5HA5A

Crystal structure of an nad-bound oxidoreductase from brucella ovis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
250
structure length
250
Chain Sequence
b'MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Brucella ovis oxidoreductase
molecule tags Oxidoreductase
source organism Brucella ovis intabari-2002-82-58
publication title Crystal structure of an NAD-bound oxidoreductase from Brucella ovis
rcsb
total genus 95
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ha5A00
4W4TA 4DLBA 5CFZA 4K28A 3OMLA 5T8KA 1GV1A 4D3SA 1KC3A 1H5QA 1Y8RA 4E3ZA 2DUUA 4OOFA 3GR6A 4FFRA 3OP4A 1NVMB 3BTUA 1PGOA 4C7KA 2JFGA 4JXKA 5IZCC 3KV3O 2GYYA 3A06A 3HNPA 4GLOA 5AXAA 2A94A 4UEKA 2GN6A 4BMNA 2C29D 3GRKA 2IXBA 2J3HA 4J43A 1GUYA 2PD3A 3PZBA 5IN4A 1P9LA 1OBFO 3O38A 4TVBA 5TT0A 5AXBA 1A7AA 1E6UA 1YJQA 3IJRA 4MVJM 4RZIA 2CDCA 4ZQFA 1NX6A 2AQ8A 4IDCA 3DAPA 3AUAA 2OP0A 3IKVA 5JXWA 4DBZA 4FSHA 4E2XA 1ONOA 4QO7A 4YJHA 2YFHA 2J6IA 5BNFA 3LT1A 3PWSA 3ZHYA 4BO2A 4F45A 1X0VA 4BIIA 1BGVA 4P38A 1VSVA 2VWGA 3D0OA 1AXGA 3IUSA 3CPSA 3P2OA 2AG5A 1AHIA 3ANLA 4AJIA 1H2BA 1J49A 2CNBA 3DEYX 4HFMA 1VI2A 2HK7A 3WR5A 4DPMA 2PZKA 1BDBA 3QVOA 3AFMA 5JAMA 2GN4A 2VTDA 3HSKA 4NU5A 4CQMA 5J23A 1EEHA 2Y1OA 1Y8RB 2FR0A 1ZVMA 2DFDA 4CM5A 2QQ5A 1Y8QB 4UVHA 1VKOA 1KBZA 2CFCA 3MOGA 1NYTA 1CDOA 5THQA 2NTVA 2AEJA 3DZKA 1C0IA 3NTOA 5IDXA 4AJHA 3WGOA 4AJ4A 5I9LA 4LVUA 3RC2A 5A06A 4LCEA 1RM3A 1A7KA 4HFRA 3DWFA 3E03A 3ETEA 5CEFA 1FMCA 1U4SA 4L75A 4B7XA 2UDPA 4OXYA 3D5TA 4XZ3A 1UXHA 3ASUA 5A03A 1RM0A 2CY0A 4MIEA 4XGIA 4FFOA 4OHUA 4DREA 5KVSA 1R66A 2GCGA 3M6IA 2O4UX 4JCOA 2I6TA 2Q2QA 3QHAA 4Q3NA 3BMOB 2PZLA 1ZFNA 2OZPA 4E0BA 3EMKA 3EVTA 3D3EA 5JNLA 2E49A 3RCBA 5ITWA 1UZLA 4YDRA 4AJPA 5U9CA 5IXYA 2I76A 4CMHA 4NQZA 1T2DA 1P1RA 1V3VA 2NQTA 4OQZA 4QFCA 2QRJA 2JFFA 3X2FA 2BLLA 1CEQA 3KSZO 1MB4A 5DCWA 1NHGA 1KY4A 1DIGA 3WIDA 1U7HA 2DM6A 3GK3A 4ZQHA 4DVJA 1HLDA 3HN7A 4J90A 1QYWA 3ZWYA 2QHXA 4WGGA 1WPQA 3JYLA 4FC7A 3S2IA 3I9JA 1DAOA 1B0AA 4ILKA 4CQLA 4BKOA 4M89A 4DL9A 1NPDA 5I8ZA 2XXBA 3I3OA 1GADO 1QLJA 1X1EA 1UP7A 2BFOA 3TDKA 1V9LA 4E5NA 1HE2A 3ZWCA 5DBGA 2DPGA 3BHMA 1G0NA 2EKLA 4O1MA 4EYEA 3H8VA 2WE7A 1LDYA 1U9JA 3A14A 4DUPA 5IZ4A 2O7QA 5JC1A 4BNGA 2B69A 3PDUA 4E32A 2BFPA 1DRVA 1LSJA 2DU8A 3C24A 1Q0QA 3Q2KA 4E4YA 1SNYA 3JSAA 5L4NA 3R1IA 2P9GA 4CR6A 5AVOA 4CLOB 4FN4A 1GY8A 1H0KA 1WWKA 3A1NA 2GZ3A 1GL3A 2PGLA 1CETA 3GAFA 2AEFA 1NQTA 3E8XA 4ZHSA 1GV0A 2DBRA 1PJLA 2FZEA 4KTTE 4OL9A 4OQYA 3BHIA 3WTCA 4CM8B 1T24A 2P68A 3KBOA 1OZAA 4J9UE 3TJRA 3WBFA 3BMCB 4PLYA 1K3TA 1X7GA 3C1TA 4P4NA 5JS6A 1ISHA 4INAA 3WYCA 3F6YA 3OETA 2JCXA 1GYRA 4XYEA 4CMGA 3U49A 4BV8A 4WCDA 4B4OA 4YYZA 3M1AA 6LDHA 3GMDA 3ZU5A 1F8GA 2O3TA 1YJ8A 1ENZA 2X58A 2WM3A 1KEWA 3DZHA 3Q3CA 4Y9DA 1P0CA 2D2IA 2JAHA 1DHRA 3IC5A 4Q39A 1E1MA 5CAEA 4RL6A 5FI5A 4IMPA 4I5EA 4Y6PA 4YT2A 5BT9A 1E5LA 1A27A 4A2CA 2R6JA 5GZ3A 1YB1A 2V6MA 5A9RA 2B4TO 1R12A 2WTBA 5BSFA 3MJVA 2OHXA 2P9EA 2ZTVA 4GWGA 2C5AA 4JJGA 4I8XA 4QX6A 3QA9A 5ILGA 4CM8A 4H15A 3UGKA 3H9QA 1PL8A 2I99A 2XOXA 5BSGA 4BNMA 4WCFC 2CF5A 4IDAA 2C0CA 4RF3A 4DIOA 1K5HA 1KVTA 3K9QO 2FMUA 3DFZA 3GN1A 1JKIA 2R2GA 2AE2A 2WE8A 3G1UA 1DC5A 2GLXA 3EDMA 5I7EA 2OL4A 4WCFA 1BXZA 4J16A 5DZSA 5KJFA 4GX1A 4R68A 2D1YA 3INRA 3VZQA 3KM0A 4WUVA 4J4BA 1XSEA 3EZYA 2Q2VA 3WGYA 4XA8A 5L95A 3KUXA 1XR3A 4MDHA 1YRLA 4I5FA 3ONEA 4Z9FA 2ZYAA 1XHLA 1JKFA 3ADPA 4OKNA 1Q0LA 2BRUA 2VYNA 2YHUA 3BTSA 3LYLA 4YAEA 1PSDA 3I52A 5ER6A 3ENKA 3W4IA 2HAEA 1T2EA 2YYYA 4ID9A 3CTMA 3JQDA 1UR5A 5JLAA 3BZUA 4RCVA 3RFTA 5C37A 4NH4A 1T25A 3KHUA 1K0UA 3WQSB 3FN4A 4QT0A 5T67A 1Q7GA 1PGQA 4D44A 2D0IA 5DOZA 4AJOA 5AYVA 4EJ6A 1LQUA 5EL0A 3VVCA 3L9WA 4ZQEA 1NAIA 3I9MA 3KVOA 4NU6A 3OQBA 2PH3A 1H94A 1QYDA 3H9GA 3JQBC 3PVZA 2NQ8A 4Y8VA 4U0KA 3Q11A 1M76A 1M67A 5IDYA 1Z74A 4XQCA 1E7YA 3ZCXA 2WYVA 1UH5A 3TWOA 5B4VA 4JK3A 3GDFA 3CKYA 3HB4X 4QECA 4BO3A 4BNNA 4ZGWA 3FTPA 1HEUA 2I67A 2D59A 1LLCA 4F6CA 4ZVVA 1SOWA 1I5RA 1UZNA 1XQ1A 1HSZA 2P4QA 4PG5A 3R0IA 1GPDG 3VTFA 3WTBA 3GZNA 1N7HA 1R4MA 4BB5A 1LDMA 1EK6A 4CMEA 4EW6A 3SX2A 1N1GA 3GOHA 2QZZA 2NU9A 3AOEC 1ONPA 1ORRA 1TT5B 2BD0A 4J6FA 4L76A 4MOWA 4XEHA 1FDSA 3ZWOA 2FRDA 4A03A 4S3MA 5COQA 3UAGA 5EPOA 4B79A 5JDCA 4MIOA 5A02A 2FR8A 5JDCC 4JJIA 2FOIA 3UF0A 1DIBA 2GZ1A 3JD3A 3K96A 5TNXA 3HFSA 5TS3A 2C20A 3GMSA 1O9BA 1HKUA 1LNQA 4MVJF 2V7PA 4IXTA 1VC2A 4YT4A 2YV2A 3SBOA 2IDZA 4BNYA 4L9RA 3B6ZA 3TPCA 3RBXA 5TC4A 3I83A 2P5UA 1OC2A 1YONA 3DBVO 3NT5A 3GGGA 3SJUA 3LSYA 3H2ZA 2GUGA 4NFHA 2B35A 4W6ZA 3TOXA 1JTVA 1ZK2A 1VLLA 4CLHA 3PP8A 3DHEA 2A9FA 3AY7A 4Y6SA 3ZWMA 4YBZA 1TLTA 5H83A 3PHHA 3UICA 5A5EA 5DF1A 3OECA 1CJCA 1HTBA 4RJTA 1PJ4A 4HADA 2W2LA 1I30A 1AXEA 1QR6A 2EGGA 4TRRA 4ALNA 1PR3A 4XX0A 1PZEA 3ZI0A 2NV6A 1HDOA 1YQDA 4KDEA 4O6VA 3FI9A 1O5IA 1Q1NA 2FP4A 2DKNA 3D64A 4RDIA 4E30A 1OMOA 4E5PA 4N5MA 3E82A 2D5AA 2C54A 1V6AA 2D3TA 2VHZA 2ZKLA 3LC7O 2YV1A 4FS3A 4WLFA 4CL3A 4E21A 4LSWA 1LJ8A 1R0SA 4BVAA 1DFHA 1LSSA 3IQDB 3IDSA 4PN3A 3U5TA 4GX5A 