5H9VA

Crystal structure of regnase pin domain, form i
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
161
structure length
161
Chain Sequence
DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAFESDGVVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease ZC3H12A
publication title Structural basis for the regulation of enzymatic activity of Regnase-1 by domain-domain interactions
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 47
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h9vA00
5FT9A 3V32A 5H9VA 4G25A 5H9WA 5DIZA 3V34A 4G23A 4G24A 3V33A 4G26A
chains in the Genus database with same CATH superfamily
3QVOA 1LNZA 4KSBA 5A5GA 4HGPA 1T4DA 1N3BA 4PSAA 3STUA 2OV2A 4N8SA 3SXJA 5C35A 1KYZA 4MEBA 4GNRA 4GGPA 4K9SA 2IGTA 3N2NA 2VHUA 1G2OA 3KAKA 4O0MA 5HRCA 1Z6YA 3KQHA 3ZV5A 1TAUA 4I1IA 5AK6A 3RNOA 4EJSB 3NHBA 1Y1KE 2XQKA 1T91A 3KNZA 2YMPA 2BHRA 3UJBA 2VP0A 2I2WA 2XVAA 3RVNA 1VKRA 1Z4JA 3A4IA 3COSA 1J5PA 1UMBA 4EUHA 2DQYA 3BREA 4RLQA 2A92A 1S2DA 1EEXB 2XUQA 2KB0A 3ZPXA 1FSFA 4MRVA 2O5EA 5D3ZA 1Y5MA 3FMVA 3A6LA 4Y7CA 5CLLA 3THYB 3JVIA 3ESDA 5FTMA 4EL5A 1CUAA 1QOZA 1TTPB 1ULZA 1WD5A 3QE4A 3OLYA 2PX4A 3OTHA 4G01B 4M9ZA 4JQOA 3ZHXA 1H0KA 3A3PA 4EITA 5KVAA 1KAOA 1RD4A 1LLDA 1M2FA 3E9CA 4H60A 5EXEA 5IAJA 5H16A 3W05A 2PS3A 3LVFO 2ST1A 3IMKA 1FS6A 1NN0A 1SCUA 1U0RA 2E82A 2PKQP 4MWSA 5D1NA 4I8DA 5FOWA 3S2GA 3GZJA 3UA4A 3WZMA 2QVYX 2QRUA 3FI9A 3ZXUB 4J0GA 3F5FA 2JJMA 4LJSA 5ALHA 3RYHB 4NE2A 1CIPA 1N7GA 1QV7A 2JLRA 5ERGB 3WLHA 1L5OA 1BG6A 1BU8A 3NC4A 3PYLA 4G2TA 4XEHA 3FYDA 1F6BA 1ZLXA 3TZCA 1MGPA 3NU1A 2BHLA 4I55F 3DZDA 5IDXA 1YZFA 2YYSA 2I54A 4HMOA 1PG0A 5AI6A 1YE3A 1UBSB 3WHKA 4F04A 5FOUA 2AX3A 2EYUA 2R751 1PYOA 3ROZA 2FEPA 2BYTA 4HWGA 4IXDA 1JYEA 1VP9A 1ZESA 2NYVA 4R2KA 1VBMA 4RK1A 1YQXA 4OXKA 2PMEA 4V0KA 4TZKA 1X1AA 1WNTA 4Q9LA 5NLLA 3ED1A 3T3MB 4TTIA 3HLTA 1MJ5A 3DC7A 1SXIA 3ET4A 4K2HA 4LISA 4MAFA 4XTCS 1DIBA 1OTYA 1C8LA 1EG2A 1YBVA 4C5CA 2RARA 2WTMA 5FL7A 2WF5A 4I3HA 4CN9A 2ZCVA 2P9JA 4RY0A 3AW9A 3WR5A 3V1MA 4EX7A 1EVLA 1VL5A 1OT5A 1R0LA 3Q7SA 4XD2A 5E6UB 2F8TA 2XMDA 2I4LA 1VPWA 4EENA 2ZSKA 4D42A 1QHSA 2VI5A 2VXCA 3EDOA 4UNNA 1XQWA 2GPTA 5ALFA 4PO9A 4AURA 1MHPA 1VCHA 3ZLBA 4LC1A 4A6PA 1SUEA 4E5MA 3I62A 4QARA 2CMDA 4ZVQA 4EYQA 3GJZA 1SFRA 5AXBA 4NCAA 3DD1A 3QX8A 1ST2A 4R8LA 4XASA 4AO6A 4IR7A 5DWVA 1ABBA 1EK5A 4E5PA 1NY6A 2HC9A 2DBZA 1N4AA 2FAXA 2GCPA 1R9GA 2RG7A 4JC8A 4MAMA 2FFQA 3KJNA 1PJLA 3WGKA 2YWBA 3D5QA 1J56A 3IPCA 2VDKB 1Q21A 4NAVA 2YJ5A 3GXOA 3MTDA 1MORA 3QFRA 4JBXA 3L92A 5JY6A 2A3NA 2C5GA 3IULA 2D8MA 3SHFA 3W5DA 2QXTA 1U6JA 1HNNA 1PS0A 3P45A 5KSPA 2CT8A 3OMXA 4J94A 1PO7A 3MB8A 1T8RA 5L3SB 3B9RA 1K66A 1CJTC 2SNIE 1OKKD 3NIWA 2Q0HA 4QODA 4ZCTA 2Q8QA 1Z56C 4DT1B 3EEBA 3PQFA 2P5YA 4IXNA 3TTSA 2FWIA 1TAHA 3T9DA 1Z9BA 3HY3A 1GPKA 1PT5A 4GQBA 2XUJA 3GEIA 2JHPA 3T3HA 3W5AA 2PSFA 3AP3A 1CULC 1YR7A 2NNWB 2ZSEA 5F7ZA 3IKTA 4I0WB 5J2UA 4QBGB 5CNKA 3QQ5A 1IQ0A 4ZMSA 3EZNA 1NOKA 1E1NA 1Y9JA 4KP7A 4GS5A 4YS6A 1NNUA 4Q02A 5ECGC 3R3JA 1GV1A 3T7SA 3U4QA 1EXDA 1ID8A 4EHJA 2FWJA 1Q7BA 2PZ8A 1UP4A 4UHDA 4EAAA 5LQAA 1CVIA 1QUEA 2FOLA 4HT3B 2R7AA 1AA9A 1XWWA 1L3IA 1QKJA 3W04A 3ZJUA 2P5SA 1JFSA 2NOAA 3L01A 3K1TA 2HF8A 3U4IA 4JC4A 3N59A 4RJIA 4MV7A 4GL2A 1SUBA 4RTLA 4ZI5A 5C7OO 1NVEA 4MYHA 5LJLA 3PHIA 1RBQA 2XAUA 1OBFO 3KVRA 2HSDA 3OZRA 4GBGA 3VR3D 5K99A 1DBSA 1WSDA 4NX2A 2DC1A 3UEOA 3R7NA 1AXRA 1EE1A 1P7YA 4L72A 1NATA 1R0XA 2HDHA 2AVNA 4TLLB 2NVWA 3FLEA 4D43A 2C0PA 3GEHA 1HWYA 3PX7A 1YS1X 2YZMA 4HEQA 4WGFA 3TEJA 2F67A 4XB1A 1AMUA 4LQCA 5K8IA 2I3AA 4FMPA 5IJZA 4KR7A 5IDYA 3WNBA 2QU7A 1ECGA 2P3QA 4MR9B 4ZEWA 2FWMX 5KOJA 2WVJA 1T3HA 4BX9A 3FWHA 4FFNA 2GJAA 4IG4A 2MSLA 1AMNA 1UBOS 1O08A 4M2LA 4QM7A 2W6JD 2HJHA 4E5YA 1W0CA 3M6VA 1XCOA 1XU4A 2YJ4A 1UCFA 4P22A 2B37A 3IR7A 3RSOA 2OCPA 4W6QA 1P5RA 1UWKA 3MRXA 4EYKA 1N5MA 1QV6A 4N41A 4MW1A 1PEDA 5FBLB 3UJAA 1UANA 2C2YA 3O8DA 5DHTA 3ZKAA 2F1HA 3ZI0A 5ITWA 4U63A 1GRVA 2WP0A 2WE7A 2PGLA 4MI1A 3FFBA 1NNEA 2O2SA 3SNHA 1M3SA 2C0QA 1NI3A 3H1TA 1QIGA 2OXEA 3A27A 4QUIA 1CQJB 2JD2A 2RKBA 3MLEA 2PGIA 4HB3A 4LRTB 3IH5A 1B3RA 1J9GA 1TD1A 4JSTA 1BQ3A 3NBKA 4WZBB 4FGUA 4Z9AA 4B3GA 5DGHA 3DZIA 5HMLA 3WGZA 3ZVKA 2JEZA 1KMHA 3GMSA 3UXEA 3QLEA 1GY8A 4RF5A 3T0GA 2A78A 4RWZA 3FRIA 4HXYA 4HDRB 4A6XA 1V16A 4EF6A 1CDDA 2BEUB 3NH9A 3OQJA 3MAJA 4DCVA 4KXWA 4E3WA 2PD4A 3DFZA 3ZK9A 5DGTA 3HJTA 1E0AA 1VBNA 5F2EA 3HYRA 2XEDA 2CV2A 3PTLA 3DYIA 1I5RA 4BQPA 3LKVA 4CHGA 2H17A 2ZBRA 3N86A 4CKCA 1T0IA 5LMNB 2DLCX 3R6LA 3A31A 3IPYA 1K27A 4HG2A 2JGRA 3K1AA 3I4LA 2HGSA 1CUBA 4Y9SA 4TWJA 4E70A 1M6HA 2BGUA 1U99A 4PLHA 2Q2QA 1XL1A 2YFQA 2R84A 3BXFA 3FZNA 1KI2A 1R4MB 3EC1A 3JAKB 4FLMA 3VOBA 2SKDA 1ULTA 3C7DB 4B9AA 1WDMA 1X9IA 2RKWA 4CDMA 3T1QA 4EI9A 2O7NA 2UV8A 3I04M 4J2OA 1V8ZA 2V7VA 3EIQA 2VS1A 3NHUA 4CFSA 1UADA 1ZKDA 1TGVA 2C9MA 2X5JO 3QJ5A 4M1MA 4BZZA 3SQDA 5C81A 2V0GA 3RC1A 4YP7A 3VH2A 3VPDA 4OQFA 3FR8A 1TZ2A 3UJPA 1Z22A 3C4VA 4PZ0A 1U9YA 1PU2A 2A58A 4U2FA 3QP9A 3H0EA 1GNRA 4K05A 3FLAA 3QMVA 4P4UA 1A9ZA 2YHUA 2A0XA 1ZR4A 