5HA1A

Crystal structure of human cellular retinol binding protein 1 in complex with retinylamine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
b'PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinol-binding protein 1
publication title Ligand Binding Induces Conformational Changes in Human Cellular Retinol-binding Protein 1 (CRBP1) Revealed by Atomic Resolution Crystal Structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Retinol-binding protein
total genus 38
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2015-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5ha1A00
2QO5A 4QGWA 3NPOA 1YIVA 4HPBA 1ERXA 2JOZA 2LFOA 4BOEA 4DQ3A 2A0AA 1LIBA 4XMFA 1GT3A 1SY3A 2CZUA 2W2BA 1RLBE 4YKMA 3B2KA 4IB7A 1DV9A 5HTEA 3U9PC 1UREA 4YKOA 2A3FX 3P6HA 1ZNEA 3F9DA 1LIFA 2RCTA 4GNYA 4N7CA 1A2DA 2PY1A 3ZUOA 1O1VA 3MVFA 4Y0QA 1LIDA 4NNTA 1OEKA 2FTBA 4QYNA 4EXZA 1IFBA 3HWFA 3JSQA 1O1UA 1NGLA 2AT6X 1BRPA 4XMGA 3APUA 2HYSA 5LJGA 4EEJA 4OMXA 1TXLA 3WJDA 2WQAE 4YCEA 5F1EA 1I04A 3TGCA 1ADLA 2FR2A 2HZRA 3U0DA 2QO4A 1E02A 3ELXA 3WJEA 4YBPA 2N93A 1S2PA 3FW4A 5EDBA 1SY2A 1BSYA 5HA1A 1SY0A 1S44A 5BVQA 1GX9A 4EFGA 1G85A 1AVGI 1MDCA 1KT5A 1XCAA 2HNXA 1TW4A 3WJGA 3GAQA 5B29A 1EPAA 1DC9A 3PPTA 2FS6A 2WSJA 5HWZA 3VG4A 2CM9A 1QY0A 2ANSA 2Q39A 2WWPA 4AZOA 3KFGA 1MUPA 4XMHA 4TKJA 3FENA 3VG5A 4QZUA 4I3CA 5D8JA 1GT1A 5DG4A 4QAEA 4BQUA 2QM9A 4Y0PA 5FENA 2ASNX 3MBTA 2FLJA 3DSZA 3HWDA 1TVQA 1CRBA 4XMCA 3UEWA 3CR6A 3FEKA 4PSQA 1CBIA 4GKCA 2W2FA 5LJHA 1ICMA 2JU7A 2FWVA 2NNQA 1IW2A 1BRQA 4NNSA 1VPRA 3VG6A 4WFUA 2AT5X 3CBSA 4Y0SA 2R74A 3CQNA 1Z24A 5HA0A 3BSZE 2WEXA 3PECA 2A13A 3KFFA 4ZHCA 5LKEA 3HWGA 3IFBA 4ORWA 5F58A 5L8IA 1G74A 4A1YA 5LJDA 4QYPA 1QY2A 4YCHA 4QZTA 2P8GA 1T68X 1ZNDA 5F7GA 4ZHDA 4AZNA 3I0AA 2LBAA 1QY1A 4M6SA 2BLGA 4CK4A 3DTQA 3CQRA 1HMRA 4EDEA 1EPBA 2HMBA 1OEJA 1EW3A 4ORSA 1LNMA 1GKAA 1HMSA 1QWDA 5HCDC 1BJ7A 1KT4A 3C78X 1KZXA 4TQ2A 3NADA 4GE1A 5KHPA 4ZJ0A 5KIDA 4QGVA 3BS2A 3ZUIA 1N0SA 5EZ2A 1YWAA 2G7BA 1U0XA 4IMOA 1P6PA 2OFMX 1PEEA 1EIOA 2R73A 1PBOA 3APXA 5F6BA 3WBGA 5LJBA 3STKA 3APWA 5AQ6A 3PH5A 2K62A 2POAA 4ORYA 3FR2A 4A1HA 3FLLA 5HZ5A 1BSQA 5LJKA 2KTDA 1PMPA 4YGZA 3EBKA 4ZH9A 1JYDA 1GXAA 1EUOA 1XKIA 1D3SA 2CBSA 5HCEC 3SAOA 3TF6A 1X8NA 3Q6LA 1YP7A 3TZSA 5K06A 3BU1A 2EU7X 2AMMX 3F8AA 1LKEA 3TGBA 3APVA 1UZ2X 1X89A 1A3YA 1LFOA 5H9AA 1RBPA 3NX1A 1GGLA 3FR4A 1LIEA 2AH7X 1KGLA 5D45A 1CBQA 1FE3A 3O2YA 5EEEA 1CBRA 4HPDA 3NX2A 4ZHHA 1HBPA 2AL0X 2X45A 1JZUA 4I3BA 4O9SA 1B56A 4HPCA 1S7DA 2AT8X 4YDBA 4YMYA 1YP6A 1BSOA 4ORRA 3QKGA 2CM4A 4LZUA 3U03A 1YUPA 2JU8A 3P6GA 4MVKA 4RUNA 5FAZA 2FR3A 3O19A 4IB6A 5LJCA 1BLRA 4ORUA 5D47A 3EM0A 1YWDA 3FEPA 3KZAA 3P6CA 1EXSA 2NNEA 5EPQA 2FRSA 5BVTA 2NP1A 2WR6A 5LJEA 5H9NA 3D96A 4YBUA 2IFBA 3P6FA 3BU9A 4XMEA 3FA7A 1OBPA 1MX8A 1AELA 2L68A 2LBVA 1ZNLA 4A60A 4DQ4A 1FTPA 4OS8A 4AZRA 4IB9A 1IFCA 3HWEA 1BWYA 4GRJA 3FW5A 2AT0X 3ZQ3A 4M7MA 2WEWA 4N7DA 3FA9A 3VG3A 2AKQA 3NQ9A 2OVEA 4ZGUA 5D48A 5CE4A 1DZPA 4TNNA 2ALLX 2CBRA 4YFPA 1FDQA 5KICA 1E00A 3FR5A 1KOIA 1T0VA 1X8QA 2MO5A 3B2HA 1VYGA 5EDCA 5DPQA 1JYJA 4OMWA 2L5PA 3C77X 5B27A 3JS1A 1EIIA 3BY0A 3KFHA 4IBAA 1QG5A 2F73A 1KT6A 3C76X 4IMNA 1DZMA 1A18A 3FA6A 3HK1A 1O8VA 4ORXA 1ICNA 3VG2A 3VG7A 4WBKA 1KQWA 4HPAA 1B4MA 1MX7A 1JJXA 3UEXA 4ODDA 3ELZA 1KT3A 3NQ3A 5EEDA 4A8ZA 2WQ9A 3L4RA 2Q4NA 5IO5A 1GM6A 4RUUA 1YWBA 4YGGA 5L8NA 2FT9A 4IAWA 4YGHA 5HZ9A 2W2AA 1ZNGA 2GC9A 1CJ5A 1EQDA 1ALBA 2NNDA 1EALA 1B0OA 4AYHA 1OEEA 4I3DA 1TOWA 1E5PA 1QQSA 4ZR2A 2A2GA 3P6EA 3CMPA 1LPJA 3EBWA 1FENA 1SA8A 4LKTA 1AQBA 3AKMA 2OVAA 4NYRA 3WJCA 3PEDA 2LKKA 5H9KA 3BDRA 3RZYA 4R0BA 2L9CA 1ZNHA 2QOSC 3WJBA 1QFVA 4GETA 1OPBA 2ACPX 3NR3A 5F6ZA 5FFHA 4K19A 2RQ0A 1CBSA 2XSTA 4OS3A 4NLJA 1HQPA 2O62A 1VYFA 1SXUA 2XKLA 1QABE 4ES7A 3IA8A 4UU3A 4I9SA 1DF3A 1DZKA 3OJYC 1IIUA 1G7NA 3B2IA 4LZVA 1GT4A 5HZ8A 1YWCA 3KFIA 1PM1X 2KT4B 1KXOA 1X8PA 3RSWA 3EYCA 3EMMA 1GX8A 1AB0A 4YDAA 1ZNKA 5H9LA 1KQXA 4YH0A 2G78A 4XMDA 1SXXA 1ACDA 1MVGA 1OBUA 3O22A 4OS0A 2Q9SA 3WVMA 1ML7A 1DFVA 2Q2PA 3FELA 4AZQA 1JBHA 4IAXA 2HLVA 2X46A 3BLGA 1I4UA 1SXWA 2JN3A 4NYQA 2A2UA 1SXYA 2RD7C 2CZTA 5IO7A 1X8OA 3AKNA 4ALOA 5LKFA 4GNWA 5HZQA 1E06A 3PP6A 2GTFX 3P6DA 4NP1A 3PH6A 1X71A 4AW8A 5HZ6A 5H8TA 2HZQA 2DM5A 3WXQA 1X8UA 3CBCA 3UEUA 3S26A 4ZHGA 3B2JA 3I17A 3B2LA 1G5WA 1KZWA 2QO6A 3TGAA 1BM5A 2R56A 1ZRYA 4KIIA 2LB6A 1U18A 2Q2MA 3G7XA 4ALBA 1HBQA 4HFOA 2RCQA 4I9RA 1U17A 4AZPA 1IKEA 4QGXA 1T8VA 3D97A 2OVDA 2ACOA 4ZCBA 4GH7A 4TLJA 4WFVA 1OBQA 1LICA 4MVLA 4YFRA 2FS7A 3FMZA 1JJJA 3NP1A 3T1DA 2L67A 4YFQA 4MVIA 3BX8A 5HTDA 1I06A 4ZFXA 1QFTA 4Y0RA 1ERBA 1D2UA 1L6MA 1R0UA 2G79A 2MJIA 1FELA 2JU3A 5D4AA 5C0NA 4TKHA 4TJZA 1A57A 5HAEA 1NP1A 5BVSA 4NLIA 4D6BA 1FEMA 4TKBA 1GT5A 3STNA 4D6AA 1TOUA 1HN2A 3KQ0A 4LKPA 3STMX 3UEVA 3FA8A 3K3LA 1LF7A 3D95A 2MM3A 2OZQA 1OPAA 1BEBA 4IB8A 2K23A 2OFRX 1B8EA 1SY1A 2WUTA 4ZHFA 1BBPA 2E4JA 5HCCC 2AT3X 1H91A 1I05A 4BVMA 4UU2A 1HMTA 3BX7A 1GKAB 1KT7A 3BRNA 3FIQA 4ARHA 2RA6A 1JV4A 4AZMA 2GJ5A 5L8OA 5IO6A 3CWKA 2YG2A 5HBSA 1NP4A 3WJFA 1IKJA 4ZH6A 5JR8A 1DZJA
chains in the Genus database with same CATH superfamily