1TB4A 2Q46A 3GG2A 4U7WA 3KB6A 2WYWA 2NTNA 3RJ9A 3OM9A 3ZV4A 3KEOA 1NQAO 1YDEA 2OP1A 1AGNA 3IAHA 4H16A 4DMMA 1NWHA 1YWGO 2CVZA 2FWMX 4Z0PA 3PGXA 3VZSA 2Z1MA 3UHAA 3ZWXA 5TGDA 1D4FA 4R1TA 3RKRA 3WYEA 5COAA 1LU9A 1AUPA 3GNQA 3PYMA 1J5PA 4CJXA 5C7IO 1C0KA 9LDBA 1XCBA 3OEYA 5I9MA 1JAYA 2VQ3A 1F14A 1YQXA 4J49A 2CZCA 1BRMA 1UAYA 1H9AA 4QQRA 3RUDA 3KZVA 1I32A 3RC1A 4E12A 1LRLA 2OMEA 1DOHA 1HDYA 4D79A 4BO1A 3L6DA 2DLDA 1E6EA 4PVCA 2OUIA 1E6WA 3H5RA 3TL3A 6ADHA 3PHLA 3QWBA 2VRCD 5A5FA 2YJZA 1HWYA 3MJCA 4XKJA 4BMVA 1JKJA 4MKRA 5T5QA 1KETA 2VCYA 1DJNA 3U4IA 2X9VA 4XB1A 3CH6A 3MJSA 3AUTA 4MJLA 1WVGA 1ADGA 4ZICA 2V6BA 3EUWA 5JCXA 1OAAA 2O3SA 5JPIA 1P31A 1U2DA 3I9LA 3V1TC 2GF2A 4CV0A 2DFVA 2OORA 1QP8A 5TQVA 3FF4A 1UP6A 3I6IA 3AU9A 1T2CA 2WD7A 3GDOA 1GEGA 4OSOA 4FJ2A 1PL7A 1DHTA 1YL5A 2NACA 4RVSA 1KVRA 3PFWO 1PEDA 2X86A 1NR1A 3QWIA 4GBJA 3CMCO 4IJWA 1UUFA 2EF1A 4MVJH 4BL5A 3DHNA 2FSSA 1L7EA 1DFGA 1K6JA 5G0UA 1XG5A 2NSDA 1ZW1A 4CUJA 2GRAA 1JW9B 3QWFA 3WWYA 1ISGA 1VJ1A 4I5GA 4A10A 1Q0HA 2Q45A 3E5MA 2NVUB 3WSWA 4DQXA 1JDJA 4RVDA 4B7UA 2EKPA 3M2PA 5K6AA 3DFUA 1ULSA 2BI8A 3PZRA 1DFIA 4MIYA 1EK5A 4OKIA 4CV2A 2CD9A 3PGJA 3TSCA 3MTJA 3W8DA 4HKTA 2DTEA 4IZHA 1H6AA 4O0LA 4B3JA 1H93A 1FDVA 2AE1A 3KO8A 4DTIA 4PIVA 1PIWA 1X1TA 2VRBA 3DAGA 4P8RA 2RHCA 5IXSA 2Z5LA 3CUKA 2JD0A 1YBAA 1MLDA 4OMUA 5F1KA 3NTQA 5G4LA 1EQ2A 1P1HA 1PGJA 1ML3A 1LC3A 3BYZA 3AOEA 3G1TA 4PG6A 1NFFA 2RHRA 1TT5A 3ZH2A 2Y05A 4J9VA 4YAIA 1KVQA 3F1LA 5DP2A 1ONNA 3PHGA 3VPHA 4R9SA 4CM7A 4Z9YA 2G0TA 2V6GA 1RKXA 1GYQA 4B4VA 1AHHA 4DGSA 1I24A 5A04A 3WNVA 4ITUA 2ZCVA 3JQ8B 3O03A 3LF2A 3QVSA 4WLUA 4W9NC 4TROA 3JYPA 4MVJP 4I1IA 3NDRA 4CQMD 2BELA 2HCTA 2VYVA 5A9TA 4JROA 3JQFA 1M75A 3OA2A 3DTYA 1BDMA 3F5SA 1PQUA 5KCZA 1GUFA 2C2YA 2E6UX 4BKRA 2Y1EA 5G0TA 1R0KA 1T1SA 3ANMA 4BUCA 4QFDA 1H6DA 4DIFA 3OIDA 1XWFA 1EE9A 3U09A 2G76A 2HJSA 2DC1A 3HB5X 1EZ4A 1XELA 3GVXA 3B1JA 3NGLA 1T26A 4XRGA 5K6AC 4D3FA 2CDBA 2Y1GA 1O6ZA 2YW9A 5H82A 1WMAA 4OH1A 1PX0A 2EWMA 1EVZA 3JQEA 3DC2A 3LDHA 3FTNA 3OJLA 2D5CA 2X4GA 1XYGA 3ABIA 5DCUA 3NGXA 3NKLA 3ICPA 4HXYA 2B4RO 1N7GA 2HO5A 1IHXA 5AXCA 3VTZA 3NYWA 1XKQA 4R16A 1M66A 1IPFA 2Y68A 1EUZA 1AE1A 1ZBQA 4WKGA 1WP4A 2JAPA 1YXMA 3FNHA 3RFXA 4CMAA 3DMTA 4YB8A 2I9PA 1E92A 1GQQA 5T8KC 4YR9A 3ZU2A 2H63A 2ZYGA 4P4LA 1DBVO 3GFBA 2VNAA 1H6CA 4N54A 5TRTA 3GPIA 4YVFA 4LRTB 3ZWWA 2Y0EA 4PG7A 5B37A 1UXJA 3JQAD 4BB6A 3GNSA 4F6LA 1D8AA 2CVOA 1WZIA 2DTDA 1DIRA 2P91A 3GN2A 3RC7A 5EMHA 3DTTA 3ROMA 4R1NA 3KLMX 3L07A 2VYVD 4GX0A 5A3JA 3ITKA 3JQ6A 3D4NA 4GSKA 2GR9A 2V6FA 3QE3A 5HWSA 4RLSA 4D0RA 1OOEA 4CL8A 4F3YA 3B1KA 2Y93A 1P74A 5B4TA 3BMQB 4IINA 3CZRA 5KJ6A 1N9GA 1ZNQO 2JHFA 4FFPA 5JE8A 2JL1A 1RM5A 1UP4A 4RDHA 5CPBA 5JYEA 1BVRA 4FIZA 3FRJA 4YAJA 1RYDA 5FF9A 3RFVA 1VJ0A 3GHYA 1IE3A 3WGQA 4B8WA 1ZJYA 2AQHA 3HG7A 4NG5A 4M55A 3ROKA 3T4EA 1NBOA 1MG5A 1XLTA 1YOVB 2Q2WA 4JLWA 5ER9A 2Z95A 3K5PA 3QY9A 4HFNA 4DC0A 5KIAA 4U5QA 1DSSG 2W90A 4BNHA 1E3IA 4DIBA 4YAGA 2PZJA 2WD7B 4AJ1A 2XXJA 3DR3A 3WICA 2C2XA 4W99A 4WOJA 2X8LA 3SVTA 3N58A 4MP8A 3RBZA 4XCVA 3B70A 1YB4A 3W6ZA 1DIAA 4QXMA 3WMXA 4MVJE 4R5HA 3KRTA 4DLAA 4CLOA 3VZRA 2X23A 2FR1A 8LDHA 1DRUA 3AUSA 5DCYA 1NXQA 4H7PA 1K89A 2O50A 3AI2A 5EN4A 3V2GA 5JYDA 1VL6A 4OIMA 4FQ8A 3DDNA 4UVDA 4GPD1 1IHYA 1C3VA 1D1TA 3MWEB 2F00A 2O2YA 2PR2A 1TT7A 4DQVA 4J2HA 4TQGA 3NJ8A 3VDRA 1YO6A 1TEHA 3DZJA 4CR8A 3JD4A 2CSUA 1W73A 1GU7A 3I6QA 3JD1A 1TXGA 4G81A 1ZZEA 4XYBA 5HS6A 2BGMA 2EG9A 4XQEA 1SOVA 3OSUA 1F06A 2W4QA 4BNUA 1LDNA 4HY3A 3S2EA 1AN9A 1B15A 2P9CA 2B36A 1Y8QA 1GPJA 5C7LO 2VHYA 4R51A 2OXIA 1JA9A 1TVEA 3GEGA 5F1OA 1OFGA 2JD2A 3UFXA 3H9JA 3JQ8A 5DP1A 4D0SA 4UEJA 1HDCA 4YTEA 4BO6A 5TT1A 3PYLA 1DRWA 2QZ9A 3P19A 4WOKA 4WLNA 2LDXA 2X5KO 3WGHA 1ZK0A 3LF1A 4B3IA 4WPGA 2PTGA 5G4KB 1B7GO 3KTDA 2WYUA 1SPXA 5TLSA 1MC4A 1QYCA 4ZA2A 2JFHA 2EW8A 2J3JA 4IDBA 1LDGA 4R69A 4R54A 5FWNA 3AWDA 2HJRA 2O2SA 1ZMTA 4XDYA 2HMUA 3CEAA 3O26A 2Q1TA 3PPIA 4JJFA 1P33A 2BFMA 3H4VA 1NAHA 4J0FA 4TRJA 4GMFA 1FXSA 4NNJA 1QG6A 1I3LA 1JVSA 4XQ9A 1P3DA 3JQBA 2HU2A 1I01A 2VUUA 4AVYA 3W6UA 4II2A 2POQX 4TZTA 2GASA 2VTEA 3Q9UA 5CDGA 5ITVA 1N1EA 1R0LA 4RVHA 1BSVA 1F17A 1I8TA 4ZJUA 3LC2O 2FY8A 1E3JA 4CUZA 2X22A 4NJMA 4YJGA 5JY6A 2AA3A 2FPPA 1U28A 2TMGA 2IYOA 1D7OA 4DPKA 3Q0EA 4IJVA 2GO1A 3KYCB 3D1LA 3D4OA 1NWCA 4AL4A 2WMDA 2BF7A 4N5NA 1IY8A 3G79A 9LDTA 4CM4A 2I5PO 2BFAA 3QVTA 5MDHA 2W2LD 3V8BA 4XYLA 4MPDA 3DBHA 2I3GA 2B5WA 4JBIA 3NRCA 3WBBA 4W7HA 5GY7A 2Q4EA 2ZIZA 4RPGA 4NBUA 3G3EA 1JU9A 4KDFA 5ICSA 2R00C 4DBVO 2X9GA 1V35A 2AHRA 2OFPA 4CM4B 3HWRA 1BHSA 1KOLA 3NDJA 5BSEA 4DYDA 1QMGA 3DBHB 1JAXA 5KKCA 3EVNA 3GVPA 4TVOA 1EUDA 1NQ5A 1CERA 5L3ZA 4GGPA 4ZD6A 3WJ7A 1HRDA 4CR7A 4DA9A 1GCOA 3DB2A 1HYGA 3ZW8A 5DDIP 4U8GA 3AK4A 2RBEA 5CP8A 5AOVA 4IJKA 3KYCA 1LC0A 4E6PA 1LLUA 4BO7A 1QYXA 3LLVA 1I2CA 4JQCA 5I7FA 1HZZA 4RVFA 3G17A 3WS7A 2B83A 4RPKA 4WLEA 4EJ0A 4CQLB 3O8QA 3RQSA 1E7SA 4IQGA 4AJLA 4MKZA 4J4HA 3WXBA 2J5RA 1Z7EA 3ZWNA 2J5KA 1SCUA 4U6QA 1C0PA 5LC1A 3U0BA 5T57A 