4D26A 1R88A 3EVTA 3ZCQA 2V0NA 1G0NA 3GEMA 1WB5A 4IIYA 5HHTA 3V34A 4NZPA 5K09A 4DIOA 2CLEB 1RYYA 1UDRA 4XYEA 5BSVA 5A9SB 4GVPA 4A0GA 3RC7A 1TVEA 3VNUA 1DEKA 3TX2A 1LU9A 1D6MA 3TNDA 2OQRA 3S81A 2E55A 3FCAA 1L7DA 3QUTA 3VU9A 3UAZA 4H0NA 1VHLA 1JN0A 1QRDA 4CTMA 1TFUA 1JPUA 3BDAA 3FTCA 1NLUA 5CYOA 2OAGA 4WDRA 1G21B 5J1SB 3C3CA 3O3CA 3CKMA 3M6LA 2HPAA 2XT6A 3BWXA 3I45A 3L8YA 1C7FA 1N2JA 2HSZA 4QDOA 1FTSA 3G0OA 3IJEB 4R1QA 4Q9IA 3RWBA 4CMGA 4R05A 1QBKC 2KS6A 4PRKA 2PKXA 3EBOA 3TXXA 5IUNC 2B7BA 2DPMA 5F2NA 2Z83A 4BP1A 3F46A 2EAUA 1FNCA 5L9AA 1FS4A 1JFFB 1WR8A 2WV9A 3WGQA 1FX1A 1L0BA 1LBHA 1BX0A 3VHLB 3KD2A 4ZOLB 2IOFK 5G4KA 3ZD9A 4A4DA 4B17A 3K9GA 4KE9A 1E3TA 2RHBA 1Z0FA 2BUAA 1EGAA 2XTZA 1YQUA 5BMVA 1U3VA 1YZYA 4IS3A 4YJ2B 2JLQA 4FM9A 1A8QA 4BV3A 3WQQA 4ZKDA 1PR2A 5F98A 4BWVA 4L16A 4OATA 4BEBA 2P2LA 1I3MA 2ZIGA 2IU6A 4KE6A 5J2TB 1QRTA 1PR3A 3TVDA 4LK3A 4BU1A 3CY6A 3HCOA 4LCEA 1C14A 1BEUB 1DIOB 2OXCA 2YJGA 2ZPTX 3H8JA 1KFEB 4R2XA 3O4RA 2F62A 5D5PA 1FJGB 1H9CA 5IUKC 2FRXA 2YWXA 1GKKA 2B8JA 4UVIA 1Z25A 5K3CA 1PGNA 2XCQA 3H3XA 2ZJAA 3N75A 4PNHA 1V95A 5JXIA 1QTQA 4BC0A 2YN0A 3GEGA 2Q3LA 1D6JA 4IXMA 3ADKA 3PXAA 1ZIDA 3GUYA 3ABOB 4YCLA 4HKTA 3DJYA 1ZA2A 2P3SA 3TZEA 4MW5A 1OU4A 1GRQA 3OJOA 3O2NA 4EW6A 1RXUA 4JWTA 3NKLA 3OM8A 4WOPA 1T3LA 5B7QA 4HRAA 3Q3EA 4RBNA 5FL7D 3EZLA 3FTPA 3G1UA 4JOBA 4KXLA 3G0DA 2PT5A 5EIWA 1YRHA 1DAHA 2HJVA 2X15A 3DHEA 2VF4X 1FMTA 2VRBA 5BW5A 1T25A 4OHKA 4ZVRA 4E4YA 3M6IA 2Q4RA 2V98A 2B83A 2AKYA 4AD8A 3ORQA 4L0DA 1OXBB 4ZEVA 5J59A 1E2FA 1ZJ4A 4MV6A 4Y3UA 5CLQA 1YK1A 5F1KA 5FTNA 1QM5A 4UZFA 5K51A 4BUCA 1QGZA 1G0OA 4L07A 4Z54A 4MUAA 4ONEA 2JAHA 1BS2A 2ZPAA 3M1AA 4TTAA 5FFNA 1D1QA 1SZPA 3H4TA 4UJ5A 2FR1A 4FQ7A 4EVSA 3HQ4O 4YAKA 3C1OA 3AESA 3IJRA 3MG9A 5MFPA 1HEYA 3QITA 1XT6A 4MR8B 4RSGA 1Z8DA 1W25A 3CX8A 4TQAA 1GCIA 1BROA 5EA2A 1CQZA 2GN6A 2W8ZA 2XF8A 4NIMA 3WIVA 1VYUA 1BXGA 3TLMA 4JA0A 5FX2A 4CF5A 4RPJA 1JMYA 4OGFA 3DMRA 4XDGA 3ADBA 1SIBE 2OAEA 2W8BA 3QKTA 1U0JA 4TKVB 1AN0A 2MT9A 4A2CA 3RFXA 2RKOA 1ORDA 5REQB 3IQEA 1SCQA 1YKSA 3UV7A 4O25A 4XX0A 4ZU3A 3F6BX 1WXGA 1E4YA 3SC2A 3WGVA 5D3KA 3RH0A 5BR7A 1JE1A 5CM2Z 2H57A 2Z5GA 3BMNB 4HGZA 1G9SA 4I9GA 1QCCA 2CCKA 4EECA 3E5MA 1G8GA 3IAS1 4Y1RB 5JZVA 1JR3A 3M5WA 3W90A 2G17A 3ND7A 4B80A 5H1YA 1M1YE 3I1JA 3KQQA 1WZUA 4I5EA 3PEUA 5E4YA 5B4UA 2CSXA 4S35A 3RRBA 4EZIA 5KWJA 4G24A 5CJJA 2HU7A 5CCEA 3GA5A 4NS4A 2JI7A 1VKOA 4O2BA 4FFBA 2O8DB 2FUCA 3EWNA 2F1IA 4WNYA 3ZBUA 5BPFA 2QYSA 2X22A 1R5OA 2REQB 3DAYA 5E8RA 2W42A 3F5MA 2CLCX 4WESA 4WN3A 1IN8A 2GZRA 2B9EA 3A4YA 4DL9A 5JNWA 2X76A 1GTJ1 1KOFA 2JFGA 3U3OA 1Q0PA 4M53A 2OM2A 4GMGA 3SYRA 4B6PA 4G3XA 1D8TA 1MRNA 2OK8A 3KJGA 4PFJA 4QO8A 1TUBA 1L4LA 3MFQA 5AVKA 5ED4A 1F2UA 4JK3A 2DB3A 1RVV1 1U3TA 4W63A 1OZ0A 4H1TA 4C6TB 1NVXQ 5DHQA 4F2HA 3A2MA 3FZEA 5BY2A 4GF5A 2AJDA 4YWHA 5AJTA 1Z4KA 4BFLA 1YB5A 1NN5A 1T9AA 1LK5A 4QGHA 2O8BB 5BYJA 2O19A 2EFCB 1OT3A 1L4MA 1P72A 4DBVO 5DB4A 4GKJB 3MW8A 4I14A 4J2HA 3GZ4A 3ZI7A 4JSRA 4LF9B 4ROSA 4KXXA 2PJRA 1YA6A 3PV0A 4Z9YA 1BXKA 3II6X 3PGMA 4QGAA 3FR7A 5C8YA 2XUAA 3STWA 3WISA 5JALA 1E5QA 2HYIC 2VF2A 1RFGE 2C54A 4R1OA 5ENZA 5E3JA 5CBKA 2P90A 2Q5HA 1J7KA 1J06A 3D1LA 2HBRA 3MWGA 4MW9A 3KWFA 1TM5E 1E1QA 5DNDA 3RTDA 3ZD8A 1MKYA 2FPIA 1E20A 3MTEA 3AB3A 1KZ7B 4N49A 2FSGA 2R68A 1L5FA 3MT0A 1NF2A 4L4UA 3WL8A 3AR4A 3LKBA 4C7JA 1AK9A 1BKYA 2ZUVA 5IYZB 3PVZA 1IWBB 4LECA 3COWA 3N87A 3UF0A 1ZK2A 3JRXA 3V9AA 5AK5A 3E3OA 1YZVA 2IKQA 3O7WA 1GQ2A 4PG6A 2HJ9A 1Z33A 2VG8A 4J4BA 4WK4B 5EXSA 1A77A 3UJNA 1C1DB 1G8FA 3T38A 1SXJE 2A1UA 5AM2A 1TCAA 2F9FA 1T3TA 3LA6A 2FLWA 1MCZA 3TRIA 3GX1A 2H8GA 4Y2PA 3ZWWA 2I9KA 1CIJA 3N8NA 2VJBA 3W4JA 1OY1A 3Q7QA 4DGSA 4GZ5A 1F51E 2VP4A 1XVUA 3I8XA 1E9AA 2BC9A 2QU8A 4TLCA 3WXBA 3ZY5A 3GD7A 3HG7A 3MCWA 4QXQA 1JEQA 2ZIXA 3COYA 2WG2A 4FHEA 4I1OA 5IJXA 2MCFA 4CEHB 3CLVA 3E9QA 3E27A 3ET5A 1RC8A 3JQFC 3GPCA 1AQYA 2BEWB 3EGEA 3FFAA 4KYVA 3SD7A 2EJCA 4OLHA 5DASA 4BE4A 1QH1B 1V6CA 1ISJA 2YDXA 3EXIB 3C6QA 3HCCA 3HRHA 4IDHA 4K9DA 2RGDA 3BD9A 1SC3A 3NUGA 3WV4A 2WZCA 4E51A 3VDRA 2XX3A 4WDQA 3PF9A 3RU7A 2AOWA 1K6JA 2QNBA 4RH3A 2HSWA 2BISA 1H6CA 2R1TA 2CL7X 1Z5VA 2PMBA 4UZSA 4YA6A 3KDPA 1BVUA 3H13A 4EHBA 1C1XA 4F8YA 2R5NA 3RRZA 1IMOA 1WV1A 4I3GA 3M5DA 1Y4DE 2J07A 2GQ0A 2NV2B 2CFTA 5J4HA 3LPDA 4G1FA 3EUFA 4R1PA 4E09A 5A6VA 4ZCRA 1FTQA 1N2IA 2ZXUA 3EARA 1A27A 3QK7A 4QTZA 4RCZA 1XA3A 2C94A 3QPAA 1NV8A 2XZDA 4RE5A 5K8VA 4TL7A 4EG3A 3QXCA 1OWLA 1J21A 4D80A 2VHWA 4H4CA 3W5UA 3F4KA 1RWNA 4E2YA 3P52A 4UDYX 1IEXA 1T0PA 4EWLA 4QRIA 2XQFA 5BUZA 1HEUA 2ZS7A 2OHOA 2JGKA 3KVNA 1Y5RA 4PZUA 1DWOA 1XU9A 4PZZA 1G3IA 4RE6A 1YI0A 3MSCA 1N75A 1QHXA 3UENA 1ECPA 2ZKIA 3AI7A 3ZHZA 4BV9A 3H2YA 4BEWA 1BWPA 2FPLA 1TAQA 4YRGA 5BT9A 3ND5A 4P7KA 2WJGA 1G9XA 2DLNA 1TUEA 3C24A 2I71A 1E1RA 1V26A 1YIDA 2ZRBA 4GLJA 5KOHB 1EQ2A 4ZXFA 3PU6A 3PEFA 4K7JA 4RMHA 5GY7A 5F33A 3KQUA 1MIOA 3SIWA 1HF3A 1EFHA 4O63O 5GJCA 2IHUA 5LC1A 1GTG1 4AICA 5AD1A 1M2OA 1XZLA 1QTIA 5JCOA 2PBZA 3OTQA 3L84A 4EHDA 1YT5A 5E95A 4EPRA 4L7VA 1T0HB 2P9HA 4YI5A 4PCAA 1P4GA 5CB4F 2Z3WA 