5H9VA

Crystal structure of regnase pin domain, form i
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
161
structure length
161
Chain Sequence
DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAFESDGVVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the regulation of enzymatic activity of Regnase-1 by domain-domain interactions
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Ribonuclease ZC3H12A
total genus 47
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h9vA00
5FT9A 3V34A 4G24A 5H9VA 4G26A 3V33A 4G23A 5H9WA 4G25A 3V32A 5DIZA
chains in the Genus database with same CATH superfamily
5CLQA 3A4IA 5EHGA 3CVJA 3Q10A 1NLZA 4BCCA 4HN4B 4DNXA 3AVTA 1T34A 3HBNA 1GZ4A 2PUBA 3PYMA 3KR0A 4YMSA 2QU8A 4E15A 4OHVA 2GJKA 3CF0A 4DUPA 3TQOA 4DC1A 1C3VA 4YIKA 1J21A 3V1LA 5HKBA 5JE8A 3IAUA 1TYAE 2IHUA 4B0OA 5TT1A 4LKRA 2O1WA 1DQSA 3F47A 3OPYA 2H9YA 1IBKB 3L0BA 3N0XA 2FPSA 4IZIA 1MP0A 1ONNA 2BN4A 2ZDHA 3H42B 4NYIR 1OBOA 3A2LA 1LW6E 2JH9A 3PWZA 2DJ5A 4TRJA 3RH0A 3EUAA 3IUEA 3BB3A 3VC3A 3GEEA 1WHSB 3K9QO 1JG4A 1QKKA 1YCGA 5EQJB 3UWOA 1K9VF 1RXUA 2FSPA 3N7UA 4HRYA 5KJFA 1QM5A 1WHTA 3QSGA 2K4MA 4UARA 3RAGA 4P83A 1JFVA 2QQGA 3WYCA 5J4KA 3T1OA 1M76A 1GZ7A 3WWPA 2L18A 5C5DA 2ZR0A 3KE9A 1NTRA 1FF9A 4MWDA 3HCFA 2QD1A 4TYPA 1SO8A 2ATIA 1MO6A 1VE7A 1W9HA 4O08A 2JF0A 3MQFA 3QBDA 4PSKA 1SQSA 3HU5A 4GOJA 3BN3A 4GD3Q 3QQ5A 1CZNA 3H84A 2I6TA 2LNDA 4Z3DA 3TE6A 1GITA 2NU6B 3K6SB 1F2DA 1E7MA 4RPLA 5BT8A 3TFOA 1YFLA 3AL3A 3NI2A 4MVJA 2REQB 4WZZA 3RS4A 1Z8DA 3X2SA 2GM5A 1FSSA 2YBDA 4UM8B 3U81A 4C89A 5SV2A 2AMLA 3LVFO 3C8DA 3ECAA 5F3WB 4JOCA 5JSFA 4ESVA 4K9MA 4N5DA 4NDNE 2Z57A 1Y9EA 3DBOB 4QLOA 4CCAA 4AKGA 4HTFA 5H9VA 1WUTA 4ZJUA 2H6EA 3HU3A 4Y2UA 1LW7A 1P1JA 2BHLA 2ORYA 3RNOA 3W8FA 4R6XA 4JVLA 4WKNA 3SFZA 2GSDA 4RLFA 1XRNA 3WICA 4G5HA 3LNCA 1VPTA 5AW1A 1B23P 1Z0AA 1RYNA 2HKIA 4JLOA 3MB8A 4MWEA 2R6GA 4HCJA 3Q8MA 5FWYB 1UZMA 1NQTA 2R66A 4PX5A 1SU6A 5IDQA 1I36A 1U5BB 5HHTA 1ZO8A 2WPDD 1QAOA 1NLFA 3B12A 2AYYA 4XDGA 4QBTA 5TC4A 4AKTA 1YOVB 1NWCA 5F23A 1FRVA 1M2KA 2DJIA 2PNFA 1OAOC 1P2GA 2AJDA 4B3TB 3WAKA 5HKLA 1ZUNA 3SR4A 4B46A 1T2VA 4BLSA 3HJCA 3NVKI 3O1LA 1AKQA 1V11A 2OECA 4MKIA 1J7JA 3W7BA 4UXJA 2QAIA 4V0KA 1QIGA 4BJHB 3Q8KA 5AM5A 1ZOLA 2R8YA 2Y9MB 2VDWB 1ZJ4A 1DADA 2EARA 2XNHA 5IBPA 3OLQA 3KL2A 2GM4A 1MUUA 3GXBA 2JZCA 4N9WA 4YYEA 2ALJA 3OE7A 2PMBA 4Y2XA 3CSUA 4G0WA 4CMIB 3W5UA 5DNYB 1BHJA 4AJPA 2PJUA 2OCIA 4I3FA 1JWBB 2H4HA 3B8EA 1Y1KE 3IR5A 3OU6A 2ONKA 2ZU0C 2XUDA 1GUYA 2DQKA 2XX3A 3ZWYA 5EJEA 1N9GA 2NUTB 4MS3A 1U8EA 2W42A 3ER6A 2R44A 1HE2A 3LX6A 2FOXA 2HYIC 3RSCA 5P21A 1DRUA 4Y2GA 3UT5A 5AW7A 3NMUF 1RSZA 4IHAA 3KV1A 4XIIA 4ZZ1A 3U60B 2JBWA 2LKDA 2NU7B 2V59A 3LC1O 3M3HA 3NTOA 4JUCA 4LF5B 3FUXA 2W43A 3RS7A 4KYUA 2P8SA 4O1MA 3U17A 3C7DB 3CBGA 4JI7B 1Z16A 2Y1GA 3JZMA 2WB4A 3O2JA 4E1BA 1FTYA 2GWHA 4YCDA 1S2LA 2PS3A 3MOIA 1FVOA 2X6RA 5JSQA 2X2EA 4FS8A 5CDTA 1RWMA 2HMSA 1JV2B 5JI2E 4H27A 2Q2VA 1MAWA 3GFTA 2X86A 4UCWA 1UPTA 3MGKA 4JX8A 7ADHA 2XE8A 3ZY2A 2J6CA 2KLBA 2X5XA 1A82A 2FPWA 5LP6C 2GTHA 1BDMA 3CZAA 2VDMB 1II8B 3GYBA 3ND5A 5KQSA 2C2HA 5EOVA 1NIJA 3Q7RA 3AVOA 1KRXA 3MGAA 1AY0A 3WXMA 4FW8A 1C4KA 3CE6A 2DR3A 3PRKE 1CCWA 3ODPA 2WT9A 3AR4A 1ZD9A 1UBJS 1J5PA 3ABQB 4CMEC 1KAHA 2NM0A 3ROTA 5DXFA 2PBLA 1RLJA 4XB1A 3OCXA 1NG9A 4O5AA 4LTMA 4ANFA 1C9YA 1W49A 5LBIA 1E3SA 4B17A 3LUJA 1KZHA 5B12A 1Z6QA 5IF9A 3Q9LA 1KSGA 2B0CA 2HXSA 1J42A 2OTCA 1AQ6A 2W2XA 3GPIA 4ZOCA 4EEXA 5JATA 5KSOA 4DNQA 3HZZA 1FDUA 4TV9B 2GUWA 1A04A 4GPIB 2ZRAA 3VJMA 3JWHA 1CBUA 4H3SA 3O93A 4RYDA 4WXEA 4XX0A 2C9CA 3KU4A 4GMFA 3RVJA 3KKPA 2CHVA 3OFKA 4QJ4A 4U5XA 3PEFA 1KYZA 4U00A 2OUIA 2JIPA 1AHIA 4D8UA 5HW0A 5HUQA 2K7FA 2I7TA 4RMIA 1E5TA 1VL2A 3QIAA 3RKSA 1GCGA 4JYPA 1Y8QA 1WXHA 1Z5VA 3LCUA 4W5WA 2PS1A 3D8HA 4Q9IA 2WZDA 1CY7A 5DXJA 3L2OB 4JUFA 1TJYA 2JI8A 3HP7A 3TI9A 2XWJI 1PEDA 3LY7A 1Z26A 1L5FA 3MSCA 4X90A 3LIPA 1K7EB 4J0DA 3W7VA 1H2WA 3IVAA 5A7FA 3G88A 4B79A 5IH7A 2I8AA 2XF2A 4O2BB 1PGOA 3OLXA 4K6FA 3VPAA 3QP9A 4BN5A 3W5AA 1TYEB 2CDRA 5EWJB 2XE6A 4PYIA 1XRQA 3LY8A 5G0SA 3SXJA 2JPDA 1YFZA 1TUGA 4NCNA 1OWOA 3KAJA 3UMSA 1JMVA 3UC5A 4DY4A 2HDWA 3ZU6A 4WOJA 2CXPA 4H16A 4WD3A 1YQQA 5D85A 3SNHA 1U6KA 3AR6A 2HSDA 5AT1A 1TEZA 1DRKA 3HA7A 3KJGA 1UKAA 3U4AA 2Q1XA 2Q4BA 3M6FA 5M7EA 1Q3TA 4HDMA 4UE2A 1JJBA 1CJUC 2HRBA 2IPNA 4IQFA 4KXYA 3FPKA 4RVDA 3HYSA 1NATA 4MTCA 5FYDA 3RRNA 4ETMA 1JU3A 1S5PA 1C2YA 3GCWA 3KFLA 3K5PA 4R1LA 3U31A 4G5FA 2DYKA 3RF7A 1B16A 1ULUA 5F2OA 1PFYA 3X43A 4B3RB 1ZU5A 3NJ4A 3QYPA 2QGNA 3DO6A 1L5RA 3ZUGA 1E94E 3ETJA 3Q85A 4MW4A 5B4TA 1DTWA 3EXIB 2XMRA 4MVWA 1H4QA 1Z0ZA 5IVPA 4IFTA 3R0IA 2OILA 1GGKA 3KHKA 3WP0A 3ROZA 1M74A 1WY7A 2FNAA 2O2DA 3EZLA 3STHA 4EW6A 3D0QA 5E4JA 1RIIA 4IP0A 5KKAA 4EFDA 1LEHA 2O8EA 4LIPD 1FMFA 3ZPXA 3JQQA 3OQMA 2XXAA 4K9LA 4Q37A 3LZ6A 3UJAA 3E9RA 3RRYA 2RBGA 3UYLA 2P3SA 5TMBA 1JEQB 2VRCD 1C81A 2QRZA 2V6JA 3FMGA 4J7AA 3P2YA 4DLNA 4YAKA 3ICCA 4DM7A 3IMFA 5CA0F 3IMKA 1O4VA 1OX6A 4OHXA 4O4IF 5BV1A 5FWNA 3VR5A 3KQWA 3NDJA 1CQJB 3C5CA 3AI7A 4C4AA 2UZ1B 