3UXYA 3D4PA 2PLAA 2GDZA 2VOJA 3PQFA 1BW9A 2OGUA 3PYXA 1E5QA 4CMIA 4HBGA 3JQFC 2Q99A 1U8FO 1I3NA 4E2YA 1F0YA 2X7HA 4CQMB 3OF2A 3ASVA 4FDAA 3DXFA 3EW7A 2PD6A 4WASA 5A3VA 5BNIA 3ZWVA 2J3KA 3RUHA 1EVYA 5B4UA 5CHEA 3G49A 4D41A 4TWRA 1HL3A 1S7CA 4GSLA 1HDGO 3RSHA 3RUEA 2XPCA 3QVXA 3IUPA 2W8ZA 4MKXA 3EAGA 3SLGA 5KWEA 3ENNA 4ZRMA 5JW6A 3DBRB 4EEXA 4IS2A 4K26A 4Y6RA 1XEAA 1KVSA 1FK8A 5CDYA 1B16A 3S8MA 5C7OO 4GLLA 1WXDA 3EGOA 4BHTA 2FHSA 3MJEA 3RKUA 1DIHA 2IEBA 2NU8A 1Y6JA 5TIIA 4BO9A 4BO4A 2GD1O 2D4AA 3DQPA 3MJTA 4CM9A 1ZCJA 2YQ4A 3DOCA 5IF3A 1WDKA 4ALLA 2IEDA 5JMWA 2YHIA 3QLJA 5KKAA 2HMVA 3BHJA 4Z9XA 2ET6A 5MGBA 4A7PA 1YS4A 3QQPA 3STHA 2JD1A 4Y98A 2YQ5A 3GVCA 1XQ6A 4ZN6A 2WDZA 1ADBA 3HFGA 1PR9A 1MFPA 4R01A 1PS0A 2J8ZA 4MVJI 4E31A 3D3WA 1ARZA 3AUUA 2C7GA 3RBVA 1YE3A 3VPSA 4IDFA 1A4UA 1ZSNA 4N7RA 3WQRA 4CV1A 1BXKA 3D7LA 1YL6A 1U3VA 2AW5A 3OJFA 3DHYA 3F4LA 4BO0A 3QW2A 4AJ2A 2PFGA 1ZSVA 4FOSA 2I66A 3GDGA 5L7TA 5A9SB 3WWZA 2C5EA 4YEDA 4UUNA 1IZ0A 2X0RA 2Y66A 5G0SA 2Q50A 3BXXA 4BNZA 4CMKA 1YGYA 4HUJA 1C14A 4UUOA 2BKAA 4NR0A 5I8WA 4DXHA 1P1IA 3UKOA 3INGA 1NM5A 1ZJZA 2CMDA 2Q1UA 5F1PA 3V5NA 3MWDB 1HZJA 2ILTA 3GA0A 3MZ0A 4AFNA 3RUIA 3H9UA 2PWZA 3GT0A 2UUOA 3TQHA 1A9YA 2OO5A 3PJGA 1QYVA 4OXKA 4JGBA 3PFFA 3HADA 2HRBA 2DBQA 1JLLA 2AEMA 3BTVA 1GAEO 2QW8A 1EBFA 1N5DA 3IP1A 5EQDA 1UDAA 2VT2A 2PNFA 3H5AA 4LISA 2IZ0A 2PA3A 4UVEA 4Q9NA 5JO9A 1N2SA 5EINA 3TNLA 3E5RA 5L45A 3IS3A 4IM7A 4PZCA 1PWXA 3D3WB 3WDSA 2VZ0A 4A26A 4XYMA 3ITDA 4YJDA 1WDLA 5DOVA 4CM9D 4R1UA 4YT5A 1NP3A 3O9ZA 4TSKA 4X54A 3TZHA 1ZMOA 3AM5A 3L4SO 4XR9A 1QV7A 1CQJA 2WEKA 2R00A 3F1KA 4KQXA 2J3IA 3BMNA 7MDHA 1GQYA 4BNJA 4C7JA 4KWHA 1W8DA 4NK4A 5K9ZA 3OH8A 1PJ3A 4BMSA 1UXKA 2O4CA 5T6BA 1SEVA 2EW2A 3NX4A 4J7XA 4UVGA 3Q1LA 5THKA 2EP5A 1NHWA 2GPTA 3W8EA 3FWZA 5JBIA 3ETGA 3ZW9A 2JKVA 1B8PA 4FW8A 1V0JA 3PRJA 2DUWA 2G17A 2QYSA 2PK3A 4DQUA 3UCEA 3JV7A 1L7DA 3FPCA 1GZ6A 3GQVA 3JQ9C 4RLHA 1EUCA 4ND3A 5G2OA 1BXGB 1X0XA 4XJSA 4E2WA 1HT0A 1KEUA 3PEFA 1ID1A 2VNSA 4YWJA 3H3FA 3VH1A 3VPXA 3WG9A 1D1SA 1U5CA 5LDGA 3OIFA 2HSDA 2O3UA 3E9QA 1C1XA 4LGVA 3GGPA 3JTMA 3U4CA 2HMSA 4YJFA 2F1KA 5CG2A 1NTOA 3RASA 4FFMA 1LLQA 2NU7A 4RO0A 3WB9A 1PJCA 1BW9B 3LLSA 1DC6A 2P4HX 4FFLA 3VDQA 3WLEA 1UJMA 1V3TA 4JN6B 4ZRNA 1ZEMA 4E5MA 1GZ4A 4WLVA 1Y81A 1IPEA 3ZHBA 3T4XA 3NUGA 3BA1A 3HDHA 1NVTA 4PLVA 3K2BA 1V3UA 5GMOA 1W6UA 3ROPA 1U5AA 1O8CA 1UAGA 1HSOA 2OOSA 5DN9A 1H6BA 2XAAA 3ONDA 5CG1A 4B3HA 3ZHXA 1PJSA 4IQ8A 1A4IA 3COSA 1GR0A 4EDFA 2Y0DA 4RORA 2EXXA 1HETA 1U7TA 5B1YA 3C85A 1H2HA 1J0XO 3CXRA 2Q4BA 3ANNA 3PDJA 3VPFA 1XGKA 1NFRA 3GEMA 4BGEA 1QRRA 4MVJD 5IN5A 2LDBA 3ROQA 2P2SA 2O3QA 4NK5A 2AQIA 3AY3A 3IMFA 4K6CA 3KOUA 4D3DA 2RCYA 1Z75A 1E1LA 3IIEA 3F46A 1BVUA 5KTKA 1X7HA 4UREA 4YJFB 3F47A 2NVBA 1C1DA 1KVUA 1ZEJA 3RIHA 3K92A 1SZJG 2HMWA 3MEQA 2RAFA 5IJZA 2VZ8A 1SMKA 1VJTA 5G4KA 1NFQA 1R37A 2YUTA 4CLEA 3ZDFA 2NVWA 4G2NA 5K0ZA 3FNGA 1MUUA 1LDBA 2ZCUA 5CPFA 4BNIA 4MVJA 3ZHZA 1Q2XA 4IPTA 5L53A 4ALIA 2UAGA 5JO0A 2PGDA 3UCFA 2PZMA 2PKRA 4PLTA 1SO8A 3R6DA 1PU2A 1JWBB 1NNUA 3GZ4A 1I36A 1GQ2A 2Y99A 1VRWA 3DZFA 4OJNA 1P0FA 2PGJA 3OFSA 2E48A 2ZTMA 4W82A 2J5QA 3OJ0A 4Q3AA 3PI7A 1A72A 4IQ0A 2O3RA 2RH8A 4PRLA 3RAJA 3JD2A 3BAZA 1WMBA 2X0IA 4XIJA 2ZB3A 2G1UA 1OI7A 3DZBA 2SCUA 3BMQA 3PTZA 4IIVA 3K2EA 1N9GB 1PJBA 2NVUA 1E77A 3TL2A 4LW8A 5L7YA 1OC4A 1MXHA 2PKQP 3FNFA 3NAQA 1Q7BA 3L0DA 1A5ZA 1MX3A 1A71A 3JQ9A 3JQ7B 4MP6A 1W0CA 4ND5A 1M6WA 2IYPA 4R4JA 4FD3A 3ST7A 4P22A 5HTOA 3ZNOA 3QP9A 1MFZA 5KNLA 2VZ9A 4J1QA 3KSUA 3GVIA 2VT3A 4ESOA 3LU1A 4W9NA 3WNQA 3KETA 4YRDA 3LK7A 3NT4A 2OBYA 3WFIA 4J1SA 2G5CA 1Y1PA 2IRWA 3RU7A 2VUTA 4PVDA 4QEDA 3AOGA 2EJWA 1IULA 3H6KA 5HM8A 3KEQA 1CYDA 4JIGA 3V1UA 1LQTA 2BH9A 4TZKA 1CRWG 1RM4A 4KUGA 3GEDA 3NV9A 1GYPA 1G1AA 2ZJ1A 2QRLA 3H5NA 4I5DA 4EUEA 4OO3A 3ORFA 4B7CA 1LSUA 4N18A 4MVJG 2IZ1A 4J4TA 3S55A 1EQUA 3E9MA 3FBGA 3MTGA 4NIMA 4R41A 5CDTA 1I10A 3UUWA 3RUAA 4KUEA 3L6OO 4R3NA 4XQGA 4WNIA 4CMJA 5AXDA 3QRWA 3SC6A 3PK0A 2VWPA 2C07A 5GZ6A 1SB9A 2X0NA 3I23A 2HKIA 2VYND 3RC9A 1EE2A 4GI2A 4OGWA 2DPHA 2AG8A 4BOYA 1ISFA 3PQEA 4CMIB 3GUCA 2A92A 3VHRA 3WMWA 3ZNPA 1R4NA 3LVFO 4J1NA 4IXWA 3E9NA 4XJTA 5KVCA 4G65A 4CM6A 3NJ4A 4Z3KA 4GQAA 4XB2A 4A27A 2W2KB 1NVGA 4Z3DA 1FF9A 4NPCA 1WW8A 3FR7A 3VC7A 1EBUA 2DBVO 4I9NA 4WJZA 4JNKA 3WIEA 4WLOA 5IG2A 2VN8A 3TFOA 3LZ6A 2JCYA 3AI1A 4IGFA 4ND4A 3TRIA 3V2UA 3DBRA 1FDWA 4OM8A 4CLXA 4BNKA 3S1LA 1J6UA 1YDWA 1NASA 3VH2A 1B26A 3EK2A 3JCZA 5KJCA 2DAPA 1VL0A 5A1TA 3C1AA 3JQGB 2FZWA 3QV1A 5JAZA 2DBZA 3N7UA 1W4ZA 1U1IA 4YJHB 4J2OA 1QSGA 1JQBA 4OOEA 1R16A 1BWSA 3K30A 5ILOA 4I08A 1VM6A 4EITA 5CEEA 1KS9A 3Q2IA 4A73A 3R3SA 1Z73A 1GCUA 2RIRA 1K6IA 4R3WA 3H2SA 1HXHA 4URFA 5L9AA 4A0SA 4M49A 5JFOA 1EFKA 3L6EA 1XA0A 1B3BA 3P7MA 3VPGA 4Z6KA 4GWKA 5F21A 2Q1SA 3OHSX 4TRNA 3GC6A 1DLIA 2IXAA 3TZ6A 4J3FA 3LT2A 3I4FA 1QLHA 4F46A 4YJGB 4XR4A 3WJAA 1ZXBA 3OICA 1ZO8A 4PLZA 1E7RA 1Y5MA 5DBIA 4QTZA 5EIOA 1EMDA 3I9NA 2YDYA 4KWIA 5A4DA 1NR7A 2DT5A 1QKIA 3Q9NA 3PIIA 