  4ALO A;  3GAQ A;  5DPQ A;  1RLB E;  1N0S A;  4ZCB A;  4ARH A;  2F73 A;  1SY1 A;  3NQ3 A;  1AB0 A;  2PY1 A;  4I3D A;  2QO5 A;  1D3S A;  4EFG A;  1BM5 A;  1R0U A;  2R74 A;  1L6M A;  2L9C A;  4BVM A;  1AEL A;  5LJB A;  1EIO A;  5L8N A;  1IFB A;  1DZJ A;  1URE A;  1YP7 A;  2CBS A;  4TQ2 A;  1SXX A;  3NAD A;  1GX8 A;  3AKN A;  1IW2 A;  5LKF A;  2FS6 A;  3KFG A;  5HCE C;  5HZ5 A;  3WJB A;  2AT5 X;  2DM5 A;  1KT4 A;  3FA6 A;  3JS1 A;  2CM9 A;  3PED A;  1FEN A;  4PSQ A;  2AL0 X;  3L4R A;  3C77 X;  4NNS A;  2WSJ A;  4QYP A;  1ACD A;  1GT1 A;  4HPC A;  4MVK A;  4OMW A;  4ORR A;  1B4M A;  4Y0S A;  2AH7 X;  4ZHG A;  4A1H A;  3IA8 A;  2POA A;  1YWB A;  4TNN A;  2KTD A;  5F1E A;  5F6B A;  2OVA A;  1X8U A;  1GKA B;  1KQW A;  1X89 A;  3BY0 A;  5HAE A;  2Q2M A;  4ORY A;  4YKO A;  1QY0 A;  4D6A A;  1TOW A;  2A13 A;  1KT6 A;  3ELZ A;  2AMM X;  2LBA A;  2A0A A;  3PPT A;  1ALB A;  2L68 A;  3EBK A;  4NYQ A;  4LZU A;  4TKB A;  1O1U A;  1LFO A;  1A18 A;  3I17 A;  3F8A A;  1KOI A;  5HWZ A;  5FAZ A;  4R0B A;  3RZY A;  3TGA A;  1OBP A;  4ZHD A;  4ORS A;  4IB6 A;  3O22 A;  5EZ2 A;  1BJ7 A;  2ANS A;  1T68 X;  5H9K A;  2X46 A;  2NND A;  4ES7 A;  1YIV A;  3WVM A;  1GM6 A;  1ICM A;  1U17 A;  3BX8 A;  4BQU A;  4ZFX A;  3JSQ A;  4IB7 A;  3VG6 A;  4I9R A;  4EDE A;  1HBQ A;  3P6E A;  1PMP A;  1QY2 A;  1G5W A;  4HPA A;  5H9L A;  2IFB A;  3FLL A;  1A2D A;  3D95 A;  1PEE A;  3TF6 A;  4GE1 A;  1A57 A;  1MX7 A;  1TXL A;  1GT5 A;  4AZQ A;  3EYC A;  1OPA A;  1KGL A;  1FE3 A;  2OZQ A;  1YWD A;  4ORW A;  4TLJ A;  5HTE A;  2Q39 A;  2Q2P A;  2QO4 A;  1EII A;  5H8T A;  1EAL A;  4ODD A;  3FEN A;  4BOE A;  5HCC C;  4IB8 A;  3TZS A;  4YCH A;  2BLG A;  1H91 A;  1YWC A;  4OS3 A;  2FTB A;  4YKM A;  1UZ2 X;  1BBP A;  4AW8 A;  5BVQ A;  1RBP A;  3WJD A;  3D96 A;  1OPB A;  5IO7 A;  4WBK A;  3NX1 A;  1OBU A;  1X8N A;  4EEJ A;  2ACP X;  4YCE A;  5FEN A;  1KZX A;  4GH7 A;  1FEM A;  2JU3 A;  3DTQ A;  3NPO A;  3T1D A;  4ZHC A;  3FIQ A;  1EUO A;  4ORX A;  4IMO A;  5B27 A;  5HZ9 A;  4K19 A;  1JYD A;  4QGX A;  2HYS A;  1JYJ A;  4OS8 A;  4MVI A;  2CM4 A;  2WUT A;  4NP1 A;  3CWK A;  4HPD A;  2HNX A;  5CE4 A;  4IMN A;  4TKH A;  5LJK A;  5EPQ A;  2K23 A;  1SY0 A;  3WJC A;  4A8Z A;  3FEK A;  3NQ9 A;  1DFV A;  4ZR2 A;  2Q4N A;  3BRN A;  5LJE A;  1EXS A;  5LJH A;  2LKK A;  1BSY A;  4ORU A;  1NP1 A;  3CMP A;  2HMB A;  2NP1 A;  5F58 A;  2RA6 A;  4XMD A;  5L8I A;  3WJE A;  1JJX A;  4YDA A;  3CBC A;  2K62 A;  1OEE A;  4QYN A;  2A2G A;  5DG4 A;  3WJG A;  2E4J A;  3G7X A;  1HMT A;  1OEK A;  2HLV A;  4IB9 A;  4XMF A;  3U03 A;  1GT4 A;  1LIE A;  1KQX A;  3FR5 A;  1HBP A;  4Y0Q A;  4YFQ A;  4QGV A;  4A1Y A;  3VG2 A;  1X8P A;  2G79 A;  2QOS C;  3MVF A;  4YH0 A;  4AYH A;  2FT9 A;  3STM X;  1GGL A;  3ELX A;  1KT5 A;  3BU1 A;  4OS0 A;  1O1V A;  2W2B A;  