2Q1UA 4OXRA 2VWHA 5ENDA 5JVDF 5IWAB 1OPXA 4IM7A 5EHXA 3QV2A 4M0MA 3FNFA 1OLUA 2LDBA 5DYYA 3VC3A 5MFZA 3UTDA 2VAWA 3KKKA 3NHLA 1PJSA 3OIUA 1GEGA 1UH5A 2L82A 2HT1A 1RJGA 3NVDA 1RYHA 3RBAA 2XJ9A 4OYYA 2O2YA 4IDNA 3MXOA 2AKAB 2VBCA 3N8IA 3PXBA 1C9JA 2K4MA 3G17A 1DQSA 3CLRD 4I4LA 3E8SA 5KTYA 1EK0A 1N2ZA 5JS2A 1TC2A 2XNDA 1G98A 2I4MA 5TMDA 5KU7A 4JQSA 2NZVG 4L6CA 3PLAE 5KWSA 4DLUA 4YMWA 3TW6A 4F6RB 3KUUA 5LQUA 5HNKA 1PNVA 4OK5A 5T5QA 3TXYA 3H5TA 3G9QA 5K3DA 1Z6ZA 5CD1A 2ANCA 1U7OA 4KU4A 4WVFA 5DMHA 1Z5OA 3QFTA 4IZHA 5AP9A 3V32A 3GCXA 2GXSA 1T5IA 5JDIC 5DRTA 1HDXA 2UVPB 4ZREA 2V7UA 5I8ZA 1U0TA 2HRCA 3ABIA 3L6CA 2NN3C 2WHRA 4DCCA 4GPAA 4MYDA 4EY7A 1GILA 1HDGO 1PBNA 3B5EA 1TCBA 1EGHA 3Q6NA 4ZZIA 4GKKB 3EBPA 2R3SA 1CQIB 3LBFA 3MGCA 3GLFA 4AP6A 2FPSA 1PP4A 2LV8A 2RHWA 2MOKA 2VNSA 2IHNA 3NLLA 5HF5A 1IXZA 2RONA 2X8LA 2HXGA 5EFZA 5BNFA 2ID4A 2QAGB 2R8PA 4KGXA 2V7WA 1LSSA 2ODWA 3DE0X 4WFQA 4PM4A 2PA3A 5HBRA 3KZXA 1QE0A 5CDUA 2C97A 2HMYB 3N7UA 4MVJA 2FB9A 1YU6A 3IESA 3K70D 3OZGA 4DCJA 1S3FA 1V9CA 1BE6A 3IODA 4GQAA 4O5AA 2IJGX 4R1UA 2W48A 3SS7X 2X9VA 5EHQA 1G41A 4MR7B 2O6LA 1U1CA 4DE5A 1R6XA 1VXOA 5H3LA 1XQ1A 4FSXA 1RZ3A 4X9XA 4ZHQA 5EHIA 4GZMA 1M7BA 2DPGA 4M6WA 1C29B 3PFCA 3N76A 2ZIVB 4P3PA 2Z4SA 3A6KA 3MWDB 3RUPA 3N70A 3AIOA 3ZVLA 1J8DA 3DE1X 5HA5A 2ZBFA 1LY1A 1KMNA 3KU4A 1W88B 4RHXA 3UTCA 5B1HA 4AM8A 1OR8A 2FX2A 2O7VA 3GJXC 1N2SA 4X3OA 2ZIZA 2IKSA 3DCJA 4N3NA 4ARAA 3AF6A 3IT0A 3OU6A 4YCAA 2QTVB 1HFEL 1O6GA 2RJNA 3PLRA 1M34B 1AXGA 1QMPA 2JKVA 2JCSA 2PL9A 4L73A 3W5SA 5HKKA 5IBRA 5HQJA 4MW7A 1Q7TA 3TVTA 3C3KA 3DZFA 4K26A 4KAFA 4X0EA 4PN3A 2JD1A 4KQIA 1V1RA 1XZGA 5JBIA 4HQNA 4ZVLA 2YXLA 1U9CA 1K7XB 3KELA 5C80A 3GPLA 2X5NA 4EB6B 1YUBA 2IEDA 2JCVA 2P4HX 2IPXA 4WCVA 3NCTA 2Q9CA 4NABA 4RKRA 4C2AA 3M6UA 1YASA 1N1DA 3IP7A 3P96A 2H4HA 2Q2VA 4M0KA 4GUAA 1RXVA 3SSAA 4CQMA 3KQNA 2P35A 4DBLE 1VZ2A 2BM8A 3A4VA 4TMFA 2VRCA 4YT2A 2A33A 3QY0A 2UKDA 3FF4A 1VJRA 3TGPA 1FSSA 2CZQA 1L7MA 3BGIA 3A1WA 2IIBA 4GP7A 3BJZA 1XJQA 4I3FA 2LDXA 2HA6A 3DA8A 4I19A 5IC6A 3S2IA 4J03A 3WIUA 5K3EA 1AA6A 2PUAA 3OZSA 4GNKA 2LTAA 2PRJA 1XWIA 3BGOS 3PNQA 1WULS 4RLHA 1E3LA 5IAAA 1USWA 2B0CA 1JHRA 2VNKA 2XNHA 2H1LA 1X7XB 4EJSA 1E7SA 3FRJA 4Q7EA 1PJQA 1QLJA 2FR8C 3UXHA 2JFXA 3G82C 2W6PA 4P38A 1HETA 3OPXA 2B6NA 1EDBA 2JFPA 3U3RA 1M2JA 3OCCA 1Z68A 3KJHA 4W82A 5BSWA 2PKRA 4TZ6A 1LNQA 4WECA 3DZKA 4KWIA 3DE4X 5CT6A 5J58A 5HG0A 1S6YA 1P0PA 5FJJA 3THYA 1DFHA 3RCBA 1E1QD 4PWYA 1W8IA 1M0SA 2VPYA 3STYA 2Y4NA 4GXRA 4PU0A 1UBLS 2KYRA 2UDPA 3R0QA 3HA5A 3PQ6A 2CUTA 4LJ5A 2ZI6A 5HF6A 1EX1A 3VYTB 3VR4A 4LDNA 2CNDA 3RK1A 4PZPA 4BJHB 2O7RA 4YP0A 2CXHA 2P2DA 5EHGA 4QOGA 3RRJA 3V6MA 4G89A 5EQFA 3RYHA 3AIMA 1LTQA 2I80A 4ZO9A 1IHPA 4PANA 4LHEA 4DWOA 5KIAA 1J8YF 5AM0A 2QMEA 5BPHA 4GL4A 3WVNA 2XRZA 1SUWA 2XMGA 2ZYWX 4FCWA 4LXTA 2NVUB 3UWOA 1W7AA 3ZU4A 2ACEA 2BMEA 4L5BA 3AVQA 5DM0A 2IPAB 4EB3A 5AW2A 4TOIA 2EG9A 3UXYA 3QNUA 3E7FA 2PT7A 4UXHA 5K1ZA 1VKNA 2I6SA 2YS6A 2QROA 1WP9A 3BG5A 1F0PA 3E9RA 4X24A 5ALRA 4GI5A 1X80B 5SY4A 3LXUX 2Q27A 3IYLW 2GCEA 2VJKA 4B6QA 4CLOB 2DHQA 3ANNA 3RSFA 1DX4A 4OA8A 2GRJA 2XYQA 3GBPA 4C0XA 4I1PA 2PLNA 4UQPA 4NYMR 3ZCUA 2P41A 1U2QA 2FZLA 2Q4DA 3VZCA 1D2RA 4PLZA 3QEMB 3RQIA 3NOXA 4D3YA 2VRWA 1SD1A 5HJ2A 3SI7A 3RJTA 3UT5B 2PKWA 1LJLA 5DLYA 3AHJA 2JHCA 4JQZA 2HCFA 5CDFA 2W6ZA 2V6BA 1M2EA 3RFVA 1MW8X 5C53B 3DBLB 4NK5A 5K3FB 3P2YA 1RPNA 2NXNA 3GFSA 4XXHA 4B3CA 5HIKA 2IIVA 3R6WA 3E8MA 3DV9A 4U7WA 4BN0A 2CF6A 5C5IA 1F0NA 3FDZB 4K86A 3B1JA 3ZJ4A 4IJ5A 5K6AA 2AN1A 3PHJA 2Q5IA 1I7PA 5EQTA 1PUJA 1RE1A 4RANA 5CVCA 3UJHA 1PT9A 3ZHCA 4BV8A 1QVRA 1JT9A 2NUAA 4ZVVA 1RIFA 4HLDA 4HDQB 5G0TA 3O3OB 4IXWA 4QTTB 3E7PA 3UM9A 2QSUA 4EZBA 3GLGE 3A3OA 1B1AA 2OO7A 3FM9A 4B5LA 4ZANA 1AHPA 2ZUFA 1RXEA 2GD0A 2QUBA 3PVSA 4OM8A 1XMJA 5BR4A 1QH8B 3A04A 1WY7A 1GJRA 5DT2A 1ADJA 3RRYA 1XJ5A 3ZZNA 5D86A 1VP3A 1E1RD 3CBGA 2WJWA 1MUUA 4ODIA 1JEAA 3U4HA 3ZCSA 2HA3A 4NOLA 2AYXA 5L3SA 4DGQA 2F48A 2AA3A 3BYZA 4AUNA 5BR8B 4DT1A 3HLYA 2VZ0A 4QIHA 1TU0A 4NCKA 5B4VA 5B6JA 2FQYA 5EE9A 3ZV7A 2XCTB 1D03A 4CLRB 1J23A 5LUAA 3KZ1E 4E3ZA 1OILA 3IO5A 1CB0A 4G0MA 4HUJA 1JQEA 3HGQA 5BN1A 4DR1B 3H9EO 4IZ6A 8OHMA 2ABWA 1V71A 3ESQA 2A9RA 1G6KA 2FE1A 4U7JA 4R41A 4HO1X 4AXXA 3MWEB 3RSZA 2PUDA 4OEHA 3UCXA 4BP8A 3A11A 4TQ9A 5K0JA 2AXNA 2C29D 3Q5EA 4G84A 4ZAXA 4MDHA 1TM7E 3F6SA 1ACJA 3SFTA 1NJ8A 4V1CB 1IQUA 3VTZA 2WA2A 4OXQA 3ULKA 2B8NA 3KR9A 1I3OA 3T1OA 2Q2OA 1B0ZA 2OORA 3HR4A 3S8YA 1W52X 4F96A 3U7GA 3ANSA 4YRRA 3C3PA 2QAGC 1EVEA 2O8CB 2Y99A 4TKUB 3BTSA 3M82A 3S55A 5L7WA 2XNDD 4EGFA 5IANA 1GZ7A 4EFMA 4LOAA 4R9SA 1NUQA 1Z39A 2EYQA 2X19A 4N0PA 1F0YA 2E5FA 2X6RA 4RIFA 2O1EA 4AZWA 1NC1A 2XGGA 4YRAA 2ZS8A 4BNHA 3TLGB 1PGPA 2XOKA 4TLDA 4EUKA 1JKIA 4D96A 5AUOB 4JJAA 2CHGA 2UU9B 3U4MA 2F1RA 3H1BA 3NTXA 4E2XA 1T5OA 1GA4A 2GXQA 2V0CA 2OLEA 4FYKA 4ZYXA 2DG2A 1BMFA 2CWWA 4HADA 2O57A 4MHOA 1HY3A 5TIIA 2VK8A 2Q6VA 1SWWA 3B5IA 1F5SA 5DBEX 2CL6X 5TARA 3PXGA 4MR9A 3PD7A 2BONA 3E4CA 2ZRNA 2H6EA 4G4JA 4YTEA 4E33A 2P9CA 2Y9MB 3LCJA 3SJCA 4PRYA 5KJ1A 5KUTA 1NBEA 