4HFJA 2VRCA 4PLFA 3DZIA 1X13A 3UOGA 1ZK4A 3VVBA 3GFGA 5G0WA 4BNFA 3RWBA 1TI7A 1D3AA 1KC1A 2GGSA 3GY0A 4IJUA 3LC1O 3QVWA 1U8XX 4GH5A 4EI2A 4BKPA 5IDQA 4IS3A 3GF4A 4OXNA 4UEOA 4JBGA 1ZXLA 1M6HA 2DQ4A 3LT4A 5BR7A 1TA4A 3BTOA 4E33A 1KIFA 4TKLA 4CUKA 1E3EA 4NFSA 3JQCA 4DRYA 1YOVA 3WGGA 3HQ4O 4RPLA 4O5OA 4OYRA 3AM4A 2AXQA 3TZKA 1FDTA 3OBBA 4CM3A 2E82A 1WNTA 1YH3A 4O59O 4B4UA 3SJ7A 3MOIA 1J4AA 1Z6ZA 3I9OA 4TKMA 3M1LA 2VOEA 4GVXA 3PHJA 4WNCA 4L73A 3JQ7A 4XRRA 4LSMA 4PLCA 1MP0A 4HX5A 3ZN2A 5LDHA 3VKVA 1IOLA 1MV8A 1PZHA 3O8QB 3P2YA 4FFNA 1PJTA 4HNHA 2HQ1A 4M1QA 3KXDA 4ND2A 3MJ4A 3DMYA 4P4GA 4E5KA 1B8VA 4PG4A 4I9UA 3HUDA 3B20A 1IZ9A 3IOYA 3W4KA 1LLDA 3EHEA 1DXYA 3BMCA 4GL4A 3SC4A 1PWZA 2CVQA 2ZQZA 4CLRB 1HDRA 4CMCA 4IGEA 4PLWA 2X1HA 3PQDA 1XU7A 4XWYA 1C1XB 3V2HA 1B2LA 3JYOA 4RF2A 4YQZA 2Y0CA 1GZ3A 3ZV6A 4D43A 3NT2A 2P5YA 2QYTA 4NBWA 3RROA 1H9BA 4YRAA 4EJMA 5T64A 5ENDA 3KYDA 1I3KA 3OEWA 4G5HA 3A9WA 2G82A 1QXSA 1DO8A 4ALKA 1XU9A 1YBVA 5EESA 5FEUA 2VHXA 2IZZA 1ZIDA 1LSOA 2I65A 2VHVA 3N74A 2W2KA 3OJEA 1MG0A 2HDHA 1M2WA 3O4RA 3B1FA 1UXIA 4OSPA 4IIUA 4U0JA 4FB5A 1QORA 4PG8A 3EYWA 5IFLA 1I0ZA 3RI3A 4KMSA 5ICMA 2NUAA 3PXXA 3I1JA 2YZ7A 3ZV5A 5JSFA 4LMPA 1B3RA 4D42A 4WE3A 2O23A 2HUNA 1DLJA 3W8FA 1WAMA 1GUZA 1I2ZA 2EP7A 5TJ9A 1LBEA 4MO2A 5LCXA 4ROSA 4PFJA 3UH1A 3ZNQA 2ZQYA 3DL2A 1P45A 5TJHA 1HE4A 4RF5A 3NTRA 4YCAA 1ADCA 3TN7A 4NDNE 4JP2A 1CWUA 3GNTA 3JQAA 4J7UA 4BNLA 2NLOA 2JJYA 3VH4A 2H5LA 4LK3A 4EGFA 4L4RA 1E3LA 4CPDA 3GHHA 4BQRA 3UVEA 4WECA 2Q3EA 1WLYA 3NDIA 3Q6IA 1U3TA 1Q7CA 2E4AA 2WJPA 1VL8A 1SAYA 4FCCA 1GD1O 3CE6A 3F9IA 2NTJA 4M54A 4NBRA 4WK6A 1XDWA 2Y1DA 4HP8A 4LMRA 5DNAA 2UVDA 1GEEA 4J91A 1LRKA 3ZNNA 4NMHA 3ZZNA 1GTMA 4UUMA 4YA6A 3QIVA 4Z0HO 4WCFB 3TZCA 3U4DA 4EEZA 1VSUA 4AG3A 1PJQA 3BMOA 3E1KA 3UCXA 4ZU3A 2YV3A 4EZBA 2HK8A 3QWAA 4MP3A 4EUFA 5ADHA 1HE5A 3C8MA 3F5QA 4KP7A 1T4DA 4RF4A 1FJHA 3BIOA 4U6SA 4TRMA 4WEOA 5L4SA 3EY4A 1DAPA 2HRZA 2ZTUA 1P1JA 1BMDA 3ETDA 3DBLA 1CQIA 5G0VA 5KJEA 4FGSA 3WOHA 1NQOA 2FPGA 2B0JA 2NADA 5I7VA 4XD2A 2EKQA 3DAFA 1Y5RA 3U4HA 3DONA 4QSMA 1HE3A 1ISJA 2BGKA 4Q3EA 3VH3A 3AFNA 4W7IA 3S2GA 4DMLA 4EUHA 3WX0A 3PWKA 2A4KA 3DOOA 3A4VA 4XGKA 3CINA 4XDZA 2BI7A 3AJRA 1ENOA 3SEFA 1K2WA 3GGOA 4NJMB 4R5MA 4EBFA 4DLLA 4OAQA 1LRJA 1PS8A 1PJ2A 3C3XA 3HDJA 4J7CA 4ALMA 2WWRA 4XYGA 5BQFA 2NM0A 3S2FA 4E2ZA 1MXFA 2O7SA 4DPLA 3FCOA 3DO5A 4DC1A 5EERA 1DEHA 5L51A 4DYVA 4KZPA 2GZ2A 1BTOA 1GDHA 5HBRA 4CLDA 4BGVA 4H3VA 4NFYA 1I33A 4B4WA 3PJFA 4CM1A 4RPJA 4NHEA 2X5OA 1PGPA 1ZUD1 1LX6A 2QRKA 4PZDA 1EDZA 1T2AA 3FD8A 3E48A 3RVDA 4BNWA 1DC4A 2BMAA 1A9ZA 1I2BA 1E0DA 1GFSA 3L4BA 4N5LA 1N8KA 4PRKA 4LCJA 3U62A 3QWHA 3ICCA 2CF6A 3JYQA 3D5QA 1SB8A 2JHGA 1IB6A 1LEHA 4RV9A 5L7WA 3WGZA 5JDIC 5JCJD 5TX7A 1CIVA 1HLPA 2ZJ0A 4BGUA 2GN8A 4PLHA 2GNAA 4Q3BA 4CLRA 1SEPA 4KOAA 4UVIA 1I3MA 3KSDO 1MGOA 4RQTA 4ND1A 2W98A 5COBA 3FR8A 4PZEA 4D46A 4KQWA 3FPLA 4Z0TA 1LA2A 1YQGA 3PJEA 4IY1A 3WSVA 3TZQA 3PLRA 1PQWA 1P1FA 3FHLA 5EJ2A 4IDGA 3P5SA 2VWHA 3AU8A 2ZYDA 3IKTA 1U4OA 3ZGYA 2YHIB 3HZZA 1ZK1A 1R15A 1PZGA 1EDOA 3RUCA 1CF2O 3PWZA 1B14A 3ADOA 5IDWA 2Y1CA 2GSDA 1SBYA 4L4SA 1RPNA 3EZLA 2PY6A 4BQPA 1DC3A 1ZKMA 2AQKA 5F5LA 2E37A 2UV8A 3KYDB 5CDSA 5JCJA 5JY1A 1E3WB 3HDQA 2EHDA 4RVUA 2HLPA 4IDEA 2PD4A 2EGHA 3CZMA 4J1TA 2HK9A 4DWVA 3GLQA 1IYZA 3JQGA 5I7SA 4JX8A 4GMGA 3A28A 3TFQA 1PL6A 3SLKA 1T2FA 2B5VA 1R6DA 1U3WA 4QO8A 2B37A 4RVGA 1T4BA 4UAGA 5A9SA 4RGBA 2YFQA 5CDUA 1MC5A 1E1NA 2NWQA 4KTVE 4CV3A 3VAZA 1T1RA 2FN7A 1E3WA 1RYEA 3OIGA 4R1SA 3M2TA 4FPXA 4JBHA 3VOSA 5DBFA 3K31A 1JN0A 4J0EA 4UULA 1P77A 1EVJA 2YY7A 3FSRA 3IJPA 5IZCA 5C5IA 3AW9A 4YT8A 3ZV3A 4JP3A 4BKQA 4IZIA 5HA5A 4ONEA 5TSDA 1V8BA 3OA0A 5ES3A 1EVIA 1G6KA 2VWQA 3ZU4A 1LTHR 2B4QA 1UXGA 3PHIA 4PGFA 1O94A 3I9KA 1C0LA 3WQQA 3L9XA 5A05A 1LXCA 3AY6A 3QSGA 1IUKA 4RPHA 3GAZA 3UW3A 5HRUA 4M87A 5H81A 1VPDA 3WFJA 4CODB 4K9DA 2D8AA 4AJEA 3AM3A 1ISMA 4YACA 4A5OA 2TMDA 1E7MA 4NBVA 1Y7TA 4NZ9A 1N92A 3ZWAA 1YB5A 3ZU3A 3WLFA 4ZQGA 5JDIA 4RZHA 2NU6A 1ZK3A 4BO5A 3PLNA 2CUKA 5BSHA 5AQ1A 2A35A 5F5NA 1Z45A 1R4MB 1Y9AA 1WZEA 3HE3A 1YVEI 3K8ZA 1Y9EA 3GRPA 1HYEA 4FR5A 1PZFA 1G0OA 3K73O 1O95A 1NPTO 2WSBA 4PLGA 3DOJA 5CEJA 4B8ZA 1BXGA 1HDZA 3CSDA 3UN1A 3GZNB 4BKUA 2C59A 4YPOA 3JD0A 2I3AA 1E7WA 3E6AA 2H6EA 2VHWA 4HV4A 3NEPX 4E13A 2FPIA 3U3XA 3GVHA 1RJWA 1EFLA 1P44A 1P1KA 2C82A 1JVBA 5KVVA 2UYYA 3U9LA 4LRSB 4FJ0A 1LUAA 5B12A 1PS9A 4K6FA 1WDMA 3ZWBA 5FYDA 2Y67A 3VZPA 4XGNA 3HDYA 4LN1A 3VKUA 1O0SA 3SXPA 1X14A 4IBOA 4AJKA 5FI3A 1KY5A 1HDXA 1KYQA 1L1FA 4BO8A 1SC6A 3BMNB 4D45A 5JAIA 5KVQA 1FDUA 3C1OA 3K6JA 1ADFA 3RU9A 4O63O 1R4NB 4WEQA 4R9RA 2WD8A 4S1VA 5TF4A 5EQFA 2QG4A 4GKBA 1F8FA 2X0JA 5JAQA 5L4LA 2H1SA 3GUYA 4BS9A 1UDBA 2AMFA 3C7CB 4IMRA 3WYBA 3I5MA 2FSVA 4KUHA 4FJ1A 3G0OA 3X2EA 5JC8A 5C3MA 4NJOA 2O48X 3H65A 3IL2A 5GZ1A 1JWAB 3HN2A 2X6TA 5JMPA 3ONFA 4TMFA 1ZSYA 1X7DA 3HHPA 3L4BC 1YL7A 4CMEC 5L40A 3FWNA 3ZWPA 3C7AA 2ZATA 1DB3A 5U4QA 7ADHA 3R3JA 4RQUA 3JYNA 3PJDA 3PIDA 1E7QA 5DULA 4II3A 4BNVA 