2UZ2A 2QO5A 2A8GA 4QGWA 3NPOA 2X34A 1YIVA 1SLFB 4HPBA 1ERXA 2JOZA 2LFOA 4GDAA 4CPHB 4BOEA 2MHDA 4O49A 1N4JA 4DQ3A 3RE5A 1STRB 2A0AA 1LIBA 4GDZA 4XMFA 1GT3A 1SY3A 2QOMA 3RE6A 4OEMA 2CZUA 3S5XA 2AVIA 2W2BA 4ZGFA 1RLBE 4YKMA 3B2KA 4IB7A 1DV9A 2GTLM 5HTEA 2PI3O 3U9PC 1UREA 4YKOA 1PTSA 2A3FX 1VWQB 3AEHA 3P6HA 1ZNEA 3F9DA 1LIFA 1SWAA 2RTNB 4O3ZA 5B11O 3T6LA 4L3RA 2RCTA 2IZHB 4GNYA 5BYPA 2X8SA 4GJVA 1AVEA 1A2DA 2PY1A 4N7CA 3ZUOA 1WUBA 1O1VA 3MVFA 4Y0QA 3T2XA 1LIDA 4NNTA 1OEKA 1SWFA 2FTBA 4QYNA 3RDQA 3RY1A 3E3CA 4BGFA 4CDEA 4EXZA 1IFBA 3HWFA 3JSQA 1O1UA 1DF8A 2HKDA 1NGLA 2AT6X 1BRPA 4XMGA 3T6FA 3APUA 2OL6O 2HYSA 5LJGA 4EEJA 4OMXA 1TXLA 3WJDA 2WQAE 4C5PA 4YCEA 5F1EA 1I04A 2RTBB 1ADLA 2FR2A 2HZRA 3U0DA 3RKGA 2QO4A 3TGCA 1E02A 3ELXA 3WJEA 1Y52X 3WZPA 2N93A 4YBPA 1S2PA 2FHLA 3CKGA 4I60A 1SWDA 3FW4A 4I95A 5EDBA 4Z2VA 1SY2A 1BSYA 5HA1A 1SY0A 3SLJA 1S44A 3D9WA 5BVQA 1GX9A 4EFGA 1JJUA 1G85A 1AVGI 1MDCA 4BX6A 1KT5A 4CDCA 1XCAA 2HNXA 1TW4A 3WOVA 3WJGA 3GAQA 1EI5A 5B29A 1EPAA 3HPEA 1DC9A 4IABA 3PPTA 1NDJA 1SWLA 2FS6A 1UYOX 2WSJA 5HWZA 3EC5A 2CM9A 3VG4A 1QY0A 2ANSA 2Q39A 2WWPA 4AZOA 5AEOA 3KFGA 1MUPA 4XMHA 4TKJA 3ZW0B 1KL4A 3FENA 3RY2A 3VG5A 4QZUA 4I3CA 2MWHA 5D8JA 1GT1A 5DG4A 4QAEA 4ON1A 4U8UO 4JO6A 2X4MA 4BQUA 4EKVA 5IRWA 1NBXA 2IZDB 2QM9A 4Y0PA 5FENA 2ASNX 3MBTA 2FLJA 2ZSCA 3DSZA 3HWDA 1TVQA 4KT5A 3LV4A 1LUQA 1CRBA 4XMCA 3UEWA 1VWIB 3CR6A 3FEKA 4PSQA 1CBIA 1OSPO 4Z27A 4CV7A 2RTDB 4GKCA 2W2FA 5LJHA 1WBIA 1ICMA 2JU7A 2FWVA 2NNQA 1IW2A 1LCZA 4GJSA 1BRQA 4NNSA 1K24A 1VPRA 3VG6A 4WFUA 3VU1A 2AT5X 3CBSA 1BM5A 2RTLA 4Y0SA 2R74A 3CQNA 1Z24A 5HA0A 3BSZE 2WEXA 3PECA 2A13A 3KFFA 2VFCA 4ZHCA 5LKEA 3HWGA 3WZQA 3IFBA 4ORWA 2X8TA 5F58A 5CSEA 5L8IA 1G74A 4A1YA 5LJDA 4QYPA 1QY2A 4YCHA 1SWCA 4QZTA 2P8GA 1T68X 1ZNDA 2BT9A 5F7GA 4ZHDA 4L1NA 2ZAGA 3PDFA 1SLEB 4AZNA 3I0AA 2LBAA 1QY1A 1KFFA 4ID2A 2BLGA 4M6SA 3DTQA 4QRLA 4CK4A 1RXHA 3CQRA 1HMRA 4NV7A 3VHHA 4NW4A 4EDEA 1SLDB 1EPBA 2F09A 2IZFB 2IZAA 3UAQA 2HMBA 1OEJA 2RN4A 1EW3A 2JMBA 1LNMA 1GKAA 1HMSA 2RTIB 4ORSA 2RTQB 1QWDA 1SWJA 1BJ7A 4U8UN 5HCDC 2RTKA 3PK2A 1KT4A 5L3YA 1SWQA 3C78X 1KZXA 4OKAA 4TQ2A 1VWGB 3NADA 4GD9A 4GE1A 5KHPA 4ZJ0A 4BX7B 5KIDA 4QGVA 3BS2A 3RDOA 3ZUIA 4O3WA 1N0SA 1Y53X 1YWAA 2G7BA 2YMSA 3AUMO 5EZ2A 1U0XA 1MM9A 4IMOA 1MOYA 1P6PA 2FHNX 1HXLA 2OFMX 1SWUA 2IZCB 2RTJA 2R73A 1PBOA 1PEEA 3APXA 4B55A 1EIOA 5F6BA 2GH7A 3WBGA 3RDSA 5LJBA 1HXZA 2DJFA 2BS6A 3APWA 5AQ6A 2FKGA 3PH5A 3STKA 2MF6A 4U9CA 4HWMA 1RXKA 2K62A 2POAA 4ORYA 3FR2A 4A1HA 3FLLA 4WHIA 5HZ5A 1BSQA 5LJKA 2KTDA 2C4IA 1PMPA 4YGZA 3EBKA 4JHQA 4ZH9A 1SRGA 3HOLA 2RTOB 1JYDA 1SRHA 4BBOA 1GXAA 1EUOA 1XKIA 3VHMA 1D3SA 2CBSA 5HCEC 3SAOA 3TF6A 1X8NA 3Q6LA 1YP7A 3D4RA 3TZSA 5K06A 3BU1A 2G8CO 2OYBO 3HOEA 4COTA 3ZW2A 1SWNA 2F01A 4KCAA 4KC7A 2EU7X 2AMMX 1SWPA 1Y9TA 2Z4IA 1LKEA 3F8AA 3TGBA 3APVA 1UZ2X 1X89A 1A3YA 1LFOA 5H9AA 1RBPA 3NX1A 5IXGA 1GGLA 3FR4A 3SLOA 1LIEA 3PQUA 2AH7X 4CDDA 5D45A 1CBQA 1KL5A 5F2BA 1KGLA 1FE3A 3O2YA 1VWRB 5B2AO 5EEEA 1CBRA 4HPDA 3NX2A 1N43A 4KH8A 3RBYA 3HTYA 4ZHHA 1HBPA 2AL0X 2BS5A 1SWBA 2X45A 1N9MA 4I3BA 4O9SA 1JZUA 1B56A 2RTGB 5CYBA 4HPCA 1S7DA 4BCSA 2AT8X 4BX5B 1N7YA 1SRJA 4YDBA 4YMYA 1VWCB 1YP6A 2RTPB 4JNJA 1BSOA 4ORRA 3QKGA 2CM4A 3ZW0A 4LZUA 3U03A 1KL3A 1STSB 4Z6JA 1YUPA 2JU8A 3P6GA 4MVKA 4RUNA 5FAZA 4CSBA 2C1SA 2FR3A 3O19A 3FIDA 4IB6A 5LJCA 1BLRA 4ORUA 5D47A 3RDXA 3EM0A 2LA7A 1YWDA 3FEPA 3KZAA 2OFAA 3ZWEA 3ZZVA 3P6CA 1EXSA 4GK9A 5FQ8E 2NNEA 5EPQA 2FRSA 5BVTA 2NP1A 2WR6A 5LJEA 5H9NA 4CDFA 2FKJA 3D96A 4YBUA 5B3MO 2IFBA 2RTCB 1VWBB 3BU9A 2WPUA 3P6FA 3RDMA 4XMEA 3FA7A 1OBPA 1MX8A 1Y9LA 2OFBA 4CPFA 1AELA 2L68A 1JMXA 3SZJA 4U46A 2LBVA 1ZNLA 3VGWA 3CKFA 4A60A 4DQ4A 1FJ1E 1FTPA 4INNA 4OS8A 4AZRA 4IB9A 1RXJA 3F6ZB 1IFCA 3HWEA 1BWYA 4GRJA 3X00A 3FW5A 2KD2A 1VWEB 2AT0X 3ZQ3A 4M7MA 3PQSA 3VHIA 2WEWA 5IRAA 1NQMA 4U8UM 4N7DA 3FA9A 3V8UA 3VG3A 2AKQA 3NQ9A 3RWXA 2OVEA 4ZGUA 5D48A 4GGZA 3OD9A 1SRFA 5CE4A 3RDUA 1HQQA 2RTHB 1DZPA 3N91A 1I78A 4TNNA 3GE2A 1IJ8A 1N9YA 2ALLX 2CBRA 2FGSA 1FDQA 4YFPA 2BC3A 1LCVA 1SWRA 3MG5A 3ZW1B 2JGSA 5KICA 2IZGB 1E00A 2G5LA 1NQNA 1VWFB 2M4LA 2VFBA 1KOIA 1T0VA 3FR5A 4CPEA 1X8QA 4Z2OA 3P24A 4KC8A 1LCWA 2MO5A 1VYGA 3B2HA 5EDCA 5FQ6E 5K68A 4FBOA 2OY5O 5DPQA 1JYJA 4BX7A 4OMWA 2L5PA 2I5VO 3WZOA 2JW1A 2IZKA 3C77X 4GZVA 5B27A 3JS1A 4Z2PA 1EIIA 2CAMA 3BY0A 2AF5A 2Y32A 3KFHA 4IBAA 1QG5A 2F73A 1KT6A 3C76X 4IMNA 1DZMA 1VWJB 1A18A 1AVDA 3FA6A 3HK1A 1O8VA 4ORXA 1ICNA 4I6SA 3VG2A 3VG7A 4WBKA 1KQWA 4HPAA 4Y5DA 1B4MA 1GX3A 1MX7A 3VE1A 1JJXA 3UEXA 4ODDA 3ELZA 1KT3A 3NQ3A 5EEDA 1VWAB 4A8ZA 2WQ9A 3L4RA 2Q4NA 1MK5A 1SLGB 4NV8A 5IO5A 1NC9A 1GM6A 4RUUA 1YWBA 4FGIB 1UYNX 4YGGA 5L8NA 4Z28A 3NBXX 2FT9A 4IAWA 4YGHA 5HZ9A 2QMIA 4GU8A 2W2AA 4OELA 1ZNGA 2BSZA 2GC9A 1EQDA 1CJ5A 1ALBA 2NNDA 2Y3EA 1EALA 1B0OA 1SREA 4AYHA 1OEEA 3SOTA 1Y55X 4I3DA 4CPIA 1TOWA 1E5PA 1QQSA 2RTFB 1SWEA 4ZR2A 2A2GA 3P6EA 3LHNA 1Y0GA 3CMPA 4CPHA 1LPJA 2GTLO 3EBWA 1FENA 1SA8A 5B10O 4O4XA 4LKTA 2OL8O 1W6FA 1AQBA 3AKMA 2OVAA 2OY1O 4NYRA 1JIWI 3PEDA 3WJCA 2LKKA 5H9KA 3BDRA 3RZYA 4R0BA 2L9CA 1ZNHA 2QOSC 3WJBA 1QFVA 4GETA 1OPBA 2ACPX 2OL7A 3NR3A 1VWDB 5F6ZA 4K19A 5FFHA 1SWGA 2RQ0A 3FYFA 4EQAC 1CBSA 1RSTB 1VWKB 2XSTA 4OS3A 4NLJA 1HQPA 2O62A 1VYFA 2X32A 1SXUA 2XKLA 4BX5A 1QABE 4ES7A 3IA8A 4UU3A 4I9SA 4GGTA 1DF3A 1DZKA 1W4TA 1IIUA 2X56A 1G7NA 3OJYC 3B2IA 3EW2A 1GT4A 4LZVA 5HZ8A 1YWCA 3S5VA 3KFIA 5FQ7E 1PM1X 1RAVA 2KT4B 1KXOA 1X8PA 3RSWA 3EYCA 3EMMA 1GX8A 1AB0A 4YDAA 1ZNKA 1RSUB 5H9LA 5B5FA 5CHKA 1KQXA 4YH0A 2G78A 4XMDA 1SRIA 1SXXA 1ACDA 4QNIA 1MVGA 1OBUA 3O22A 4OS0A 2Q9SA 3WVMA 1ML7A 1DFVA 2Q2PA 3FELA 5IRUA 4AZQA 4IAXA 1JBHA 2Y3FA 2OF9A 2HLVA 1VWLB 3T2WA 3Q34A 2X46A 4MISA 5AJCA 3BLGA 3VE2A 1I4UA 2GTLN 1SXWA 2JN3A 4NYQA 2A2UA 4FBRA 1SXYA 2RD7C 2CZTA 1VWNB 5IO7A 1X8OA 3AKNA 1SWTA 3OE3A 4ALOA 5LKFA 