1X8Q A;  3WXQ A;  4AZN A;  1ZNH A;  3QKG A;  1BSQ A;  1LKE A;  4ZHH A;  5FFH A;  3UEX A;  4TJZ A;  1E06 A;  3FEL A;  5JR8 A;  3CQN A;  1ERX A;  1SXY A;  5L8O A;  2MM3 A;  1BRP A;  4NYR A;  2AT3 X;  3DSZ A;  1OEJ A;  3FW5 A;  1SXW A;  3FMZ A;  1A3Y A;  3OJY C;  1QFT A;  2FRS A;  2JN3 A;  4ZH9 A;  4Y0P A;  1YUP A;  3APU A;  4WFU A;  4A60 A;  3KFH A;  1CRB A;  1HMR A;  3MBT A;  3U0D A;  4LKP A;  5F6Z A;  1ZRY A;  4YGZ A;  3BX7 A;  3VG5 A;  2X45 A;  1B0O A;  2WQA E;  1HQP A;  4ZHF A;  3STK A;  1GX9 A;  1ERB A;  1KXO A;  1XCA A;  2XKL A;  1JZU A;  2EU7 X;  5EEE A;  5LJD A;  2GTF X;  5HA1 A;  4YGG A;  3NP1 A;  4WFV A;  2MJI A;  4I3B A;  3PH5 A;  2G78 A;  3TGB A;  2OFR X;  3UEU A;  1QQS A;  3FA7 A;  3ZUI A;  1B8E A;  2MO5 A;  3UEV A; 
#chains in the Genus database with same CATH topology
 4KII A;  4LZV A;  2FKG A;  2C1Q A;  3S60 A;  5L3Y A;  1MEP A;  1SRI A;  1U0X A;  2F01 A;  2WWP A;  4RUU A;  1S44 A;  1VYO A;  2FR2 A;  2X8F A;  4GET A;  1WUB A;  1AQB A;  1HMS A;  2L5P A;  1I05 A;  4O4U A;  2RTE B;  4MIR A;  3U9P C;  3B2I A;  3PH6 A;  1VWB B;  1N43 A;  3PDF A;  1LF7 A;  4BX6 B;  3APW A;  1VWC B;  3WZO A;  1SWR A;  5KIC A;  2OL8 O;  1B56 A;  2OVS A;  3SLO A;  1S7D A;  2FLJ A;  5EDC A;  2IZA A;  1MVG A;  1SXU A;  3BU9 A;  3S26 A;  1IKE A;  1SWE A;  1LCV A;  2X55 A;  1FTP A;  1JV4 A;  3HOE A;  4GNY A;  1KZW A;  1O8V A;  2RCQ A;  3FEP A;  2NNE A;  1SWO A;  4AZP A;  4XMH A;  5BVT A;  1RAV A;  4YFP A;  1G85 A;  2BS5 A;  2Y3F A;  3E3C A;  4M7M A;  4U8U M;  1KT3 A;  3FR2 A;  2RTO B;  5D47 A;  2QM9 A;  2OFB A;  4LKT A;  1SWU A;  2CZT A;  2XST A;  1CBS A;  1E02 A;  2L67 A;  1SWS A;  1AVE A;  1I06 A;  4QQ1 A;  2X8S A;  1RST B;  5FQ8 E;  2Q9S A;  3UEW A;  2LA7 A;  3FYF A;  3OD9 A;  1YP6 A;  1WBI A;  1QWD A;  3SLJ A;  5AQ6 A;  5HZQ A;  3RKG A;  2OF8 A;  4ZGU A;  4M6S A;  4TKJ A;  2ZAG A;  3FR4 A;  1VWH B;  4L1N A;  3BSZ E;  3ZQ3 A;  2IZK A;  4Y0R A;  4GK9 A;  4INN A;  3CKG A;  2ASN X;  3C78 X;  2OY5 O;  5LJG A;  4IAW A;  2RTN B;  1QAB E;  3NX2 A;  1GT3 A;  2WR6 A;  1LPJ A;  1LID A;  2P8G A;  1P6P A;  2HZQ A;  3B2L A;  3O2Y A;  3PP6 A;  4KCA A;  4IBA A;  4YDB A;  2LBV A;  2A2U A;  5LKE A;  1FEL A;  5KHP A;  2WQ9 A;  4QGW A;  2RTJ A;  1VWG B;  1CBR A;  2ALL X;  1EPA A;  3HWF A;  2AT8 X;  3RDQ A;  5D48 A;  3C76 X;  3ZI8 A;  1YWA A;  3KQ0 A;  4HPB A;  1DF3 A;  1I4U A;  3BDR A;  3VU1 A;  3AKM A;  3AUM O;  2OFM X;  2X8T A;  5D45 A;  1SRJ A;  4GGR A;  5D4A A;  1SA8 A;  2A3F X;  2G7B A;  3HWD A;  3N91 A;  1NQM A;  3P6H A;  1X71 A;  3VHH A;  2N93 A;  4Z27 A;  1SWG A;  4GU8 A;  4ZH6 A;  3RDU A;  4CK4 A;  4GKC A;  5B10 O;  5H9N A;  4UU3 A;  5IO6 A;  4NW4 A;  4CV7 A;  1RXK A;  1EW3 A;  2RTM A;  3QQ2 A;  3KFI A;  2RD7 C;  1JMX A;  1TOU A;  4QNI A;  1VPR A;  3SAO A;  2ACO A;  3TGC A;  1NP4 A;  2BSZ A;  