1F12A 3V1YA 4D7AA 3H3JA 4GX2A 3L77A 3CIFA 2C7VA 3DMTC 3W4JA 3T7EA 1HYHA 1ENYA 3ULKA 2EJVA 4GKVA 2JCVA 2PH5A 2VUSA 2IODA 3DZGA 1VE9A 4IDDA 3GG9A 2CDAA 3QJ5A 4AJJA 2X9NA 3C7DB 4L4XA 4FC6A 4M8SA 4CMBA 1C1DB 3JQAB 3LQFA 4E5YA 3FBTA 3WGTA 4YXFA 1Z82A 2QX7A 1PTJA 2QIOA 2H9IA 1Z7BA 3HJAA 5KJ1A 5IAAA 3TF5A 1B8UA 1VKNA 2GERA 3INTA 4FGWA 1E1KA 1X15A 4BGIA 4LVCA 4YAKA 2EV9A 4I9HA 4FBGA 1PQPA 2YDXA 2X5JO 2ZK7A 3OQ1A 4NBTA 1DPGA 4NI5A 3AI3A 1KEVA 2ZB7A 5DT9A 4K1LA 8ADHA 1S6YA 3ON5A 3CMMA 1LI4A 4Q3DA 3EC7A 2RH4A 4IUYA 4L8VA 4PCVA 1K6XA 4L74A 4GVLA 3WGIA 4M86A 2OBNA 1YBMA 2ZB4A 5KOIA 4ALJA 2EEZA 1ZH8A 4HWKA 3IP3A 3MCVA 1MA0A 2O3JA 3DBLB 4Y67A 5ENVA 1ISIA 3OJOA 4ZQBA 5F3RA 2V65A 4XIYA 3KLPX 3RUFA 1LDEA 1ENPA 1UDCA 3H9EO 4GAEA 2ZB8A 4QUKA 4UUPA 2BHLA 2GN9A 2XF8A 2HMTA 3KYBA 5U1PA 2PKQO 1U2GA 4BNXA 2Z1NA 5I9NA 4PLPA 2IE0A 1KEPA 4FOOA 3F3SA 1NPYA 1DJQA 2PV7A 3E18A 4BV9A 2Q49A 2UUPA 1YKFA 4YQYA 4MINA 2ZTLA 4YRBA 5BNTA 1KERA 3FNEA 2NNLD 1IL0A 3OQ6A 4L0QA 2Q1WA 1U3UA 1HF3A 1DDOA 1BG6A 2DVMA 2DTXA 2EIHA 3F4BA 3RD5A 5HS4A 3W1VA 1XIVA 2Y1FA 3RJ5A 4BNTA 2BGLA 1QV6A 3GH3A 1RWBA 4AJNA 2EERA 3T7CA 1E3SA 1O89A 3GPDG 1ULUA 5FFFA 1UZMA 3I4CA 4Q3CA 3LT0A 3TOZA 4GGOA 4C4OA 3H7AA 4AICA 4HNGA 1PGNA
chains in the Genus database with same CATH superfamily
4W4TA 2ORIA 4FS8A 4IVRA 5LYJA 4OBEA 3ESCA 1C7EA 1PNRA 2KBEA 1QTNA 2DUUA 1S9HA 5ETJA 2V03A 3BTUA 3CKLA 5DHQA 2HJGA 2IZOA 5JIBA 5LZ4A 1OT5A 4JXKA 3WWEA 2B99A 3KV3O 4GLOA 3A06A 4MCIA 1L4LA 1YHZA 1M8GA 1EJ2A 4D4GA 4UEKA 2GN6A 2C61A 4BMNA 2C29D 5F9FA 3GRKA 1J09A 3H0EA 3L84A 1G59A 5FUQA 1GUYA 4KFTA 2PD3A 3PZBA 1BJTA 3HCNA 3V3TA 1IONA 1BE6A 4MS1A 3A05A 2ZM5A 1P9LA 3O38A 3T5MA 3UB4A 4JITA 1UBEA 3B6KA 4YJ2B 5TT0A 1EPUA 4Q7KA 4DLRA 3IJRA 4RZIA 2CDCA 2VQDA 4O2BB 4WK4B 1NX6A 1K86A 4OHBA 3LGXA 5DGXA 3TLXA 1V4BA 1WHSA 2OP0A 3ET4A 5EYPB 1WW3A 4C22A 1P6QA 1RWQA 1VMEA 2MU1A 3IE1A 5BNFA 3PWSA 3SSOA 3ZHYA 2BSAA 2H92A 4DFDA 4F45A 1BGVA 4L0MA 4P38A 1PDOA 1JR3D 3BWMA 5HVNA 1AXGA 4IKEA 2VK1A 2ZSJA 4QQNA 1OSNA 4YUYA 4AJIA 1H2BA 5BN1A 2CNBA 3PR2B 3DEYX 3MN1A 1NVAA 3T9AA 2HK7A 1K9SA 1JZSA 1WSBA 2BUAA 4Z0NA 3EDYA 1USIA 3QVOA 1Z4LA 3MCZA 2YR0A 4L7QA 2GN4A 3HKEA 3HSKA 1QRAA 3FFXA 3SBXA 1Y8RB 3WGUA 3HR4A 4R8MA 2J0QA 4HLUA 3ADKA 4ZZ1A 2VDVE 1SUIA 2ZUBA 3BFKA 3QPDA 5FWDA 2ZIWB 3ICVA 3UJ7A 2CFCA 2J85A 2YMLA 2Z2YA 3FG9A 4URYR 5THQA 3QU4A 4BU0A 1JG7A 3HB0A 4UD6A 2G83A 5IDXA 1WKCA 4AJHA 1H69A 3VSDA 1DJPA 1GRCA 4KE8A 4AJ4A 4F60A 4ZIRA 2OC4A 4LCEA 1JHYA 4L8FA 1RM3A 1VPLA 1D03A 3DWFA 1U6IA 3E03A 3ETEA 4I4LA 5B7NA 2I7XA 2AN5A 2QZPA 1Z37A 1J2TA 3DFKA 3D5TA 4BE7B 1VBKA 3NHBA 4D57A 2BJVA 3AX6A 5IW8A 1GPH1 3MLAA 5KHOC 1UEJA 5J4HA 2QX4A 4XGIA 2AXNA 2JIQA 1XPUA 3CR8A 1KKUA 1GSIA 1VHJA 4KXYA 4ZCSA 2CXHA 4YBRA 2ODAA 4DDTA 2GEJA 3WYFA 2I6TA 4UXHA 4DJTA 7REQA 3IOBA 4JLKA 3R0ZA 4PHHA 4Q3NA 4V0RA 3TM4A 4HSEA 4EYKA 1ZFNA 3BICA 1ZESA 4RHUA 1GVNB 3EBPA 4JP8A 3EVTA 4WNAB 2Y1XA 4GEGA 4EKDA 5DE3A 4Q16A 2C2WA 4GW3A 1Z4MA 3RCBA 3RFFA 3RRBA 4AJPA 5D8DA 3RHTA 4LZNA 5CT9A 1DKOA 4CMHA 1N33B 4CQJA 4YIHA 2LRHA 1T2DA 3LDUA 2FN4A 3IV7A 3A4MA 5HYVA 2QMHA 3SLRA 2G28A 4MWEA 5EI5A 1FYXA 3X2FA 1M6YA 1BHJA 2BLLA 3ZJUA 1NHGA 1ATZA 3WLTA 1BCRA 3AYXB 2B21A 3I76A 1AKTA 2FW1A 3AY0A 3SICE 2CXOA 4V0NA 4EA9A 3FOWA 4N6OA 4DM7A 5A4IS 2H8GA 4V1CA 4GHWA 1OWNA 3L4KA 3H5IA 3I9JA 3SIXA 4AY5A 4XVQA 2MYTA 2QQEA 4UNSA 4L22A 4WHMA 5AJHA 4DL9A 4LNHA 4YJ3A 2BMJA 3I3OA 1PR5A 4MKHA 1GADO 2QLFA 1UP7A 1EG2A 4DQDA 5F12A 3TDKA 1IJFA 3KD2A 4LGMA 5A0VA 5DBGA 3DOUA 2DPGA 4PWZA 4QARA 1Y8AA 1Z28A 2C2BA 3MFYA 4K87A 2EJBA 2H7VA 3H8VA 1WM1A 1VFNA 3IIKA 2EC5A 4IF4A 4DNPA 4ZYXA 4IJ5A 2O8DA 5CH8A 4ZMSA 3UGQA 3E5NA 1Z6PA 4F4CA 2VIIA 5AHKA 4D5GA 2GA8A 1P0QA 3OQVA 1QYIA 5TS2A 3PJRA 2CJPA 2HJWA 2O7QA 4LBWA 3ICEA 3UKOA 5I4KA 3ZI4A 3C24A 1J7KA 1LSJA 2B1RA 1XZAA 1UBNA 3HBAA 1SUCA 2YWDA 3I92A 4UE6A 1AO3A 2PV0A 2FZGA 1ODCA 1VXOA 5E8JA 2XD4A 3R1IA 3R5TA 4HX2A 5L4NA 1ACLA 4CR6A 1FDRA 3C8HA 5AK6A 5AVOA 4ZEVA 3LUHA 3PFKA 1PUXA 3IB6A 3EZFA 5EEHA 4WXRA 1IN7A 3CW9A 2WM8A 5DOZA 3WIBA 4E03A 1FRFS 1QO0D 2OA0A 1TQ6A 5F33A 1CETA 3GAFA 2AEFA 1NQTA 3BWDD 2R44A 5CK4A 2AZ4A 1E0KA 1M0EA 5FXMA 2FPSA 3YASA 4DOMA 4E4TA 3LOPA 1H4TA 3IESA 1OZAA 4NU8X 4CIVA 1LD3A 2NMVA 5ECGC 2QRQA 4Q6BA 4MRAA 1LFAA 1JEAA 5ALIA 2IIBA 4PLYA 3WWPA 1WHTB 3WMGA 4N8DA 5JS6A 4P4NA 3IHKA 3S81A 4A1OA 4W8OA 3PNLA 3SEQA 2QAGC 1GYRA 1EJBA 2IZ7A 3WOVA 2JCBA 4BV8A 1CUEA 5CVCA 3FGNA 2Q5OA 1J8QA 4LHEA 4WCDA 1QF7A 4GP7A 1KMCA 1E9FA 1OV6A 1Q17A 3MD9A 2LZ0A 1YJ8A 3DZHA 1EFRA 2WWWA 2NTYC 4TL6A 4PFKA 4ZOCA 1KDYA 3TEMA 1X92A 1DHRA 2ZE6A 3D43A 3QI7A 4RL6A 5FI5A 3KK0A 5JBNA 4WZZA 2VDLB 3OVMA 4AWAA 1AB6A 4OGLA 5K3OA 1CNMA 1MABA 3LWNA 3STTA 4CTMA 4DDWA 1US8A 5EZQA 1NJFA 3QLVC 1OBVA 1AKQA 1GKYA 2OCPA 3NHZA 1ZVKA 1R12A 3LWZA 3C70A 4QOIA 5K1ZA 1C7QA 4RY2A 4ESEA 1KDOA 3K6RA 2NPFA 2AYZA 4QUAA 4RE6A 1EFPA 1Y4SA 3ZWQA 1KHTA 4FKZA 2X8AA 3QA9A 1Y63A 1EHIA 1AA6A 4Z4IA 1V1MB 3SQDA 3UGKA 4YHBA 1HURA 3B6MA 4DG8A 1U99A 5GVRA 4BQNA 1AG9A 4V0MA 3FYDA 