4GNWA 4FQBB 2IZIA 1E06A 2RTEB 3P02A 2GTFX 3P6DA 3PP6A 3OBLA 5HZQA 3WZNA 2IZEB 4IRWA 3SLTA 2RTMA 1HY2A 4NP1A 2X55A 3PH6A 2C1QA 1X71A 3WYQA 4AW8A 5H8TA 5HZ6A 2A5CA 2HZQA 2DM5A 1VWMB 1JMZA 3WXQA 1X8UA 2RTRB 3CBCA 3NQKA 3UEUA 4MVEA 4O4OA 3S26A 1I9HA 4ZHGA 3B2JA 3I17A 3B2LA 1G5WA 1KZWA 2QO6A 3TGAA 4BX6B 1SWSA 1ZRYA 2R56A 2LB6A 4KIIA 1W5RA 4PJ2A 1U18A 2Q2MA 2IZBA 3ZW1A 3EW1A 3VPJE 3G7XA 1E2TA 4ALBA 1LDQA 4DCBA 3SZHA 3WYPA 1PBYA 1HBQA 4HFOA 2RCQA 4I9RA 4O3YA 1U17A 4AZPA 4JGLA 1IKEA 4QGXA 4BJ8A 3FDCA 1T8VA 2KTSA 3D97A 2OVDA 2ACOA 4ZCBA 1K3BA 4GH7A 4TLJA 4WFVA 1OBQA 1LICA 4MVLA 4YFRA 2FS7A 2IZLB 3FMZA 3KVNA 1JJJA 3NP1A 1MEPA 2L67A 3T1DA 2UYWA 4YFQA 4MVIA 3BX8A 5K67A 3SZIA 5HTDA 1I06A 2RTAA 2OY8A 2DJGA 1VYOA 4ZFXA 4MEEA 1QFTA 2OF8A 4Y0RA 1ERBA 1D2UA 1L6MA 2OY7A 5AJBA 1VWOB 1R0UA 2G79A 2MJIA 1FELA 2JU3A 5D4AA 5C0NA 4TKHA 4TJZA 1A57A 3MM0A 1SMPI 5HAEA 1NP1A 2VDFA 4O4UA 5BVSA 3S60A 4NLIA 3H3IA 4U3QA 1FEMA 4O3XB 4D6BA 1JQPA 4TKBA 1GT5A 1SWOA 2ZAIA 3QQ2A 1STPA 3STNA 4GUZA 4D6AA 1TOUA 3LTWA 4QQ1A 1HN2A 2KW1A 1LDOA 2OVSA 3KQ0A 4LKPA 3STMX 3UEVA 3FA8A 5JD2A 1VWHB 3K3LA 2X8FA 4YVBA 1LF7A 3D95A 2MM3A 2OZQA 1OPAA 1BEBA 4IB8A 4MIRA 2K23A 2OFRX 1B8EA 1SY1A 2WUTA 2QCBA 4ZHFA 4Y59A 4O4SA 1BBPA 2E4JA 5HCCC 2AT3X 4DNEA 1H91A 1I05A 4FBVA 4BVMA 1LELA 4UU2A 1HMTA 1VWPB 1SWHA 2I5ZO 3BX7A 5B5GA 1SWKA 4GGRA 1GKAB 1KT7A 3BRNA 3FIQA 4ARHA 4LQZA 2RA6A 2A5BA 1JV4A 4AZMA 2GJ5A 4ML7B 2BHVA 5L8OA 5IO6A 3MX7A 3CWKA 2YG2A 3ZI8A 5HBSA 1NP4A 3JQOA 3WJFA 1IKJA 4ZH6A 2Z4HA 2IZJA 5JR8A 1DZJA
chains in the Genus database with same CATH topology
2QO5A 4QGWA 3NPOA 1YIVA 4HPBA 1ERXA 2JOZA 2LFOA 4BOEA 2MHDA 4O49A 4DQ3A 2A0AA 1LIBA 4GDZA 4XMFA 1GT3A 1SY3A 3S5XA 2CZUA 2W2BA 4ZGFA 1RLBE 4YKMA 3B2KA 4IB7A 1DV9A 2GTLM 5HTEA 3U9PC 1UREA 4YKOA 2A3FX 3P6HA 1ZNEA 3F9DA 1LIFA 4O3ZA 4L3RA 2RCTA 4GNYA 5BYPA 2X8SA 4N7CA 1A2DA 2PY1A 3ZUOA 1O1VA 3MVFA 4Y0QA 1LIDA 4NNTA 1OEKA 2FTBA 4QYNA 3E3CA 4EXZA 1IFBA 3HWFA 3JSQA 1O1UA 1NGLA 2AT6X 1BRPA 4XMGA 3APUA 2HYSA 5LJGA 4EEJA 4OMXA 1TXLA 3WJDA 2WQAE 4YCEA 5F1EA 1I04A 3TGCA 1ADLA 2FR2A 2HZRA 3U0DA 3RKGA 2QO4A 1E02A 3ELXA 3WJEA 4YBPA 2N93A 1S2PA 4I95A 3FW4A 5EDBA 1SY2A 1BSYA 5HA1A 1SY0A 1S44A 5BVQA 1GX9A 4EFGA 1G85A 1AVGI 1MDCA 1KT5A 1XCAA 2HNXA 1TW4A 3WOVA 3WJGA 3GAQA 1EI5A 5B29A 1EPAA 1DC9A 4IABA 3PPTA 2FS6A 2WSJA 5HWZA 3VG4A 2CM9A 1QY0A 2ANSA 2Q39A 2WWPA 4AZOA 5AEOA 3KFGA 1MUPA 4XMHA 4TKJA 3ZW0B 3FENA 3VG5A 4QZUA 4I3CA 2MWHA 5D8JA 1GT1A 5DG4A 4QAEA 4ON1A 4U8UO 4BQUA 2QM9A 4Y0PA 5FENA 2ASNX 3MBTA 2FLJA 3DSZA 3HWDA 1TVQA 4KT5A 3LV4A 1CRBA 4XMCA 3UEWA 3CR6A 3FEKA 4PSQA 1CBIA 4CV7A 4GKCA 2W2FA 5LJHA 1ICMA 2JU7A 2FWVA 2NNQA 1IW2A 1BRQA 4NNSA 1VPRA 3VG6A 4WFUA 3VU1A 2AT5X 3CBSA 4Y0SA 2R74A 3CQNA 1Z24A 5HA0A 3BSZE 2WEXA 3PECA 2A13A 3KFFA 4ZHCA 5LKEA 3HWGA 3IFBA 4ORWA 2X8TA 5F58A 5L8IA 1G74A 4A1YA 5LJDA 4QYPA 1QY2A 4YCHA 4QZTA 2P8GA 1T68X 1ZNDA 2BT9A 5F7GA 4ZHDA 4L1NA 2ZAGA 4AZNA 3I0AA 2LBAA 1QY1A 4M6SA 4ID2A 2BLGA 4QRLA 3DTQA 4CK4A 3CQRA 1HMRA 4NW4A 4EDEA 1EPBA 2F09A 3UAQA 2HMBA 1OEJA 2RN4A 1EW3A 2JMBA 1LNMA 1GKAA 1HMSA 4ORSA 4FBRA 1QWDA 4U8UN 1BJ7A 5HCDC 1KT4A 3C78X 1KZXA 4TQ2A 3NADA 4GE1A 5KHPA 4ZJ0A 5KIDA 4QGVA 3BS2A 3ZUIA 4O3WA 1N0SA 2YMSA 1YWAA 2G7BA 5EZ2A 1U0XA 4IMOA 1P6PA 2OFMX 1PEEA 1EIOA 2R73A 1PBOA 3APXA 5F6BA 3WBGA 5LJBA 3STKA 2BS6A 3APWA 5AQ6A 3PH5A 4U9CA 4HWMA 2K62A 2POAA 4ORYA 3FR2A 4A1HA 3FLLA 4WHIA 5HZ5A 1BSQA 5LJKA 2KTDA 1PMPA 4YGZA 3EBKA 4ZH9A 3HOLA 1JYDA 1GXAA 1EUOA 1XKIA 1D3SA 2CBSA 5HCEC 3SAOA 3TF6A 1X8NA 3Q6LA 1YP7A 3D4RA 3TZSA 5K06A 3BU1A 3HOEA 4COTA 3ZW2A 4KCAA 4KC7A 2EU7X 2AMMX 1Y9TA 2Z4IA 1LKEA 3F8AA 3TGBA 3APVA 1UZ2X 1X89A 1A3YA 1LFOA 5H9AA 1RBPA 3NX1A 1GGLA 3FR4A 1LIEA 3PQUA 2AH7X 1KGLA 5D45A 1CBQA 1FE3A 3O2YA 5EEEA 1CBRA 4HPDA 3NX2A 4KH8A 3RBYA 3HTYA 4ZHHA 1HBPA 2AL0X 2BS5A 2X45A 4I3BA 1JZUA 4O9SA 1B56A 5CYBA 4HPCA 1S7DA 2AT8X 4YDBA 4YMYA 1YP6A 1BSOA 4ORRA 3QKGA 2CM4A 3ZW0A 4LZUA 3U03A 1YUPA 2JU8A 3P6GA 4MVKA 4RUNA 5FAZA 4CSBA 2FR3A 3O19A 4IB6A 5LJCA 1BLRA 4ORUA 5D47A 3EM0A 2LA7A 1YWDA 3FEPA 3KZAA 3ZWEA 3ZZVA 3P6CA 1EXSA 4GK9A 5FQ8E 2NNEA 5EPQA 2FRSA 5BVTA 2NP1A 2WR6A 5LJEA 5H9NA 3D96A 4YBUA 2IFBA 3P6FA 3BU9A 4XMEA 3FA7A 1OBPA 1MX8A 1Y9LA 1AELA 2L68A 2LBVA 1ZNLA 4A60A 4DQ4A 1FTPA 4INNA 4OS8A 4AZRA 4IB9A 3F6ZB 1IFCA 3HWEA 1BWYA 4GRJA 3FW5A 2KD2A 2AT0X 3ZQ3A 4M7MA 3PQSA 2WEWA 4U8UM 4N7DA 3FA9A 3V8UA 3VG3A 2AKQA 3NQ9A 3RWXA 2OVEA 4ZGUA 5D48A 3OD9A 5CE4A 1DZPA 3N91A 4TNNA 3GE2A 2ALLX 2CBRA 4YFPA 1FDQA 3ZW1B 5KICA 2M4LA 1E00A 3FR5A 1KOIA 1T0VA 1X8QA 3P24A 4KC8A 2MO5A 3B2HA 1VYGA 5EDCA 5FQ6E 4FBOA 5DPQA 1JYJA 4OMWA 2L5PA 2JW1A 4GZVA 3C77X 5B27A 3JS1A 1EIIA 3BY0A 3KFHA 4IBAA 1QG5A 2F73A 1KT6A 3C76X 4IMNA 1DZMA 1A18A 3FA6A 3HK1A 1O8VA 4ORXA 1ICNA 4I6SA 3VG2A 3VG7A 4WBKA 1KQWA 4HPAA 1B4MA 3VE1A 1MX7A 1JJXA 3UEXA 4ODDA 3ELZA 1KT3A 3NQ3A 5EEDA 4A8ZA 2WQ9A 3L4RA 2Q4NA 5IO5A 1GM6A 4RUUA 1YWBA 4FGIB 4YGGA 5L8NA 3NBXX 2FT9A 4IAWA 4YGHA 5HZ9A 2QMIA 4GU8A 2W2AA 1ZNGA 2GC9A 1CJ5A 1EQDA 1ALBA 2NNDA 1EALA 1B0OA 4AYHA 1OEEA 3SOTA 4I3DA 1TOWA 1E5PA 1QQSA 4ZR2A 2A2GA 3P6EA 3LHNA 3CMPA 1LPJA 2GTLO 3EBWA 1FENA 1SA8A 4O4XA 4LKTA 1AQBA 3AKMA 2OVAA 4NYRA 1JIWI 3PEDA 3WJCA 2LKKA 5H9KA 3BDRA 3RZYA 4R0BA 2L9CA 1ZNHA 2QOSC 3WJBA 1QFVA 4GETA 1OPBA 2ACPX 3NR3A 5F6ZA 4EQAC 5FFHA 4K19A 2RQ0A 3FYFA 1CBSA 2XSTA 4OS3A 4NLJA 1HQPA 2O62A 1VYFA 1SXUA 2XKLA 1QABE 4ES7A 3IA8A 4UU3A 4I9SA 1DF3A 1DZKA 3OJYC 1IIUA 1G7NA 3B2IA 4LZVA 1GT4A 5HZ8A 1YWCA 3S5VA 3KFIA 5FQ7E 