1HQQ A;  4JNJ A;  3STN A;  1LIF A;  3P6D A;  4YFR A;  1PBO A;  1CBQ A;  4GD9 A;  2FWV A;  2AT6 X;  4FBV A;  4N7D A;  3IFB A;  4GJS A;  1JMZ A;  1MX8 A;  3VG3 A;  3KFF A;  5IRA A;  2GH7 A;  2WEW A;  4NLJ A;  3D4R A;  1ZND A;  4Z2P A;  3CKF A;  3VG4 A;  4NV8 A;  4QZU A;  2GC9 A;  3P6G A;  1AVD A;  2RTG B;  1S2P A;  2JMB A;  1Y0G A;  2KT4 B;  5F7G A;  4YBP A;  1KL5 A;  1I04 A;  3PEC A;  5IO5 A;  1VWO B;  3RSW A;  1XKI A;  1JJJ A;  1LIB A;  3B2H A;  1SWD A;  2AT0 X;  3GE2 A;  4GGZ A;  1PM1 X;  1DZK A;  2IZE B;  2F09 A;  5BVS A;  4ML7 B;  2DJG A;  2LB6 A;  1RXJ A;  2GJ5 A;  2OL7 A;  2OVD A;  3B2K A;  4XME A;  1LIC A;  5AEO A;  3FDC A;  1EI5 A;  3WJF A;  4COT A;  3WYP A;  1NDJ A;  1DZM A;  1OBQ A;  1VWJ B;  2R73 A;  1SWA A;  3FA9 A;  3WYQ A;  5CE4 A;  2WEX A;  1MUP A;  1VYG A;  4GRJ A;  2CBR A;  5HA0 A;  5B29 A;  2OVE A;  1GKA A;  4UU2 A;  1BWY A;  4CSB A;  1G74 A;  1T8V A;  1UYN X;  4KC8 A;  1K24 A;  1SWL A;  1ICN A;  4AZM A;  4O9S A;  5HBS A;  2JU8 A;  4EXZ A;  2FS7 A;  4N7C A;  1CBI A;  2UYW A;  1HY2 A;  3EW2 A;  3NR3 A;  4CPH A;  3OBL A;  1SLF B;  1VYF A;  1TVQ A;  1D2U A;  1SWT A;  4JO6 A;  1SWK A;  2AKQ A;  1Y55 X;  5IXG A;  5LJC A;  4ZJ0 A;  1E00 A;  1BEB A;  4GUZ A;  1EQD A;  5HZ6 A;  1Y53 X;  1SLE B;  4YMY A;  2X34 A;  3PQU A;  3EMM A;  1BRQ A;  1N9Y A;  2JU7 A;  2RCT A;  5HCD C;  2W2F A;  3ZW1 B;  3ZUO A;  4AZO A;  3RE5 A;  1JBH A;  1KT7 A;  3B2J A;  4BX7 A;  4DCB A;  1OSP O;  1ZNK A;  2BS6 A;  1NGL A;  1SWQ A;  3FA8 A;  2Y32 A;  4OKA A;  1HXZ A;  1T0V A;  4XMC A;  2LFO A;  1IIU A;  1VWL B;  1I78 A;  2G5L A;  2GTL O;  1AVG I;  3EM0 A;  2VFC A;  3D9W A;  3HWG A;  2QOM A;  4MVE A;  4GNW A;  1IKJ A;  1DC9 A;  1NQN A;  1ADL A;  1ML7 A;  1HN2 A;  2R56 A;  4XMG A;  1STR B;  1GXA A;  2OFA A;  3ZW0 A;  1JJU A;  1SWP A;  3K3L A;  3EC5 A;  4MVL A;  3ZW0 B;  3Q6L A;  1TW4 A;  2JOZ A;  5K68 A;  2MHD A;  1CJ5 A;  2Z4H A;  2OY7 A;  2AF5 A;  4BX5 A;  4DNE A;  1JQP A;  4YBU A;  3HK1 A;  2IZG B;  1SY3 A;  4D6B A;  2A5C A;  1VWI B;  4GDZ A;  5D8J A;  4QZT A;  3HTY A;  2W2A A;  3I0A A;  3P6F A;  2M4L A;  5EDB A;  4CDF A;  2RQ0 A;  1KFF A;  1QFV A;  2IZL B;  4IAX A;  3RDS A;  2O62 A;  3MM0 A;  4I95 A;  1DV9 A;  1Z24 A;  2MWH A;  4ID2 A;  2BC3 A;  3WZP A;  2NNQ A;  1IFC A;  2HZR A;  4FBO A;  3NQK A;  5KID A;  1BLR A;  3WBG A;  2HKD A;  3FW4 A;  3LHN A;  4AZR A;  3O19 A;  2YG2 A;  3CQR A;  2BHV A;  3CR6 A;  5K06 A;  3VG7 A;  1X8O A;  4EKV A;  1LNM A;  3F6Z B;  4QAE A;  1VWR B;  1BSO A;  2RTK A;  5H9A A;  3F9D A;  5C0N A;  2CAM A;  5HTD A;  1FDQ A;  2UZ2 A;  1MDC A;  4OMX A;  1G7N A;  3HWE A;  1ZNG A;  3D97 A;  4HFO A;  4EQA C;  3X00 A;  3T6F A;  3FID A;  3H3I A;  2CZU A;  3APV A;  2QO6 A;  4DQ3 A;  4I3C A;  3CBS A;  1SY2 A;  1QG5 A;  4I9S A;  4RUN A;  2IZC B;  2VFB A;  3APX A;  4B55 A;  4NLI