4NBUA 1I4OA 1VTKA 1CT9A 2YXBA 3K7EA 5L45A 5K8UA 4N3NA 2VA9A 2FPXA 2JFNA 2XUKA 1DJLA 2PBZA 4PLCA 4Y6SA 1PJBA 1UP4A 1IVSA 1JEYA 3AGPA 4PS1A 4OLAA 4DRZA 1PJAA 2W4IA 3IRUA 2GBGA 4EUEA 3C7KA 2XVYA 5IH3A 2RH4A 1I6KA 1VHWA 2D0OB 4OQ4A 4DMUB 3I2YX 1X38A 2KX7A 4DIMA 3UXEA 3PPWA 1Y4SA 4X9XA 2R96A 4B3IA 1V4VA 2QZ4A 1FX0B 4ENTA 4DAOA 1KVRA 2FN9A 3VR5H 2YMMA 2XMBA 3TLZA 3SP1A 2YZNA 2AW3A 5LB4A 3H13A 1MA0A 3NW9A 1IY2A 3CGGA 3UPUA 1W73A 5AK6A 5H3CA 3RWMB 4HBZA 3FRIA 4ZPJA 2RC5A 1T4MA 1AKVA 2Z83A 3NKLA 3OI7A 2P3QA 4U2FA 2I22A 4BS9A 2XUHA 1NW9B 3AI1A 1KP9A 2BHRA 4HMPA 4MXDA 4HRXA 3EZNA 4V2IA 3WJ7A 4B73A 2GX6A 3CPSA 4KUHA 3UNXA 4QGHA 2Z4RA 5ENZA 4AY2A 1H05A 2FN3A 3KS9A 3U44A 1P0CA 1H2HA 4ZI7B 4QM7A 4JQCA 1U2GC 4BWFB 4JUAA 1J6UA 3W34A 4MGKR 3W0LB 3JR3A 5EE5B 4X7RA 3L7NA 2MSNA 1M10A 4Q15A 1XCLA 2FZLA 2CXHA 1GN9A 5FUYA 1M1NA 1UFOA 3L8MA 4U2CA 3JVDA 2H85A 1N4DA 2LBPA 1G4UR 3MJTA 2NU8B 3UN1A 2NOAA 4EIWA 4L2IA 4YH1A 2EKDA 1VGVA 3ECSA 1Y5MA 2O7VA 4UHFA 2DSTA 2YNMD 3M70A 5B57C 2AC2A 3DPUA 2I5PO 3KAQA 4MUXA 5DBIA 4P3PA 1OGJA 2ZE8A 2FPLA 2GCOA 4PPQA 3OIYA 3OD1A 1J2TA 1LVUA 1SD2A 3OZUA 1W4BA 2MTBA 5IEBA 4LRTB 3F9IA 4PYJA 3L1IA 1OV4A 2O0MA 2VP5A 5AXAA 4YROA 4QBGB 2X8BA 1JHOA 2ECQA 2IDMA 4LHXA 4LVCA 2BGTA 1IU9A 2P35A 1T2AA 1B6GA 1KDPA 1V11B 2AZMA 2B3DA 2IODA 2XOKA 3GLHB 4MUMA 2WWFA 1PWYE 1SVKA 2I99A 4JYBA 5FTMA 3UK7A 2NZUG 3M4JA 5FCDA 1TMGE 3ZIUA 3AY6A 1SZDA 1BXRB 2WAXA 2VPXA 4HAUA 3WHPA 4E5KA 1XEXB 4FWIB 4GC9A 4RCYA 2B5WA 1G0NA 3NIFB 4FB5A 2QTRA 4MQ4A 2HADA 1JKJA 1SQ5A 1NJ8A 2PKXA 4FDVA 2AXQA 3CS3A 1MTOA 4M54A 4KLAA 4N8SA 3SJZA 4QOEA 1JJAA 3L8ZA 3DEIA 5H59A 1U2GA 3TMAA 3WQBA 3ZEAA 4EGCB 5JFGA 3EXG1 1COZA 3LC0A 1KARA 5ELLA 3TIIA 1BOOA 1Z6AA 1NRXA 5CB6A 1ZHOA 4FZ3A 3GA7A 5BPHA 4F92B 4Z9YA 4I3GA 4R1SA 2KYRA 1EE2A 4GX1A 1TCCA 4LC9A 4PAOA 4WJZA 4JGIA 4XGRA 4Q9JA 3ZE9A 4LDZA 3DM5A 4G8CA 5HJEA 4O02B 4TL6A 1SJ9A 2A78A 1H2YA 3DPSA 3V80A 3IHKA 3H2IA 3E15A 1LSSA 1IZZA 1S02A 4X8HA 2ECOA 4HXGA 3KB2A 4XYLA 3U3MA 3O8CA 2UZ4A 4HAVA 1UK9A 5EUBA 2WEKA 1NW6A 1YNSA 2G25A 4JJKA 2DBYA 3RC9A 3KT6A 3UKJA 3ZV6A 1KP3A 1E9RA 3RYFB 3ZGYA 1T8SA 4HI0E 3I39X 2Z9DA 1F2UA 3FFAA 4E5UA 4DUYB 3PWSA 5JO9A 4FW9A 3ZVKA 4EY3A 4ER0A 3RWBA 1FXWF 5B2FA 4GX0A 2YN2A 3M4ZA 4Q12A 3RS2A 5EKUA 4BP8A 5EXXA 4TTRA 4HDMB 3PL5A 5J4VA 3R3SA 4B6SA 1QVAA 3CVVA 4FR0A 3U9TA 1JIQA 1ZH6A 2JNWA 1YQWA 2OO3A 2ZVPX 4O8ZA 5E8JA 5A3QA 1DAHA 3A14A 3QRWA 4QTYA 1VSUA 3PRYA 1WAMA 4QYTA 5KVSA 1OA1A 2CZQA 2WAAA 5EJFA 2YS7A 4UBJA 5K0EA 4EG1A 1QQAA 1XMSA 1JDTA 2O05A 3T4UA 4ARIA 1JQKA 4M1ZA 3TXAA 3KQLA 4RULA 1M34E 2EKLA 1K97A 1N2SA 1TB4A 3C3JA 4FEYA 1AH2A 8GPBA 2CSUA 2AJTA 2OV8A 4G0NA 1E89A 3RUHA 4DM3A 4DOMA 1U1FA 5ALLA 4RO0A 3ZE6A 4KQ1A 2E4XA 3R2JA 1KIAA 2XHZA 3UZUA 4MRNA 4ABTA 2XCTB 2NP6A 1YQEA 1F14A 1RQPA 2CF5A 2CYAA 3Q5GA 3A05A 5CX1B 4M87A 4ZQIA 1IUPA 3GR6A 3HO1A 1PYDA 5EZQA 4UHKA 4O63O 2Y2UA 2PR7A 4KX3A 4CLOA 3EQ7A 2A86A 3G9ZA 1ZESA 3MJRA 2FPGB 1ODJA 3E2MA 4GMHA 4X00A 1F38A 3WMRA 5HZHA 1DZ3A 5JWRA 1THTA 1W35A 2Q9UA 3NBQA 3WLNA 4O5OA 2VBCA 1CUYA 2XT0A 1YZTA 2GYYA 3OCCA 4YBRA 1WKBA 4KQKA 5KS2A 1FJ2A 4C7OB 3L0DA 1WSWA 1DWOA 3N05A 4FCVA 4D46A 3H2HA 1NLYA 3U3OA 2B78A 4B33A 4R16A 3OZBA 4ZDIA 4QATA 2QJWA 3G8AA 4JBWA 4N7RA 3S8YA 3TF5A 1AN9A 2BFCB 4QDTA 3SC3A 3WSTA 4EF4A 2PUAA 4I0WB 4GICA 2LCFA 2ZRIA 4I46A 1QYIA 3FPFA 2ES4A 4NCHA 4DWJA 4NJMB 1UMDA 2UUOA 5DSXA 2B83A 2VZ0A 2PVPA 4RKWA 4LISA 1DUIA 1ICIA 2G40A 2I54A 3PJDA 4LWPA 2O2IA 1AA6A 1PTKA 4BRUA 1EG2A 3D6NB 5KOIA 3UGQA 3U16A 3QY9A 2QTFA 4AQ7A 2YWGA 3GCXA 3MS2A 1K7CA 1SN7A 4K86A 4MV7A 4BRZA 3JARB 2NSJA 3SHFA 3HJGA 3OM0A 3O1IC 1R0WA 2WY2D 4BTVA 4EHBA 5B3KA 5M3BA 1MRZA 5ICCA 3VM6A 3GAAA 2PCJA 3TZHA 4TMXA 3I9MA 4DDVA 4OXYA 3GVCA 4AP6A 4Y7CA 1USGA 1CHDA 4ZQGA 3HB1A 1DAOA 3I1FA 2V3VA 2CLIB 2EP7A 2EZ9A 3TSWA 1APBA 1ZC4A 4FI3F 3WB1A 3FAKA 5ES4B 2RG1A 2ZUEA 3AJAA 4LTNA 5BVHB 2FWNA 1Q20A 4QZVA 1YZLA 2AOUA 2C61A 3R3ZA 3CX4A 4C1BA 1UQTA 1LLCA 4OP1A 2WA2A 5TXGA 4I50F 1RJ9A 2GKSA 4BLVA 2L17A 4HDNB 3TUZC 4CQMD 3C1TA 4RIIA 3M5PA 4WBNF 3WGTA 5I9SA 3HZRA 5EQFA 2WHQA 3K31A 3MBKA 4YRJA 1ZIPA 5G3ZA 1Z6TA 1ODKA 3PPYA 4BO4A 5HGXA 4H2DA 4LJ5A 2E89A 4IUDS 4AS2A 2OGWA 3GJXC 2A4KA 3P26A 3HKEA 1E2NA 1WSAA 3DBLB 2GHIA 5IUJC 3OTGA 1CF9A 2PGAA 1B76A 3P9CA 4BUZA 4GW3A 2W83A 2AUTA 3KLNA 3H5OA 4IDFA 4XLZA 3DH0A 2IS1A 3HUUA 3WKBA 4PHHA 3LYHA 4OAQA 1YKFA 3C3MA 3W05A 4ZO9A 3DW3X 5AI9A 2EXXA 1NVXQ 4BB6A 1X1CA 1DRWA 1VMAA 1UKBA 2O4UX 3GH3A 3WLHA 4CHGA 1GRRA 1XFDA 3KJNA 5EL0A 5J23A 4NABA 1R3DA 1MPTA 2ZYGA 1Z73A 1XXHA 4OM8A 1JE0A 1Y9DA 2I76A 1UWLA 1RRVA 3A2NA 3NT5A 5EE3A 1NVMB 5BSTA 3BHJA 2ZUTA 3SZRA 3MT0A 3VTKA 4B48A 1OZHA 1NI5A 2K6GA 1JR2A 3R44A 4E11A 3KHUA 4B4DA 3M6LA 2HWWA 2O3RA 3I2HA 2WNHA 2Q5LA 2GXUA 5DLDA 1KBZA 1R8QA 1Q6ZA 1U1DA 4M60A 1OH7A 3D4LA 1V3TA 3GJ5A 1PLKA 2PRKA 1W5EA 1NV8A 2YH2A 2Z9BA 4XRRA 3TLYA 3ER8A 1J99A 3Q4GA 4HNGA 3JRXA 4WCVA 2V7VA 4I50A 3RRMA 4FBMA 3T1TA 1R2QA 2RE8A 4JFAA 1K2VN 1PN3A 2HIAA 3F67A 3HEBA 1Z7GA 3NH6A 4Q48A 2D5LA 1KO7A 5LMZA 2ZGVA 2R7KA 2O0HA 3NWJA 5L53A 2R86A 1FVFA 3CRNA 5FL3A 3WSWA 