1DS6A 2P5TB 1AZTA 3E5NA 4DIFA 2XYRA 3BL6A 5DHFA 4PC3A 5CFMA 1RP7A 1UBFA 2IPNA 2PT6A 3H2IA 3O4IA 1XZHA 3ONDA 1F60A 1P9RA 1B8OA 1I2MA 4RKYA 4TVKA 3F3MA 5ALJA 4JI6B 3EDYA 4J9UE 3E7XA 3TSYA 3JVEA 4DREA 3T12A 4N82A 4LDJA 4XYLA 5LP6B 5FUBA 3TRFA 1G7CA 4M21A 4JI5B 5KX5B 3VJRA 2ZUUA 1DWPA 2FKNA 5PNTA 4CF4A 4TYYA 4OJMX 3ZCXA 1E66A 2AD5A 3A1CA 5EZ6B 1E7RA 1YR8A 3KR2A 2NO4A 4G07A 4FFPA 4PINA 5AKXA 4NXNB 4Y67A 2F9LA 2AK2A 1RMYA 1CQJA 4RD2A 2Z9CA 3ZQKA 3GFRA 1KBQA 2V59A 2PZLA 2ZYIA 3P0HA 1IBLB 3EZGA 4U7HA 2E1RA 1N36B 4I81A 1NY5A 1D4FA 3EEFA 5BVHB 3EXG1 1AQNA 2IDZA 4NBUA 1E4EA 1MB4A 1Q19A 2WWIA 4PONA 5FRDA 1E77A 2GKSA 1V43A 2XKBA 4RO0A 3LCVB 1UXJA 2PLWA 1H23A 2W6CX 2BEUA 2PU7A 3I72A 5T6MA 4N48A 1SC1A 2XTNA 2JASA 1YUMA 4PSCA 2ZBPA 2WP8J 1UKCA 3MOSA 4JKIA 3WRYC 4D0RA 1ZYUA 3K0KA 3PKJA 4F5YA 5HKKD 5HZHA 1YTUA 2ZT6A 4B3HA 3GUCA 3K0SA 1C4XA 2VTBA 1QVVA 5IBQA 1NYLA 2H1CA 2NWQA 4IX9A 1JKJB 2HBZA 1DJPA 1WCWA 2Q3HA 4S1WA 3U6BA 1R74A 5J2TA 3ESRA 3JAKA 3KEOA 4C7MA 1R4MA 3HKEB 4Q24A 1FOEB 4TM8A 2PDAA 1ZY2A 2YRWA 1QC5A 2E87A 2FQ1A 3QRWA 5EEHA 1VSTA 5CLGA 5HIAA 3N5CA 2MSWA 1A7JA 3LW7A 2IYYA 4LHWA 4TV9F 3LT0A 1WW2A 3MCVA 3ER6A 4J7UA 1EZZA 2MWMA 2C83A 2WT4A 2J5XA 1W1UA 3JQFA 2IELA 5FKJA 2J3LA 4OHWA 2A9OA 2PZAA 2FU5C 1U04A 1V4VA 2A5YB 4DXAA 2JJ1A 2R1UA 1ZJ5A 1T4GA 2ZJ7A 2OHVA 3QXHA 3EN0A 2FW7A 4MICA 4KTTE 4MYRA 4CF7A 4NMWA 3IUNA 5H59A 1DLIA 2CMGA 3BFVA 5AK3A 2OHXA 5JSFA 5JSUA 4Q3CA 1LCIA 3HEAA 1Y34E 5EUMA 2IYNA 3ZEIA 2QL7A 1GTRA 1P7PA 1VJCA 1Y5IA 2QOEA 3ZLTA 3AVTA 4RU1A 4UM8B 3K2EA 3RJMA 3SZRA 3V8BA 4IIDA 1CX9B 2L0XA 2GZMA 2H4FA 5FBVB 1CF9A 3VNVA 1VHQA 4IAOA 3LRPA 3HJAA 2JNWA 4K6FA 4G9BA 5AUQA 4DWVA 4Q19A 2ZYSA 3EWSA 1CTQA 1B1CA 1G21A 1L1EA 1TIKA 4HR7A 4TWRA 2O23A 1TEXA 2GJKA 1M8FA 2Q28A 3FMFA 1TB4A 4GR4A 5E9JA 5EMMA 1JJBA 1K5DA 3KTAB 1CY6A 3LT4A 3ZD7A 1S96A 1J6UA 2VK1A 4IIHA 4O4HF 5CT8A 3D3KA 2D1QA 3F74A 2UYOA 4ICIA 1SD5A 3G2NA 4NE7A 1A72A 4YLEA 1FQKA 3HKBB 4FC7A 3O9MA 3I1FA 5K7SA 2VDPB 1ML4A 1Z2AA 4ZOLA 1GQQA 2DFVA 2W6OA 3FOBA 4PTLA 1H42A 2VH1A 3VR4D 3KAPA 3TQRA 3WGHA 4B74A 5A0TA 3SZLA 1SOMA 1XXLA 1W581 3ZNQA 4TTQA 4YJ2A 2PYZA 2RC5A 3E81A 3LOUA 2PUGA 2G07A 2W43A 1A8PA 3I9V6 3S2ZA 2B20A 3OTIA 1SU8A 3L7CA 4N5HX 1JZTA 4XE5A 3SOPA 4LV6A 4EH1A 5EE1A 2DFNA 4XIGS 4CM5A 3M0EA 4AWAA 3OO0A 1ZCAA 4KPUB 3VJKA 2XADA 3T61A 4K3VA 1A5SB 5FWYB 2C7OA 2I8LA 3UN1A 3UNXA 4D3DA 3N7TA 1HT2E 3ADDA 4LGVA 4BNWA 4J16A 3AF5A 1L8XA 5CEFA 3HDJA 4AQYB 2R2GA 1MLDA 2R6R1 1E3MA 1PQPA 4OJKA 3F97A 4P2BA 3JALB 4JB8A 2P8JA 4UBOA 3K1YA 3STTA 3TK1A 5AI5A 1T1GA 1XP5A 2ARKA 3UAXA 1OXUA 3CLHA 2HQSA 3AJEA 1IJBA 3ZDAA 3VNRA 1MJNA 3W3AA 4NKRA 4ZAFA 2IEGA 2GPBA 2F1KA 3BIWA 5I9MA 1XVIA 3TI7A 1UJ2A 3ZQ4A 3LCRA 3OPYI 5CDYA 4DIDA 4G0UA 1BH6A 4XPIB 5EQJB 5JFOA 4AZ0B 4QLOA 1DV1A 4ZK6A 4ILEA 3OOYA 1J09A 3BZWA 3SMQA 2NZUG 1YDMA 5JHGB 5JMOA 4JLSA 2QD5A 1Q0SA 2AB0A 2J9XB 1ZGAA 3C8HA 3RGWS 5SYMA 4KAXA 2AN3A 3EGDA 3HJRA 3M6MD 3G6KA 1NMEA 5J2UF 1G8JA 2V7GA 1ORVA 2OZVA 2JJQA 4HWPA 4J6EA 1XF1A 2A1IA 1QZZA 4K9NA 1HSZA 4HY3A 5GZ6A 3D64A 3HA2A 4MVJI 4C4TA 2GEKA 2JIMA 1I1OA 1ODFA 2GASA 3EDMA 4MR8A 5FI3A 1E9EA 4O08A 1CLUA 5JDIA 2YS7A 4DW8A 3F67A 1YQEA 2VYQA 3EA4A 3C97A 1AJEA 4KXVA 3DMYA 2ODNA 3PPYA 5JXJA 1EP9A 4NHOA 2FCRA 1XDBA 1CDZA 2F2TA 4TKVA 2GLTA 5JR3A 2QSYA 3I76A 5DHPA 2BM1A 4C29A 3JZAA 2JFBA 3C6MA 5REQA 3P9SA 4RD1A 3PZRA 3HCEA 1JAZA 4PYKA 4HNQA 1HT1E 5FIUA 4DAOA 4RPHA 4LF7B 1KFJB 3A9UA 3WLKX 2VT6A 3SLRA 1Q22A 2OZPA 4UTNA 1OIXA 5KS2A 3W5BA 2K7FA 2DR0A 3BMNA 1OB2A 5FAXA 2YIMA 4LBZA 1CY2A 5HUQA 5J5CA 4Y1RA 2AJBA 2BFWA 2EKZA 2JGIA 2QTZA 1J0DA 1R8SA 2RK6A 2ZRIA 4ZP1A 4YAUA 3R76A 2B5VA 4KGDA 2FJPA 3PE4A 2O07A 1N92A 4Q9JA 2HQOA 4LC0A 3C7CB 1YE8A 3DZCA 3TTUA 3FHTA 3EG9B 4YP5A 3RSQA 3KHTA 4G65A 3QWIA 2O8DA 2YOGA 2REQA 4BE9A 1LFDB 2JBWA 1LSOA 3C6XA 3MINB 1JYFA 4M83A 4F06A 2P9QA 3KWLA 5FA6A 3WWOA 3D8RA 2G9QA 1DCKA 3PJGA 1TTHA 3OJCA 3PUIA 1CZRA 4C01A 4HI0E 3M7IA 1JXMA 1XQ6A 4PW0A 3DBOB 4YROA 2Q1WA 4WXRA 4AVYA 1TJ5A 2QE6A 4LWZA 3B1VA 4C6TA 4WCFB 4Q03A 1W1WA 1PFKA 2ZYDA 4WT7A 5LP6C 4YYEA 2JLBA 1YDWA 2JD0A 3KPUA 5CUQA 4NDZA 4C7KA 5KMGA 3KHSA 2O8BA 2C59A 2HHAA 5JDCC 5THKA 2FI1A 1XROA 4QTYA 5E2AA 3P5SA 3FVTA 1ZZEA 2XCRB 1QORA 2H63A 3AU8A 4YRFA 2FZVA 4JI3B 4PLGA 1ZIYA 2N0SA 4B8WA 2LR0A 4AJ9A 1JZQA 1BMFD 4BAZA 4DVGA 3SIXA 5IZCA 5A9TA 1HT3A 1CU1A 1F8YA 2NU9B 1F3LA 2OVBA 2JFYA 2RCYA 3B7GA 3RF7A 2VSXA 4OKIA 3OY7A 3R7BA 2VSYA 4RYLA 2FX3A 3NNDA 3EVZA 3PKZA 5DIFA 4YONB 1NLZA 2IV3A 3QHPA 4B8ZA 5EIEA 4BQOA 4NJEB 2H3HA 3TD2A 5IYZA 3UIEA 2DHCA 1FDWA 3JSXA 5B4TA 4F2WA 1Z07A 2YJZA 3D4PA 4J49A 3HVUA 2ZE8A 1C1DA 3AV0B 1Y33E 4WOCA 3W9BA 1M6EX 3QG1A 3QX9A 2AN4A 1EP2B 4NU0A 1GSOA 2G6BA 3TPCA 4DLAA 2M6LA 1KSFX 1ENYA 2NYAA 2E85A 3QNWA 4PVCA 4DLYA 1NBIA 2C3MA 3ZZ0A 5L3QB 1GQOA 2HEIA 3OQBA 4DA9A 3CN7A 4L8GA 4LYYA 5CVTA 3VVMA 4URFA 3VYSB 3TPFA 5L6MB 3OQ6A 2J87A 2CUZA 3BHNA 5DWQA 5E4TA 1DAKA 3DV0B 1PQWA 1U8FO 1H6BA 3F8SA 2BEWA 4OHMA 4FKBA 2H2GA 3WLAA 3COJA 3O4JA 3Q2IA 1ZMBA 3RK0A 4CWAA 2ADMA 1QH1A 3DCYA 3JQ9A 3EXIA 5CCDA 1S9DA 2MHCA 2OB2A 1WW3A 3AP2A 