5TQ0B 1UKCA 2CE7A 2Z98A 2OORC 3VYVA 2K7FA 4RF3A 2RG1A 4KAFA 2G80A 5KSZA 3DDHA 1EFRD 2QR3A 2Y6VA 2CT8A 3GGSA 2ZI5A 2FMUA 4HVLA 3DFZA 2WNIA 2A7XA 1UK7A 4H59A 2ZRCA 1NVFA 2BCJQ 5DHTA 3TW0A 2HT1A 3G1UA 3O74A 2PUJA 3FIUA 2ODBA 4MGZR 1DAKA 1DC5A 4DEXA 3QUSA 3S8YA 4IFTA 2OL4A 1JHZA 5ALNA 4BVBA 4EWLA 3I34X 2VPPA 4DV3B 2HA5A 4J4BA 2F7SA 1Y3IA 4WZBB 3TH5A 3PS9A 3VUFA 1R5OA 4MDFA 1L4NA 3GJ7A 3KUXA 1VIVA 1P1CA 2JCSA 1YRLA 4I5FA 4IHQA 4UM5A 1P4HA 4MYSA 3FYSA 1XHLA 1TA0A 4ZOAA 5H4GA 2LGJA 1JEDA 4MGEA 4LV8B 1VIYA 1PNTA 1PSDA 1ESDA 3LUAA 3I52A 4YDQA 2NZYA 3W4IA 2FDRA 4J07A 1T2EA 4YV1A 2YYYA 4ID9A 4HO1X 5KWIA 2QD5A 5JLAA 1WXEA 3FZQA 3IH5A 2H08A 3D6VA 1JHXA 4GXTA 1DKUA 1KYWA 3KHUA 2Q3DA 2QWXA 3EIFA 4BC0A 5LMCA 3SVTA 5AWFC 1JEQB 1Q7GA 2ORWA 5HMLA 4D44A 1V11A 3V55A 4K3VA 2AX3A 4OB7A 1VG8A 2ZPAA 4AG6A 1XZBA 1JG4A 3GLKA 4FBLA 2ZIAA 5AYVA 3V7FA 2GK3A 1LQUA 3F0TA 4QWMA 5EL0A 1RPTA 5D5PA 5HGXA 5FO0A 3D9QX 1ZS9A 3JQBC 3PVZA 4P7FA 4Y8VA 3K0AB 3R6LA 3L46A 4XPZA 1M67A 1QHHA 3QKSB 3H13A 1XLTC 2WYVA 4BU1A 3K53A 2WTAA 1Z8NA 3R2JA 5B4VA 3C6QA 3TSYA 2XRFA 3GDFA 3HB4X 3I2HA 4B33A 4R1OA 1YMUA 1J5XA 2XA9A 4JBWA 1SKUA 3ZVKA 3FTPA 3R7WA 1ND5A 3K9BA 5EQJB 4F6CA 4ZVVA 3G5LA 4QNNA 4BB9A 3F7OA 3BCHA 2IV7A 3SIPA 2QU8A 1HSZA 2VP0A 4FI3C 3R0IA 4KYTA 1GPDG 1AKNA 2RHBA 3PQ3A 4UHFA 2J87A 3WTBA 3OCXA 3WDKA 2YW2A 1R4MA 3OFND 5ALMA 2F3RA 1CFJA 4EY4A 2FMHA 1XQXA 4EW6A 1JMKC 3SX2A 2WVHA 5JMTA 1EFUA 2QZZA 1QBGA 2VF5X 5KQLA 2YINC 3AOEC 1ONPA 1TT5B 2BD0A 4MOWA 4J6FA 2VSFA 3CH5A 5TPWB 4IDNA 1IZ8A 4UCWA 3C5VA 4I3FA 1X9GA 5JDCA 1SOUA 3R8CA 2F43B 2FR8A 2FG7C 4H6PA 3N5CA 2XIJA 3U61B 1DIBA 2QTTA 3FCXA 4PAGA 4CGYA 4FUTA 1FNNA 1H1TA 4KI7A 2P62A 2AFIB 3QSYA 1T9ZA 1K1EA 3HFSA 3R3YA 5TNXA 3FXAA 5TS3A 3KKPA 1HFWA 1HPLA 5FA6A 5H5JA 1LNQA 1SELA 2VZLA 1DCTA 2HYIC 1VC2A 4A36A 1DMRA 3AYZB 2YV2A 3JWEA 4QBIA 1KY3A 2O2JA 1NLZA 2MR6A 1VL2A 3MYRA 2H2WA 4US1R 2XZPA 4CCWA 3UJHA 3I28A 4MV3A 2IDKA 1R4ZA 3HBJA 4HTAA 3SZGA 2JLYA 1GGKA 3HUUA 2KE5A 3TG2A 5BUQA 1OC2A 1YONA 1XNGA 1GARA 3DBVO 3WAJA 4O1IA 3TQQA 3SP1A 2FFRA 2QUAA 3GFTA 3AERA 4LHVA 2DT8A 5DTMA 2OV1A 3VNSA 2ATCA 4XOUA 1X80B 5ALVA 5LN1A 1YRYE 2A58A 2JJQA 4G4IA 2JAOA 2BFFA 2CWDA 1KI2A 1COWD 1W44A 2YJ6A 2ONZA 4M1OA 4AB1A 2YTZA 1PEKE 3TIVA 4G9EA 1J25A 2V7QA 4DIKA 5AVZA 2BAGA 3M4NA 5H3LA 1E96A 3EEBA 4KJZA 4PYOA 3UICA 4ZAFA 1NNI1 4PTYA 1SBIA 3BJEA 1M2HA 1CJCA 1P9WA 3NUQA 2XTZA 1THGA 3QH4A 4UATA 1YULA 2Z5FA 4YJ2A 3ZBUA 4TRRA 3E7XA 4MRSA 1PR3A 3ZI0A 3O82A 5BQ5A 2NV6A 5C8DA 3LPAA 1RJGA 3OPYI 3R9IA 3REGA 2WOJA 3LX4A 1IXSB 3F3MA 4RDIA 2DKNA 2OCBA 2PGIA 2IWRA 5DRTA 4B3XA 3T7KA 4E30A 5IKMA 5KQMA 3VHLB 5M5BA 3E82A 2D5AA 4P4TA 4EGCB 4FGKA 1F0KA 1OLOA 4FS3A 2WT9A 2NXEA 2YV1A 1P2BA 2Q3HA 4M0MA 2NZXA 2W8BB 4BVAA 1ZGBA 4I1YA 2VYQA 3IDSA 1CPYA 2OK8A 2Q4TA 5AHWA 3DGFC 1LVHA 1HNWB 4YRGA 4LZLA 1QO7A 1VLQA 5JS7A 4F3TA 2NTNA 1Y3FE 4P7GA 1Z34A 3USCS 1GTL1 1W581 2C2HA 1NQAO 1VGRA 1SVMA 1YDEA 1AZSC 1N25A 2QORA 1H42A 4H16A 1NWHA 4JJ4A 1YWGO 4JP1A 4MR8B 3VI4B 2Z9CA 4DMMA 3PGXA 1KU0A 5J2UF 2CHEA 3UHAA 4OQEA 2F6RA 4DDHA 5E7QA 2PL3A 4BC1A 4R1TA 3WYEA 3FMOB 1Q20A 1SXJB 2J3LA 3LO8A 3U80A 4ARZB 3N2YA 3JZDA 4LECA 3N2EA 1ES9A 3D3JA 3GNQA 3PYMA 3H2KA 1ETHA 4QRHA 2ORVA 2W2VA 1RJFA 3RYCB 4NJEA 1BJKA 4S1NA 2REQB 1X7ZB 2ZJ3A 3ZE0B 2DFTA 2EBHX 2FW6A 3IUYA 1H9AA 2YH2A 2FEKA 3NHSA 2HIMA 1NW9B 3SQWA 4E12A 1S5PA 2OMEA 1FQWA 1SU8A 3EBOA 5HKAA 1COZA 2PXXA 4BO1A 2UUAB 3FFTA 4PVCA 4BB0A 1KMQA 3QWBA 2VRCD 2BGJA 4QXQA 1F8UA 1JKJA 4E5VA 5GONF 1DJNA 3ZJYA 1Y9JA 4L8LA 3PI6A 3K05A 3SR0A 2I1QA 4I1UA 5FRDA 3GWZA 3FWHA 1JBQA 5JD5A 1WVGA 1G3IA 4HWTA 1ADGA 2P27A 2G9VA 2V6BA 3FHOA 3EUWA 4X20B 5D3MB 5DMXA 4ZICA 1OAAA 2H1RA 5FH9A 5JCXA 2O3SA 4RS4A 4B2IA 3C6KA 3I9LA 3ETJA 1ZA1A 4I99A 2GTIA 2BISA 1G66A 1QP8A 2J46A 2INGX 3A58B 1QDLB 4EGJA 1T2CA 5JZ9A 2G1PA 3W2FA 1B8NA 1UQTA 3A3PA 4AW9A 4CT5A 4KYUA 4DY4A 1DHTA 1KVRA 3R8FA 3DEKA 5E0OA 1Q57A 2ZIXA 2H59A 3IQEA 2X86A 1N6KA 3QMPA 1T13A 3ZY6A 4XQ9A 5KYYA 4QM7A 1HQKA 3N2GA 1V11B 3CGGA 1OXUA 3IAS1 4KXMA 1DFGA 1NDHA 3CCBA 1O54A 3CNBA 3BK7A 4KQMA 1C7JA 3NO4A 2XMRA 5EJ7A 4N0DA 4AY3A 5LYJB 2DHCA 2HF2A 3WWYA 1O4VA 4NZOA 4JI3B 2EJCA 4JI0B 4I5GA 3RW9A 1O95D 3E5MA 3WSWA 4RVDA 1DX6A 1J56A 4AMZA 5H9WA 3A6EA 1DFIA 4MIYA 1EX1A 2CD9A 2PRIA 1YE8A 2W6CX 2V58A 3MTJA 1UEXC 3W8DA 4P4SB 1U94A 3CGWA 1I1NA 3KZNA 3N8IA 2O52A 2VF4X 3IVMA 4O0LA 3SCZA 1H93A 1ZJJA 3JR3A 4TXJA 5HMMA 4H4DA 3N8HA 4BFWA 4M1EA 3TEFA 3OD1A 4AF6A 3QBDA 5DN6A 3D7SA 2QMOA 1GL9B 2BEUB 3S2ZA 5K8IA 2DH5A 2XNCA 4O4IF 3RO7A 2F4VB 1O96A 3RHSA 2Z5LA 3CUKA 2WB2A 4RAOA 1EQ2A 4MUBA 3R77A 4PX9A 3VRHA 2QTHA 5H3CA 2J3DA 4HWOA 4N03A 2RHRA 1M34A 1TT5A 3MQFA 1Q1AA 3P0FA 4YAIA 2PS3A 2XDYA 5DP2A 4XUCA 10MHA 2V9ZA 4YMHA 5LOVA 4N3CA 1A9PA 5AW0A 2C3YA 2IU0A 1C8LA 1AB5A 4BN0A 4CM7A 2NOAA 5JASA 2PBRA 1GYQA 3RAPR 1ESMA 2JIPA 5D86A 3VKGA 4GP6A 4XSHA 2ZCVA 2QUZA 3JQ8B 4MR7B 2H7XA 2AYXA 2FW9A 4R1MA 3U1TA 3K8OE 4A4DA 4H27A 3AF3A 4P53A 5KMGB 2QA5A 3ZXIA 2FZKA 1DAHA 3P4UA 5DTEA 5DGTA 2D5IA 2F48A 