2AJCA 1PR5A 1GPWB 3SFVA 1J8MF 1Z3CA 1BJKA 3EMBA 4IR7A 3EZ2A 3HZHA 4B3MB 4F71A 3SN6A 4AECA 4I2NA 3C8HA 5F98A 1K5DA 1E0JA 3EDOA 3UAXA 3RSGA 2GEDA 4RZXA 4R5HA 5C2JB 4HWGA 4E21A 3RG2A 3MFYA 3QVMA 4CF5A 2NTEA 3CX6A 3NOVA 4REOA 2JVJA 2XUIA 3OPNA 2VT6A 1E5LA 1XTKA 4TM7A 2W2KB 4DBLC 3V7FA 5EUMA 3CLSD 2P5SA 1NW4A 3GGSA 2WI8A 5DBGA 4KQXA 1T3ZA 2PL3A 3FHLA 4Y0VA 1XHEA 2QI9F 3H5IA 5J2UF 2H52A 2ZAIA 2DPYA 3FGOA 4MDYA 3KKZA 4AUMA 1YDFA 1BE1A 4GOKA 2V6MA 4I1OA 4NZMA 1JHPA 4OHRA 2QJRA 4XIYA 3U7FB 1BCSA 5JAQA 1J70A 3CRW1 2HHJA 1RBYA 5LXTB 4ZWNA 5BUCA 4JYAB 4S1VA 4NV1A 3SX0A 3X2FA 5AOBA 3NH9A 3GFVA 3H11B 1OIWA 2FZ5A 2VK4A 1C9DB 1I9CA 2P2YA 3ETGA 3QZUA 4JDPA 2P9QA 4AJKA 4BIIA 2P2DA 1G38A 2QK4A 5FLEX 5C1DA 3HKBB 1SCUB 2F7SA 2GSWA 3KZ1E 3WLIA 3G7SA 3ILVA 4MGZR 2QBYA 2HPHA 4WBNB 5A4MS 3GPDG 1XEFA 4J6EA 2WWVD 2XOKD 5EMKA 3L6BA 5HFAA 1VA4A 5J3JA 2C4KA 3B8HA 3O4FA 4DTCA 3PQ2A 2PWAA 1KKMA 1PVDA 2POCA 4BLWA 4BO8A 1Y7IA 1ZICA 2NTYC 3LBHA 2VTBB 2OCDA 2COKA 3EUWA 5DI3B 2I67A 1TKCA 3AR3A 3KLBA 3U4DA 2OV1A 1DG3A 4GI3A 1HT3A 4MR9B 3A3KA 5A04A 5TPZA 5L6MB 1N5OX 4JXZA 4LDPA 3QE0A 1FTGA 1MC4A 3L7BA 2D5CA 1GLVA 4YCLA 5HSGA 3I52A 3RJMA 1LDBA 1NJFA 4BQRA 5L3SB 4KR3A 2H2AA 3PL1A 5DHUA 1A4IA 3LY5A 3EPJA 1IM2A 4D1YA 4OJQA 3GJ7A 2QTWB 4HFNA 5CK5A 3MWJA 1ISSA 1Z06A 2DXIA 3PEWA 2WVHA 2W9XA 4PX2A 3O84A 2II6A 4KQ2A 4WI1A 1MZPA 3OLVA 3E5NA 5GV7A 1MFZA 4AZWA 3ZHBA 2HDOA 3L79A 1A8HA 1B00A 3BH0A 3PGKA 4WDRA 4PXAA 4RXTA 2CBGA 2N42A 4NFYA 4Q3AA 3T3IA 4BFYA 1JH8A 2LD4A 2A9JA 2BE9A 1HEUA 4JYCA 1F2UB 4KWEA 5H3LA 4KDRA 3KT3A 3SC4A 3D4NA 1U7ZA 4AXXA 5JH7B 1AMNA 5HIMA 3K6JA 1MJGM 5DCWA 4CV2A 1PQYA 1H2RS 5U4XA 3GELA 3KZKA 3UUWA 1EXWA 2ZJ2A 1OXBB 1W96A 1XF1A 3FPLA 3N39C 3PDCA 4MV6A 3QEJA 3VNSA 1N1DA 4XQCA 4RQUA 3AQ4A 3OOJA 2WJAA 4YRLA 5GWXA 3QY0A 1HRDA 2DHCA 3NLLA 3H0KA 1IN5A 2QTNA 2WHRA 3BD9A 1KFKB 5BYJA 4G5QA 5CU7A 1WDLA 5LA6F 4UNNA 1QO7A 2CMGA 2F43A 2O23A 3NTLA 2CZCA 3NTQA 2W2QA 1ETHA 1C9NA 3C70A 3FGZA 4XVHA 2XNCA 2ZBVA 4NG4A 4JVMA 4D9IA 1Y9AA 3TLGA 4ECEA 5KJEA 3OTOB 1VRCA 1NTOA 3VC7A 2I3BA 3EBLA 2ECPA 3UJCA 2YX1A 5KX5F 2ERCA 1L3IA 3BRWA 4JQZA 3ROGA 3OZRA 3JALA 1VI2A 1BMTA 4L02A 5TPZD 4DM4A 5IUNC 5CA1B 3SHOA 5EYPB 3W9UA 3UB4A 1UWVA 3ZDXB 1XTBA 2CKMA 5CFRA 5AI4A 2BUAA 1E3EA 1R6AA 3P0EA 2B6HA 2NV0A 2LV8A 2QKYA 4UAUA 2AEEA 4PAMA 4QNNA 3IP8A 4FEGA 3EGXA 4JX9A 4U7GA 1I4LD 5F1YA 5C3UA 4PAGA 1JTEA 3U37A 1PL0A 4C06A 1LXCA 4DJJA 4LYYA 4IDDA 5FPTA 4AW9A 1HURA 4EHFA 1T2FA 4N5NA 5EINA 4EG7A 4YDRA 2CHUA 4K5QA 4BZZA 2QROA 3FNHA 5LLDA 5A7GA 1X15A 4WESA 4LECA 4ZVMA 3Q5EA 3DMGA 1QNLA 3K2EA 4G01B 2VWHA 4DRXA 4BKRA 1E3WB 2GRAA 5CB4F 4MJXA 3KOYA 4MJLA 1EVIA 2QUBA 3WHIA 2GUGA 3F5QA 1EBBA 4Z54A 4YQYA 3R77A 4KMOA 5SZIA 2JASA 2A5FA 5CDYA 2GHQA 3NTXA 3R20A 2GHTA 3LUFA 5FDFA 2J9RA 4IIHA 5IKEA 1DAPA 1PQUA 4D3FA 1CERA 4DG5A 4YI3A 5CVUA 2J3KA 2BEJA 1N6RA 4F06A 2V4UA 2CFIA 4D43A 3QF4A 3GVIA 1C8VB 1TAGA 2DFPA 1UM8A 1G2IA 1PNQA 1VCHA 3LXRA 4CMIA 1P7CA 2XCIA 4QFDA 1B74A 1PG0A 4DSTA 1XXHE 4AD8A 1VPVA 3B3FA 3DYBA 1EVKA 2W6ID 1IEQA 3DWFA 2H06A 2IYQA 4MYHA 4EDFA 1NNLA 4D8VA 4Q7QA 3IBGA 2ZIFA 1H5UA 1G19A 3RJTA 4IV5A 1DARA 1SXJA 1QCCA 2I80A 5JRZA 4GZ6A 1AHHA 1ZIDA 1GQOA 2G09A 3OFNA 2BW0A 1AKUA 3IUSA 3OO0A 4PLWA 3AU8A 5U1PA 2GAIA 4FHEA 4RD1A 1I5OA 4IYRA 1RJ9B 1OX4B 2OFOA 3ASUA 1WCYA 1DKUA 1DU4A 1O58A 1GPAA 2JD0A 3H3FA 3M3PA 3QE2A 3VR3A 3ANXA 3BMCA 5M34A 3RDPA 1DUVG 3QITA 2IBMA 3UK2A 3FNFA 4ZTZB 4ESOA 4QXOA 4ZVKA 3ID6C 1KI6B 5BSWA 4RA6A 4MLCA 1ZD5A 2GN9A 5E7QA 3LOQA 3VFDA 2HB6A 5LU9A 3ZWAA 5HDQA 1GL7A 4D9MA 4DEXA 1NXWA 4QXQA 4WXHA 4OPMA 4C78A 2YS6A 2W11A 2C7QA 3D2LA 3HV0A 4B7ZA 3SS9X 3K9LA 2YIDA 4D3XA 1YJ8A 4PFJA 4KFTA 4ZI3A 3JQ8A 3QWIA 5AVOA 2OGSA 2PWPA 4PZCA 1DJMA 1YJBA 3LY9A 1OGIA 3NIDB 1A96A 4IBOA 5F78A 1HLGA 3K9NA 3AINA 3EA0A 2D59A 4LXUA 4M0CA 3OMXA 4KL8S 4P3YA 4ZVTA 3DCIA 1J0EA 2J7PD 1KDRA 2Q2NA 3BIOA 3ANNA 4DQLA 5CBPB 1HE4A 2OXCA 3DVQX 1ISIA 5A6SB 3CNQS 5JU6A 2FETA 4EG8A 1UH5A 3M8KA 1DBWA 2AG8A 1XWFA 3KQMA 3PDWA 1W5TA 4KWHA 5CEFA 1ZOIA 1TO1E 4CL2A 1GV0A 2C2XA 2Q6TA 4YI5A 1YBVA 3REGA 3IC5A 3EVNA 2VDVE 2X8JB 1CRPA 4EG6A 1U2RA 1FDRA 3AIOA 1CULC 5ALPA 1W1UA 2DKNA 3HHPA 1PR3A 4URXR 2F9MA 4KAAA 4UQPA 1SA0B 2D1FA 2JANA 3PQFA 3KEQA 3BIWA 3G9QA 1GG9A 4QFCA 1DP4A 5ERGB 1FFCA 3VZSA 4UNSA 5F9HA 1E98A 3FX2A 2PIDA 4E1AA 1HXHA 2YXNA 5T41A 4KO2S 3ZLTA 4GAEA 4BNGA 2BT4A 2Z08A 4V24A 3I5UA 4RELA 1Z0KA 3T1HB 4CCYA 2NX2A 1EWTA 4MDEA 1G21E 1ZUWA 3HPQA 4RFVA 3L6UA 5D2CA 4ZJYA 2CLCX 1CQXA 1EU1A 2W0SA 3D4OA 3TTVA 3AERA 2WD7B 2XNSA 2W4MA 4DVGA 3K73O 4YV1A 2NVUB 1J0XO 4OH1A 5CJJA 4ZOBA 3V1MA 4AZSA 4DLWA 3ZI7A 1F0YA 2M6SA 1XGKA 2FZ4A 3T1NA 3FDFA 5LYJB 2YXDA 3PC6A 1ADCA 2QR3A 1JP7A 4JQYA 4AMYA 4UUAA 1NFRA 1SNYA 4BBJA 4OHFA 1JR3D 1U8CB 3C24A 4YLGA 3RVSA 7REQB 4HUQA 5GJBA 4L16A 3BA1A 3E4CA 4WEQA 1V16B 2RKWA 1KEKA 5ALVA 1GUBA 3V1UA 3BMNA 4ZYWA 1I94B 2COUA 5C52B 1IXZA 1D6JA 3BK2A 2PMCA 2V7UA 2IUSA 2ZRQA 2PPVA 3H11A 3IQZA 3LAWA 4MS1A 4RL6A 3ZWPA 1YB1A 3DMPA 4WV3A 4DGSA 4DNPA 4IXWA 3V97A 1SZJG 4NOJA 1UJ4A 2EG5A 3O4RA 3PQ6A 5EHIA 2BDTA 3GLQA 1JKFA 