A;  1SRF A;  4MIS A;  4YGH A;  4ALB A;  1QY1 A;  3T2W A;  1EPB A;  1DZP A;  4NNT A;  5HZ8 A;  3SOT A;  1E5P A;  3BLG A;  3KVN A;  1STP A;  2RTF B;  3BS2 A;  3KZA A;  3P6C A;  4DQ4 A;  1U18 A;  3NBX X;  5EED A;  1STS B;  1ZNE A;  2FR3 A;  3EBW A;  1ZNL A;  1VWE B;  1N9M A;  1RSU B;  2KD2 A;  1RLB E;  1N0S A;  3GAQ A;  5DPQ A;  4ZCB A;  4ALO A;  4ARH A;  2F73 A;  1SY1 A;  5B5F A;  4O4O A;  3NQ3 A;  1AB0 A;  2PY1 A;  4I3D A;  2OY1 O;  1I9H A;  3VHM A;  2QO5 A;  4U3Q A;  1D3S A;  1LDQ A;  4EFG A;  1BM5 A;  3MX7 A;  1R0U A;  4FGI B;  3WOV A;  2GTL N;  2R74 A;  3RBY A;  1L6M A;  2L9C A;  4GJV A;  3RY2 A;  4BVM A;  1AEL A;  1DF8 A;  5LJB A;  1EIO A;  5L8N A;  3ZZV A;  1IFB A;  1DZJ A;  1URE A;  1LDO A;  1YP7 A;  2CBS A;  1SXX A;  2ZAI A;  3LTW A;  4KT5 A;  3NAD A;  4LQZ A;  1GX8 A;  3AKN A;  1IW2 A;  2PI3 O;  2RTD B;  5LKF A;  2FS6 A;  3KFG A;  5HCE C;  4CPF A;  3WJB A;  5HZ5 A;  2AT5 X;  2Y3E A;  2DM5 A;  1KT4 A;  2X32 A;  3FA6 A;  3JS1 A;  4Z6J A;  1PBY A;  2RTR B;  2CM9 A;  3PED A;  1FEN A;  2WPU A;  4PSQ A;  2AL0 X;  3L4R A;  3C77 X;  4I60 A;  3VHI A;  4NNS A;  2WSJ A;  4JGL A;  4QYP A;  1ACD A;  1GT1 A;  4HPC A;  4MVK A;  4OMW A;  4ORR A;  4C5P A;  1B4M A;  4Y0S A;  2AH7 X;  4ZHG A;  3SZJ A;  4A1H A;  3IA8 A;  4CPE A;  2IZB A;  2POA A;  1YWB A;  4TNN A;  5CHK A;  4CDE A;  2KTD A;  5F1E A;  3MG5 A;  5F6B A;  2RTA A;  2OVA A;  1LEL A;  1NC9 A;  3T6L A;  1X8U A;  1GKA B;  1KQW A;  1X89 A;  3BY0 A;  4O3W A;  5HAE A;  2Q2M A;  1SRH A;  2OY8 A;  4ORY A;  1QY0 A;  4OEM A;  4YKO A;  4D6A A;  2X4M A;  2OL6 O;  1TOW A;  2A13 A;  4KC7 A;  1KT6 A;  3ELZ A;  2AMM X;  4ZGF A;  2LBA A;  2A0A A;  4YVB A;  3PPT A;  1ALB A;  2L68 A;  3EBK A;  4NYQ A;  4LZU A;  4WHI A;  5IRU A;  4CPH B;  4TKB A;  1O1U A;  1LFO A;  1W4T A;  1A18 A;  3PQS A;  3I17 A;  3F8A A;  1KOI A;  3VGW A;  5HWZ A;  5FAZ A;  4R0B A;  3RZY A;  2IZF B;  3TGA A;  1OBP A;  4ZHD A;  2KTS A;  4ORS A;  4IB6 A;  3O22 A;  5EZ2 A;  1BJ7 A;  2ANS A;  1T68 X;  4U8U O;  5H9K A;  1KL3 A;  2X46 A;  2NND A;  4ES7 A;  1VWA B;  2RTP B;  1YIV A;  3WVM A;  4BX7 B;  1GM6 A;  1ICM A;  1U17 A;  3BX8 A;  4BQU A;  5AJC A;  4ZFX A;  3JSQ A;  4FBR A;  4IB7 A;  4O3X B;  1VWK B;  2Z4I A;  3JQO A;  4I6S A;  4QRL A;  2G8C O;  3VG6 A;  5IRW A;  1VWQ B;  4I9R A;  4EDE A;  1HBQ A;  1HXL A;  1SLD B;  1PMP A;  1UYO X;  2FHN X;  2JGS A;  3P6E A;  1QY2 A;  1G5W A;  1Y9T A;  4HPA A;  5H9L A;  3T2X A;  2IFB A;  3FLL A;  1A2D A;  3D95 A;  1PEE A;  3TF6 A;  4GE1 A;  2RTB B;  1MK5 A;  2C1S A;  4GGT A;  4BBO A;  1A57 A;  1MX7 A;  1TXL A;  1N4J A;  4Z2V A;  1GT5 A;  4AZQ A;  3EYC A;  1OPA A;  3VPJ E;  4BX5 B;  1KGL A;  1FE3 A;  3RDX A;  2OZQ A;  1YWD A;  4ORW A;  4TLJ A;  5HTE A;  3RDO A;  2X56 A;  2Q39 A;  2IZD B;  2Q2P A;  2QO4 A;  3SLT A;  5F2B A;  1EII A;  5H8T