1PM1X 2KT4B 1KXOA 1X8PA 3RSWA 3EYCA 3EMMA 1GX8A 1AB0A 4YDAA 1ZNKA 5H9LA 1KQXA 4YH0A 2G78A 4XMDA 1SXXA 1ACDA 4QNIA 1MVGA 1OBUA 3O22A 4OS0A 2Q9SA 3WVMA 1ML7A 1DFVA 2Q2PA 3FELA 4AZQA 1JBHA 4IAXA 2HLVA 2X46A 4MISA 5AJCA 3BLGA 3VE2A 1I4UA 2GTLN 1SXWA 2JN3A 4NYQA 2A2UA 1SXYA 2RD7C 2CZTA 5IO7A 1X8OA 3AKNA 3OE3A 4ALOA 5LKFA 4GNWA 4FQBB 3P02A 1E06A 5HZQA 3PP6A 2GTFX 3P6DA 3OBLA 4NP1A 3PH6A 1X71A 4AW8A 5HZ6A 5H8TA 2HZQA 2DM5A 3WXQA 1X8UA 3CBCA 3NQKA 3UEUA 4MVEA 4O4OA 3S26A 4ZHGA 3B2JA 3I17A 3B2LA 1G5WA 1KZWA 2QO6A 3TGAA 1BM5A 2R56A 1ZRYA 4KIIA 2LB6A 4PJ2A 1U18A 2Q2MA 3ZW1A 3VPJE 3G7XA 4ALBA 1HBQA 4HFOA 2RCQA 4I9RA 4O3YA 1U17A 4AZPA 4JGLA 1IKEA 4QGXA 1T8VA 2KTSA 3D97A 2OVDA 2ACOA 4ZCBA 4GH7A 4TLJA 4WFVA 1OBQA 1LICA 4MVLA 4YFRA 2FS7A 3FMZA 1JJJA 3NP1A 3T1DA 2L67A 4YFQA 4MVIA 3BX8A 5HTDA 1I06A 4ZFXA 1QFTA 4Y0RA 1ERBA 1D2UA 1L6MA 5AJBA 1R0UA 2G79A 2MJIA 1FELA 2JU3A 5D4AA 5C0NA 4TKHA 4TJZA 1A57A 1SMPI 5HAEA 1NP1A 4O4UA 5BVSA 3S60A 4NLIA 3H3IA 4U3QA 1FEMA 4O3XB 4D6BA 4TKBA 1GT5A 2ZAIA 3STNA 4D6AA 1TOUA 4QQ1A 1HN2A 2KW1A 2OVSA 3KQ0A 4LKPA 3STMX 3UEVA 3FA8A 3K3LA 2X8FA 1LF7A 3D95A 2MM3A 2OZQA 1OPAA 1BEBA 4IB8A 4MIRA 2K23A 2OFRX 1B8EA 1SY1A 2WUTA 4ZHFA 4O4SA 1BBPA 2E4JA 5HCCC 2AT3X 1H91A 1I05A 4FBVA 4BVMA 4UU2A 1HMTA 3BX7A 1GKAB 1KT7A 3BRNA 3FIQA 4ARHA 4LQZA 2RA6A 1JV4A 4AZMA 2GJ5A 4ML7B 2BHVA 5L8OA 5IO6A 3MX7A 3CWKA 2YG2A 3ZI8A 5HBSA 1NP4A 3JQOA 3WJFA 1IKJA 4ZH6A 2Z4HA 5JR8A 1DZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QO5 A;  4QGW A;  3NPO A;  1YIV A;  4HPB A;  1ERX A;  2JOZ A;  2LFO A;  4BOE A;  4DQ3 A;  2A0A A;  1LIB A;  4XMF A;  1GT3 A;  1SY3 A;  2CZU A;  2W2B A;  1RLB E;  4YKM A;  3B2K A;  4IB7 A;  1DV9 A;  5HTE A;  3U9P C;  1URE A;  4YKO A;  2A3F X;  3P6H A;  1ZNE A;  3F9D A;  1LIF A;  2RCT A;  4GNY A;  4N7C A;  1A2D A;  2PY1 A;  3ZUO A;  1O1V A;  3MVF A;  4Y0Q A;  1LID A;  4NNT A;  1OEK A;  2FTB A;  4QYN A;  4EXZ A;  1IFB A;  3HWF A;  3JSQ A;  1O1U A;  1NGL A;  2AT6 X;  1BRP A;  4XMG A;  3APU A;  2HYS A;  5LJG A;  4EEJ A;  4OMX A;  1TXL A;  3WJD A;  2WQA E;  4YCE A;  5F1E A;  1I04 A;  3TGC A;  1ADL A;  2FR2 A;  2HZR A;  3U0D A;  2QO4 A;  1E02 A;  3ELX A;  3WJE A;  4YBP A;  2N93 A;  1S2P A;  3FW4 A;  5EDB A;  1SY2 A;  1BSY A;  5HA1 A;  1SY0 A;  1S44 A;  5BVQ A;  1GX9 A;  4EFG A;  1G85 A;  1AVG I;  1MDC A;  1KT5 A;  1XCA A;  2HNX A;  1TW4 A;  3WJG A;  3GAQ A;  5B29 A;  1EPA A;  1DC9 A;  3PPT A;  2FS6 A;  2WSJ A;  5HWZ A;  3VG4 A;  2CM9 A;  1QY0 A;  2ANS A;  2Q39 A;  2WWP A;  4AZO A;  3KFG A;  1MUP A;  4XMH A;  4TKJ A;  3FEN A;  3VG5 A;  4QZU A;  4I3C A;  5D8J A;  1GT1 A;  5DG4 A;  4QAE A;  4BQU A;  2QM9 A;  4Y0P A;  5FEN A;  2ASN X;  3MBT A;  2FLJ A;  3DSZ A;  3HWD A;  1TVQ A;  1CRB A;  4XMC A;  3UEW A;  3CR6 A;  3FEK A;  4PSQ A;  1CBI A;  4GKC A;  2W2F A;  5LJH A;  1ICM A;  2JU7 A;  2FWV A;  2NNQ A;  1IW2 A;  1BRQ A;  4NNS A;  1VPR A;  3VG6 A;  4WFU A;  2AT5 X;  3CBS A;  4Y0S A;  2R74 A;  3CQN A;  1Z24 A;  5HA0 A;  3BSZ E;  2WEX A;  3PEC A;  2A13 A;  3KFF A;  4ZHC A;  5LKE A;  3HWG A;  3IFB A;  4ORW A;  5F58 A;  5L8I A;  1G74 A;  4A1Y A;  5LJD A;  4QYP A;  1QY2 A;  4YCH A;  4QZT A;  2P8G A;  1T68 X;  1ZND A;  5F7G A;  4ZHD A;  4AZN A;  3I0A A;  2LBA A;  1QY1 A;  4M6S A;  2BLG A;  4CK4 A;  3DTQ A;  3CQR A;  1HMR A;  4EDE A;  1EPB A;  2HMB A;  1OEJ A;  1EW3 A;  4ORS A;  1LNM A;  1GKA A;  1HMS A;  1QWD A;  5HCD C;  1BJ7 A;  1KT4 A;  3C78 X;  1KZX A;  4TQ2 A;  3NAD A;  4GE1 A;  5KHP A;  4ZJ0 A;  5KID A;  4QGV A;  3BS2 A;  3ZUI A;  1N0S A;  5EZ2 A;  1YWA A;  2G7B A;  1U0X A;  4IMO A;  1P6P A;  2OFM X;  1PEE A;  1EIO A;  2R73 A;  1PBO A;  3APX A;  5F6B A;  3WBG A;  5LJB A;  3STK A;  3APW A;  5AQ6 A;  3PH5 A;  2K62 A;  2POA A;  4ORY A;  3FR2 A;  4A1H A;  3FLL A;  5HZ5 A;  1BSQ A;  5LJK A;  2KTD A;  1PMP A;  4YGZ A;  3EBK A;  4ZH9 A;  1JYD A;  1GXA A;  1EUO A;  1XKI A;  1D3S A;  2CBS A;  5HCE C;  3SAO A;  3TF6 A;  1X8N A;  3Q6L A;  1YP7 A;  3TZS A;  5K06 A;  3BU1 A;  2EU7 X;  2AMM X;  3F8A A;  1LKE A;  3TGB A;  3APV A;  1UZ2 X;  1X89 A;  1A3Y A;  1LFO A;  5H9A A;  1RBP A;  3NX1 A;  1GGL A;  3FR4 A;  1LIE A;  2AH7 X;  1KGL A;  5D45 A;  1CBQ A;  1FE3 A;  3O2Y A;  5EEE A;  1CBR A;  4HPD A;  3NX2 A;  4ZHH A;  1HBP A;  2AL0 X;  2X45 A;  1JZU A;  4I3B A;  4O9S A;  1B56 A;  4HPC A;  1S7D A;  2AT8 X;  4YDB A;  4YMY A;  1YP6 A;  1BSO A;  4ORR A;  3QKG A;  2CM4 A;  4LZU A;  3U03 A;  1YUP A;  2JU8 A;  3P6G A;  4MVK A;  4RUN A;  5FAZ A;  2FR3 A;  3O19 A;  4IB6 A;  5LJC A;  1BLR A;  4ORU A;  5D47 A;  3EM0 A;  1YWD A;  3FEP A;  3KZA A;  3P6C A;  1EXS A;  2NNE A;  5EPQ A;  2FRS A;  5BVT A;  2NP1 A;  2WR6 A;  5LJE A;  5H9N A;  3D96 A;  4YBU A;  2IFB A;  3P6F A;  3BU9 A;  4XME A;  3FA7 A;  1OBP A;  1MX8 A;  1AEL A;  2L68 A;  2LBV A;  1ZNL A;  4A60 A;  4DQ4 A;  1FTP A;  4OS8 A;  4AZR A;  4IB9 A;  1IFC A;  3HWE A;  1BWY A;  4GRJ A;  3FW5 A;  2AT0 X;  3ZQ3 A;  4M7M A;  2WEW A;  4N7D A;  3FA9 A;  3VG3 A;  2AKQ A;  3NQ9 A;  2OVE A;  4ZGU A;  5D48 A;  5CE4 A;  1DZP A;  4TNN A;  2ALL X;  2CBR A;  4YFP A;  1FDQ A;  5KIC A;  1E00 A;  3FR5 A;  1KOI A;  1T0V A;  1X8Q A;  2MO5 A;  3B2H A;  1VYG A;  5EDC A;  5DPQ A;  1JYJ A;  4OMW A;  2L5P A;  3C77 X;  5B27 A;  3JS1 A;  1EII A;  3BY0 A;  3KFH A;  4IBA A;  1QG5 A;  2F73 A;  1KT6 A;  3C76 X;  4IMN A;  1DZM A;  1A18 A;  3FA6 A;  3HK1 A;  1O8V A;  4ORX A;  1ICN A;  3VG2 A;  3VG7 A;  4WBK A;  1KQW A;  4HPA A;  1B4M