4INAA 5I7WA 2B1RA 4GOMD 1LLFA 2Y77A 3GL9A 1Z2AA 2Q3BA 2CT8A 4FZRA 4E94A 1NVEA 4QEDA 1B0ZA 1JLSA 4QOHA 3HR7A 2A0YA 5T5QA 4QGAA 1Z6ZA 2JARA 4WY5A 4J29A 4FILA 2WU4A 4KFSA 5A71A 2ECFA 2FFAA 4U7JA 3HFGA 3RSQA 3AWDA 3ESXA 1T5DX 2EBFX 4MP8A 2HJ9A 1FXUA 2OPBA 3WJ1A 4MR9A 3Q2IA 4Z9XA 4A1OA 3O8NA 4RH3A 2BYTA 1WZIA 2FFHA 4BVFA 1POXA 5E6SA 4JBXA 4Z0TA 1YQUA 1ZN9A 3EIFA 1QO0A 2BR3A 1F60A 2FMTA 3MUOA 5JR3A 4XYEA 4EENA 2V7QA 1IG3A 3KE8A 4FJ2A 4GLOA 4REMA 3ZV4A 2GBCA 5CFLA 2O19A 2FQYA 3PNMA 1C9JA 1XKQA 1BMQA 2IH2A 4BNHA 4TL7A 1VKNA 3A3PA 3QU9A 4D8TA 2H1WA 3PLNA 2BMDA 2DZDA 3GBPA 1W85B 3AUSA 4OA8A 1I51A 3ZTTA 4BP1A 1QPZA 3QA3E 1JDZA 1SBYA 3VX4A 4MW1A 1O3YA 2ACWA 2Q49A 2QVLA 4HX5A 4W5NA 1UOPA 4LMPA 1A2OA 4RHCA 4EJFA 3L5OA 2XVXA 3DJYA 4JEMA 4RHEA 4MK4A 4XIJA 2A84A 4A0RA 3FZEA 2TECE 2JJ1A 2YZ7A 1ESMA 4GRIA 1ZI6A 3GX1A 5BSRA 4EEKA 1O94D 1ZX1A 5H81A 3E27A 3ENQA 4Q1EA 4Y6QA 2M2IA 3AL0C 4AQYB 3TEMA 3MWEA 4CT4B 2GPJA 5L40A 1UJMA 3ZQ6A 4Q4HA 5T3YA 3MAGA 4C4OA 2BTOA 2RHGB 3P5SA 2QVCA 1W2GA 3F7OA 3E48A 3P9YA 4MEJA 3LGXA 4D3YA 4TLBA 4BAZA 4E5NA 2AR7A 3PXDA 2HA4A 2E1RA 4OGGA 5CNJA 2H7CA 4Q19A 1OXVA 3OQVA 1R4ZA 3DW1X 2FN4A 1MX1A 4HYYA 1ZN7A 4R2IA 4N3BA 4OKIA 3ZCVA 4DSAA 3NEPX 4U9UA 3U44B 1NKTA 3CY6A 2OP0A 1JMYA 5DE3A 4C7VA 3OSUA 1UPFA 1OLSB 2C57A 4NCJA 5AI6A 3V00A 4I99A 5KYYA 1NM5C 4IGAA 1MN6A 4IMPA 4OXNA 3WGHA 5ITSA 1MOQA 4AJLA 1AC5A 4DB2A 4HHEA 3U1BA 3G0BA 1PGQA 3ORFA 1P7ZA 3BGIA 2YZ2A 1DX9A 3OUUA 2FEXA 1KI8A 2CNKA 2QXTA 2H5JA 3RF6A 3ZHVA 4S3MA 5JCOA 2QRLA 1JLLA 3OURA 3VOAA 3G79A 4WJKB 2YIVX 4WN9B 4OFBA 2AZDA 3FOCA 2XUPA 2D7JA 4IVNA 1BVHA 1NUHA 3QBTA 2AW5A 1Q7CA 1CUHA 1U8TA 4DIKA 4E03A 1XVIA 1P2VA 3DG9A 3MJDA 2DHQA 5G53C 1BW9B 2X8AA 3MLEA 1ARZA 3IPRA 2QUKA 2WOJA 4QVGA 1GPH1 1H42A 1PG5A 4CN9A 4EHKA 3B1FA 3ZNOA 1D8TA 1R9JA 1UPAA 3GEIA 3KKOA 4EECA 2BR4A 1TVCA 1RYEA 5C9ZA 1LU9A 1JH9A 4CKWA 3U1TA 1QYXA 3IX7A 3F8SA 3MRXA 5CLIA 3UMBA 1KF0A 2Z56A 4EFKA 4F60A 1O95C 1WXFA 4JJGA 1RYYA 3JS5A 4OLHA 3WLJA 4F38A 5JCXA 1RXVA 2PKEA 3DLHA 2PH7A 2EJVA 4HX9A 5FO0A 5J2UA 4KE7A 3VO8A 4LFCB 3IEKA 3F7TA 4NPCA 3DBVO 1F9EA 1EGHA 1KDTA 2AYXA 2G67A 3B53X 3DOUA 2H4FA 3MOGA 4MUEA 3JQDA 2BM1A 3AIIA 5I7RA 2Q3EA 3NRJA 1DFGA 2BEWB 2J1LA 4JEIA 4J2TA 3SHWA 1THZA 3I23A 5BNFA 1Q0ZA 4IHQA 4R7TA 3WGOA 3P9ZA 1MNAA 2QYHA 2R7MA 4DQUA 1E7SA 1ULZA 4CKCB 1E1QA 2C5FA 3FIJA 2XIQA 3OOSA 3QMVA 1Q0TA 1AUOA 2PZFA 3CYFA 3G7UA 3GLVA 3OZDA 3A4YA 1HMPA 2VP3A 5HFJA 1L5HA 1JSLA 4LSWA 2IBSA 2F9LA 3ADKA 2ZWPA 1Z5UA 3L0PA 5F12A 2AVNA 1LSUA 4P3OA 3A6ZA 2IEDA 2QW8A 5CHEA 3ST7A 5BNZA 3GI1A 1ESZA 4ALLA 4JUIA 1SCIA 2IEAA 1RXCA 2ZJ5A 4WINA 3TNFA 3IDQA 1SBQA 4OCZA 4RV9A 3LQ2A 2G7ZA 5FNVA 4CT0A 4EPXA 5AVWA 4WLFA 3DVRX 3TCKA 1DRVA 1M67A 5BQFA 4X1KB 4S1TA 4JSYA 1S3FA 3M9XA 1JAYA 5I9NA 3VXKA 4LNAA 4XUEA 3FPHA 3DQPA 3RVKA 4MSUA 4W1PA 3WY9A 3U4QB 1IUNA 4GL2A 5IXSA 2DQSA 4OHOA 3INNA 1NXSA 4Z0NA 3STWA 1Q7GA 4HDRB 2IY7A 2ZB3A 3OTWA 3FZYA 2WABA 3CTPA 4O4JB 3KFVA 3SBEA 3X1MA 2J9FA 3D0RA 2QXUA 4KAXA 3IQWA 1ECBA 5IVDA 2D7CA 4EA8A 4HAOA 4NDAA 3IPXA 4QYSA 3VJRA 1ZY2A 4B81A 4GMKA 3NHWA 4ENPA 3HDTA 5ISMA 1JSXA 4V0SA 4BMOB 3HB0A 4B09A 2QG9A 1P0FA 2CVHA 2YOFA 3CNOA 2AFHB 3WL3A 2C1EA 5HKKD 3OICA 5L95A 4TYWA 3BZBA 4JP3A 2V3CC 4HWOA 1NBOA 2IT1A 2BKVA 4XYGA 4V38A 2E87A 4REQA 2C92A 1Y34E 1Z7EA 2P2GA 5LFAA 1WMEA 5K3CA 4YEDA 1SBNE 4M8NE 3HY3A 1PZMA 1Z0JA 1URPA 2I6SA 2X0NA 1VLLA 4FX5A 4I1SA 4FPXA 1NJ5A 1ZOPA 1A4UA 3KTFA 4LC1A 4B6OA 5KJ6A 5K6AC 4MQEA 1MIOA 2VP0A 3M4NA 2VFAA 1J06A 2O1XA 1B8OA 3R5XA 2V58A 4MUJA 1W48A 4NJEA 4LXTA 2GF2A 4JVNA 2PH1A 4CI0B 2ZJFA 1RYHA 1TF5A 1X42A 4XQEA 2OD2A 4IG4A 4YP9A 5BVGA 1DG1G 1FSGA 4IFBA 1QGAA 3RU3A 1DKQA 4F4FA 1NDHA 2ZSJA 2LGJA 2RAUA 3HXOA 4JBIA 4P35A 4HNUA 1BDBA 4PCVA 1Z2DA 4FMDF 1CX9B 1WEHA 3M5DA 4MS3B 1VHJA 4IEFB 1CUGA 1E2HA 1SC6A 5F77A 2G4VA 3KPVA 2C97A 2V7QD 3MTBA 4UEWA 5E6RB 4Z4QA 3PCTA 4ITUA 4ZMBA 2DH5A 2NSYA 3MJFA 4GNKA 5DM4A 1U28C 5I7AA 4BMYA 3ESRA 3PNKA 2VHEA 1WCWA 1XMJA 2WQ7A 3DL0A 5F9MA 3L77A 4TLLB 2W6MA 4X71A 5KX5B 3O9ZA 2ASEA 2ZB7A 3F6SA 5F4BA 1M0WA 1PR0A 3SZGA 1R6VA 4AN1A 1C7QA 3IE1A 1ORTA 1OREA 1A5BB 3RYHA 3GFRA 2JIDA 4R40A 5IMBA 4ND3A 2VK2A 4OKNA 4BU0A 4WH0A 3IOMA 4B74A 2Q5HA 1E3MA 4GSLA 3O8OB 1US8A 3QPVA 4OQYA 5J5CA 3MS7A 3W9SA 5B5SA 1NM5A 5E3IA 3KWLA 3NORA 4JBGA 1QB7A 2FGKA 2OQRA 2YC2C 3L8GA 3Q0TA 2X5JO 1KVSA 5HXAA 3QPWA 3MWLA 3KP1A 2M1ZA 1YR8A 2NT4A 1K5HA 2CHFA 4AO7A 3B3JA 3UAWA 4DA6A 5CVDA 1QE3A 3PPVA 4AJJA 3DBHB 2QWXA 5JBNA 4BC0A 2G1UA 5H82A 3DE4X 1ILEA 4FR5A 4X85A 1OI7A 4B3FX 1OLOA 3LX5A 3P94A 4YTEA 4LGYA 3HG7A 3AZPA 5DM60 1VXRA 5AD1A 1X94A 4RVCA 4PWZA 4QOFA 3ZGLA 2GPAA 3PA8A 4WVFA 4BQPA 3UWMA 3L40A 4YPVA 4ZQCB 2ZBEA 1EK1A 4PSUA 2FZKA 4IIJB 5CFNA 3V33A 4DPLA 3JD3A 4MKZA 2TS1A 4B3JA 1HEIA 5FI1B 1RTKA 1YASA 1LDMA 3DULA 4C0KA 4X63A 4F3NA 2C5GA 4QGSA 4LZNA 5KSWB 3H2BA 1B8UA 4HEQA 4AUKA 1YFKA 5C81A 1MB9A 4GXQA 2PXAA 4Z1MA 3JQGB 3JWJA 2P0AA 2QUJA 3EASA 3HZOA 1ZGBA 3JSAA 3SZLA 1DE0A 2JZOA 2OHFA 3KYDB 2O7NA 4M9RA 3SU8A 1V8BA 3N8IA 4CG0A 1ECFA 1UXKA 2HA6A 2WAMA 2FUCA 3WGKA 3WGMA 1I4EB 4UUQA 2I6FA 