A;  1EAL A;  4ODD A;  3FEN A;  4BOE A;  5HCC C;  2IZI A;  4IB8 A;  3TZS A;  3V8U A;  1VWF B;  4KH8 A;  4YCH A;  5JD2 A;  2BLG A;  4BX6 A;  1H91 A;  3HPE A;  1YWC A;  4L3R A;  3SZI A;  4OS3 A;  2FTB A;  4YKM A;  1UZ2 X;  3ZWE A;  1JIW I;  1SWF A;  1BBP A;  4Z28 A;  4AW8 A;  4BCS A;  5BVQ A;  1RBP A;  3WJD A;  3D96 A;  1OPB A;  5IO7 A;  4WBK A;  3NX1 A;  5CYB A;  1OBU A;  1X8N A;  2KW1 A;  4EEJ A;  2ACP X;  4YCE A;  4CDD A;  3ZW2 A;  1SWJ A;  1PTS A;  5FEN A;  2FKJ A;  4BGF A;  1VWM B;  1KZX A;  3Q34 A;  4GH7 A;  1RXH A;  1FEM A;  4O3Y A;  2JU3 A;  3DTQ A;  3NPO A;  3T1D A;  3VE2 A;  2I5Z O;  2A5B A;  4ZHC A;  4CPI A;  3FIQ A;  5CSE A;  1EUO A;  2I5V O;  4IMO A;  2FGS A;  4ORX A;  4K19 A;  5B27 A;  5HZ9 A;  1JYD A;  1SRG A;  2HYS A;  1JYJ A;  4GZV A;  4OS8 A;  4QGX A;  4HWM A;  4MVI A;  2CM4 A;  2GTL M;  2RTH B;  2WUT A;  3AEH A;  5AJB A;  4NP1 A;  3CWK A;  4HPD A;  1LCZ A;  2HNX A;  4IMN A;  2FHL A;  4TKH A;  1LUQ A;  2C4I A;  2QMI A;  5FQ6 E;  5LJK A;  5EPQ A;  1MM9 A;  4OEL A;  2K23 A;  1SY0 A;  3WJC A;  1Y9L A;  4FQB B;  4A8Z A;  3FEK A;  4MEE A;  4U8U N;  3NQ9 A;  1DFV A;  4ZR2 A;  4GDA A;  2MF6 A;  2Q4N A;  3BRN A;  2OYB O;  5LJE A;  1EXS A;  5LJH A;  2RTI B;  2LKK A;  1BSY A;  4ORU A;  1NP1 A;  3CMP A;  2HMB A;  2NP1 A;  4IRW A;  5F58 A;  2RA6 A;  4XMD A;  5L8I A;  3WJE A;  1SWH A;  4Y59 A;  1JJX A;  4PJ2 A;  4YDA A;  1Y52 X;  1FJ1 E;  3CBC A;  2K62 A;  2RTL A;  1OEE A;  4QYN A;  2A2G A;  5DG4 A;  2BT9 A;  4O4S A;  3WJG A;  2E4J A;  1N7Y A;  3G7X A;  4Z2O A;  5B2A O;  1HMT A;  1OEK A;  2HLV A;  4IB9 A;  1SWC A;  4XMF A;  1GT4 A;  1SMP I;  3U03 A;  1SRE A;  1LIE A;  1KQX A;  3RDM A;  1SWB A;  5K67 A;  3FR5 A;  1HBP A;  4Y0Q A;  4YFQ A;  3S5X A;  2RN4 A;  4QGV A;  4A1Y A;  3PK2 A;  4NV7 A;  3VG2 A;  1SWN A;  2IZH B;  1X8P A;  2G79 A;  3P24 A;  1IJ8 A;  2QOS C;  4BJ8 A;  3RWX A;  3MVF A;  4YH0 A;  4AYH A;  4TQ2 A;  3WZN A;  2FT9 A;  3STM X;  1GGL A;  3ELX A;  1KT5 A;  2JW1 A;  3VE1 A;  3BU1 A;  1E2T A;  4OS0 A;  3OE3 A;  5BYP A;  1O1V A;  2W2B A;  1X8Q A;  1K3B A;  3WXQ A;  4ON1 A;  4AZN A;  1ZNH A;  4U9C A;  1GX3 A;  3QKG A;  1BSQ A;  1LKE A;  2OF9 A;  3HOL A;  5FFH A;  3UEX A;  4TJZ A;  1E06 A;  3FEL A;  4ZHH A;  2ZSC A;  5JR8 A;  3CQN A;  1ERX A;  4JHQ A;  1SXY A;  5L8O A;  2MM3 A;  1BRP A;  4NYR A;  4U46 A;  2AT3 X;  4Y5D A;  3RY1 A;  3S5V A;  3DSZ A;  1OEJ A;  3FW5 A;  1SXW A;  3UAQ A;  2YMS A;  3FMZ A;  1VWP B;  1A3Y A;  4CDC A;  3OJY C;  1QFT A;  2FRS A;  2JN3 A;  5B3M O;  4ZH9 A;  4Y0P A;  1YUP A;  3APU A;  4WFU A;  2RTQ B;  4A60 A;  3KFH A;  4O49 A;  1CRB A;  1MOY A;  1HMR A;  3MBT A;  3U0D A;  4LKP A;  3LV4 A;  3RE6 A;  1VWN B;  5F6Z A;  1NBX A;  1ZRY A;  4YGZ A;  3BX7 A;  2DJF A;  3VG5 A;  2X45 A;  3WZQ A;  1B0O A;  5FQ7 E;  2WQA E;  1HQP A;  1LCW A;  2RTC B;  