A;  1MX7 A;  1JJX A;  3UEX A;  4ODD A;  3ELZ A;  1KT3 A;  3NQ3 A;  5EED A;  4A8Z A;  2WQ9 A;  3L4R A;  2Q4N A;  5IO5 A;  1GM6 A;  4RUU A;  1YWB A;  4YGG A;  5L8N A;  2FT9 A;  4IAW A;  4YGH A;  5HZ9 A;  2W2A A;  1ZNG A;  2GC9 A;  1CJ5 A;  1EQD A;  1ALB A;  2NND A;  1EAL A;  1B0O A;  4AYH A;  1OEE A;  4I3D A;  1TOW A;  1E5P A;  1QQS A;  4ZR2 A;  2A2G A;  3P6E A;  3CMP A;  1LPJ A;  3EBW A;  1FEN A;  1SA8 A;  4LKT A;  1AQB A;  3AKM A;  2OVA A;  4NYR A;  3WJC A;  3PED A;  2LKK A;  5H9K A;  3BDR A;  3RZY A;  4R0B A;  2L9C A;  1ZNH A;  2QOS C;  3WJB A;  1QFV A;  4GET A;  1OPB A;  2ACP X;  3NR3 A;  5F6Z A;  5FFH A;  4K19 A;  2RQ0 A;  1CBS A;  2XST A;  4OS3 A;  4NLJ A;  1HQP A;  2O62 A;  1VYF A;  1SXU A;  2XKL A;  1QAB E;  4ES7 A;  3IA8 A;  4UU3 A;  4I9S A;  1DF3 A;  1DZK A;  3OJY C;  1IIU A;  1G7N A;  3B2I A;  4LZV A;  1GT4 A;  5HZ8 A;  1YWC A;  3KFI A;  1PM1 X;  2KT4 B;  1KXO A;  1X8P A;  3RSW A;  3EYC A;  3EMM A;  1GX8 A;  1AB0 A;  4YDA A;  1ZNK A;  5H9L A;  1KQX A;  4YH0 A;  2G78 A;  4XMD A;  1SXX A;  1ACD A;  1MVG A;  1OBU A;  3O22 A;  4OS0 A;  2Q9S A;  3WVM A;  1ML7 A;  1DFV A;  2Q2P A;  3FEL A;  4AZQ A;  1JBH A;  4IAX A;  2HLV A;  2X46 A;  3BLG A;  1I4U A;  1SXW A;  2JN3 A;  4NYQ A;  2A2U A;  1SXY A;  2RD7 C;  2CZT A;  5IO7 A;  1X8O A;  3AKN A;  4ALO A;  5LKF A;  4GNW A;  5HZQ A;  1E06 A;  3PP6 A;  2GTF X;  3P6D A;  4NP1 A;  3PH6 A;  1X71 A;  4AW8 A;  5HZ6 A;  5H8T A;  2HZQ A;  2DM5 A;  3WXQ A;  1X8U A;  3CBC A;  3UEU A;  3S26 A;  4ZHG A;  3B2J A;  3I17 A;  3B2L A;  1G5W A;  1KZW A;  2QO6 A;  3TGA A;  1BM5 A;  2R56 A;  1ZRY A;  4KII A;  2LB6 A;  1U18 A;  2Q2M A;  3G7X A;  4ALB A;  1HBQ A;  4HFO A;  2RCQ A;  4I9R A;  1U17 A;  4AZP A;  1IKE A;  4QGX A;  1T8V A;  3D97 A;  2OVD A;  2ACO A;  4ZCB A;  4GH7 A;  4TLJ A;  4WFV A;  1OBQ A;  1LIC A;  4MVL A;  4YFR A;  2FS7 A;  3FMZ A;  1JJJ A;  3NP1 A;  3T1D A;  2L67 A;  4YFQ A;  4MVI A;  3BX8 A;  5HTD A;  1I06 A;  4ZFX A;  1QFT A;  4Y0R A;  1ERB A;  1D2U A;  1L6M A;  1R0U A;  2G79 A;  2MJI A;  1FEL A;  2JU3 A;  5D4A A;  5C0N A;  4TKH A;  4TJZ A;  1A57 A;  5HAE A;  1NP1 A;  5BVS A;  4NLI A;  4D6B A;  1FEM A;  4TKB A;  1GT5 A;  3STN A;  4D6A A;  1TOU A;  1HN2 A;  3KQ0 A;  4LKP A;  3STM X;  3UEV A;  3FA8 A;  3K3L A;  1LF7 A;  3D95 A;  2MM3 A;  2OZQ A;  1OPA A;  1BEB A;  4IB8 A;  2K23 A;  2OFR X;  1B8E A;  1SY1 A;  2WUT A;  4ZHF A;  1BBP A;  2E4J A;  5HCC C;  2AT3 X;  1H91 A;  1I05 A;  4BVM A;  4UU2 A;  1HMT A;  3BX7 A;  1GKA B;  1KT7 A;  3BRN A;  3FIQ A;  4ARH A;  2RA6 A;  1JV4 A;  4AZM A;  2GJ5 A;  5L8O A;  5IO6 A;  3CWK A;  2YG2 A;  5HBS A;  1NP4 A;  3WJF A;  1IKJ A;  4ZH6 A;  5JR8 A;  1DZJ A; 
#chains in the Genus database with same CATH topology
 2UZ2 A;  2QO5 A;  2A8G A;  4QGW A;  3NPO A;  2X34 A;  1YIV A;  1SLF B;  4HPB A;  1ERX A;  2JOZ A;  2LFO A;  4GDA A;  4CPH B;  4BOE A;  2MHD A;  4O49 A;  1N4J A;  4DQ3 A;  3RE5 A;  1STR B;  2A0A A;  1LIB A;  4GDZ A;  4XMF A;  1GT3 A;  1SY3 A;  2QOM A;  3RE6 A;  4OEM A;  2CZU A;  3S5X A;  2AVI A;  2W2B A;  4ZGF A;  1RLB E;  4YKM A;  3B2K A;  4IB7 A;  1DV9 A;  2GTL M;  5HTE A;  2PI3 O;  3U9P C;  1URE A;  4YKO A;  1PTS A;  2A3F X;  1VWQ B;  3AEH A;  3P6H A;  1ZNE A;  3F9D A;  1LIF A;  1SWA A;  2RTN B;  4O3Z A;  5B11 O;  3T6L A;  4L3R A;  2RCT A;  2IZH B;  4GNY A;  5BYP A;  2X8S A;  4GJV A;  1AVE A;  1A2D A;  2PY1 A;  4N7C A;  3ZUO A;  1WUB A;  1O1V A;  3MVF A;  4Y0Q A;  3T2X A;  1LID A;  4NNT A;  1OEK A;  1SWF A;  2FTB A;  4QYN A;  3RDQ A;  3RY1 A;  3E3C A;  4BGF A;  4CDE A;  4EXZ A;  1IFB A;  3HWF A;  3JSQ A;  1O1U A;  1DF8 A;  2HKD A;  1NGL A;  2AT6 X;  1BRP A;  4XMG A;  3T6F A;  3APU A;  2OL6 O;  2HYS A;  5LJG A;  4EEJ A;  4OMX A;  1TXL A;  3WJD A;  2WQA E;  4C5P A;  4YCE A;  5F1E A;  1I04 A;  2RTB B;  1ADL A;  2FR2 A;  2HZR A;  3U0D A;  3RKG A;  2QO4 A;  3TGC A;  1E02 A;  3ELX A;  3WJE A;  1Y52 X;  3WZP A;  2N93 A;  4YBP A;  1S2P A;  2FHL A;  3CKG A;  4I60 A;  1SWD A;  3FW4 A;  4I95 A;  5EDB A;  4Z2V A;  1SY2 A;  1BSY A;  5HA1 A;  1SY0 A;  3SLJ A;  1S44 A;  3D9W A;  5BVQ A;  1GX9 A;  4EFG A;  1JJU A;  1G85 A;  1AVG I;  1MDC A;  4BX6 A;  1KT5 A;  4CDC A;  1XCA A;  2HNX A;  1TW4 A;  3WOV A;  3WJG A;  3GAQ A;  1EI5 A;  5B29 A;  1EPA A;  3HPE A;  1DC9 A;  4IAB A;  3PPT A;  1NDJ A;  1SWL A;  2FS6 A;  1UYO X;  2WSJ A;  5HWZ A;  3EC5 A;  2CM9 A;  3VG4 A;  1QY0 A;  2ANS A;  2Q39 A;  2WWP A;  4AZO A;  5AEO A;  3KFG A;  1MUP A;  4XMH A;  4TKJ A;  3ZW0 B;  1KL4 A;  3FEN A;  3RY2 A;  3VG5 A;  4QZU A;  4I3C A;  2MWH A;  5D8J A;  1GT1 A;  5DG4 A;  4QAE A;  4ON1 A;  4U8U O;  4JO6 A;  2X4M A;  4BQU A;  4EKV A;  5IRW A;  1NBX A;  2IZD B;  2QM9 A;  4Y0P A;  5FEN A;  2ASN X;  3MBT A;  2FLJ A;  2ZSC A;  3DSZ A;  3HWD A;  1TVQ A;  4KT5 A;  3LV4 A;  1LUQ A;  1CRB A;  4XMC A;  3UEW A;  1VWI B;  3CR6 A;  3FEK A;  4PSQ A;  1CBI A;  1OSP O;  4Z27 A;  4CV7 A;  2RTD B;  4GKC A;  2W2F A;  5LJH A;  1WBI A;  1ICM A;  2JU7 A;  2FWV A;  2NNQ A;  1IW2 A;  1LCZ A;  4GJS A;  1BRQ A;  4NNS A;  1K24 A;  1VPR A;  3VG6 A;  4WFU A;  3VU1 A;  2AT5 X;  3CBS A;  1BM5 A;  2RTL A;  4Y0S A;  2R74 A;  3CQN A;  1Z24 A;  5HA0 A;  3BSZ E;  2WEX A;  3PEC A;  2A13 A;  3KFF A;  2VFC A;  4ZHC A;  5LKE A;  3HWG A;  3WZQ A;  3IFB A;  4ORW A;  2X8T A;  5F58 A;  5CSE A;  5L8I A;  1G74 A;  4A1Y A;  5LJD A;  4QYP A;  1QY2 A;  4YCH A;  1SWC A;  4QZT A;  2P8G A;  1T68 X;  1ZND A;  2BT9 A;  5F7G A;  4ZHD