5GONB 1Y6RA 1JI0A 2QX9A 2YR0A 1XX6A 3O73A 3QLJA 4PCAA 3MJ4A 2HJSA 1EP9A 4O3MA 4AS1A 1TADA 2JGAA 4GSKA 3KQYA 4NAVA 1QQTA 2RJ3A 4Q34A 1CLUA 4G4GA 1I5RA 3VYTB 3TOCA 3W4KA 3ZWDA 1P44A 5IYZB 3PF8A 2H54A 1TZCA 5E2IA 5EPEA 1CJKC 3LP6A 2RHHA 4GEKA 3DZCA 2OSBA 3DCJA 5DYWA 4URWR 3W06A 1QYDA 4YYZA 4DR5B 1NXXA 4X61A 2GH1A 5DHAA 2C8LA 3RTGA 2BTQA 4DG8A 3AI2A 3IBCA 4KVZA 5E2BA 5AUOB 3P9KA 2ZM6B 1XMPA 3RB8A 4FGUA 3VZQA 4Y6GB 4K03A 3X1WA 5F1KA 1JEDA 1D4AA 4FZVA 3U9LA 1RXWA 2W6PA 4Q21A 4A6EA 1LV7A 5IASA 1BX1A 2VDJA 2BEUB 1DIBA 2IYWA 3P9QA 3ZX5A 4QVIA 4TQGA 2V7PA 2NV2B 5KU7A 3OQIA 5JNLA 4BUCA 4HXFB 3TRHA 5BV0A 3G5AA 4KQWA 3VH1A 4UMFA 1VG9B 5KYYB 3BH7A 4ZEMA 5F2NA 2P9FA 3HO8A 3KEGA 1YBHA 3ANTA 2VC2B 4ZHQB 3QVGA 1VB5A 4JQOA 4ZD6A 1F4LA 5K9ZA 1S4MA 1XDUA 4ZYZA 4RY8A 3S2FA 1RVDA 2UVQA 2XYQA 1DC8A 1J8FA 3PC8A 1JLKA 2I6UA 2WHEA 5A5FA 5D3KA 1FZTA 2VHTA 5DHQA 1N3IA 1TUIA 4MCAA 2DTXA 3H3JA 1P77A 4BNWA 1M2FA 1FY2A 3HH8A 3DEYX 2CLOB 2QDKA 3L07A 3QOXA 1I6WA 4EX7A 4UHHA 5CT4A 2NP7A 1Z08A 4Z4CA 2PZ8A 3ULKA 4G25A 3Q9SA 2AD1A 3HJAA 3NC4A 2VXOA 1N5KA 1Z2OX 1GRNA 4M36A 1L3BA 4XGNA 3PQ7A 5ECWA 4TV8B 1Y1QA 1QUFA 4L27A 4O4JA 4RADA 1QHYA 1I3LA 3A06A 3E03A 1N0UA 3GV0A 4CW7A 3K70B 2XF8A 1C1XB 1UM9A 2ZVDA 1SXJD 5IDVA 3WMWA 2CXQA 3N6RA 2DOKA 2IS6A 1H85A 5ALQA 2JJ2D 1XVAA 3CISA 3UCXA 3L9WA 4A0SA 5ADVA 3AQIA 2QGZA 4D92A 2A1TR 3BGWA 5LNK6 2UZ1A 1RTTA 1S1MA 5K8TA 2CKDA 3KYJB 2L82A 1A5SB 1NQOA 1QG6A 1YO6A 3F6RA 4FWBA 3BGVA 2IV7A 4Y9TA 4EPTA 3A36A 3MVEA 2ZI3A 3DV0B 2ZYHA 3DE5X 3LWDA 2Q62A 4G1BA 2IU0A 3WLMA 1L6RA 3DYIA 4UUOA 5EJGA 2I78A 1F3LA 2JS7A 3F9RA 2HSZA 3FYHA 2C1ZA 4G3XA 2RGGA 5ESXA 2OHVA 2WJ3A 1ZM4A 1XWIA 1G1MA 1VSQA 1X86B 3DFMA 3M6UA 4FMCB 5BRAA 5KNCD 3T9EA 1SKBA 3C3CA 2YXLA 3GGOA 1GU1A 4KXVA 5KNBD 2SICE 3V2GA 2RAFA 4GF5A 4CL3A 1GT91 3ETNA 4F9GA 5BUSA 1XJ0A 3GEDA 3L0IB 3P8ZA 2D1QA 4G26A 4XIFA 5COQA 1GNPA 4XGKA 2GETA 2XCUA 5L7YA 2YZKA 3JQFA 4GO1A 2RGCA 3C98A 4M9XA 3SM9A 4YXFA 2EYUA 3QEMB 5JPDA 1XHLA 1EM8A 1M2JA 3O1HB 1LBQA 4BC1A 4MWGA 3OKFA 3KVOA 4RSRA 1TVKA 3HS3A 3RS0A 3Q7QA 1LDYA 2XUQA 3H5RA 3OCYA 3V4ZA 4JMLA 4AAYA 1AXRA 4RJLA 1E66A 4C7KA 3T3GA 4JY7A 4KAFA 3COJA 3EODA 4LJKA 4QBHA 3AUYA 4XQ9A 1V4BA 1U99A 3ZJYA 2IUYA 5K45A 1G16A 1HM5A 3FWPA 1MX3A 3PTAA 1JIVA 3OU2A 1WY5A 3COVA 4KRFA 4HY3A 4MI3A 1ES9A 1KYVA 1MC8A 3NAMA 4GR9A 1PNRA 2V4ZA 5C1PA 1A8PA 5KEIA 4X7PA 3T15A 2GB4A 3N2EA 1PS8A 1FJGB 1CQIA 2PUWA 1GEEA 4WZAA 4LMAA 3TUJC 5K20A 4QPNA 2ORVA 4UE6A 5L3ZA 2X0EA 2O3TA 1IHDA 3UF0A 2KPOA 3RAEC 1U2ZA 2O20A 5H1YA 2AR9A 2FVXA 2IZ0A 3OTIA 2YXPX 1OB5A 4G67A 4BV9A 1VMKA 4L9WA 3ZDRA 3HFRA 1U8XX 1XF9A 2FW0A 4ERNA 5G1OA 2JGJA 4LHEA 1ZUIA 4NYMQ 4B4VA 5DHTA 5I4IA 4G0PA 3OEEA 3KETA 4P33A 3JASB 4NV0A 2G9QA 4J6FA 4ZV4A 3DNPA 4OHMA 4EY4A 2AOVA 4KNYA 4F5EA 3W1EA 4ESHA 3F8TA 4CIAA 3NOQA 1Z2PX 3TW8A 4S24A 1XMIA 4EI9A 3C6YA 1SXGA 1X3SA 1X7XA 1J8DA 4NMMA 2XECA 3H18A 3FOEC 4NE9A 1MF7A 1UFRA 2D8AA 4XLTA 1KS2A 4LDJA 4EKIA 4KR6A 1QOQB 3W5CA 3CZRA 4ER3A 1FP6A 1IDN1 3H17A 1OFUA 3ONNA 1BFKA 2GZ2A 3OUZA 4D9BA 3FVVA 1CQJA 1RKQA 3KJIA 3RVDA 3ICQB 1V8FA 4JJZA 3OM9A 4MAAA 1R4MB 4C7JA 5E6RA 2JCXA 4HDSA 1O95D 1SXJE 1DKNA 1SXPA 2PUCA 1CUXA 4LVNA 1Q44A 2ZG6A 4LN1A 2ILTA 2BGKA 3ITDA 3QJGA 1YQXA 3PHLA 3FB4A 1IIRA 1FDVA 1PT9A 2WMDA 1E5VA 2JGDA 3LW7A 3EOAI 5A4FS 4TWIA 2WFAA 5A3RA 1HDEA 3G59A 5AKYA 3HBAA 3DE2X 1LNZA 2EHDA 5KDLA 3FNRA 2PMKA 1EINA 3AJDA 3PX7A 3K16A 4FLEA 4FQ5A 4U7WA 1JIIA 2X7JA 3ZCXA 5C8YF 3D6FA 1JQLB 3HBJA 4TS4A 2XADA 1QF9A 2ZJYA 1ZJ6A 2BTQB 1WVGA 3PVZA 3HJUA 2X8LA 5AUPB 5BVHA 2A7XA 5HYVA 5I3CA 1TCBA 1E96A 2GXSA 1JQJC 4O4LB 1Z39A 5EG5A 2IBTA 5LKAA 4M7OA 3E70C 1DC5A 5EJ7A 1Q0PA 4KN9S 3SQXA 4M88A 1NW3A 1T3LA 1NXQA 2QD2A 2ZE7A 4GYYA 3ZNQA 3MGCA 3P9RA 3V8PA 4BNNA 5C1BA 2FN8A 4QVKA 4HWRA 1WHSA 1XZFA 3WYNA 2ETXA 2PRZA 1SXIA 2ID4A 2HFKA 3U48A 4C6HA 4F85A 5HMMA 1TQHA 2GAOA 2HA5A 4Y6LA 4TV8F 3AVXA 3R75A 4L8FA 1TIPA 3JALB 4DL9A 1PNVA 3AUXA 5K0LA 4TLCA 3K9BA 3TJRA 1QVWA 1DEAA 3PUZA 5DN6A 4MW5A 5F3DA 3GMSA 5CHYA 1QU2A 1TT7A 3I9OA 1CUIA 4LFBB 621PA 3ZGZA 1PL7A 2Q4DA 4QXAA 4ZANA 2NLOA 4DNFA 3SICE 4HOYA 3M5CA 4GOLD 1AKWA 1AV6A 2PBFA 2JAQA 5HE9A 2VTDA 1RD4A 4ZRDA 2A33A 2Z2JA 2J59A 2SKCA 3QA9A 4BB5A 4G85A 1NURA 1PO7A 1ZXXA 3LCJA 4KNWA 1QTRA 5EGSA 5K3FA 5DIFA 5TJ9A 2AN4A 1BH6A 4OSEA 3UA3A 3AF2A 5EPOA 3DMNA 3C48A 5D3MB 4YXWA 7ABPA 4BPBA 4C4ZA 1OYVA 1VZ2A 2HN9A 5K1ZA 3ZXUB 2I71A 3GU3A 4ICIA 3UUFA 4AIRA 2FPGA 1RYBA 3RTCA 2CC2A 2AEJA 2QTHA 4TV9F 4PX9A 4RAOA 2VZ9A 3D1LA 5BOVA 1OUMA 4G24A 5DEIA 1QC5B 1TUEA 2O57A 2PT5A 2ZWIA 3LPDA 1AU9A 1MJ5A 1YDMA 4KQFA 1Q12A 4PR0A 4X92A 1R6UA 2X3FA 3CLRD 4X1IA 1SVIA 4ZQBA 5K8LA 2FWPA 2YVQA 3KUDA 1WRBA 1T43A 4AKSA 4AY3A 3NHUA 3VNAA 3NYIA 1PKEA 1ZI8A 1W36B 4OV6B 3WOVA 4EDHA 4Z4HA 2AFIE 5CDFE 3M89A 3OAAD 1AGYA 1GCIA 2ZJ3A 4Q4AB 1J0AA 2VNKA 2XUFA 2A3NA 3OHMA 5CXSA 3WZ2A 1WIWA 4MZXA 4MPRA 3ABSB 4HDKB 3JQAD 3VR6D 4GX2A 1Q1EA 3KQKA 2ZTHA 2ONJA 2RG7A 1G66A 2QN6A 3C1AA 3VSBA 2HIHA 2OMEA 1KPIA 3PXCX 4JC4A 4LVOA 4ND5A 1K6JA 1NASA 1GR0A 4J7XA 4IKOA 1DLJA 1N2XA 2IY8A 1KAOA 2IE8A 4H0NA 3VNVA 