3KYBA 1DTSA 5CLJA 1IXYA 1FRFS 2HHCA 3KL2A 1K5HA 2RFLA 1HR0B 1YAJA 3AY7A 1RC1A 3CT6A 3MUNA 4LMAA 4GZ3A 2HIMA 3V4FA 5CVEA 1SCAA 1KHTA 2QP9X 2HRZA 1JWBB 5D5HA 2KI5A 2EL7A 2BH2A 4UMVA 2B94A 1YIAA 2I5PO 3M6AA 4D9GA 4W8HA 3VR5H 1ZHHA 4M7OA 4UREA 2DSNA 3GT3A 1QO7A 2KMLA 5H68A 4U9HS 4BY9E 3LA8A 2C20A 2AI3A 3HA7A 1YBAA 1M9NA 1FJXA 1RWBA 4QU8A 2Y0EA 4MPPA 3KPVA 3B1YA 2ZJ2A 3CKYA 3JQ8B 4DY6A 2Z1NA 3QBTA 5BO5A 2YV1A 1OBHA 4L8WB 3NPMA 2B7CA 4AJKA 2EEPA 1W9HA 3H6HA 4HUQB 4OI2A 3GELA 3ZG6A 1NKTA 3CLUC 1SZCA 1GVHA 3E61A 4BIIA 1RHMA 1S3SA 4FHDA 2Q9UA 1VE5A 4KLCA 2JJ1D 2WJVA 4WNCA 1XAIA 2QN3A 5K8UA 3A3YA 4K40A 2B2XA 3ETGA 3QKRA 4I5DA 4IDGA 1Q1NA 4YDHB 3W2GA 1YZ3A 2ZI5A 4N9WA 4A1FA 5C52B 1QE3A 5EJ7A 3UAGA 1WKVA 4Y1EA 4OAPA 3ESBA 3OLZA 4N47A 3C3EA 4BO4A 2JHFA 2I3GA 2AKEA 1EUCB 2HPVA 2ZB7A 2A9FA 4ND5A 5AM5A 1ZLYA 2JPDA 4MUIA 4DPMA 1E2EA 1I01A 5KOHA 1BDMA 1R12A 1RWXA 1O8CA 4B6FA 5JS8A 3EPRA 3DAGA 4IWNA 2LZ0A 1ENOA 2DBVO 3MGBA 1TYAE 5EJ5A 3BQMB 3G2HA 1ONSA 3ZV6A 3IERA 1KJIA 4IUYA 5CXXA 4CI0B 1V8DA 3DE5X 4AX8A 1X8LA 3CNEA 3L18A 1QAOA 3IUYA 1DC4A 4ZZ2A 4X64B 2VOEA 1V4NA 1L5KA 4FILA 2ATXA 5J1TB 2DY1A 1UAYA 3SLGA 2WLTA 1KAGA 4E5DA 2GEJA 3RYIB 4NBWA 4CL2A 3RM3A 5DTJA 3AUYA 3JYQA 1ZVMA 1PWXA 2QDKA 1BHJA 3NAMA 4ND7A 5IRCD 1UBJS 4CM9A 1OYWA 4P92A 3CKKA 4P35A 1DHRA 1JAXA 1L7VC 3PRHA 4TUYF 4YCBA 4F3CA 1YOVB 1C0EA 3OA2A 3W34A 4Q12A 1Y48E 3RTCA 1RKUA 2YZNA 1ZD1A 1SZJG 1WAMA 3HB0A 1TVCA 4MAAA 3W6OA 1FUYB 1RE0A 1R4AA 3C6YA 2DECA 2DCMA 1XL0A 1QGED 1TKCA 3ZJYA 2NTYC 1SOWA 3BUSA 2P6PA 3HUUA 4KZPA 5JZMA 2FK8A 5A7HA 2XY4A 3O8QB 4F6RA 3ZY4A 2FW9A 5K5EA 2XVMA 2PTGA 5IJ9A 1GUBA 3FNHA 3HB4X 2FQWA 3K16A 1ODJA 3DL2A 1QG0A 4QSMA 2GO1A 3F1LA 3EQ6A 3JSAA 3L49A 4AS2A 4F72A 2BSAA 2YV5A 4YREA 1JLKA 4A8TA 2UVPA 5DBIA 1M1ZA 1WLSA 4EG1A 4PS1A 4Z9XA 3IKVA 4C3ZA 3R23A 3PEWA 3G9ZA 1CSEE 2QPLA 1YAHA 2Z2ZA 2VP9A 2GESA 3F7TA 5KTNA 1G3QA 1GNVA 3BE8A 1M1XB 1NE7A 3SVTA 3RHFA 3MHPA 4UFOA 4YNBA 4ZC8A 4Q7KA 4WKCA 1U4SA 3H5AA 5HIMA 4G0WA 5DGCA 1BJKA 1VLJA 1FNDA 2D3TA 1KI3A 5BSHA 4BE7B 2P1ZA 3R7DA 4IIFA 2DE0X 4OHYA 1H85A 2Q3JA 3UC9A 2P6NA 2J08A 5LMUB 1CY8A 1WPXA 1GDHA 2N42A 3K0BA 4PQFA 1SOUA 2XB8A 3N07A 4BZXA 2GF9A 2NO0A 4FW8A 4FOOA 3KOWA 2UZ1B 2QY9A 3IOEA 3HCNA 3T9BA 3EQ7A 2NUPB 3DXXA 4O2BF 4OGWA 1JEEA 4OQEA 4PC6A 4Z4HA 3MB5A 1DKUA 2OGUA 3NRCA 3ZQ6A 4MR7A 1M8KA 1EI9A 2C61A 4L3VA 3TCKA 1SD2A 4G86A 5COBA 4MMZB 4MVJP 4WASA 1XEWY 1NP6A 3HVRA 2X3UA 3GVCA 3NRJA 2A0WA 4P54A 4XQ9A 1KQNA 4BFUA 1RTTA 5JQWA 1L4FA 2RBEA 2XVZA 3MWDA 4H7IA 4IGAA 5TT1A 5IH3A 1SBIA 4FNGA 1K7SN 1YGPA 4IHJB 3OJEA 4JUCA 5KHAA 5IVIA 2I2BA 1W88A 1E58A 2VP2A 3IP8A 1UF9A 3C8ZA 2EQ5A 4D4LA 1X77A 3CLTD 1VG1A 4A0FA 3R74A 2P6RA 4RA6A 4QVKA 3TVYA 2QTVA 1HH4A 1ZW1A 2G1AA 1M34A 3AHDA 4C78A 3TSOA 2CHQA 1LH0A 2RIPA 3PS9A 4M1OA 2BDEA 2P2GA 4HDNB 4X44A 1UKZA 2ID9A 4DMGA 4F3TA 4YPOA 1AB6A 4RYDA 1Z4IA 1DUSA 4ZQIA 2OQVA 2G36A 2KSQA 1SKBA 4KIWA 4EELA 3FKJA 4KO2S 5NULA 5CNJA 4QATA 2AUNA 1KY2A 3B3JA 1G7TA 1G291 4LXQA 1YJBA 5IC5A 3T7KA 4ARSA 5I7OA 3H99A 1IM2A 4O3MA 3H6KA 2MTBA 1LDMA 3JD1A 2ZE7A 2ZYVX 1UZAA 4GIBA 4RK7A 4COKA 4E1AA 3CVYA 5BNIA 1BYUA 2EOAA 4ZEXA 4MS1B 1C0KA 1FEZA 2QTBA 1Y9ZA 2GWRA 2JBHA 3HDYA 2C96A 2YY7A 3HZZA 3Q12A 2VNJA 4KR0A 4C0LA 5JS7A 9MHTA 3PHGA 1FPQA 4ZQFA 4JXZA 2VF5X 2CNWA 3HKDB 4JDUA 3PR2B 1G2IA 4Q1EA 5KCZA 3R3VA 5JAUA 1DAIA 4E5VA 1ZAYA 1SBNE 2ID7A 3DWFA 4KDFA 2CVQA 1DBIA 1E18A 4F11A 2CL0X 1CBUA 3F5SA 4DMHA 2QR2A 5K20A 2Y05A 1ONBA 2FVYA 4O1HA 1EVJA 4Q3NA 5CW1A 3V9PA 2PUWA 3D0OA 3PEVA 1X7XA 2YX1A 3ZN2A 1SKUA 3GJ5A 4ZDKA 2FLVA 1CQWA 1HE3A 5IDVA 3SS9X 1YR9A 4BFCA 4U6QA 1FMFA 3BS4A 3C3WA 4OQNA 4DCPA 1D1PA 5C8DA 5DOZA 3RV3A 3X1JA 1ZL2A 3BJMA 1GP2A 4OMFG 1K4YA 4FHFA 2KE5A 2QW8A 3QYFA 4GI2A 1GR1A 1OI3A 1AE1A 2AE2A 3LXMA 4K6OA 4YJHB 1NU8A 2FK7A 3X1DA 3KQVA 4F3KA 1I2DA 4M7RA 2D54A 2ZYAA 1PL6A 3L7OA 1JFTA 2CKDA 4FD3A 1EBUA 2W83A 3FPLA 3QMPA 3OIWA 2BY4A 4C9BA 5FLEX 3C15C 2LIPA 3TQQA 4G8DA 1UXHA 3GLVA 4CLDA 5HYVA 4LYDA 1WQ1R 3BVPA 3RSHA 1GGVA 2VTEA 1NBWB 2P9ZA 1LRJA 1W47A 3R2JA 4IFIA 1OGIA 4LRQA 3FJOA 3HNPA 3NOOA 4R1LA 4KAJA 1VPEA 3K35A 1IN7A 3QU2A 4TTJA 4IOLA 3KO8A 4RKQA 3FRHA 2IIPA 5EE5B 4CTNA 5KI6A 2YJNA 2NVUA 4GRAA 4RD3A 1TMYA 1RLTA 2QQ5A 1B74A 1FDIA 2YWJA 3U4AA 5ELXA 5A71A 4XFJA 2DULA 1JG6A 4U2EA 2E21A 4ZYVA 1X80A 4HZGA 5U4QA 4DCMA 3FCOA 3I9MA 3JASB 4OOFA 3I6MA 3GLUA 3OQHA 3WL6A 4YGXB 4B40A 4DYDA 1EHYA 3E8XA 5AKKA 1T1EA 1L7BA 3QEMA 4V0SA 1E6WA 1RKQA 3UT5A 1SURA 1T2EA 3HRKA 4EMSA 1J99A 1ECJA 3A1NA 4UOZA 2MYPA 4G8BA 4UU0A 1AUOA 2JCGA 1QQ6A 4AJOA 1IZZA 1G6Q1 1KARA 3D7SA 4HQ6A 4JLPA 1GZVA 1W49A 2GSWA 4P7BA 3N1UA 1L7XA 5ILQA 1I14A 1FSGA 2QRZA 4PE5B 2DQZA 3CH5A 5K3FA 5JFTA 1Y6QA 3BDIA 2WJHA 4L08A 2ZTSA 4IG9A 2NO9A 2HHLA 1QCDA 4JNKA 1ECBA 3B9BA 4L76A 2OC9A 4MVJG 4OA5A 3JQEA 1W36D 3FDZA 2I66A 4J3NA 4OK3A 3LDUA 1OSNA 5ADUS 4JJ4A 4O5OA 2WUVA 1U5AA 3Q7PA 4KLNA 1H69A 2V3VA 1E1KA 5IX8A 2GCIA 4F86A 4LJ4A 1QGDA 2DFDA 4NONA 1FFYA 1GT6A 3CONA 1KZ4A 2XECA 2Q41A 1TEZA 1WZEA 2PKEA 1VHTA 4YUXA 4QE3A 1D2EA 4MRMB 4P53A 4Y7DA 3VO1A 2XGOA 3LLMA 4X66B 1FQOA 