A;  4L1N A;  2ZAG A;  3PDF A;  1SLE B;  4AZN A;  3I0A A;  2LBA A;  1QY1 A;  1KFF A;  4ID2 A;  2BLG A;  4M6S A;  3DTQ A;  4QRL A;  4CK4 A;  1RXH A;  3CQR A;  1HMR A;  4NV7 A;  3VHH A;  4NW4 A;  4EDE A;  1SLD B;  1EPB A;  2F09 A;  2IZF B;  2IZA A;  3UAQ A;  2HMB A;  1OEJ A;  2RN4 A;  1EW3 A;  2JMB A;  1LNM A;  1GKA A;  1HMS A;  2RTI B;  4ORS A;  2RTQ B;  1QWD A;  1SWJ A;  1BJ7 A;  4U8U N;  5HCD C;  2RTK A;  3PK2 A;  1KT4 A;  5L3Y A;  1SWQ A;  3C78 X;  1KZX A;  4OKA A;  4TQ2 A;  1VWG B;  3NAD A;  4GD9 A;  4GE1 A;  5KHP A;  4ZJ0 A;  4BX7 B;  5KID A;  4QGV A;  3BS2 A;  3RDO A;  3ZUI A;  4O3W A;  1N0S A;  1Y53 X;  1YWA A;  2G7B A;  2YMS A;  3AUM O;  5EZ2 A;  1U0X A;  1MM9 A;  4IMO A;  1MOY A;  1P6P A;  2FHN X;  1HXL A;  2OFM X;  1SWU A;  2IZC B;  2RTJ A;  2R73 A;  1PBO A;  1PEE A;  3APX A;  4B55 A;  1EIO A;  5F6B A;  2GH7 A;  3WBG A;  3RDS A;  5LJB A;  1HXZ A;  2DJF A;  2BS6 A;  3APW A;  5AQ6 A;  2FKG A;  3PH5 A;  3STK A;  2MF6 A;  4U9C A;  4HWM A;  1RXK A;  2K62 A;  2POA A;  4ORY A;  3FR2 A;  4A1H A;  3FLL A;  4WHI A;  5HZ5 A;  1BSQ A;  5LJK A;  2KTD A;  2C4I A;  1PMP A;  4YGZ A;  3EBK A;  4JHQ A;  4ZH9 A;  1SRG A;  3HOL A;  2RTO B;  1JYD A;  1SRH A;  4BBO A;  1GXA A;  1EUO A;  1XKI A;  3VHM A;  1D3S A;  2CBS A;  5HCE C;  3SAO A;  3TF6 A;  1X8N A;  3Q6L A;  1YP7 A;  3D4R A;  3TZS A;  5K06 A;  3BU1 A;  2G8C O;  2OYB O;  3HOE A;  4COT A;  3ZW2 A;  1SWN A;  2F01 A;  4KCA A;  4KC7 A;  2EU7 X;  2AMM X;  1SWP A;  1Y9T A;  2Z4I A;  1LKE A;  3F8A A;  3TGB A;  3APV A;  1UZ2 X;  1X89 A;  1A3Y A;  1LFO A;  5H9A A;  1RBP A;  3NX1 A;  5IXG A;  1GGL A;  3FR4 A;  3SLO A;  1LIE A;  3PQU A;  2AH7 X;  4CDD A;  5D45 A;  1CBQ A;  1KL5 A;  5F2B A;  1KGL A;  1FE3 A;  3O2Y A;  1VWR B;  5B2A O;  5EEE A;  1CBR A;  4HPD A;  3NX2 A;  1N43 A;  4KH8 A;  3RBY A;  3HTY A;  4ZHH A;  1HBP A;  2AL0 X;  2BS5 A;  1SWB A;  2X45 A;  1N9M A;  4I3B A;  4O9S A;  1JZU A;  1B56 A;  2RTG B;  5CYB A;  4HPC A;  1S7D A;  4BCS A;  2AT8 X;  4BX5 B;  1N7Y A;  1SRJ A;  4YDB A;  4YMY A;  1VWC B;  1YP6 A;  2RTP B;  4JNJ A;  1BSO A;  4ORR A;  3QKG A;  2CM4 A;  3ZW0 A;  4LZU A;  3U03 A;  1KL3 A;  1STS B;  4Z6J A;  1YUP A;  2JU8 A;  3P6G A;  4MVK A;  4RUN A;  5FAZ A;  4CSB A;  2C1S A;  2FR3 A;  3O19 A;  3FID A;  4IB6 A;  5LJC A;  1BLR A;  4ORU A;  5D47 A;  3RDX A;  3EM0 A;  2LA7 A;  1YWD A;  3FEP A;  3KZA A;  2OFA A;  3ZWE A;  3ZZV A;  3P6C A;  1EXS A;  4GK9 A;  5FQ8 E;  2NNE A;  5EPQ A;  2FRS A;  5BVT A;  2NP1 A;  2WR6 A;  5LJE A;  5H9N A;  4CDF A;  2FKJ A;  3D96 A;  4YBU A;  5B3M O;  2IFB A;  2RTC B;  1VWB B;  3BU9 A;  2WPU A;  3P6F A;  3RDM A;  4XME A;  3FA7 A;  1OBP A;  1MX8 A;  1Y9L A;  2OFB A;  4CPF A;  1AEL A;  2L68 A;  1JMX A;  3SZJ A;  4U46 A;  2LBV A;  1ZNL A;  3VGW A;  3CKF A;  4A60 A;  4DQ4 A;  1FJ1 E;  1FTP A;  4INN A;  4OS8 A;  4AZR A;  4IB9 A;  1RXJ A;  3F6Z B;  1IFC A;  3HWE A;  1BWY A;  4GRJ A;  3X00 A;  3FW5 A;  2KD2 A;  1VWE B;  2AT0 X;  3ZQ3 A;  4M7M A;  3PQS A;  3VHI A;  2WEW A;  5IRA A;  1NQM A;  4U8U M;  4N7D A;  3FA9 A;  3V8U A;  3VG3 A;  2AKQ A;  3NQ9 A;  3RWX A;  2OVE A;  4ZGU A;  5D48 A;  4GGZ A;  3OD9 A;  1SRF A;  5CE4 A;  3RDU A;  1HQQ A;  2RTH B;  1DZP A;  3N91 A;  1I78 A;  4TNN A;  3GE2 A;  1IJ8 A;  1N9Y A;  2ALL X;  2CBR A;  2FGS A;  1FDQ A;  4YFP A;  2BC3 A;  1LCV A;  1SWR A;  3MG5 A;  3ZW1 B;  2JGS A;  5KIC A;  2IZG B;  1E00 A;  2G5L A;  1NQN A;  1VWF B;  2M4L A;  2VFB A;  1KOI A;  1T0V A;  3FR5 A;  4CPE A;  1X8Q A;  4Z2O A;  3P24 A;  4KC8 A;  1LCW A;  2MO5 A;  1VYG A;  3B2H A;  5EDC A;  5FQ6 E;  5K68 A;  4FBO A;  2OY5 O;  5DPQ A;  1JYJ A;  4BX7 A;  4OMW A;  2L5P A;  2I5V O;  3WZO A;  2JW1 A;  2IZK A;  3C77 X;  4GZV A;  5B27 A;  3JS1 A;  4Z2P A;  1EII A;  2CAM A;  3BY0 A;  2AF5 A;  2Y32 A;  3KFH A;  4IBA A;  1QG5 A;  2F73 A;  1KT6 A;  3C76 X;  4IMN A;  1DZM A;  1VWJ B;  1A18 A;  1AVD A;  3FA6 A;  3HK1 A;  1O8V A;  4ORX A;  1ICN A;  4I6S A;  3VG2 A;  3VG7 A;  4WBK A;  1KQW A;  4HPA A;  4Y5D A;  1B4M A;  1GX3 A;  1MX7 A;  3VE1 A;  1JJX A;  3UEX A;  4ODD A;  3ELZ A;  1KT3 A;  3NQ3 A;  5EED A;  1VWA B;  4A8Z A;  2WQ9 A;  3L4R A;  2Q4N A;  1MK5 A;  1SLG B;  4NV8 A;  5IO5 A;  1NC9 A;  1GM6 A;  4RUU A;  1YWB A;  4FGI B;  1UYN X;  4YGG A;  5L8N A;  4Z28 A;  3NBX X;  2FT9 A;  4IAW A;  4YGH A;  5HZ9 A;  2QMI A;  4GU8 A;  2W2A A;  4OEL A;  1ZNG A;  2BSZ A;  2GC9 A;  1EQD A;  1CJ5 A;  1ALB A;  2NND A;  2Y3E A;  1EAL A;  1B0O A;  1SRE A;  4AYH A;  1OEE A;  3SOT A;  1Y55 X;  4I3D A;  4CPI A;  1TOW A;  1E5P A;  1QQS A;  2RTF B;  1SWE A;  4ZR2 A;  2A2G A;  3P6E A;  3LHN A;  1Y0G A;  3CMP A;  4CPH A;  1LPJ A;  2GTL O;  3EBW A;  1FEN A;  1SA8 A;  5B10 O;  4O4X A;  4LKT A;  2OL8 O;  1W6F A;  1AQB A;  3AKM A;  2OVA A;  2OY1 O;  4NYR A;  1JIW I;  3PED A;  3WJC A;  2LKK A;  5H9K A;  3BDR A;  3RZY A;  4R0B A;  2L9C A;  1ZNH A;  2QOS C;  3WJB A;  1QFV A;  4GET A;  1OPB A;  2ACP X;  2OL7 A;  3NR3 A;  1VWD B;  5F6Z A;  4K19 A;  5FFH A;  1SWG A;  2RQ0 A;  3FYF A;  4EQA C;  1CBS A;  1RST B;  1VWK B;  2XST A;  4OS3 A;  4NLJ A;  1HQP A;  2O62 A;  1VYF A;  2X32 A;  1SXU A;  2XKL A;  4BX5 A;  1QAB E;  4ES7 A;  3IA8 A;  4UU3 A;  4I9S A;  4GGT A;  1DF3 A;  1DZK A;  1W4T A;  1IIU A;  2X56 A;  1G7N A;  3OJY C;  3B2I A;  3EW2 A;  1GT4 A;  4LZV A;  5HZ8 A;  1YWC A;  3S5V A;  3KFI A;  5FQ7 E;  1PM1 X;  1RAV A;  2KT4 B;  1KXO A;  1X8P A;  3RSW A;  3EYC A;  3EMM A;  1GX8 A;  1AB0 A;  4YDA