4PNZA 1FLDA 4YRDA 1EFCA 1ELOA 1PJ8A 4EUNA 3TW0A 1Y3CE 1KY3A 5BMVF 2GCIA 3NP9A 4GSYA 3TCXB 3LZDA 1MNQA 4IUYA 5REQA 2FSGA 1B8VA 4RQBA 5GTDA 2IP2A 3IEPA 1QHHA 2Y1XA 4XWYA 1IIBA 1AUPA 1VIVA 3VVLA 3L49A 1KMMA 2OXFA 2ZRLA 1GUFA 4IS2A 3HCEA 3UQZA 3LVQE 1Z0IA 3I9NA 5DHSA 3RT7A 3N2ZB 1XC7A 2C84A 2I2BA 4R1TA 3T7TA 4CIDA 3ND8A 3HXQA 3V1YA 3B6IA 3G2JA 2J6HA 1XDBA 2VHXA 3O3OB 3WI7A 4A1FA 1EX9A 1O2DA 1S0UA 3LA8A 3ZWXA 5CDHA 1ORHA 5AH0A 4ND7A 4NFSA 4ZVNA 3AF3A 2PKRA 3NT2A 4ILEA 1P60A 4Q7LA 4FYPA 3VPSA 5JRJA 3FUTA 1E6WA 4RC9A 1Y4AE 1RYMA 1E6KA 3ZCSA 3A70A 1IBSA 2FPUA 1WQ1R 1EAYA 5IJ9B 2MR6A 2HJGA 2PLFA 3FYTA 1L5QA 4KPUB 3B51X 4TKUA 3G0DA 3WGLA 4AJ4A 4B83A 5ALEA 4Z1OA 1IXSB 3A26A 5JI3E 2CMHA 5DGDA 3OZWA 2DHDA 2HC9A 1NVVQ 1TLLA 2A0XA 2YTZA 4MVJI 3TD6A 3A9TA 2W6NA 5ICEA 1QIFA 2FR8A 5FNZA 2QQ5A 3AEYA 3MWFA 4D3DA 3ZZ0A 1MX5A 3M0EA 4RHYA 2A9KA 4HWPA 3FWYA 1HC7A 2YDYA 2O2SA 3PNQA 5FHRA 5E3HA 3D4IA 2IYVA 4E12A 2BI4A 2OP1A 3O4GA 1KO8A 2EWVA 2OXRA 2I29A 2JDIA 2JI4A 4MW7A 4ZEWA 1BQ3A 4QBKA 1N6KA 5T7BA 3R5SA 3S70A 1EJ2A 1ZGCA 5DISB 4B0PA 2IHVA 2IDZA 3ETCA 3DXXA 2GKGA 2GK4A 5JXWA 3WGUA 2GCEA 3GAMA 1AHPA 1U9CA 1E2IA 1IH8A 2WD8A 1MBZA 1SBCA 2XTAA 3K4QA 3VOTA 2J30A 4ADSG 3QKRB 2FN7A 3BB1A 3KT0A 4OUKX 1NVGA 1WJGA 3BS4A 3O21A 3VISA 3L4BA 5JADA 3PLAE 1EXDA 4POOA 2KBFA 5AOAA 2XWSA 4IRUB 1OCEA 3QI2A 1OW3B 1X1DA 1Q95A 2X4GA 4MYRA 2YINC 1JIJA 1Y8QB 3WJ2A 4AWBA 4BO1A 4YCSA 4ZYUA 4YIHA 5FBHA 2Z3WA 3ER9A 1BN6A 3BXEA 5JVDA 3KVRA 4M7RA 1KPGA 3GRYA 1GA6A 2XKJE 3IGFA 2XYVA 3RTDA 4DLRA 2QF7A 1O6BA 2LWIA 1L4HA 3W2IA 4B43A 1RJGA 4QC2A 6ADHA 2J32A 1JS1X 2BI7A 4KO4S 4BQSA 5AJWA 2KW5A 1T25A 2BEUA 2BELA 1UK7A 3QUTA 3WNZA 1EVQA 4J94A 4KXXA 3KZOA 4DDHA 3AM1A 2AH5A 1AA9A 1M2VA 3W5IA 4BMXA 4W1SA 4OQNA 2W2PA 4LF7B 1K6IA 4MQ6A 2FZVA 4S1NA 2BLNA 2C88A 4ZHQF 1P7YA 1NLMA 2CUTA 3MXTA 3TQSA 5HF9A 3HVJA 2CK3A 4CQJA 3WKEA 5J58A 2ZZMA 4GZ3A 3DVAA 3ESYA 4HGQA 1N0VC 4HNAB 1UJCA 3MFQA 1QJCA 4EA9A 1SU4A 5HQ3B 1T9GR 3GMIA 5C37A 4YAUA 5AJZA 1ZBQA 1CRQA 2XZTA 1BS9A 2AE1A 4L6CA 4EHIA 2G0NA 2DM6A 3M6MD 1DXHA 1I1OA 3L1KA 4TM8A 4HEA6 5TQJA 4IZHA 1VP9A 1Z0FA 1T4CB 3E22A 1DZIA 4W6QA 1KFEB 1AOXA 2Y1LA 3ADPA 2Q41A 4YJ3F 5AKXA 1KEWA 4RQAA 1UIRA 4H6XA 4RJIA 3SXPA 4DIDA 1HDIA 1G8AA 4K0RA 4UDOA 2G71A 2OBMA 4LGVA 1BAPA 1YONA 4YCAA 4YRQA 2R5NA 2DKOA 1VRWA 1FNBA 1ONOA 1NQWA 4IIXA 1DJOA 1EVYA 2Q0QA 2XITA 5CUQA 5ITWA 2QBYB 3T7SA 5FNVF 3E9CA 3I83A 1KVTA 5K03A 2DBRA 1XZEA 5E4TA 3N5KA 3FTEA 2Q8QA 4JGBA 2OLJA 4O29A 5L3SA 5I7OA 2HWKA 3ZIDA 3H1BA 3D31A 4GPBA 1DAGA 2AJ8A 4LG1A 1BVUA 2PYIA 3PPIA 5AW9A 1GZSA 3WL7A 3SDBA 1PFVA 4JI0B 3ILSA 2MCFA 3LF1A 2RARA 3L43A 3REOA 4RZ2A 2XD9A 4MHTA 4TKMA 1OH5A 2F8MA 1O0SA 1I6LA 1BDHA 4A10A 3T0IA 4LJ8A 2SNIE 2XV1A 4RAQA 4DCUA 2ZZNA 2GPNA 2P5TB 2X6QA 3NT4A 1RP1A 2BFNA 4CFYA 4R01A 2QVXX 3TTTA 3R76A 2A5JA 1XDSA 1K88A 2PZEA 2ZQZA 2ZW9A 2IWHA 4B3BA 4A36A 3U6KA 4J4TA 1IZ9A 2ADOA 3GMDA 4HH0A 4WGGA 4DSNA 2H9IA 3TVDA 2H51A 2AV6A 4UFNA 1ZJWA 3E61A 3AM3A 2B7BA 5FKJA 1EJ0A 2W6CX 3O8DA 2BBTA 3USZA 2C8VA 3S1AA 1U11A 4QDXA 2LVBA 2BRUA 3ZY4A 1GPLA 4TLAA 5EERA 4F97A 3KAPA 1O9HA 2DERA 3JATB 2UU9B 4MGYR 5KUTA 2D74A 3F97A 1IVYA 4TS3A 3ZU4A 3CRMA 2O2ZA 1I2DA 2HQRA 2PFKA 3KZXA 2NSDA 5DX8A 1VB3A 3RRXA 4G56A 3WIUA 1ESNA 2PTGA 3F6YA 4FOOA 1GKYA 1PJQA 1RR6A 5FQOA 3PB3A 5CG2A 4MQBA 4TUYF 1Z37A 2C78A 3QXGA 1F0PA 1OFIA 2BFFB 3CF6R 4Q1DA 4ZMRA 3JQPA 1PR6A 4AJIA 4AZ0B 4RGYA 1WMBA 2PT7A 1EFVA 4EHHA 3M83A 1FEZA 3H8JA 1NP7A 3KXPA 2VKQA 4UASA 5EI5A 1WMSA 1WXXA 4F1WA 1WCIB 1E7YA 1NL3A 3NNNA 16PKA 1CDEA 2C2ZA 1P4HA 4IF4A 1SUWA 1JRLA 3UWKA 3N9IA 4HGOA 1F0KA 2ODNA 4MLPA 2IHBA 2ZIXA 3E5HA 4BFCA 1PVOA 3ZW7A 5AJTA 1OU0A 2PJZA 3RSOA 4EITA 4DDTA 5KINB 1UKCA 2XTMA 3QPCA 5GOZA 1Z0DA 1ZKMA 1QGYA 3DJFA 4XM1A 3WGVA 2RK4A 5BO5A 3D3QA 2LR0A 1ESDA 4PG6A 1D2HA 3F71A 1E1LA 2HXGA 3LXXA 2XUZA 5LJIA 5DHFA 4ETWA 3WKCA 3OWXA 5EPUA 3UATA 4OL0A 5BSMA 4GP7A 3OC0A 3WRXA 1OLUA 1WUKS 1K89A 3OX2A 4P36A 4YJ3B 2HV9A 5AM2A 4CGYA 3FE2A 3DEJA 1ZUD1 2JVIA 3FB1A 3IUYA 2VSNA 2E6KA 5JIBA 4OI1A 2EATA 1XTTA 2ZSAA 3HL4A 5K8IA 1HYBA 2WJPA 1E2PA 2UYOA 1IHUA 1FFGA 2CDAA 3AFIA 3JY6A 1M1YA 2YQ5A 1UEIA 1AK2A 2A1TS 3AYZB 5DZSA 4BHTA 4X95A 5A1JA 2Y0PA 1S89A 1JHXA 3SC2B 3CR7A 4KPEC 4FGWA 5EXDA 4IDHA 3V7UA 1QAMA 4DILA 1VLMA 2AS0A 3Q41A 2JIZD 4DR3B 1GG2A 4CV0A 1SU8A 4EH1A 2YZMA 3NFRA 1F6BA 3W5BA 3IAXA 3HWWA 4JOQA 2OPHA 1U7XA 1KE2A 3AUAA 1M1XB 2WFZA 5JXJA 4XEUA 3QVSA 3I8XA 5FUBA 2QTLA 1E6MA 4IOKA 1A7KA 1Z5OA 2MYPA 3NU1A 1JG7A 1TLTA 1T36B 3B5JA 4KU4A 2EZTA 1FYEA 3E3NA 2J3QA 3CLTD 1UAGA 1VP3A 2YYSA 1QFXA 2ZAOA 1EGVB 5CM2Z 3QBJA 4GXNA 3DE3X 4WBXC 2XVMA 5KQGA 1Z36A 2Q28A 1PUIA 5FNVB 4R3WA 3DFIA 1JLMA 1NPYA 4X94A 5REQB 1I30A 2PT6A 4XM0A 3QKTA 2NSHA 3E9QA 3JQ7B 4F1KA 1V45E 4D9KA 3NHLA 1ZPDA 821PA 5AJXA 4BX3A 3KDAA 4HFJA 3N7TA 3GLHE 3LKZA 3ZV7A 3J80A 3RUCA 3NPMA 1TPZA 5JECA 1MABB 2ZWOA 1XMVA 1XL0A 4QAQA 1TD9A 3EMKA 3V8NA 1EP2B 5CJ2A 2A35A 5I8WA 5JV5A 3KALA 3W5SA 7MDHA 1G20A 1PWHA 4L4SA 4BMPB 1EKXA 2CWDA 1F9AA 5AW6A 5GZ1A 1MD9A 3FDXA 3MXOA 4IHJA 5KSYA 2EL7A 2UYYA 4OM7A 4GRAA 2WJZB 