3PP8A 1EVQA 1YH3A 3S4YA 5TE9A 1VKHA 2VKTA 5K0NA 1JG7A 4NV3A 2G7MC 3SHVA 4AIIA 4G09A 5ALLA 2ZOSA 2QT9A 4W6ZA 3W2HA 5KYWB 3QPCA 1UL1X 2X42A 4RV9A 3I8SA 3K0AB 4WCDA 5C46F 2QUAA 3HI4A 1RQPA 3TQFA 4BKPA 3NW9A 3VGPA 3UFXA 2EKQA 3P97A 4XOUA 3EVAA 1VJ1A 1E99A 3WGUA 1UR5A 3QWFA 2O2XA 2VWPA 3DEAA 4KMOA 1MQ8B 4IHKA 3TOCA 4RTRA 4EW3A 3THOA 2GAJA 3HYSA 3LUHA 4CLRA 1W73A 2YQZA 1YZLA 2W2KB 3LYUA 1QVAA 4EG0A 4UBNA 4FMCB 1Y80A 2IODA 1T35A 2P11A 4PX5A 3TLAA 2XIQA 3L4BC 1YR3A 2M2IA 3TIFA 4CM8A 1WCYA 1Z6XA 1PSDA 3EDCA 1CE8A 3FUWA 1C7EA 3MWEA 4L74A 2EHJA 4R31A 5BOVA 5DN6D 3Q7RA 1TT5B 4ETWA 3REGA 2BBSA 3HPRA 4J90A 4PFQA 1E9FA 1T6YA 4JLMA 4Q4AB 5I7HA 4URYR 3PEEA 4YUWA 3A3KA 2XJ4A 1GKUB 4FXOA 4JLVA 4L1KA 3TZLA 1UM8A 4X00A 2IZ1A 1W6UA 2AQHA 2BH9A 5F35A 3U3DA 3DW3X 2P4SA 1FFEA 2R8OA 1ISHA 2O8CA 3O47A 4TKUA 1F6DA 2WIAA 4ZRNA 4FWIB 3SVLA 1T6BY 1PUXA 4MRPA 1VI2A 4RFLA 3H7AA 3WY9A 4H17A 1T26A 3FHJA 2UYHA 3F4LA 3V1YA 3HU1A 2XI4A 1TL7C 3OZAA 1A71A 4LA4A 4NP6A 1Y5LA 2WEKA 3TLGA 4W99A 2Q99A 1N0WA 5CEJA 2ZUBA 1UBGA 3Q8XB 4JDPA 2FFBA 3R7LA 2Q1SA 5MN5A 1Y4AE 2JHAA 4DDWA 1CUCA 1XD8A 1ZBQA 2ANBA 3ADOA 3V4RA 4GYJA 5FI0B 2VQSA 4WK0B 3THRA 2XTAA 2NV6A 1DKQA 1XDUA 3TLXA 2NU7A 4U1RA 1WXXA 4AYWA 5BT8A 4LJ8A 2HOQA 4XB6B 4JB3A 4NBLA 3ZR4B 1ESNA 1H1DA 1C0IA 1PKEA 4MUHA 3VR6A 3RUHA 5LXTB 1V45E 1YZHA 2ECPA 2IL1A 4CM6A 3QLVC 4LKRA 1C8BA 4PO8A 5ALPA 2J31A 1QIHA 3K09C 2H51A 4V39A 5AVOA 3QBVA 1PQYA 2GSDA 3LK6A 4JLAA 4MV9A 4DJJA 2XUFA 1SHUX 2GA9A 2MJLA 3LXXA 3QIAA 1G4HA 4HS4A 3KYIB 2O14A 3UBTA 4GYWA 3KS9A 4FFOA 5ERYA 5DU2A 2GBCA 1GHTA 3DDNA 3E18A 4F45A 5LZ2A 3BULA 2WJAA 5JYDA 1Y7PA 4QQNA 3S8MA 3U7HB 4UPDA 4F5ZA 3WOHA 4BLSA 3BBPA 3K9QO 1VA4A 2OLJA 3CF0A 5KDLA 3KOZA 4E11A 2AQKA 3DTNA 4MARA 4KQCA 1OV6A 3HE3A 4C2TA 3IOYA 5FHQA 3TAHA 2G08A 2Q5LA 1J33A 4C4RA 3UUEA 5B3JC 3O7MA 2HA5A 5AW5A 3IMFA 2XMCA 5BVHA 3UK1A 1P0QA 2J9FA 4IDCA 4V0LA 3QXGA 3WGLA 1RLMA 1ZOOA 2O8NA 2P91A 3GPBA 3ZBQA 2Q46A 2QORA 2ZLBA 3PFWO 3ON5A 5LNK6 2DPLA 1E3WA 5EXDA 3GG2A 1YMUA 4FEGA 2X14A 3T0IA 5LKAA 1TJPB 4P5EA 1OZFA 2BFNA 4TN5A 3D8NA 4XJTA 3SR4A 4JJ8A 3V6LA 2VHTA 4BQRA 3LTNC 1VKJA 3ZWQA 4LPKA 3LE8A 1RR6A 2ZTLA 3PCRB 4LRSB 1EK1A 3QLUC 1JKJA 3V5NA 1JBEA 1QS0B 1VMEA 4NFLA 4HNUA 2COUA 4ZQBA 4XZ3A 1IH8A 3I42A 4TL9A 2P9BA 3OEEA 1ZJYA 3HVJA 3I2YX 1U9IA 4RACA 3O9ZA 4F38A 3PG5A 3AOGA 4ROTA 1CT9A 1J2JA 4NYMQ 5L4LA 2QMHA 2X5KO 4DV1B 4W1PA 5F1PA 3RSSA 1NURA 1HFWA 1U2RA 2G5TA 4HWTA 1CUFA 4MJ7A 3W6NA 1GPDG 3U39A 4F4DA 2VZ9A 1G17A 1KETA 5M2QA 2ZAIA 4F71A 1LX6A 1U3GA 1ETUA 2IDKA 1E32A 1FMLA 3PB3A 5L3RA 5HBGA 3D6HA 1ZJ6A 2YVKA 3PUJA 3WK5A 2CNWD 2IUTA 4BIMA 2VYNA 1GYQA 1YHZA 4YH1A 3UANA 4LNAA 4OP3A 3WQRA 3EVNA 3EMBA 1EXNA 1P91A 2ZATA 1O89A 1QE5A 4CTKA 2EDAA 3NRBA 3VZPA 4UC0A 1JDUA 2OB1A 1MC1A 1O0SA 2V7TA 2YICA 2IYZA 2EIXA 2REXB 3D7KA 1KEWA 4B35A 2A1TS 4FU0A 1Z4LA 4RCYA 3WTCA 4M9CA 3QU9A 2XRYA 1KSGA 5F64A 3VPCA 4KZKA 2HSEA 4ZAYA 1N6PA 4FEEA 1BD4A 3UK7A 1NE2A 1L5YA 2GWHA 2OCXA 4QNNA 4C7OB 1QDUA 3VJLA 3LTEA 3T94A 5AVZA 3N3AC 4HNHA 2TSYB 2XE7A 1RCTE 1WETA 3VPAA 1S8OA 4ETIA 3KXDA 3GW8A 2C7RA 4F91B 2X2PA 1ZGCA 4DV4B 4ESEA 3CRQA 1VE7A 3HKBA 4GOLD 2ZRQA 1XGKA 1KVQA 1XALA 2WKWA 1QFSA 3LYHA 3QIVA 1YZTA 2BBOA 1U2EA 2G1JA 3L0DA 5FTWA 5KEIA 1DFGA 4D25A 1BGVA 2C2BA 5HS6A 5TY0A 2R85A 3SEQA 9ATCA 3P9NA 4HDMB 3TJRA 3N6XA 4NR0A 4P1ZA 3SS8A 2GXUA 3P0EA 4ZGWA 4S05A 2I3ZA 1XLWA 4JBIA 1SVIA 1N78A 4ACAA 3EPPA 1V47A 2VQDA 3FWPA 1PDVA 4FE7A 1K9SA 1L7NA 3PC8A 4FONA 4PCLA 5JSKA 1EUDB 1I94B 4I4TB 5FWYA 5C3UA 4LNUB 4IIJA 1USUA 4TKLA 3WAKA 1SIWA 2QRQA 4PVDA 2IHVA 4PHGA 1E7MA 2IHYA 1ZM4A 1V9LA 4PZDA 1XDGA 1JHUA 2E7ZA 2H2HA 4MO9A 4F21A 1Z2NX 2W4MA 2WQZA 3HBMA 3M33A 5I8WA 3JALA 5FYQA 1FRVA 1DCFA 2WT9A 1JJAA 3K6JA 4LTNA 1X9HA 1XYYA 1JYSA 2LCFA 4M1EA 3WDKA 1MRSA 2WAXA 1YVRA 5E0KB 4C89A 4LGMA 5KNCA 2H7YA 1W87A 4ZT4A 4D44A 2W11A 4E46A 2HIHA 3RK4A 3BD7A 3P0IA 3NTOA 4IOJA 1TZCA 4UTOA 4XPIA 5EUBA 2C9OA 4AZ0A 4OQQA 5DM1A 1G4UR 1HQKA 2BLLA 3OCXA 4PYRA 3IL2A 5FB3A 2F4NA 2L18A 2IZ7A 3JY6A 3QEBZ 3AX6A 1TQHA 1E5VA 1IWPB 3MM4A 1XCGB 1NVTA 3ZZTA 4MS4B 3H97A 3V4VB 3M34A 1MQAA 1KYQA 2DBYA 3U1TA 2XR1A 1NYRA 3JV7A 3VZSA 2WSLA 3KTFA 4MV5A 3AUUA 4G81A 5G1OA 5TEVA 1OGYA 1DC5A 1RKVA 2W71A 1NW7A 1DELA 4HLUA 1E7YA 1UPBA 3EIOA 4F7WA 2Q0QA 3TRDA 2YUIA 3IA7A 4YV7A 4ZEMA 1C3OB 1GADO 3R5TA 4DMRA 3EYAA 1V7QA 4MVJH 1DT3A 1P4AA 1JU4A 2Q45A 4KNYA 1KVRA 5ITVA 5FFFA 2GAAA 4JZKA 3RARA 3MN1A 5H0IA 4NHEA 4E31A 1ZN7A 3KEQA 4KO4S 5D3QA 1NT4A 4C6HA 2VQFB 1P3JA 5CDHA 2DCUA 2H18A 4JXJA 4X1IB 5GWXA 1ML3A 1ICIA 3H1PA 1V5WA 1XJWA 4LOHA 1JIKA 1POWA 3W1EA 4E7OA 3LKZA 1PEYA 2A84A 3K6SB 3NBMA 2BV3A 3KQKA 3IDSA 1RI3A 8LDHA 1DAOA 2H4YA 2HTFA 4KC0A 2X9LA 2YV2A 3EY9A 2ZK7A 3PPXA 1G5RA 1U2GA 3EG9A 3H4MA 1I4LD 4L5IA 5AJUA 1U98A 2C98A 2JH3A 3K92A 3ZHSA 1MGOA 3QJGA 1KZ1A 2YJ6A 4PLCA 2A9VA 3ZX4A 1UXGA 4TL6A 2YMQA 3MINA 3VRHA 1L6RA 1QRRA 2E9SA 3KD3A 2QXYA 3L0ZA 4ZCPA 3TH5A 3TKAA 3KEFA 5KQPA 4PQGA 4LIPD 1ZHFA 3ZZ1A 5C51B 3RT7A 5I6DA 1I13A 2JLUA 2IA5A 3HCRA 2NV0A 1Z6TA 3QA3E 4CL8A 3OZ7A 4WCFA 3U0VA 1UFKA 3HADA 4YUYA 4QGSA 