1W5R A;  3STK A;  1GX9 A;  1ERB A;  1KXO A;  1KL4 A;  1XCA A;  2XKL A;  4ZHF A;  1JZU A;  1SLG B;  2EU7 X;  5EEE A;  5LJD A;  2GTF X;  2QCB A;  5HA1 A;  4YGG A;  3NP1 A;  3SZH A;  4WFV A;  2MJI A;  4I3B A;  3ZW1 A;  3PH5 A;  2G78 A;  1W6F A;  3TGB A;  3P02 A;  2OFR X;  5B5G A;  3EW1 A;  2VDF A;  4IAB A;  2AVI A;  5B11 O;  2A8G A;  4O3Z A;  3UEU A;  1QQS A;  3FA7 A;  4O4X A;  3ZUI A;  1B8E A;  2MO5 A;  2IZJ A;  3UEV A;  1VWD B; 
#chains in the Genus database with same CATH homology
 4KII A;  4LZV A;  3S60 A;  2WWP A;  4RUU A;  1U0X A;  1S44 A;  2FR2 A;  2X8F A;  4GET A;  1AQB A;  1HMS A;  2L5P A;  1I05 A;  4O4U A;  3U9P C;  4MIR A;  3B2I A;  3PH6 A;  1LF7 A;  3APW A;  5KIC A;  1B56 A;  2OVS A;  1S7D A;  2FLJ A;  5EDC A;  1MVG A;  1SXU A;  3BU9 A;  3S26 A;  1IKE A;  1FTP A;  1JV4 A;  3HOE A;  4GNY A;  1KZW A;  1O8V A;  2RCQ A;  3FEP A;  2NNE A;  4AZP A;  4XMH A;  5BVT A;  4YFP A;  1G85 A;  2BS5 A;  3E3C A;  4M7M A;  4U8U M;  1KT3 A;  3FR2 A;  5D47 A;  2QM9 A;  4LKT A;  2CZT A;  2XST A;  1CBS A;  1E02 A;  2L67 A;  1I06 A;  4QQ1 A;  2X8S A;  5FQ8 E;  3UEW A;  2Q9S A;  2LA7 A;  3FYF A;  3OD9 A;  1YP6 A;  1QWD A;  5AQ6 A;  5HZQ A;  3RKG A;  4ZGU A;  4M6S A;  4TKJ A;  2ZAG A;  3FR4 A;  4L1N A;  3BSZ E;  3ZQ3 A;  4Y0R A;  4GK9 A;  4INN A;  2ASN X;  3C78 X;  5LJG A;  4IAW A;  1QAB E;  3NX2 A;  1GT3 A;  2WR6 A;  1LPJ A;  1LID A;  2P8G A;  1P6P A;  2HZQ A;  3B2L A;  3O2Y A;  3PP6 A;  4KCA A;  4IBA A;  4YDB A;  2LBV A;  2A2U A;  5LKE A;  1FEL A;  5KHP A;  2WQ9 A;  4QGW A;  1CBR A;  2ALL X;  1EPA A;  3HWF A;  2AT8 X;  5D48 A;  3C76 X;  3ZI8 A;  1YWA A;  3KQ0 A;  4HPB A;  1DF3 A;  1I4U A;  3BDR A;  3VU1 A;  3AKM A;  2OFM X;  2X8T A;  5D45 A;  5D4A A;  1SA8 A;  2A3F X;  2G7B A;  3HWD A;  3N91 A;  3P6H A;  1X71 A;  2N93 A;  4GU8 A;  4ZH6 A;  4CK4 A;  5IO6 A;  4GKC A;  5H9N A;  4UU3 A;  4NW4 A;  4CV7 A;  1EW3 A;  3KFI A;  2RD7 C;  1TOU A;  4QNI A;  3SAO A;  1VPR A;  2ACO A;  3TGC A;  1NP4 A;  3STN A;  1LIF A;  3P6D A;  4YFR A;  1PBO A;  1CBQ A;  2FWV A;  2AT6 X;  4FBV A;  4N7D A;  3IFB A;  1MX8 A;  3VG3 A;  3KFF A;  2WEW A;  4NLJ A;  3D4R A;  1ZND A;  3VG4 A;  4QZU A;  2GC9 A;  3P6G A;  4YBP A;  5F7G A;  1S2P A;  2JMB A;  2KT4 B;  1I04 A;  3PEC A;  5IO5 A;  3RSW A;  1JJJ A;  1XKI A;  1LIB A;  3B2H A;  2AT0 X;  3GE2 A;  1PM1 X;  1DZK A;  2F09 A;  5BVS A;  4ML7 B;  2LB6 A;  2GJ5 A;  2OVD A;  3B2K A;  4XME A;  5AEO A;  1LIC A;  1EI5 A;  3WJF A;  4COT A;  1DZM A;  1OBQ A;  2R73 A;  3FA9 A;  2WEX A;  1MUP A;  1VYG A;  4GRJ A;  2CBR A;  5HA0 A;  5B29 A;  2OVE A;  1GKA A;  4UU2 A;  1BWY A;  4CSB A;  1G74 A;  1T8V A;  4KC8 A;  1ICN A;  4AZM A;  4O9S A;  5HBS A;  2JU8 A;  4EXZ A;  2FS7 A;  4N7C A;  1CBI A;  3NR3 A;  3OBL A;  1VYF A;  1TVQ A;  1D2U A;  2AKQ A;  5LJC A;  4ZJ0 A;  1E00 A;  1BEB A;  