4TSFD 1GVHA 2JDIA 3UQYS 1XNQB 1R18A 2P5SA 1OB5A 3UUEA 4MVJP 1KAGA 3EXHB 2VYVA 3RQIA 5KDDA 1Q91A 1M75A 1YQEA 2PJUA 2W6QA 3OA2A 4A9AA 4C0KA 1LBSA 2E6UX 2WV7A 4BKRA 4ZC1A 3RYFB 1R0KA 4IIBA 1IN1A 3OX2A 4EX6A 1E98A 1P7PA 1L2TA 1TO2E 2CFOA 3GPBA 3KPVA 4RFSB 1H6DA 1JYSA 1JIUA 1E8DA 1SN7A 1NN5A 1ZHFA 3GDWA 1BA3A 1XJQA 1XWFA 1EE9A 3Q7RA 3H75A 4G1UC 4LJ9A 4W6QA 4CG0A 2RDMA 3HB5X 2XQJA 3DP7A 1GZ7A 3ES9A 3I61A 1EZ4A 1XELA 1XMQB 1H2RS 1NJ8A 1QOPB 5FUXA 1RXYA 2DFPA 2V9PA 1WTCA 1TCVA 2XHEA 3K32A 3MRXA 4XH9B 5JNSA 1JPNA 1I51A 1V43A 2FTKE 2J4FA 2Q9CA 4JUFA 3N70A 1KSFX 1RABA 5KQRA 4Q12A 5DK4A 2EWMA 3SY8A 4R9UC 1B41A 5JQWA 1OFUA 4EMUA 4KQIA 3HKBB 1R0RE 2J3MA 2X4GA 3C3EA 2YZNA 2UYOA 4LHSA 3ROZA 3NGXA 2OKCA 4YRFA 5FTKA 2VDWA 5FTNA 4JASB 3VTZA 4P34A 4R16A 1YR6A 4JEHA 3A9UA 3CNNA 2LVBA 5DRYA 4UPVA 1WP4A 2ZWOA 4CMAA 4YB8A 3WK9A 1KJQA 2VSYA 1GQQA 4D97A 3A26A 1SIUA 2H63A 2W2MA 4MRVA 5FWYB 1XCGB 1D0VA 1DBVO 3AEQA 2V7TA 1J2JA 1DG1G 3A9SA 3ESXA 3PEWA 5KSPA 2VNAA 1MORA 1LK0A 4ZPXA 4A0RA 3A3NA 3GUVA 4W1SA 4N54A 4LRTB 3AUXA 3ZWWA 3ZHVA 3KT0A 2RAUA 5AKKA 1PDVA 3LD9A 2D0PB 1OFUX 1UXJA 2YBEA 3HACA 2V6IA 1AF4A 4J3NA 3EZ6A 4LJ7A 5HR5A 3CYFA 2R96A 1QK4A 1MO5A 4X8OA 4TSFA 2XE4A 5EMHA 4QDJA 2A1UA 1Y48E 3G2KA 1UC4B 5ALUA 3MOSA 5CURA 5EXTA 2VJAA 4HQ6A 1DQSA 1JEYB 2ZETA 4L02A 4L51A 2X1VA 2VYVD 1VP9A 4GI7A 4GX0A 5A3JA 1GAWA 3JQ6A 5BYJA 2XR1A 4TTIA 5ECWA 2O06A 2B1QA 5AJVB 3HKBA 2Q8PA 4PIPA 3QE3A 5HWSA 3OQNA 1MHTA 4JAVC 2JS7A 3QU9A 5GJBA 3O7WA 5GONB 3A4LA 3QE0A 3UM9A 3RVMA 3CZRA 1N9GA 1WY5A 5JE8A 4B35A 3M6MD 2JL1A 2CW5A 5LA6B 1RM5A 2GETA 2VL7A 4RDHA 1GOTA 1QGED 1K2VN 2R1TA 4FIZA 4YAJA 3ZDDA 3ICQB 1RYDA 3ETHA 3P1JA 2AN4A 3GHYA 5AI8A 4YP0A 5AK4A 2FQWA 4ZVKA 1R6TA 3WGQA 1AS3A 1RP1A 2A1TS 2B1GA 3HG7A 1V1RA 5C4GB 3BXOA 3RUPA 3FWYA 2X8JA 3I62A 3JR7A 2HX1A 5LBUA 4M0FA 1JJBA 1HV8A 1XHFA 4LPSA 1MG5A 1XLTA 3MT9A 3PT9A 2Q2WA 5ER9A 4HFNA 1TMYA 3HVUA 4U5QA 5E6RA 1H1DA 2LW7A 1T1IA 1WB6A 4B17A 9GPBA 5F23A 3UJ8A 2DBYA 3RU3A 3WLOA 3CR7A 2KB0A 5D87A 1N2CE 2RC5A 2WD7B 4AJ1A 2C7OA 4AY2A 2C2XA 2XE6A 1CYEA 1J1UA 1N2JA 4X3CA 2EJTA 3IB3A 3HBLA 3K0FB 3RBZA 4ARBA 4XCVA 1Y4AE 2V3CC 4C6RA 4BLRA 1ZA2A 5C8YF 2QP4A 4TMTA 3VR5H 2W93A 1CEYA 2DR0A 2XADA 4MVJE 4F8YA 4ND8B 3T41A 1K98A 1PN3A 3O73A 5EYPA 3TW8A 3GOQA 1TOAA 1HO3A 4M0KA 3VZRA 4CLOA 1J0AA 4CU2A 3PQCA 3FWPA 1A96A 5EN4A 3AI2A 3BN3A 3V8PA 4RTKA 5JYDA 4OIMA 3VNVA 2CHUA 2JJMA 3AHFA 1NC3A 2TECE 4GPD1 1SUFA 3L0PA 1GGNA 2XT0A 2P69A 2R6HA 2FFBA 1V48A 4JEUA 3H2GA 5C9ZA 3P9QA 1AA9A 1C3VA 4TXHA 1V1RB 5JSYA 2WFLB 2F00A 1OASA 2CLLB 2O2YA 3ABZA 4YMSA 1UPCA 5EXXA 4D4KA 3H8WA 3F6RA 5CVUA 3TI9A 2IS4A 4IO0A 3EN0A 2JGMA 5MF6A 4FP9A 3NJ8A 3VDRA 1RSZA 1NQUA 3DZJA 1KDVA 3JD4A 2HF9A 2YBDA 4NEQA 3V1LA 5CA0B 1IN8A 3EASA 4LOHA 4MV1A 1XVAA 1ZZEA 2C2OA 5BQPA 4WZAE 1VTKA 4MUGA 3GXBA 4BFYA 5KC8A 1ZDMA 2WFMA 4EHLA 1U3GA 1VG9B 1MU0A 3HJGA 1V45E 1E2IA 1GSHA 4Z86A 3UHPA 3LMKA 1E2MA 4WXYB 4IGAA 2GAFA 1M1YE 1D6MA 2P9CA 5SYAA 3V8VA 4MMZB 3OUUA 5CT6A 3OX4A 2O7RA 4R51A 3DOEA 4QQ8A 3D7KA 4I3HA 1JR2A 2QMQA 4I2VA 3L06A 5HDBB 2BBSA 3EVGA 4J0DA 3B9QA 5KWEA 1JSRA 3MINA 4UE3S 3E22B 2AN3A 2ARKA 5FR1A 3RAEC 1HDCA 1A7UA 1NBAA 3N07A 1NSFA 2Q7XA 5TT1A 1U6JA 1LLFA 2E5WA 4PSVA 2LDXA 5DIZA 2J45A 2G25A 1ZK0A 3MB8A 4HEQA 4HEHA 3IMEA 4IRUB 1BHQ1 1U2QA 5CCXA 1J9ZA 4O4HA 5KYXA 1G4HA 3OLWA 3FKJA 2R7MA 3KTDA 2WYUA 1YZVA 2CXTA 2WT4A 5CYGA 3UHJA 3HYSA 4KO1S 3UAVA 5JAOA 3SKXA 5B58T 3TTVA 4GRIA 4PO8A 2EQAA 4R54A 4Q48A 2PLRA 3EARA 1ZMTA 2ZI6A 4XDYA 2II6A 3ZCPA 1D6NA 3SDBA 4Q93A 3F49S 3FZYA 4JJFA 4MWTA 4OHKA 4TRJA 4C1BA 4JWTA 4HB0A 5ADUS 4TYMA 4AVYA 4UNIA 4NJEB 2HD4A 3W6UA 5ELXA 3R3XA 2VTEA 3CONA 3B13B 2GHTA 4B0PA 2VRWA 1EDDA 4DLKA 2P2GA 2AR0A 4XWGA 4RTLA 2EX4A 1F17A 5EXSA 2FY8A 3ZY2A 1E3JA 4CUZA 3MTIA 5DWDA 4J8PA 4WBXC 5INTA 1H1LA 3C74A 2JARA 3HPQA 4YJGA 4ZHQB 1FFSA 2R66A 1QZ3A 1RAFA 5FKJA 4R81A 1AUQA 3Q0TA 5SY9A 2XRZA 4UJ5A 4EHNA 3OJWA 3IXLA 1AMNA 3DM9B 1J8MF 5AVSA 2Q21A 4AL4A 3UT5B 1YKGA 2BF7A 4OQXA 4E1VA 4YMIA 4G5GA 2XQGA 2GAJA 3G79A 1TTQB 3HS3A 9LDTA 4CM4A 4KO2S 1TZJA 4NPHA 3FM9A 3OWXA 1B76A 3V8BA 1ODJA 2FSFA 3L8FA 4JB0A 3CS3A 1Z0DA 4MEJA 2I3GA 3D3QA 3DL0A 3ETLA 3HCEA 4WZ6A 2GF0A 5BW6B 4CFYA 1CSEE 2XYRA 1IWPB 4DV0B 1WUHS 3NRCA 3UAXA 3WBBA 1CZHA 2DR3A 3X1ZA 1TF7A 1Y1SA 4PPFA 4KR7A 1B42A 3W34A 2HWUA 5IVPA 4MYDA 1K7CA 2VBIA 1V35A 1SXPA 3KC2A 1X7WB 5HOQA 3DMPA 3MGAA 5CNMA 3NDJA 5ALDA 5EIEA 1OYWA 1G8HA 1CVLA 2CV2A 4LTNA 2IHTA 2Q6IA 1QMGA 3DBHB 1COWA 1VDMA 4TWAA 4TVOA 1KO8A 3QKUA 1CERA 3O9VA 1AF7A 3CXUA 1JHUA 4KXLA 1BEUB 3V48A 4KNWA 3MS7A 4KO4S 5DYYA 1GG5A 2WJYA 3GP5A 1OH6A 1CG6A 5ALZA 4JSTA 9ATCA 1T2NA 3HK2A 2YN0A 3NBFA 4UHBA 3IT3A 2RBEA 1JHAA 3HGMA 2OVFA 3JWIA 4IJKA 4EG0A 2B8EA 5JOQA 1LK5A 1IFXA 1N4DA 1W35A 3J7AC 4PX3A 2CMKA 4UHEA 1TZCA 4ASUA 1ECLA 1I2CA 3A6DA 3AVVA 3F8WA 3O95A 4LQ4A 4RVFA 3WS7A 2B83A 2PEZA 1E4YA 2MWMA 3ZU6A 1DAMA 1U8ZA 3RQSA 1AJEA 2WUFA 5IM5A 5AHXA 1A0OA 3LY9A 1TPZA 3RH0A 4J4HA 1X87A 3EZ7A 4L7VA 2YYZA 3TLGA 2QE7D 3RSCA 3QOYA 4BE4A 3ZWNA 