3NR2A 1JG1A 2CY0A 3AWDA 5K3BA 4KQJA 2Y1OA 2WY2D 2PS1A 1UIMA 3JYOA 5B1SA 4KX3A 1SC9A 2F1OA 1SUAA 3AUAA 6CHYA 1BKSB 1I24A 1M1UA 3W5CA 2A59A 4M0EA 5EERA 2HM7A 3Q2KA 1PZGA 4EO7A 2PE5A 2ZROA 3N8KA 1D2AA 4QUDA 4MQBA 5CW2A 4YRDA 3A7EA 3SXUA 2AG1A 2IYLD 4K2AA 1YFZA 2AOVA 2PX2A 2OLKA 5E7MA 5BVGB 3F7MA 4XM0A 3DQZA 4IMPA 1E2IA 5F78A 1T1SA 4PO1A 3SKVA 1PBTA 4BO3A 2FPGB 2DF8A 1WJGA 2NU9A 2WHQA 5DX1A 5DYIA 4R0MA 2DPYA 5AQ1A 2PRZA 3UPUA 5ALNA 1J2EA 1JNYA 1N7IA 1YOBA 1I6WA 4PLFA 2DH6A 3CVOA 3AJ8A 3DOHA 4JQYA 4TM7A 1XQ9A 4NJEA 4XTRA 1Y4ZA 4G63A 1O95A 1Z5WA 4HB0A 4GMHA 2DQKA 3T0FA 1ETHA 2AG8A 1H3EA 3HUTA 3MTJA 5IT9A 2WF8A 3I6YA 4BC1A 4QXMA 5ALXA 1OFHA 1E2PA 1QYWA 5F2OA 2H07A 4IQGA 4EJ6A 5L3QA 2NPFA 2WQ7A 2PU5A 3QVUA 4OG2A 1TZMA 5ERXA 5ESDA 4BN5A 1UBRS 1CKEA 2BF7A 1N5LA 2C9CA 3I58A 1AURA 3PX2A 1T4MA 3AR7A 2QJTA 1N2HA 3D7MA 3JD2A 3N0RA 2N47A 3RG2A 4CMCA 5H81A 5A1JA 2EP5A 1BDIA 1VQ1A 1IK4A 3DV0A 4QXOA 1CUHA 4J1QA 4CG0A 1H2AS 2PLAA 4JLOA 4JEHA 4EMBA 5DTIA 3FCCA 1KERA 1N5DA 1T9ZA 1RTKA 2I3BA 1RRGA 1RC0A 3H75A 1DV2A 2W98A 4L28A 4C3OB 4EA7A 1QVZA 3I0NA 1XKXA 2H59A 4RELA 1V1MB 1KVUA 1Q2XA 4UOQA 3FX2A 4ZVNA 5LQKA 1V3VA 4G9EA 5LD2B 3W8NA 2UXBB 5AW0A 1K8QA 1W19A 4WADA 2WAAA 5J5VA 2EJBA 1EYZA 5K0ZA 1M5RA 3PT9A 4JL5A 1H9AA 1QX4A 1SBHA 1KH3A 2VDJA 2QR5A 3P2MA 2Q6KA 2JJ2A 1NSTA 2O1SA 2VUUA 3OEED 5JATA 4OQXA 2AG0A 3F5DA 4OXIA 3G3EA 1NWCA 3INNA 1WMFA 3SVZA 3HH8A 4G5SA 3SC3A 3NHAA 4ERNA 3GEEA 1SN7A 2EF1A 1DI0A 4ABTA 3CEPB 3JQ8A 2IHBA 4BPBA 4ZZ3A 2WAYA 1XU7A 3P26A 4NCXA 5EINA 2BSQA 1O87A 4BUJA 3MQ4A 2IS2A 3IUBA 3PXCX 2HLPA 1MEOA 3I9V1 4CM7A 2FP3A 1H3NA 1TXGA 1V7PC 1AOXA 2QQFA 2R6JA 4HUQA 4WA8A 4ZOLF 1E3SA 4ASUA 5AESA 4FDAA 1UT5A 2HRBA 1BCSA 1PHPA 2PMWB 2VYND 3FTNA 1KZ6A 2QG9A 3QSGA 1KQPA 1M2GA 2GDJA 5JRJA 4K1LA 3R8XA 2OT3B 2H4JA 1JQAA 4X1YB 4DCGA 4CDRA 1ZDMA 1M2NA 1NLFA 1SBCA 4I9UA 1Z73A 4MEJA 4C20A 5KHOC 3VA7A 1WWKA 2J5RA 4XIYA 3F6CA 3KOMA 1EUCA 4D1YA 4G36A 1IUKA 4BPRA 3HZOA 1I2BA 3N2KB 4IDPA 1XZPA 3OLXA 4POAA 2VNHA 4C0WA 1F20A 1QYCA 2IDMA 5EOVA 1XRLA 3TJMA 2WSIA 4M0FA 1OFUA 1SQ0A 3DL7A 4WY2A 4KXYA 1QZTA 3R9XA 3GP8A 4AZSA 1MBZA 2QD3A 1H4QA 2VJNA 4MW4A 5KYKA 4HH0A 5A4MS 3FWNA 3D9QX 3RS3A 3IEMA 1U80A 4Q05A 4E4RA 2OD7A 2Z2JA 4KV9A 2NSHA 2O9JA 3ER9A 3PC7A 2J41A 1I0IA 3CX7A 1FVOA 1P3Y1 2PFSA 3DPUA 3QVKA 2H0QA 3G9UA 4RJTA 3TAUA 3CZPA 3TGLA 3UMVA 4AZ3B 3CRNA 3RYIA 1G8AA 1YJ5A 2BI8A 2CVHA 4CKBB 5BRJA 1PN3A 2ZSBA 2M98A 3AUKA 1YK0A 3FAZA 2A9JA 2IYWA 2WLSA 5JSHA 4MI3A 3ZE6A 1U1GA 2FW8A 2WMYA 4ZALA 2IZ0A 1QHIA 1SHKA 5IXYA 1DO8A 3FY4A 4DLBA 4AN4A 3VDQA 1Z2OX 3TOSA 4BKUA 2VXOA 4EUFA 2X7JA 3JQBC 3DOIA 5G3ZA 4A82A 4CW7A 3HM9A 2BN4A 4H7FA 3B13B 4XM1A 3VKUA 3OF2A 2FG6C 3O8QA 1QJ4A 3WBKA 1W4RA 3L93A 3PWTA 4MXDA 1JSRA 3TO5A 3I9JA 2OG2A 2QTLA 3K8YA 4YRBA 1XLTA 4KREA 1B6SA 4H59A 3Q3CA 1OH5A 2CXXA 1FFHA 1Z7BA 4NYIR 5KNCD 1YQWA 3CG0A 3LVRE 2Y67A 3BCSA 5AO9A 2NTEA 3BILA 4XDYA 3HU5A 2Q62A 3H83A 4DNQA 2RI0A 1S0UA 1ISRA 1CUUA 1ZD2P 3ZQJA 3LY5A 2QRJA 2AOUB 1G4AE 2UVDA 3TR0A 2VDWB 2PTHA 3WZLA 2LWIA 1AGPA 2JG3A 4H0FA 4MB2A 4NU6A 1UIRA 4UEKA 1U8AA 4G1EB 4TWBA 4BMZA 2NXCA 1O94A 2V9CA 3WYNA 2QUKA 4EKNB 5EXTA 5BQPA 1LK0A 3FN4A 3KTDA 3Q3IA 1SVUA 2W22A 4F60A 3P9PA 3DDUA 4JR0A 2J3DA 1L7RA 1O03A 4LDZA 4N40A 4Y8VA 5FTKA 3DHWC 4BTLA 4Z0PA 1A2KC 3ZWNA 2AR0A 2XYVA 5AMXA 4MDEA 2NUPA 5CA0B 1QH0A 1GGFA 3ZLJA 1WS6A 1GU0A 4QNMA 2Z4RA 2IBSA 4IV8A 1UOQA 3DMPA 1HYGA 1ZUHA 4QAQA 1C1HA 1RNLA 4F2PA 2I65A 4IMJB 8ABPA 5CIYA 4QVIA 4W5NA 2NQ2C 4PTYA 3L7BA 5JAIA 2IC5A 1J8VA 1XZBA 1Y6JA 2WSYB 1YA8A 1DU4A 1PT7A 2VPIA 3DSRA 3Q7TA 4KW7A 3ZY6A 5I01A 4CEJB 1A50B 1BQEA 2ECKA 3DP7A 2G71A 1MW9X 1FSPA 2EKLA 4LKOA 1ZOPA 4IHJA 3LUBA 1CRQA 1E0KA 1EZ1A 1BHO1 2OD2A 3H9QA 3HSYA 4R8SA 3TAXA 1NW5A 5F1OA 1FFXA 3GROA 3EC2A 5FWDA 4D9KA 1JH8A 2HIGA 3A25A 3P9XA 4LZAA 5LLSA 4DNOA 2VL7A 2WSMA 1JKMA 2R25B 3T5TA 8GPBA 1KAMA 5H9VA 4DJFC 4NMLA 5HTKA 1XZAA 2BHNA 2GBPA 1ISMA 5L3VA 5ISMA 1GOTA 4JH0A 4A8PA 5CFLA 2YW2A 2IQIA 3UXMA 4DLLA 2AMVA 2XWQA 1DDGA 1Z5ZA 4HDNA 2D5LA 3M81A 3AY0A 2Q7OE 2G0AA 3D6TB 4O2AF 1FJHA 3RYFA 3UMGA 3T8YA 3DM9B 1YA4A 5GADl 4IVPA 4EPWA 1WB4A 1H9BA 1T9HA 2QL6A 3BHJA 1H6DA 3GLHA 3WV5A 3H3JA 3CN9A 1JLRA 2PJDA 5E1MA 1F8XA 2PJUA 3CEJA 3K05A 3VU8A 5KTMA 3U60B 3C45A 2XNJA 3B6MA 4HNRA 5F9MA 5JPIA 4AMGA 4QG3A 3HFGA 3PD0A 4W5HA 1EMDA 5IKEA 2C5SA 1EUZA 1P2SA 1MMFB 2ZDHA 2I6GA 3FAKA 3N2GB 4JP5A 5GGYA 2GEBA 3OECA 3TLJA 2WT8A 3HKDA 1KF0A 4X65B 5KNDD 2CDNA 2QLNA 3L8ZA 4RF2A 1J70A 1XLUA 2AI1A 2JIRA 3HA3A 4QL3A 3OHMA 1PVVA 4MWBA 5AT1A 1Y3CE 1E1DA 3WLNA 1F4PA 1JDZA 1LLFA 2WHEA 2ETVA 1A8UA 3M4XA 4UD6A 3T34A 4KKVA 3TPZA 2OV8A 221PA 3HV0A 1Z82A 3QLUA 1O54A 5LYJB 4YY3B 4GMXA 2ZJBA 2RHMA 3R0XA 3RBVA 5H82A 4KODA 1ICEA 3GGJA 2VDQB 3HJNA 4IFBA 4K1XA 4X3PA 5FLYA 5I45A 1SELA 2W4IA 2XE4A 2FP4B 3AI2A 3TLZA 3TN7A 4E0BA 4PN7A 3UW3A 1JDJA 3ELYA 2GHRA 3BTVA 2OP0A 2J09A 3B5JA 4YJHA 5BSKA 3TGWA 1FXSA 1VCMA 1WMSA 4ECAA 5AI4A 1N6OA 2ZVQX 2X6QA 3LU1A 3KKLA 1USKA 4HH4A 4LXGA 4ZQEA 1SAYA 5GV7A 2P3LA 4JLJA 3ORYA 4XUEA 3RVLA 1USIA 1KO7A 1GQSA 4FGJA 4H3SA 1D3AA 4FIZA 3T3DA 