1EQD A;  5HZ6 A;  4YMY A;  3PQU A;  3EMM A;  1BRQ A;  2JU7 A;  2RCT A;  5HCD C;  2W2F A;  3ZW1 B;  3ZUO A;  4AZO A;  1JBH A;  1KT7 A;  3B2J A;  1ZNK A;  2BS6 A;  1NGL A;  3FA8 A;  4XMC A;  1T0V A;  2LFO A;  1IIU A;  2GTL O;  1AVG I;  3EM0 A;  3HWG A;  4MVE A;  4GNW A;  1IKJ A;  1DC9 A;  4XMG A;  1ADL A;  1ML7 A;  1HN2 A;  2R56 A;  3ZW0 A;  1GXA A;  3K3L A;  3ZW0 B;  4MVL A;  3Q6L A;  1TW4 A;  2JOZ A;  2MHD A;  1CJ5 A;  2Z4H A;  4YBU A;  3HK1 A;  1SY3 A;  4D6B A;  5EDB A;  4GDZ A;  5D8J A;  4QZT A;  3HTY A;  2W2A A;  3I0A A;  3P6F A;  2M4L A;  2RQ0 A;  1QFV A;  4IAX A;  2O62 A;  4I95 A;  1DV9 A;  1Z24 A;  2MWH A;  4ID2 A;  2NNQ A;  1IFC A;  2HZR A;  4FBO A;  3NQK A;  5KID A;  1BLR A;  3WBG A;  3FW4 A;  3LHN A;  4AZR A;  3O19 A;  2YG2 A;  3CQR A;  2BHV A;  3CR6 A;  5K06 A;  3VG7 A;  1X8O A;  1LNM A;  3F6Z B;  4QAE A;  1BSO A;  5H9A A;  3F9D A;  5C0N A;  5HTD A;  1FDQ A;  1MDC A;  4OMX A;  1G7N A;  3HWE A;  1ZNG A;  3D97 A;  4HFO A;  4EQA C;  3H3I A;  2CZU A;  3APV A;  2QO6 A;  4DQ3 A;  4I3C A;  3CBS A;  1SY2 A;  1QG5 A;  4I9S A;  4RUN A;  3APX A;  4NLI A;  4MIS A;  4ALB A;  4YGH A;  1QY1 A;  1EPB A;  1DZP A;  4NNT A;  5HZ8 A;  3SOT A;  1E5P A;  3BLG A;  3P6C A;  3BS2 A;  3KZA A;  4DQ4 A;  1U18 A;  3NBX X;  5EED A;  1ZNE A;  2FR3 A;  3EBW A;  1ZNL A;  2KD2 A;  4ALO A;  3GAQ A;  5DPQ A;  1RLB E;  1N0S A;  4ZCB A;  4ARH A;  2F73 A;  1SY1 A;  4O4O A;  3NQ3 A;  1AB0 A;  2PY1 A;  4I3D A;  2QO5 A;  4U3Q A;  1D3S A;  4EFG A;  1BM5 A;  3MX7 A;  1R0U A;  4FGI B;  3WOV A;  2GTL N;  2R74 A;  3RBY A;  1L6M A;  2L9C A;  4BVM A;  1AEL A;  5LJB A;  1EIO A;  5L8N A;  3ZZV A;  1IFB A;  1DZJ A;  1URE A;  1YP7 A;  2CBS A;  2ZAI A;  1SXX A;  4KT5 A;  4LQZ A;  4TQ2 A;  3NAD A;  1GX8 A;  3AKN A;  1IW2 A;  5LKF A;  2FS6 A;  3KFG A;  5HCE C;  5HZ5 A;  3WJB A;  2AT5 X;  2DM5 A;  1KT4 A;  3FA6 A;  3JS1 A;  2CM9 A;  3PED A;  1FEN A;  4PSQ A;  2AL0 X;  3L4R A;  3C77 X;  4NNS A;  2WSJ A;  4JGL A;  4QYP A;  1ACD A;  1GT1 A;  4HPC A;  4MVK A;  4OMW A;  4ORR A;  1B4M A;  4Y0S A;  2AH7 X;  4ZHG A;  4A1H A;  3IA8 A;  2POA A;  1YWB A;  4TNN A;  2KTD A;  5F1E A;  5F6B A;  2OVA A;  1X8U A;  1GKA B;  1KQW A;  1X89 A;  3BY0 A;  4O3W A;  5HAE A;  2Q2M A;  4ORY A;  4YKO A;  1QY0 A;  4D6A A;  4KC7 A;  1TOW A;  2A13 A;  1KT6 A;  3ELZ A;  2AMM X;  4ZGF A;  2LBA A;  2A0A A;  3PPT A;  1ALB A;  2L68 A;  3EBK A;  4NYQ A;  4LZU A;  4WHI A;  4TKB A;  1O1U A;  1LFO A;  1A18 A;  3PQS A;  3I17 A;  3F8A A;  1KOI A;  5HWZ A;  5FAZ A;  4R0B A;  3RZY A;  3TGA A;  1OBP A;  4ZHD A;  2KTS A;  4ORS A;  4IB6 A;  3O22 A;  5EZ2 A;  1BJ7 A;  2ANS A;  1T68 X;  4U8U O;  5H9K A;  2X46 A;  2NND A;  4ES7 A;  1YIV A;  3WVM A;  1GM6 A;  1ICM A;  1U17 A;  3BX8 A;  4BQU A;  5AJC A;  4ZFX A;  3JSQ A;  4FBR A;  4IB7 A;  4O3X B;  2Z4I A;  3JQO A;  4QRL