A;  1ZNK A;  1RSU B;  5H9L A;  5B5F A;  5CHK A;  1KQX A;  4YH0 A;  2G78 A;  4XMD A;  1SRI A;  1SXX A;  1ACD A;  4QNI A;  1MVG A;  1OBU A;  3O22 A;  4OS0 A;  2Q9S A;  3WVM A;  1ML7 A;  1DFV A;  2Q2P A;  3FEL A;  5IRU A;  4AZQ A;  4IAX A;  1JBH A;  2Y3F A;  2OF9 A;  2HLV A;  1VWL B;  3T2W A;  3Q34 A;  2X46 A;  4MIS A;  5AJC A;  3BLG A;  3VE2 A;  1I4U A;  2GTL N;  1SXW A;  2JN3 A;  4NYQ A;  2A2U A;  4FBR A;  1SXY A;  2RD7 C;  2CZT A;  1VWN B;  5IO7 A;  1X8O A;  3AKN A;  1SWT A;  3OE3 A;  4ALO A;  5LKF A;  4GNW A;  4FQB B;  2IZI A;  1E06 A;  2RTE B;  3P02 A;  2GTF X;  3P6D A;  3PP6 A;  3OBL A;  5HZQ A;  3WZN A;  2IZE B;  4IRW A;  3SLT A;  2RTM A;  1HY2 A;  4NP1 A;  2X55 A;  3PH6 A;  2C1Q A;  1X71 A;  3WYQ A;  4AW8 A;  5H8T A;  5HZ6 A;  2A5C A;  2HZQ A;  2DM5 A;  1VWM B;  1JMZ A;  3WXQ A;  1X8U A;  2RTR B;  3CBC A;  3NQK A;  3UEU A;  4MVE A;  4O4O A;  3S26 A;  1I9H A;  4ZHG A;  3B2J A;  3I17 A;  3B2L A;  1G5W A;  1KZW A;  2QO6 A;  3TGA A;  4BX6 B;  1SWS A;  1ZRY A;  2R56 A;  2LB6 A;  4KII A;  1W5R A;  4PJ2 A;  1U18 A;  2Q2M A;  2IZB A;  3ZW1 A;  3EW1 A;  3VPJ E;  3G7X A;  1E2T A;  4ALB A;  1LDQ A;  4DCB A;  3SZH A;  3WYP A;  1PBY A;  1HBQ A;  4HFO A;  2RCQ A;  4I9R A;  4O3Y A;  1U17 A;  4AZP A;  4JGL A;  1IKE A;  4QGX A;  4BJ8 A;  3FDC A;  1T8V A;  2KTS A;  3D97 A;  2OVD A;  2ACO A;  4ZCB A;  1K3B A;  4GH7 A;  4TLJ A;  4WFV A;  1OBQ A;  1LIC A;  4MVL A;  4YFR A;  2FS7 A;  2IZL B;  3FMZ A;  3KVN A;  1JJJ A;  3NP1 A;  1MEP A;  2L67 A;  3T1D A;  2UYW A;  4YFQ A;  4MVI A;  3BX8 A;  5K67 A;  3SZI A;  5HTD A;  1I06 A;  2RTA A;  2OY8 A;  2DJG A;  1VYO A;  4ZFX A;  4MEE A;  1QFT A;  2OF8 A;  4Y0R A;  1ERB A;  1D2U A;  1L6M A;  2OY7 A;  5AJB A;  1VWO B;  1R0U A;  2G79 A;  2MJI A;  1FEL A;  2JU3 A;  5D4A A;  5C0N A;  4TKH A;  4TJZ A;  1A57 A;  3MM0 A;  1SMP I;  5HAE A;  1NP1 A;  2VDF A;  4O4U A;  5BVS A;  3S60 A;  4NLI A;  3H3I A;  4U3Q A;  1FEM A;  4O3X B;  4D6B A;  1JQP A;  4TKB A;  1GT5 A;  1SWO A;  2ZAI A;  3QQ2 A;  1STP A;  3STN A;  4GUZ A;  4D6A A;  1TOU A;  3LTW A;  4QQ1 A;  1HN2 A;  2KW1 A;  1LDO A;  2OVS A;  3KQ0 A;  4LKP A;  3STM X;  3UEV A;  3FA8 A;  5JD2 A;  1VWH B;  3K3L A;  2X8F A;  4YVB A;  1LF7 A;  3D95 A;  2MM3 A;  2OZQ A;  1OPA A;  1BEB A;  4IB8 A;  4MIR A;  2K23 A;  2OFR X;  1B8E A;  1SY1 A;  2WUT A;  2QCB A;  4ZHF A;  4Y59 A;  4O4S A;  1BBP A;  2E4J A;  5HCC C;  2AT3 X;  4DNE A;  1H91 A;  1I05 A;  4FBV A;  4BVM A;  1LEL A;  4UU2 A;  1HMT A;  1VWP B;  1SWH A;  2I5Z O;  3BX7 A;  5B5G A;  1SWK A;  4GGR A;  1GKA B;  1KT7 A;  3BRN A;  3FIQ A;  4ARH A;  4LQZ A;  2RA6 A;  2A5B A;  1JV4 A;  4AZM A;  2GJ5 A;  4ML7 B;  2BHV A;  5L8O A;  5IO6 A;  3MX7 A;  3CWK A;  2YG2 A;  3ZI8 A;  5HBS A;  1NP4 A;  3JQO A;  3WJF A;  1IKJ A;  4ZH6 A;  2Z4H A;  2IZJ A;  5JR8 A;  1DZJ A; 
#chains in the Genus database with same CATH homology
 2QO5 A;  4QGW A;  3NPO A;  1YIV A;  4HPB A;  1ERX A;  2JOZ A;  2LFO A;  4BOE A;  2MHD A;  4O49 A;  4DQ3 A;  2A0A A;  1LIB A;  4GDZ A;  4XMF A;  1GT3 A;  1SY3 A;  3S5X A;  2CZU A;  2W2B A;  4ZGF A;  1RLB E;  4YKM A;  3B2K A;  4IB7 A;  1DV9 A;  2GTL M;  5HTE A;  3U9P C;  1URE A;  4YKO A;  2A3F X;  3P6H A;  1ZNE A;  3F9D A;  1LIF A;  4O3Z A;  4L3R A;  2RCT A;  4GNY A;  5BYP A;  2X8S A;  4N7C A;  1A2D A;  2PY1 A;  3ZUO A;  1O1V A;  3MVF A;  4Y0Q A;  1LID A;  4NNT A;  1OEK A;  2FTB A;  4QYN A;  3E3C A;  4EXZ A;  1IFB A;  3HWF A;  3JSQ A;  1O1U A;  1NGL A;  2AT6 X;  1BRP A;  4XMG A;  3APU A;  2HYS A;  5LJG A;  4EEJ A;  4OMX A;  1TXL A;  3WJD A;  2WQA E;  4YCE A;  5F1E A;  1I04 A;  3TGC A;  1ADL A;  2FR2 A;  2HZR A;  3U0D A;  3RKG A;  2QO4 A;  1E02 A;  3ELX A;  3WJE A;  4YBP A;  2N93 A;  1S2P A;  4I95 A;  3FW4 A;  5EDB A;  1SY2 A;  1BSY A;  5HA1 A;  1SY0 A;  1S44 A;  5BVQ A;  1GX9 A;  4EFG A;  1G85 A;  1AVG I;  1MDC A;  1KT5 A;  1XCA A;  2HNX A;  1TW4 A;  3WOV A;  3WJG A;  3GAQ A;  1EI5 A;  5B29 A;  1EPA A;  1DC9 A;  4IAB A;  3PPT A;  2FS6 A;  2WSJ A;  5HWZ A;  3VG4 A;  2CM9 A;  1QY0 A;  2ANS A;  2Q39 A;  2WWP A;  4AZO A;  5AEO A;  3KFG A;  1MUP A;  4XMH A;  4TKJ A;  3ZW0 B;  3FEN A;  3VG5 A;  4QZU A;  4I3C A;  2MWH A;  5D8J A;  1GT1 A;  5DG4 A;  4QAE A;  4ON1 A;  4U8U O;  4BQU A;  2QM9 A;  4Y0P A;  5FEN A;  2ASN X;  3MBT A;  2FLJ A;  3DSZ A;  3HWD A;  1TVQ A;  4KT5 A;  3LV4 A;  1CRB A;  4XMC A;  3UEW A;  3CR6 A;  3FEK A;  4PSQ A;  1CBI A;  4CV7 A;  4GKC A;  2W2F A;  5LJH A;  1ICM A;  2JU7 A;  2FWV A;  2NNQ A;  1IW2 A;  1BRQ A;  4NNS A;  1VPR A;  3VG6 A;  4WFU A;  3VU1 A;  2AT5 X;  3CBS A;  4Y0S A;  2R74 A;  3CQN A;  1Z24 A;  5HA0 A;  3BSZ E;  2WEX A;  3PEC A;  2A13 A;  3KFF A;  4ZHC A;  5LKE A;  3HWG A;  3IFB A;  4ORW A;  2X8T A;  5F58 A;  5L8I A;  1G74 A;  4A1Y A;  5LJD A;  4QYP A;  1QY2 A;  4YCH A;  4QZT A;  2P8G A;  1T68 X;  1ZND A;  2BT9 A;  5F7G A;  4ZHD A;  4L1N A;  2ZAG A;  4AZN A;  3I0A A;  2LBA A;  1QY1 A;  4M6S A;  4ID2 A;  2BLG A;  4QRL A;  3DTQ A;  4CK4 A;  3CQR A;  1HMR A;  4NW4 A;  4EDE A;  1EPB A;  2F09 A;  3UAQ A;  2HMB A;  1OEJ A;  2RN4 A;  1EW3 A;  2JMB A;  1LNM A;  1GKA A;  1HMS A;  4ORS A;  4FBR A;  1QWD A;  4U8U N;  1BJ7 A;  5HCD C;  1KT4 A;  3C78 X;  1KZX A;  4TQ2 A;  3NAD A;  4GE1 A;  5KHP A;  4ZJ0 A;  5KID A;  4QGV A;  3BS2 A;  3ZUI A;  4O3W A;  1N0S A;  2YMS A;  1YWA A;  2G7B A;  5EZ2 A;  1U0X A;  4IMO A;  1P6P A;  2OFM X;  1PEE A;  1EIO A;  2R73 A;  1PBO A;  3APX A;  5F6B A;  3WBG A;  5LJB