2VHZA 5HKLA 1O95D 4J76A 3MJTA 2BF4A 1XDZA 2N46A 3GU3A 3SYMA 5B2ZA 4B87A 3F71A 3PFNA 3CR8A 4A7PA 2EV9A 1SOAA 1XVLA 3I32A 4QOJA 4WOKA 3RRFA 4US1R 3SDSA 1A9OA 1IAQA 1U65A 3DO8A 3QWHA 1C7ZA 2PRYA 4O1IA 4ESVA 4LBWA 4RHEA 1G55A 2J8ZA 3NNNA 3R6DA 3DEJA 2A6PA 5DYNA 4PV7A 1MA3A 1QQ7A 1TYDE 2QNRA 3BK1A 3H2GA 1HKHA 2BP7B 3ABQB 3WLOA 1U1IA 2IU3A 3PTZA 3T7TA 4HAVA 4TLEA 2CE2X 3WMFA 1XXHA 2WTEA 1DOZA 3F4BA 4XYMA 5MF6A 3REQB 3QBEA 3CWZA 1TQ4A 4O4IB 1XZCA 3NGMA 2WKSA 1O97C 3PFHA 2E4XA 1Z0UA 3JASA 2JANA 2RAFA 3AH8A 1H0RA 4NXMB 5T3YA 1YUNA 2FMTA 2DTEA 3ICQB 3D2AA 3H6GA 1HTBA 1D7OA 2I6QA 2ZYGA 4Z3DA 1ZC3A 3PXXA 5FWXB 4RQBA 2JGAA 4HRYA 1YJXA 1YZNA 1TCUA 5DCWA 1TVMA 1AZWA 2IYRA 5TX7A 2QMQA 4ITUA 3Q3HA 2FSHA 4B83A 1RLOA 2G1PA 2J3MA 4AJEA 1Z6QA 3S1AB 2JJ2D 2RAPA 4AU1A 5CG2A 3KSRA 4W1SA 1BU5A 4WXEA 1ZCJA 1XSEA 1EFDN 2P78A 3IAXA 1HXHA 3KG2A 3NDJA 4O4JF 2GT1A 2ZP1A 4BNZA 3SHWA 4BYMA 1GKIA 3GJ8A 1OB5A 4WKNA 1MB0A 1R4ZA 4BU0A 5JT1A 1I9CA 3W3AH 1WUJS 1JALA 1FMJA 2QA5A 1NVBA 1C7IA 4GPIB 1D6SA 1OFVA 3L9WA 5CH8A 4B9EA 4ASUD 3Q8LA 1YMVA 4N4AA 5BYAA 1QYDA 4ILKA 1XNJA 1GZDA 1J2TA 3URMA 1R0SA 2IHJA 3PI7A 1JHYA 4B6OA 3EGCA 4G8CA 4IYJA 1VCNA 2QR3A 3PQ8A 4J07A 4LYJA 4MRMA 5AOVA 3W6PA 4Q37A 3UW1A 3SK0A 4DZZA 2RHHA 4IL5A 3FNEA 4N7JA 2Q6IA 3P9RA 3PR3A 1L7OA 5B3KA 3I4CA 4XIJA 4ND6A 3NASA 3OCJA 2OFOA 2B4QA 4BNMA 1W4ZA 2Z0MA 2PXXA 3BCHA 4IH9A 4KQMA 3AM1A 2VO1A 5KYWA 4OHPA 4E7PA 3S99A 1JIVA 2OCYC 3O8RA 1UK9A 3DXZA 4QRDA 4E2FA 4H6VA 4BP9A 3LCUA 4PSUA 3AERB 3BKWA 4DR6B 5CU7A 2LCIA 1MVNA 1Q0RA 3WL4A 4IX1A 3WSTA 2AFIB 1G3UA 2XZLA 1MG5A 2Q6LA 1QQ5A 3OZFA 1SKAA 3ILVA 4PF1A 2J67A 1L3CA 2AS0A 6ADHA 1CG6A 1OWPA 4BQNA 3OE1A 1DZIA 2W2KA 4FKZA 4NFYA 5KJEA 2IXEA 3WA6A 2JFZA 2OHGA 3QVXA 4IKPA 3ZGZA 1NX6A 2OUKA 3W9UA 3VZRA 4CODB 4XGIA 4EJFA 3IVXA 4Y2HA 3GGDA 4CXMA 1MT3A 4NCJA 1E1LA 1NJ6A 3L41A 4TMZA 5BYBA 4D6YA 1TT5A 3AUJB 4US2R 3GDWA 4RY2A 5K8JB 3T7DA 4MGYR 4PNPA 2BTOA 1V0JA 4Q4AA 5B37A 2DM6A 4P98A 2QRVB 5D01A 3VVCA 2VSFA 3IV7A 2QZZA 3TQOA 3QOXA 3NETA 5TGDA 5L95A 2BGMA 3A6PC 3HDTA 4DUGA 4YRQA 3CBQA 3NWEA 4UAVA 2R7NA 3CCCA 3JQPA 5JQGB 2R11A 4JIGA 3KHUA 5A4JA 4G5HA 1TFRA 2NQTA 3QVVA 3K72B 4Q39A 1T13A 4YI3A 1Q1AA 1JSLA 1SXGA 3KDSE 3TLBA 5FO0A 2CLDX 1AO3A 3TSAA 3E9MA 3GZNB 1AVTA 1A9XB 4OIFA 1NQ5A 2M1XA 3K4HA 4GSYA 4LZNA 2WILA 4GLLA 2XDYA 4HD8A 3NHKA 3VPSA 3RQSA 2G63A 4Z7OB 1AQUA 3H0KA 1KMCA 3MBKA 3WLIA 4EEKA 3ZGXA 4UUOA 3K9NA 1B8UA 3VKFA 3EZXA 1ZGHA 3CUYA 2AXEA 2I4OA 1PDWA 1YB2A 1HO3A 3ZWBA 4EEZA 3VKWA 1XJCA 3BB1A 3NATA 5K4GA 1IJEA 1CDOA 1QU2A 5JSZB 3ILSA 1WBBA 4UXIA 3AXTA 3FW1A 3N53A 1NUAA 3PNPA 4KN5A 3IBFA 3BMOA 1ZVQA 1O94D 1H1TA 3THXA 2YNMD 3BIOA 4KBYA 5AW4A 5LXTA 3OIVA 5KHLB 1PFQA 1YBHA 4R9NA 3H5LA 2F3UA 1ARZA 2O2DA 4RJKA 5EKTA 3CVWA 4LVCA 5FBWB 1XTSA 2AR7A 3FNGA 4JLKA 2OXIA 4D4KA 4UDXX 2HR1A 1YQTA 1BYIA 1W8DA 2MYNA 1C3JA 1XRPA 5DF1A 3BD8A 1O7JA 1KDVA 3ZE9A 2PS0A 4XLLA 3WQSB 2GD1O 3UHAA 3VISA 4ZQHA 2Y3IA 1JDVA 2QMUA 4B09A 1V3QE 1NJ2A 1R6UA 1ZXBA 3GLSA 5E7JA 1N1GA 1TA9A 1PGJA 2CYAA 4RTNA 8ADHA 5SZHB 3PC2A 1PS8A 5CXUA 5JTTA 3KUCA 2ZIWB 4PFKA 5BSRA 1EVKA 4HPWA 4OHRA 5I5EA 1XQYA 3FETA 4NQRA 4BNFA 1G5PA 2Q3CA 2ZI3A 1TQ2A 4Q21A 1JEOA 5EHNA 5H70A 1DC3A 4JHXA 4KDCA 4QICA 1N5KA 3OFJA 4B4KA 1Q95A 2JAQA 1PAUA 1FSZA 3KLOA 2F8MA 5FUVA 5I48A 1V4BA 2X1LA 5C2JB 4DHWA 3I9OA 1E9CA 3FPGA 2RBGA 3GJ7A 1T0UA 5EFOA 1NR5A 2CK3A 4DIUA 3RC3A 2MYUA 3HP1A 5AHRA 2YVLA 4H2DA 5TLSA 1LJUA 4QPCA 3CVXA 3L5OA 2VYFA 2X13A 3ORFA 4YCNA 2JFFA 1N6RA 4CEHA 3CXUA 4ISCA 1DEAA 1P6QA 3GWGA 3PPWA 1ZZGA 4QTXA 3ANYB 5ALGA 5JWOA 1SZDA 4YQZA 4QOSA 5ILOA 3LT5A 4L5YA 4L8VA 3LDFA 4M60A 2WM2A 4YQEA 4B32A 2VHVA 4GR5A 1MOZA 2RIRA 1GQYA 1U2DC 1WCIB 3EAQA 2V54A 4R01A 2IU4A 5CB8A 3EXHB 5HGJA 4C3VA 1P8AA 2LXNA 3K4QA 4N5NA 5FADA 1R15A 3OQOA 1R4NA 4IZIA 3AQ4A 5JZOA 4KUHA 1V41E 2LNDA 2QTHA 5A9RA 3WO1A 4ZDWA 1L3BA 2DMRA 2VJCA 3CPSA 3NKFA 1NPTO 3ZWCA 2BRUC 5KDDA 1N2GA 1ND5A 2H8KA 2M1ZA 1XD2B 2PCJA 4EI8A 3E15A 4KWEA 1S89A 4M3NA 4RZXA 4B71A 5DNUA 1AF7A 3GRYA 1EFTA 1BE1A 1E9DA 1ZNZA 4Q1CA 2ZITA 3IT3A 3PNLA 1NL3A 2XOXA 3H1FA 4WVLA 1AK1A 1M34E 3PUVA 1FQWA 4YQFA 5TQVA 2ZJZA 1KAQA 1Z8FA 3IB3A 3N0XA 4J0EA 4RZ3A 5A6SB 2DEUA 3IQDB 5FI5A 4KE7A 1VL1A 3D0RA 3LT2A 4BJ6A 1BVHA 4C7OA 2VT3A 1AV7A 2OHHA 2E6KA 3KKEA 5A03A 3AEUB 3O8OB 4U2BA 2N1MA 5LYYA 2OSBA 5TVGA 1NXQA 1ZL0A 5L4NA 1N6IA 2X58A 2OCGA 3WGMA 4OB8A 2DOKA 2DRIA 1ZK0A 4WBNF 1C81A 4QPNA 1P8JA 5JD4A 3ZE0B 4S2UA 2PR7A 1NUTA 2V6MA 3EVDA 1NM5A 4HSEA 2XB4A 1WDLA 4R6XA 5DK6A 3NVKI 2X1HA 3L7JA 1AXEA 4RC9A 1UJ4A 2BGIA 2CLOB 2V5VA 3TR6A 4ZJYA 1E8NA 4HDMA 4L4SA 1W4CA 1CV2A 3LPNA 4Z8YA 1XE3A 2CJYA 5KYUB 4JSYA 3W06A 1Z0DA 4KIGA 4TMYA 1BS1A 3BC1A 3D59A 1MJGA 3FA2A 4LHVA 2PUBA 1EUDA 1WMDA 1P4JA 1MV5A 1EH5A 1FC0A 2GRUA 2FWBA 4LNUA 3DLPX 2VH2A 2IDJA 2CW5A 4Y0NA 2CL5A 1SC6A 3FCXA 4QDXA 1NJFA 2HWKA 4LFCB 2Q29A 4PG5A 3GDGA 3QFCA 2I03A 4LJKA 4C5BA 4M89A 2WTUA 2A4MA 3HFRA 5DCLA 2CFRA 4ME6A 1OI7A 5IP5A 5F5NA 3JYPA 4YRTA 3HZHA 3GFPA 1W6RA 4M8NE 4MUKA 5TMEA 4ECEA 3H8VA 1QPZA 4W9NC 2Y1DA 1ESEA 1LDBA 2AFRA 4CVNA 4IVNA 3GFBA 3NEAA