A;  4I6S A;  3VG6 A;  4I9R A;  4EDE A;  1HBQ A;  3P6E A;  1PMP A;  1QY2 A;  1G5W A;  1Y9T A;  4HPA A;  5H9L A;  2IFB A;  3FLL A;  1A2D A;  3D95 A;  1PEE A;  3TF6 A;  4GE1 A;  1A57 A;  1MX7 A;  1TXL A;  1GT5 A;  4AZQ A;  3EYC A;  1OPA A;  3VPJ E;  1KGL A;  1FE3 A;  2OZQ A;  1YWD A;  4ORW A;  4TLJ A;  5HTE A;  2Q39 A;  2Q2P A;  2QO4 A;  1EII A;  5H8T A;  1EAL A;  4ODD A;  3FEN A;  4BOE A;  5HCC C;  4IB8 A;  3TZS A;  3V8U A;  4KH8 A;  4YCH A;  2BLG A;  1H91 A;  1YWC A;  4L3R A;  4OS3 A;  2FTB A;  4YKM A;  1UZ2 X;  3ZWE A;  1JIW I;  1BBP A;  4AW8 A;  5BVQ A;  1RBP A;  3WJD A;  3D96 A;  1OPB A;  5IO7 A;  4WBK A;  3NX1 A;  5CYB A;  1OBU A;  1X8N A;  2KW1 A;  4EEJ A;  2ACP X;  4YCE A;  3ZW2 A;  5FEN A;  1KZX A;  4GH7 A;  1FEM A;  4O3Y A;  2JU3 A;  3DTQ A;  3NPO A;  3T1D A;  3VE2 A;  4ZHC A;  3FIQ A;  1EUO A;  4ORX A;  4IMO A;  5B27 A;  5HZ9 A;  4K19 A;  1JYD A;  4GZV A;  2HYS A;  1JYJ A;  4OS8 A;  4QGX A;  4HWM A;  4MVI A;  2CM4 A;  2GTL M;  2WUT A;  5AJB A;  4NP1 A;  3CWK A;  4HPD A;  2HNX A;  5CE4 A;  4IMN A;  4TKH A;  2QMI A;  5FQ6 E;  5LJK A;  5EPQ A;  2K23 A;  1SY0 A;  3WJC A;  1Y9L A;  4FQB B;  4A8Z A;  3FEK A;  4U8U N;  3NQ9 A;  1DFV A;  4ZR2 A;  2Q4N A;  3BRN A;  5LJE A;  1EXS A;  5LJH A;  2LKK A;  1BSY A;  4ORU A;  1NP1 A;  3CMP A;  2HMB A;  2NP1 A;  5F58 A;  2RA6 A;  4XMD A;  5L8I A;  3WJE A;  1JJX A;  4PJ2 A;  4YDA A;  3CBC A;  2K62 A;  1OEE A;  4QYN A;  2A2G A;  5DG4 A;  2BT9 A;  4O4S A;  3WJG A;  2E4J A;  3G7X A;  1HMT A;  1OEK A;  2HLV A;  4IB9 A;  4XMF A;  3U03 A;  1GT4 A;  1SMP I;  1LIE A;  1KQX A;  3FR5 A;  1HBP A;  4Y0Q A;  4YFQ A;  3S5X A;  2RN4 A;  4QGV A;  4A1Y A;  3VG2 A;  1X8P A;  2G79 A;  3P24 A;  2QOS C;  3RWX A;  3MVF A;  4YH0 A;  4AYH A;  2FT9 A;  3STM X;  1GGL A;  3ELX A;  1KT5 A;  2JW1 A;  3VE1 A;  3BU1 A;  4OS0 A;  3OE3 A;  5BYP A;  1O1V A;  2W2B A;  1X8Q A;  3WXQ A;  4ON1 A;  4AZN A;  1ZNH A;  4U9C A;  3QKG A;  1BSQ A;  1LKE A;  4ZHH A;  3HOL A;  5FFH A;  3UEX A;  4TJZ A;  1E06 A;  3FEL A;  5JR8 A;  3CQN A;  1ERX A;  1SXY A;  5L8O A;  2MM3 A;  1BRP A;  4NYR A;  2AT3 X;  3S5V A;  3DSZ A;  1OEJ A;  3FW5 A;  1SXW A;  3UAQ A;  2YMS A;  3FMZ A;  1A3Y A;  3OJY C;  1QFT A;  2FRS A;  2JN3 A;  4ZH9 A;  4Y0P A;  1YUP A;  3APU A;  4WFU A;  4A60 A;  3KFH A;  4O49 A;  1CRB A;  1HMR A;  3MBT A;  3U0D A;  4LKP A;  3LV4 A;  5F6Z A;  1ZRY A;  4YGZ A;  3BX7 A;  3VG5 A;  2X45 A;  1B0O A;  5FQ7 E;  2WQA E;  1HQP A;  4ZHF A;  3STK A;  1GX9 A;  1ERB A;  1KXO A;  1XCA A;  2XKL A;  1JZU A;  2EU7 X;  5EEE A;  5LJD A;  2GTF X;  5HA1 A;  4YGG A;  3NP1 A;  4WFV A;  2MJI A;  4I3B A;  3ZW1 A;  3PH5 A;  2G78 A;  3TGB A;  3P02 A;  2OFR X;  4IAB A;  4O3Z A;  3UEU A;  1QQS A;  3FA7 A;  4O4X A;  3ZUI A;  1B8E A;  2MO5 A;  3UEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...