1PZGA 2R4UA 3DDWA 4UZFA 2R8ZA 1DWPA 2OWDA 2ZEJA 1JAXA 1RBZA 2BHTA 5ITVA 4QUHA 3LT1A 1ZW6A 3OT1A 4TTAA 5KNBH 2OK8A 1VXOA 3VHXA 2QUHA 4F9EA 2O5CA 4DLTA 3AF5A 3GIDA 5FL7D 2FZWA 1H0SA 2QXYA 4CKBA 1ZISA 3E1GA 5HCNA 4KX5A 3FFWA 4HEA1 1UMCB 4LZJA 5FPPA 3SS7X 4DJTA 4QKQA 1BWSA 1Z34A 1UKVY 2Q27A 4ZOLF 4HS9A 2G9VA 4GNRA 3LTNC 1L7MA 2O2EA 2PD3A 4B7UA 3EEOA 3T5TA 1T91A 3OZAA 3PFNA 3BZUA 3G0IA 1Y42X 4HNQA 4RD2A 1OPXA 4UJ3A 1I32A 4RTKA 2EU8A 3LPLA 4UVEA 2J4CA 1V8DA 3AESA 2NPOA 1NQVA 1U1EA 1HE8B 2JD1A 2QI9C 1XZMA 3DXZA 3F4KA 3IAS6 4KLNA 2VLBA 2GN2A 4LRWA 3Q40A 4KRXA 1Z5ZA 3E1SA 2OKCA 4HLUC 4XA8A 5D3MA 2H1RA 3F49S 1CZHA 2HIMA 3ZDEA 3ICWA 2FSIA 2OZEA 2P9EA 2RSLA 4OAOA 3WK5A 3PI6A 4PU0A 1XKTA 4C1NA 3KYCB 4QRIA 1PJSA 1QHSA 1GA4A 2WSYB 3O9MA 2NU9A 4YJGB 1C3EA 1MVLA 1OOEA 5JAIA 4XD2A 3JASA 2GESA 4NENB 4A15A 3K4HA 3M4XA 3H65A 2EW2A 4B6FA 5FLXA 4ZODA 3ZNPA 1GTRA 1ORIA 3T3MB 5BUZA 3STVA 1AZSC 3CU5A 2O2HA 3OMLA 4ZALA 1GDDA 5KBYA 4MW6A 3NHMA 3N3AC 1V47A 4BGUA 2M1XA 3LC7O 2XMGA 1RKUA 4Z9BA 4W82A 4NSNA 2MINA 1TJ5A 4IQ4A 4PCUA 1HQDA 2ANCA 4F2PA 2WHXA 4G8JA 1DWUA 4TZTA 1OU4A 4BO6A 1NJGA 4M8SA 1J56A 1P5JA 2Q4OA 4FNGA 1M2VB 2YYYA 4PLFA 2KM1A 3AVVA 3FJ1A 1U9ZA 5H80A 4JI5B 3HVKA 3NJ8A 2H4XA 2Q3CA 1UAAA 1FXSA 1Z47A 4Y98A 4KN6A 1YR2A 4HB0A 2RHDA 1YH3A 2D06A 3TL2A 1HGXA 2B8JA 1ZONA 2Q1SA 1PQ4A 2ZT6A 2WT4A 3CLVA 4WAUA 3WMGA 5BURA 5ICFA 1C29B 2DR2A 4IW3B 1NBEA 2R60A 3GZTB 4NJMA 3TZCA 5I6DA 4PSVA 5IM4A 1M3SA 2E2WA 4QULA 2N1BA 2WWGA 3FOBA 4U1RA 2CDNA 5EUCA 2FUG1 3E3AA 1NYLA 1PTJC 3DDSA 1ADGA 4RLSA 1QH8B 4OYLA 2D0PB 5HMLA 2XT9A 2WTNA 3OMWA 5TR9A 1ZAYA 4QO7A 4QSHA 2INGX 5FL7A 2ZSBA 5TVKA 1QV9A 4W8GA 5LXTF 4L0CA 3H4TA 2QW1A 2GZHA 3KUCA 4NX2A 5T8KC 1DG9A 3CZQA 3H8VA 4C6SA 3NBKA 4CLEA 5DMHA 4H3VA 5ALUA 4L1KA 4JEUA 4ZCIA 2GYUA 3ZGOA 3DDNA 1JTVA 1NI3A 4FYVA 4OMUA 5FUVA 5KTSA 1EK5A 4ZVOA 1UDXA 2H5IA 5KHLB 3N53A 5JZMA 1CJTC 3NEYA 1YS6A 1V3QE 1PEYA 1FTSA 1HNNA 1O77A 1TJNA 1J00A 1R0BA 2AK3A 2OAP1 2WW8A 5B6IA 3GD5A 1ZVVA 4ZREA 1Q17A 2PSJA 1B93A 3GLFB 4KR9A 2PUHA 4I55B 4HVTA 2WQ6A 1G9XA 3NONA 3CBQA 1Z15A 3KFXA 2UYHA 1W87A 1K5PA 5E9WA 4YRFA 1VLQA 3BZWA 2DFNA 4OJYA 1DBVO 3O7MA 4PGAA 4WXMA 5LBTA 5D00A 4EMBA 1ZC3A 2PS9A 1HQCA 2FSVC 2A59A 1ZIXA 4XR9A 2I6QA 3SE0A 1R6BX 2OB1A 2W2MA 4C0BA 3P97A 2X1LA 4V03A 2PHZA 4DMFA 5JNTA 2QNBA 5CB4A 3R9XB 1SHKA 4CUZA 2OCXA 3HUEA 4JVSB 2ZLBA 4GLJA 4IDQA 4QU0A 3FKQA 4F8EA 3PE6A 1MW8X 2OR3A 3BKXA 3R8FA 3B6KA 1FFSA 4D9EA 4DLVA 5THXA 5EZYA 1OT5A 3L0CA 4WNIA 1GPKA 1DC7A 1RHKA 1DNPA 2ZP1A 3ED1A 5EZ5A 2JFQA 1XNQB 1NVDA 1JSRA 3EEYA 1SCDA 1QGZA 3X44A 1U4OA 4MAMA 1BJTA 2EAUA 5L9AA 2FWJA 4Q39A 5DTEA 2VPPA 4E09A 4DXHA 3DM9B 1JVSA 3PA6A 5EMNA 4N6OA 2XUAA 3TINA 2RGXA 3TDNA 2CMKA 3PDUA 5BQ3A 3RRJA 3KDPA 2REXB 4BFZA 3I4FA 1GSOA 1SVLA 4UDNA 3PXBA 2WMYA 2MMCA 1G5PA 3ZLVA 3OZIA 1E92A 1X7HA 2G0TA 2OCAA 3FVRA 3IMGA 3JTMA 4FDAA 5D5HA 3QUQA 1MRNA 2XUGA 3KQQA 4M9SA 4URZR 1S3SA 1KOGA 2B5VA 2D4HA 2Z6AA 3QE4A 2X15A 4WOKA 2E49A 1PL8A 1T35A 3E58A 3HUTA 3W04A 2CW5A 3ZKWB 2IOYA 4D7AA 4C07A 2PUEA 1FMCA 3DOEA 4FKBA 3CMCO 3U7JA 4F4IA 3WA7A 1J97A 1M83A 3HYTA 5AVVA 3G6KA 2IH4A 4OI0A 4HUTA 4Q1BA 4AJOA 3RK1A 3GGJA 3GJ3A 3AOEA 3KQSA 5G1PA 5JRDS 4P58A 4C29A 3ZIAD 2GQ0A 2YY7A 2G70A 3ZHSA 3SSNA 1K6EA 2Z4SA 2O2YA 3A25A 5GM2A 3W78A 3HK2A 4MGIR 2PJRA 3K2BA 3SZOA 2C7VA 4NEGA 3ZZUA 2Z6QA 3JQ9A 2O2JA 1WZCA 1PJLA 3A37A 5F3RA 3R0QA 4PO1A 4JBNA 1I3OA 3G0GA 2I3GA 1VBFA 1E2UA 1AS3A 2FSSA 2D1RA 4RXMA 1ND5A 5FR1A 3EF0A 6PFKA 2QB5A 2R3SA 3C5VA 1N8TA 3S3TA 2FEKA 1JFSA 1QP0A 1L7NA 1GZUA 3LTEA 1IOZA 2FX2A 1GFZA 3FN4A 2OB2A 3H8SA 1X74A 3BL6A 3HACA 4DIUA 2YV4A 3IDOA 1BH2A 2NTNA 3EIQA 4ACBA 3SC2A 2MT9A 5B7QA 3E6AA 3F3SA 1BXZA 4ZIRB 4CBVA 4AVYA 1N2CE 3L0YA 1V5IA 4GS5A 4JFRA 2PV0A 4HZUA 2DBZA 1NF2A 2UZIR 5HG0A 1V3UA 3GP3A 3IPLA 3V1NA 4MRMA 2WV9A 3JXEA 2QY9A 3H9CA 4L5YA 1CY8A 3IKLA 4I55F 3ZI0A 3COYA 5EHQA 4BX2A 3L7MA 4D8YA 2JI9A 2YHBA 1DAKA 4P4TA 3C7AA 2X5KO 1G64A 3MJEA 3HV2A 4L3OA 3DKVA 4YCCA 3UK0A 3IBTA 4M1TA 3ZEIA 4PFKA 4AMGA 1UT5A 4II7A 2XDWA 5J2TB 1OF1A 2EGGA 1ZKDA 1N25A 2X1MA 3CFYA 1HQYE 1MGPA 1OH8A 2GPSA 4BWVA 2ZSFA 2I65A 3VI4B 5HTOA 1OWLA 3FCXA 4LJAA 4EJ6A 2ZAGA 4P92A 1Y7PA 4JOBA 3IO5A 3FCCA 3CNNA 4KP7A 2O8BB 1YE8A 3JSXA 3B1XA 5K0BA 3B1ZA 4TQAA 4QUKA 3N8NA 4KQGA 4DIFA 4KRYA 3RHZA 3VR4H 4YUAA 3T41A 4OJKA 4FK8A 1FU7A 4OHWA 5KYNA 3GUCA 5TDHA 1OVMA 1XBTA 4TMFA 4BX0A 1ZH4A 2ZBPA 2QRHA 4TZKA 1UQUA 1W75A 3BAZA 4HGYA 1WPXA 5F64A 3K8QA 1JPJA 1TAHA 5DKFA 5B3JA 3PVSA 1HDGO 4RPJA 5CCEA 4KWTA 2IEYA 2NUAB 5HJ5A 1KSFX 4DG9A 4EPRA 3ONEA 3EVAA 4WADA 3CEPB 1B0AA 2C94A 2DTEA 2WJ4A 4XX1A 2ODPA 2SHKA 4IDBA 4HVCA 1T2UA 1M5RA 2YNMC 4B3XA 3UMJA 2H59A 3OX3A 2BUCA 2VBGA 5IG2A 4R9UC 3AEZA 7GPBA 1A9TA 2WKRA 3WNQA 3T94A 4BZWA 3A6EA 4JAVC 2DHRA 4IAOA 4MUFA 4EJSA 4N6GA 3BMOB 4K9KA 1X80A 2PGDA 1G3MA 4DCVA 3NGLA 3R6LA 3Q5DA 2DLDA 2OAQ1 3SEZA 3V2HA 3MWGA 1MO2A 4TZ6A 4H4DA 1E2MA 3FJOA 2NZWA 5CFPA 1U0FA 4PQFA 1FS4A 2QAGA 3CINA 3SQLA 2OBNA 4LDQA 4NICA 3RLFA 1QG0A 1ZMTA 4LCEA 1QZTA 3HXTA 2QV7A 3LO5A 3B48A 3CURA 5IBRA 3IKMB 4HNAA 4ZAWA 4DLZA 