A;  3STK A;  2BS6 A;  3APW A;  5AQ6 A;  3PH5 A;  4U9C A;  4HWM A;  2K62 A;  2POA A;  4ORY A;  3FR2 A;  4A1H A;  3FLL A;  4WHI A;  5HZ5 A;  1BSQ A;  5LJK A;  2KTD A;  1PMP A;  4YGZ A;  3EBK A;  4ZH9 A;  3HOL A;  1JYD A;  1GXA A;  1EUO A;  1XKI A;  1D3S A;  2CBS A;  5HCE C;  3SAO A;  3TF6 A;  1X8N A;  3Q6L A;  1YP7 A;  3D4R A;  3TZS A;  5K06 A;  3BU1 A;  3HOE A;  4COT A;  3ZW2 A;  4KCA A;  4KC7 A;  2EU7 X;  2AMM X;  1Y9T A;  2Z4I A;  1LKE A;  3F8A A;  3TGB A;  3APV A;  1UZ2 X;  1X89 A;  1A3Y A;  1LFO A;  5H9A A;  1RBP A;  3NX1 A;  1GGL A;  3FR4 A;  1LIE A;  3PQU A;  2AH7 X;  1KGL A;  5D45 A;  1CBQ A;  1FE3 A;  3O2Y A;  5EEE A;  1CBR A;  4HPD A;  3NX2 A;  4KH8 A;  3RBY A;  3HTY A;  4ZHH A;  1HBP A;  2AL0 X;  2BS5 A;  2X45 A;  4I3B A;  1JZU A;  4O9S A;  1B56 A;  5CYB A;  4HPC A;  1S7D A;  2AT8 X;  4YDB A;  4YMY A;  1YP6 A;  1BSO A;  4ORR A;  3QKG A;  2CM4 A;  3ZW0 A;  4LZU A;  3U03 A;  1YUP A;  2JU8 A;  3P6G A;  4MVK A;  4RUN A;  5FAZ A;  4CSB A;  2FR3 A;  3O19 A;  4IB6 A;  5LJC A;  1BLR A;  4ORU A;  5D47 A;  3EM0 A;  2LA7 A;  1YWD A;  3FEP A;  3KZA A;  3ZWE A;  3ZZV A;  3P6C A;  1EXS A;  4GK9 A;  5FQ8 E;  2NNE A;  5EPQ A;  2FRS A;  5BVT A;  2NP1 A;  2WR6 A;  5LJE A;  5H9N A;  3D96 A;  4YBU A;  2IFB A;  3P6F A;  3BU9 A;  4XME A;  3FA7 A;  1OBP A;  1MX8 A;  1Y9L A;  1AEL A;  2L68 A;  2LBV A;  1ZNL A;  4A60 A;  4DQ4 A;  1FTP A;  4INN A;  4OS8 A;  4AZR A;  4IB9 A;  3F6Z B;  1IFC A;  3HWE A;  1BWY A;  4GRJ A;  3FW5 A;  2KD2 A;  2AT0 X;  3ZQ3 A;  4M7M A;  3PQS A;  2WEW A;  4U8U M;  4N7D A;  3FA9 A;  3V8U A;  3VG3 A;  2AKQ A;  3NQ9 A;  3RWX A;  2OVE A;  4ZGU A;  5D48 A;  3OD9 A;  5CE4 A;  1DZP A;  3N91 A;  4TNN A;  3GE2 A;  2ALL X;  2CBR A;  4YFP A;  1FDQ A;  3ZW1 B;  5KIC A;  2M4L A;  1E00 A;  3FR5 A;  1KOI A;  1T0V A;  1X8Q A;  3P24 A;  4KC8 A;  2MO5 A;  3B2H A;  1VYG A;  5EDC A;  5FQ6 E;  4FBO A;  5DPQ A;  1JYJ A;  4OMW A;  2L5P A;  2JW1 A;  4GZV A;  3C77 X;  5B27 A;  3JS1 A;  1EII A;  3BY0 A;  3KFH A;  4IBA A;  1QG5 A;  2F73 A;  1KT6 A;  3C76 X;  4IMN A;  1DZM A;  1A18 A;  3FA6 A;  3HK1 A;  1O8V A;  4ORX A;  1ICN A;  4I6S A;  3VG2 A;  3VG7 A;  4WBK A;  1KQW A;  4HPA A;  1B4M A;  3VE1 A;  1MX7 A;  1JJX A;  3UEX A;  4ODD A;  3ELZ A;  1KT3 A;  3NQ3 A;  5EED A;  4A8Z A;  2WQ9 A;  3L4R A;  2Q4N A;  5IO5 A;  1GM6 A;  4RUU A;  1YWB A;  4FGI B;  4YGG A;  5L8N A;  3NBX X;  2FT9 A;  4IAW A;  4YGH A;  5HZ9 A;  2QMI A;  4GU8 A;  2W2A A;  1ZNG A;  2GC9 A;  1CJ5 A;  1EQD A;  1ALB A;  2NND A;  1EAL A;  1B0O A;  4AYH A;  1OEE A;  3SOT A;  4I3D A;  1TOW A;  1E5P A;  1QQS A;  4ZR2 A;  2A2G A;  3P6E A;  3LHN A;  3CMP A;  1LPJ A;  2GTL O;  3EBW A;  1FEN A;  1SA8 A;  4O4X A;  4LKT A;  1AQB A;  3AKM A;  2OVA A;  4NYR A;  1JIW I;  3PED A;  3WJC A;  2LKK A;  5H9K A;  3BDR A;  3RZY A;  4R0B A;  2L9C A;  1ZNH A;  2QOS C;  3WJB A;  1QFV A;  4GET A;  1OPB A;  2ACP X;  3NR3 A;  5F6Z A;  4EQA C;  5FFH A;  4K19 A;  2RQ0 A;  3FYF A;  1CBS A;  2XST A;  4OS3 A;  4NLJ A;  1HQP A;  2O62 A;  1VYF A;  1SXU A;  2XKL A;  1QAB E;  4ES7 A;  3IA8 A;  4UU3 A;  4I9S A;  1DF3 A;  1DZK A;  3OJY C;  1IIU A;  1G7N A;  3B2I A;  4LZV A;  1GT4 A;  5HZ8 A;  1YWC A;  3S5V A;  3KFI A;  5FQ7 E;  1PM1 X;  2KT4 B;  1KXO A;  1X8P A;  3RSW A;  3EYC A;  3EMM A;  1GX8 A;  1AB0 A;  4YDA A;  1ZNK A;  5H9L A;  1KQX A;  4YH0 A;  2G78 A;  4XMD A;  1SXX A;  1ACD A;  4QNI A;  1MVG A;  1OBU A;  3O22 A;  4OS0 A;  2Q9S A;  3WVM A;  1ML7 A;  1DFV A;  2Q2P A;  3FEL A;  4AZQ A;  1JBH A;  4IAX A;  2HLV A;  2X46 A;  4MIS A;  5AJC A;  3BLG A;  3VE2 A;  1I4U A;  2GTL N;  1SXW A;  2JN3 A;  4NYQ A;  2A2U A;  1SXY A;  2RD7 C;  2CZT A;  5IO7 A;  1X8O A;  3AKN A;  3OE3 A;  4ALO A;  5LKF A;  4GNW A;  4FQB B;  3P02 A;  1E06 A;  5HZQ A;  3PP6 A;  2GTF X;  3P6D A;  3OBL A;  4NP1 A;  3PH6 A;  1X71 A;  4AW8 A;  5HZ6 A;  5H8T A;  2HZQ A;  2DM5 A;  3WXQ A;  1X8U A;  3CBC A;  3NQK A;  3UEU A;  4MVE A;  4O4O A;  3S26 A;  4ZHG A;  3B2J A;  3I17 A;  3B2L A;  1G5W A;  1KZW A;  2QO6 A;  3TGA A;  1BM5 A;  2R56 A;  1ZRY A;  4KII A;  2LB6 A;  4PJ2 A;  1U18 A;  2Q2M A;  3ZW1 A;  3VPJ E;  3G7X A;  4ALB A;  1HBQ A;  4HFO A;  2RCQ A;  4I9R A;  4O3Y A;  1U17 A;  4AZP A;  4JGL A;  1IKE A;  4QGX A;  1T8V A;  2KTS A;  3D97 A;  2OVD A;  2ACO A;  4ZCB A;  4GH7 A;  4TLJ A;  4WFV A;  1OBQ A;  1LIC A;  4MVL A;  4YFR A;  2FS7 A;  3FMZ A;  1JJJ A;  3NP1 A;  3T1D A;  2L67 A;  4YFQ A;  4MVI A;  3BX8 A;  5HTD A;  1I06 A;  4ZFX A;  1QFT A;  4Y0R A;  1ERB A;  1D2U A;  1L6M A;  5AJB A;  1R0U A;  2G79 A;  2MJI A;  1FEL A;  2JU3 A;  5D4A A;  5C0N A;  4TKH A;  4TJZ A;  1A57 A;  1SMP I;  5HAE A;  1NP1 A;  4O4U A;  5BVS A;  3S60 A;  4NLI A;  3H3I A;  4U3Q A;  1FEM A;  4O3X B;  4D6B A;  4TKB A;  1GT5 A;  2ZAI A;  3STN A;  4D6A A;  1TOU A;  4QQ1 A;  1HN2 A;  2KW1 A;  2OVS A;  3KQ0 A;  4LKP A;  3STM X;  3UEV A;  3FA8 A;  3K3L A;  2X8F A;  1LF7 A;  3D95 A;  2MM3 A;  2OZQ A;  1OPA A;  1BEB A;  4IB8 A;  4MIR A;  2K23 A;  2OFR X;  1B8E A;  1SY1 A;  2WUT A;  4ZHF A;  4O4S A;  1BBP A;  2E4J A;  5HCC C;  2AT3 X;  1H91 A;  1I05 A;  4FBV A;  4BVM A;  4UU2 A;  1HMT A;  3BX7 A;  1GKA B;  1KT7 A;  3BRN A;  3FIQ A;  4ARH A;  4LQZ A;  2RA6 A;  1JV4 A;  4AZM A;  2GJ5 A;  4ML7 B;  2BHV A;  5L8O A;  5IO6 A;  3MX7 A;  3CWK A;  2YG2 A;  3ZI8 A;  5HBS A;  1NP4 A;  3JQO A;  3WJF A;  1IKJ A;  4ZH6 A;  2Z4H A;  5JR8 A;  1DZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...