1J39A 2FSVA 2GLXA 2CN1A 3LQ1A 5SYAA 2IYRA 3HGQA 1RMYA 1Y7HA 4A8PA 4N65A 2CDCA 4ZYLA 4MUNA 3TKAA 1NMQA 1HLPA 1VE1A 4ZT2A 3NS7A 3VO2A 2XSZD 3QEOA 3AGQA 1X70A 5IABA 4QOJA 3OC6A 4R8VA 4XEHA 1OH6A 1EH5A 3MWDB 1PZNA 4JEHA 2A7QA 1DMSA 4DMGA 1E8NA 3DEZA 3C1OA 1R4AA 4C7MA 3D7LA 4ZCMA 4XW2A 3AVQA 2I4TA 2NO9A 3LPAA 1H4SA 1BHSA 4KW7A 3E9EA 1GKIA 4ALIA 2BCEA 1Q7BA 1W85A 4EG3A 4ETIA 2XTZA 3KXKA 3FR7A 4XR4A 5B64A 5BY2A 3OEHA 4PYMA 5CPFA 2ZR7A 4BE4A 2KE5A 2JI7A 2WDZA 4CQMB 1EUYA 3P52A 4LY0A 4YLEA 2FPIB 1C0IA 2A9PA 4UE3S 4EHAA 3EJ6A 4FYHA 4E2XA 4LF8B 5A4KA 3LXMA 3DL7A 1A9QA 2QD4A 4S2UA 4DW8A 3CEAA 3GEMA 2EDCA 2JHGA 3GNTA 1NOIA 2BGUA 2AVDA 2VJMB 3IODA 4L8WB 4LK2A 2YWBA 4AN4A 1HPLA 2PMDA 4F91B 3U7QB 1T24A 4CFZA 5KX5A 5EIHA 2EGUA 1TM3E 1L5WA 5F4ZA 4A8JC 1G291 1P81A 1CVIA 3LC2O 1K1EA 2J4DA 1KNQA 3MWKA 2J0VA 4JB0A 3HLKA 3TPFA 4F96A 3EMDA 1G3RA 1Y1PA 4OBWA 1I10A 4R41A 1PCXA 3RC3A 2VHZA 3KQHA 2RGNC 4J1NA 5ERYA 5FEMA 5FOSA 2Z30A 4GX5A 3KYIB 4HYQA 5A4IS 2ZKLA 4JS0A 1JBQA 3IVRA 1M7BA 5JS7A 4IXTA 1UWKA 4F93B 3MLBA 3SAJA 2GFHA 1TJPB 4QEZA 1CRLA 5CFQA 2ISSD 3IP5A 4X3PA 3K6RA 4CKYA 5BW5A 1F4PA 4BDSA 3DOHA 3G8BA 1VMEA 1GT6A 1TMOA 1C1XA 1UM9B 2HMWA 1NDQA 2FEOA 3ILXA 3ND7A 3PIDA 4M1WA 2M6KA 3CJQA 1G9SA 3K32A 4MR8A 1ZK1A 2GRJA 2NVBA 2QMOA 4PVDA 4R8SA 5ER6A 5IAKA 4E6EA 3KOZA 1W88B 3UG7A 4DDMA 2W2NA 3WAGA 1G2PA 1RHUA 4J0FA 4QNRA 4D56A 1XPRA 2F8LA 3CH4B 3KDSE 2C03A 3O8BA 2RHOA 4DUGA 1IOLA 1WMAA 3E2PA 1BE8A 3GQVA 4PGGA 4PZYA 3BWEA 2V7WA 5AQEA 3TQCA 3AILA 1GPBA 4RH1A 3NCTA 4Y0NA 3TMYA 4EG0A 4JYZA 5DEOA 2F1OA 1EVZA 1JDBB 2P6PA 4NONA 4WXPA 4PGFA 4R69A 1E62A 4ZHSA 4CXMA 1Z7BA 1QP4A 1AJEA 1PD0A 1XWWA 1FB5A 1MV5A 3AH8A 3NDIA 4ARZB 2EYQA 4AUNA 5AM3A 1V5GA 1OFUX 5CD9A 4M46A 1KEEB 4XTCS 2QZ9A 3WIVA 5FOUA 4E3WA 2NXNA 4KR2A 2GO7A 1K7FB 4BKMA 3VOSA 2VXCA 4AF8A 1K08A 1DQNA 3IV7A 1L4UA 2JEYA 1DXQA 1WUYA 4GQAA 4BMVA 2QJTA 2GNPA 1T8UA 4ALMA 3JW8A 2MSLA 4RCZA 4RLQA 1P2DA 1X7WB 4M1SA 3EZFA 1XROA 3E3OA 1NI4B 4KSYA 3OZ7A 1QK4A 4GLBA 3F3KA 1QS0B 1DCFA 3HGTA 5GGXA 1S3GA 1XZKA 3AEUA 3TRJA 5LQKA 1DO0A 1NC3A 5AKIA 5DLYA 2OC4A 3GLIA 1T3GA 1W8IA 3IYLW 2VRBA 4Q7EA 2BSQA 1RAFA 1GTZA 2ZANA 1ZGAA 2HNBA 1GNQA 1HETA 3BE6A 4V0QA 2WUWE 4BFUA 4JK3A 3HO6A 2AGVA 1Z88A 2C0QA 1BHQ1 4D42A 2QUZA 4EYOA 1QZZA 1S1CA 2I2WA 4L73A 5E3JA 5A5EA 4LNUB 3RYCB 1OB2A 4OQDA 1V41E 4ZYVA 3B85A 2Z6VA 3B6ZA 3G6WA 3ZY5A 1QCDA 4IDPA 1YCHA 1JZQA 1Q57A 4A5SA 1RHQA 1SKQA 2NO7A 4CKEA 3TECE 3QMWA 2ONZA 1V6CA 4URVR 1RCFA 4UM7A 3RVPA 2VUSA 5AVXA 5CVJA 4U9HS 1M6WA 4XXHA 2IF0A 1U02A 4QQFA 4A4DA 1QIKA 1KDZA 5ENVA 2VPTA 3RTEA 4CEHB 1YZQA 2WSBA 3B6MA 1BHO1 3PE4A 4O4HB 3AERB 2YWCA 2GEFA 1XALA 1YRHA 3WDSA 5BMVB 1G7TA 1VG8A 1XUOA 1T3TA 2BCJQ 2J9FB 3ACCA 5A9SB 3MMNA 3HPRA 1Q16A 2P3LA 2R79A 4ND8B 3R7AA 3TLCA 2HI0A 5KI6A 3WK4A 1X7XB 1FX1A 1XNJA 3GBSA 4NXMB 2AYZA 2RHMA 1Y89A 2AF4C 3LVBA 3R4CA 4YRPA 3F5MA 3P2OA 4Z4FA 4EUFA 2ZJ1A 1UCFA 4A0QA 3WHKA 3KB1A 3K0FA 5KYUB 4DAEA 1LNSA 1NR5A 2YHIB 1Z4NA 1BFUA 3OCZA 3Q0IA 2D7DA 3ZZMA 3CB4A 3D1VA 3DKRA 1HLFA 3TW6A 5FA8A 5CD1A 2V6IA 4H18A 2NXWA 2Q1TA 2DPXA 3R09A 2OHIA 3DKKA 4BP9A 1IC6A 1NU6A 1U9JA 3H6HA 1D1SA 4C2BA 5HS4A 3ZXXA 3I92A 5KYXA 1DO2A 3L7DA 4H60A 4YAGA 1F8GA 1NSYA 5FOQA 4DQDA 4IGFA 3PFWO 5KU1A 5EXEA 1XJWA 3QLUA 3RBXA 3RAPR 3PEYA 3ESQA 1TQ2A 4LI3X 3W77A 1IK4A 3KSRA 2CDBA 1XYVA 4BV2A 4Z53A 3BK7A 5LQMA 3WHLA 4UCQA 3IEMA 2QG6A 2MYUA 4FBGA 1GZHB 4P7BA 2BJVA 1WXQA 3EGEA 4FE3A 3NV9A 4QQ8A 2XE7A 5FUMA 5BN5A 4N0EA 2BP7A 1R15A 1WDTA 1R9GA 3DEFA 4KEAA 3HDGA 4NATA 2BI8A 2PWYA 1WA5A 1WBBA 1AO3A 4LYJA 4MO9A 4QE3A 2FPIA 2MWMA 4FYKA 3VZDA 2B5OA 4N12A 2E5FA 3A3NA 3BSFA 3U13A 2JHAA 2ZUBA 3JX9A 1GGVA 4AZ3A 1F7UA 4H7JA 2Y1CA 2G9ZA 4HP8A 4L3WA 1UZUA 1GZDA 1WBJB 2R6R1 3SGLA 2PWZA 3WWEA 4D0RA 3D0OA 2CNLA 4XWGA 2P78A 1YRQA 2VF5X 1H22A 1DBRA 4XWKA 2F1JA 2OQ2A 1WD7A 5IDXA 1WNFA 1P6QA 4TTSA 3AR9A 3X1KA 6YASA 1U28A 2WPDA 4UAJA 1OFTA 4QA9A 2PAAA 1UBLS 5FQNA 2NUBA 5LQAA 2QPTA 3PYLA 2QRJA 1ABBA 1N34B 4CIYA 1EYZA 4J1TA 3QUCA 2HZ7A 3L1JA 3LKDA 3OEED 1ONSA 1YRLA 3A1SA 1SIWA 1Z6YA 1SUIA 4KIUA 4YRCA 1OHHD 4W7IA 4HWSA 1DV2A 2NYRA 1YHYA 2QUAA 2GDJA 1FCJA 4PYQA 1GV1A 1KJ9A 3NETA 1NMXA 3GQBA 5FPSA 1YT5A 3DMRA 2HDHA 4JBYA 4RVGA 3GUUA 3OF5A 5C8YB 4UTZA 4TLDA 4A2WA 2B2XA 2WIDA 9ATCA 5EHZA 3BWXA 2EEZA 3WLTA 2QZSA 4G2TA 1KRHA 1A3CA 1MEOA 1YS4A 1BKDR 3FGPA 3IA7A 4QFBA 3O6VA 5IT9A 3ZY6A 1OIVA 1MMFB 3PJGA 4FDMA 1G21B 4OYYA 4YJFB 4KPFC 3T9BA 3TTWA 3LOPA 3E7PA 5C8DA 1LRJA 1KZ4A 5KPDA 3FGNA 3VTAA 3OZEA 2E85A 3VAAA 1H69A 2D5AA 1AGRA 1FIUA 1MTZA 1R4NA 5LZ7A 3ZH9B 2A9FA 2YMLA 4HZUB 1P5ZB 1DQPA 1AZTA 1CZUA 1MFPA 2QTVB 2WSIA 3DZJA 4I4LA 4INJA 1RAHA 3QENA 4BQFA 1JG1A 1KR5A 2RBKA 1XN1A 2FJPA 3CWCA 2G63A 4GPEA 3DOFA 5I7SA 4AF7A 1RYZA 3BRQA 4PCLA 2EHJA 2XA2A 3PUJA 1FC0A 4HVAA 5FTKA 4Q24A 3DV0A 1DIOB 2R751 1YS9A 3B9BA 1O9BA 2XA1A 5K0GA 4O2AA 4E7OA 3K0HA 2PZLA 2OYCA 3EWAA 2A67A 5FTLA 1G1AA 4E0BA 2BCGY 2F8SA 4G4SO 5A0VA 1NVWQ 2XGGA 2R6HA 1BN7A 1RQGA 3C6BA 2I33A 4ISBA 1IN1A 3MPOA 2BVNA 1FMJA 2GNAA 3VSCA 4EF6A 2R84A 2FG6C 4I1YA 1XEAA 1Y5IA 3SEQA 4JITA 2CB9A