3CRW1 2ZG6A 5L6LB 2HWXA 2J5KA 2VTBB 4U6QA 1N36B 2N0SA 1HTWA 4EKIA 2ODWA 1XVLA 4YMLA 2Q5FA 1CIPA 1J7JA 1VCOA 5HKKA 4AQYB 4CMIA 5ITZB 2BDUA 3O9MA 4X71A 3I1IA 4MEBA 2PT7A 2XQFA 4E7PA 1HORA 5G1NA 4ADSG 3DD1A 2WUWE 3K1AB 2X7HA 3GRCA 3T38A 3ASVA 3DXFA 5I45A 3GCZA 5BNIA 3K0HA 3ZWVA 1SHLA 2PUDA 1EVYA 4ZI7B 4HDNA 2QTWB 1NXPA 5ALRA 1YVRA 5HCUA 1WY7A 3DKKA 1XT6A 3DCYA 1FYVA 4DGSA 1Z0ZA 2QZ4A 2ZXFA 3QVXA 1CUBA 2XCUA 4U63A 1Z18A 4JV5B 1UL1X 1X8KA 4L2IA 2GVDC 3ENNA 4ZRMA 3DBRB 4IS2A 4KXXA 5M29A 4PHGA 4ZTBA 1KO5A 5CBPB 3S8MA 3T06B 1EK1A 5IAEA 4Y1EA 1JIIA 2YJ4A 2WYIA 5JNWA 3EGOA 2GKSA 3G85A 4BHTA 1SIWA 2C03A 1V2GA 1FFAA 2PXHA 1DIHA 3TRHA 3AINA 3NATA 2H1FA 3IXQA 4LF6B 4KPGA 1T9HA 3LAWA 3NHUA 4BO4A 3NXKA 1FTNA 4ABTA 2PKCA 1RXVA 3TNDA 1Z0KA 1GPUA 2IXGA 1L6IA 2CNLA 1NVXQ 4HDSA 4ALLA 1X7ZA 3T1OA 4AWBA 4S05A 5K0BA 1O0BA 1GG8A 1YB2A 2E6KA 3QTBA 1EK0A 3L1IA 2ID7A 1IG3A 5CAEB 1AVTA 1YS4A 4JGGA 5H7XA 3HO1A 4QPZA 3GVCA 3O6VA 1T4CA 2VRNA 2WDZA 3T61A 3HFGA 1JQ5A 1X2BA 1ZISA 3A4IA 3LQQA 4CN8A 1DC7A 4E31A 3IOMA 2XA1A 4UDOA 2C7GA 5K01A 4AIIA 5JCZA 2OLKA 1ZOLA 1MIOB 4MQ6A 1YE3A 5JG7A 1AU9A 3B2NA 4IDFA 1G3RA 5MHTA 4C5BA 2FSGA 2IQIA 1T1EA 1KMMA 1O97C 3K3PA 3OJFA 4HBZA 1C5KA 3LECA 3F6BX 1W25A 3ND7A 3GUUA 2PFGA 1FTWA 1VIMA 3FPBA 4FOSA 5KQPA 2OYRA 4N41A 2O5EA 3L7AA 1JXAA 1Q92A 4MQEA 4KWTA 5EJAA 2XB6A 5G0SA 4TL8A 3BXXA 1G9SA 2BKAA 3ZCSA 4DLPA 1KYZA 3NB0A 3INGA 4JL5A 2FMXA 1R1DA 2XD9A 3BS4A 4IR7A 4LTMA 3CLRD 2VNIA 1A76A 4ZVMA 1GNLA 4P0TA 3T12A 3T7JA 3V5NA 5I3ZA 5H70A 2BFNA 4HMPA 1CNFA 3HXKA 4LE1A 4QC2A 4B34A 5FUBA 4F2GA 3GT0A 3BJRA 3R5XA 3T4PA 5DGDA 4UJ3A 5FBVB 1BFDA 1E0JA 2G5PA 3EDRA 3ZJ5A 4OXKA 1VIDA 3PFFA 4HEA6 4I0WB 4U3JA 4RZXA 3RIEA 1XXHE 3BTVA 4FX5A 3IP1A 2QW8A 2WTUA 4QODA 2I4OA 2C84A 1MOSA 3AQ4A 2QVCA 4OI0A 5C53B 1M2OA 2I6GA 4I6JA 2PNFA 3ZXSA 2VXBA 1ZJ5A 2O2CA 4LISA 2IZ0A 4D9FA 1YR7A 3ZIAA 4OQNA 3RS2A 3TNLA 3E5RA 1GCGA 5TGZA 4O3MA 1Y5IA 4FGUA 2VJLA 1VL5A 3WDSA 1TA9A 3FAZA 3Q0IA 5HQ3B 1RLTA 3AL0C 1Y1TA 3IO3A 1YMQA 4EM6A 3MWFA 4PY2A 3O9ZA 1TF5A 4X54A 2YOGA 3TZHA 4D5EA 4MV4A 2H7YA 1QO9A 1A9XB 2Z09A 4XR9A 2QMUA 5PNTA 4UPEA 3JRXA 4DCVA 3ILHA 2CE2X 1PEAA 6AT1A 4KYIB 2WI8A 3WB0A 1W8DA 2Y9MB 1UPTA 3DKRA 2IFTA 1JV2B 3OH8A 1JILA 1PJ3A 1M1XB 1YZUA 3ELWA 4WADA 4WZAA 1Q0RA 5ALKA 2Q5QA 3IVXA 2DWUA 2YVAA 3NX4A 4JBLA 4JUAA 2B4YA 4UVGA 5T6BA 5THKA 4GRDA 1G20B 3L1VA 1RRPA 3A37A 4KXUA 1NHWA 1AIPA 3RYIB 3PNMA 5HJ7A 1O97D 1G291 1P81A 3ORSA 3RK1A 2NNWB 2PH7A 3CX7A 1B0PA 4L15A 3H3XA 4OCZA 4EB6A 5HRAA 2QOEA 4G1MB 2VH2A 3PRJA 1CUSA 1OXTA 3LBFA 1FSSA 5EFZA 2CXNA 3QYAA 1CR0A 2UZ0A 3DD5A 2IP2A 2P6OA 3RT1A 4YO8A 4EKYA 3GQVA 1L5WA 5EWMB 1SUSA 1GDDA 4GD3Q 2KLHA 1GNQA 1V5IA 4ARUA 5KMGA 2ONCA 1X0XA 1FYDA 3P2MA 1AUXA 1F2TB 1HT0A 2OM6A 4KH0A 1E3DA 4YWJA 1D1QA 3H3FA 4E7OA 1IXRC 5THXA 1SA0B 3WG9A 1D1SA 5LDGA 1HG0A 4E4RA 3E9QA 3SM9A 2BL4A 3DCIA 4OLHA 1XEXB 3GGPA 2JDID 2JBAB 4H0CA 2CLEB 2PSSA 3JARB 2HMSA 2OV6A 2VAXA 1QV9A 3I32A 3U3RA 3H5VA 5EE9A 1K0FA 1AS0A 4TUYA 2EATA 1LLQA 2NU7A 4WAUA 1C9DB 1GNSA 1T3ZA 2VPTA 5LA6F 3TKLA 4QUGA 2CCGA 4FFLA 2C9ZA 1SXQA 1REQB 3A70A 3U9SA 1B2RA 1JHRA 4KGZA 3W78A 1DRKA 2QZSA 2WW8A 1G20A 1O2DA 3RR2A 3O5AA 3X1KA 4A5SA 1UJMA 4Z2YA 1YZTA 1ZEMA 3DTVD 2Z2IA 3N0VA 4WLVA 2GZSA 1Y81A 1IPEA 1J0BA 1DJLA 1OFVA 2QEQA 2XUAA 3KDAA 3VJLA 3WY9A 4A8HA 1CW2B 1JT9A 4DILA 3IBFA 2FZ5A 3K2BA 3ROPA 1SUAA 3QEAZ 1UAGA 2OOSA 1XEWY 2OWDA 1QQAA 1H6BA 5KYTA 2JCGA 4Y1RB 3CLUD 3WP0A 3KUDA 4IHAA 3SJBA 4RK7A 4N6NA 4EDFA 4WKCA 1H8HA 1HETA 3F8SA 4RELA 1XPRA 3GZJA 5K0ZA 5ARBA 1DNPA 1F2VA 3ANNA 5IKXA 3AHHA 1JDNA 3E3NA 1RNLA 1TJNA 1XGKA 2DZDA 4QJ4A 1K97A 1ZM9A 2QQGA 2V59A 3WL6A 2P2SA 4DAEA 2O3QA 4NK5A 5EJIA 3NYRA 5K51A 1HX7A 1NZDA 1SG6A 3ELUA 1R9MA 3PA8A 4TV9A 4EF4A 1ZVVA 4NECA 5EGNA 2QXTA 3F46A 2O1WA 5CU7A 1KFJB 5KTKA 1WRBA 3IT2A 3F47A 3OCYA 3OIWA 1KVUA 6REQB 3Q12A 2BIFA 5AJYA 2I4TA 1NI4A 4YAUA 3N6XA 2PR7A 3RWMB 1PD1A 2OZEA 1U2RA 3WLSA 3UGJA 3ID6C 3UAOA 5IJZA 2GZAA 3LGSA 2GK4A 1ZR4A 1ID8A 4OBXA 3L7NA 1A98A 4EUSA 3FNRA 3HY4A 4EG4A 3PGMA 4I3GA 3LY7A 1FFCA 4HNQA 5JI3E 3NVMB 3N2KA 4DCCA 2GRJA 2JLUA 1C7RA 3PF9A 1RIFA 4PQRA 4L50A 1VPVA 3KTAA 2PGDA 1SH7A 2PZMA 4YP1A 1NXWA 3V00A 5A6VA 3F2VA 4FXPA 4Z9BA 3S27A 4IG9A 1QDUA 1EFPB 4D6XA 3GZ4A 1GQ2A 3DZFA 4OJNA 3VYTB 2WUEA 1P0FA 2HWYA 3IV6A 4ZCTA 4YI5A 4W82A 1K5PA 1NVUQ 1GFZA 5JQGA 3IODA 3OJ0A 4KGXA 1G8AA 1VBFA 4UQLA 2CBGA 1L7AA 4M0LA 2BW0A 2D0DA 2EWWA 3JD2A 5CJPA 4EH1A 2ERYA 3CISA 2X0IA 5HIMA 3TPFA 1VCHA 2XB2A 2MOKA 3AUKA 3HA2A 5T4HA 3IMKA 3DZBA 4KE6A 2HGZA 4CL0A 3PTZA 5GADl 2I7TA 1PJBA 1E77A 1TD9A 4PZ9A 3ZXXA 4RUKA 2CLHB 5LQMA 4D02A 1BYUA 1UT5A 3MWJA 4B74A 3L0DA 2QUHA 1Z62A 2JAUA 3JQ7B 2HIHA 3K0CC 1UT8A 2N1BA 1M6WA 4ND5A 4OA8A 1OKKA 3DO6A 4FD3A 3GRAA 4P22A 4R4JA 4RGYA 1JLLB 3SZMA 4XM1A 3M8KA 4E11A 3NWJA 2UYGA 3E58A 1QFJA 2QR5A 2WF6A 1EZZA 2YS7A 4LXIA 3M6XA 4INPA 4ESOA 3LU1A 4W9NA 1DRJA 2HU8A 3WNQA 2EU8A 1KYIA 2ESRA 1JTEA 3ECCA 3L8GA 1LPBB 4ZTZB 4C0XA 1UFKA 3RU7A 1PVVA 2VUTA 4QEDA 3PE4A 3JQQA 5HM8A 3CX3A 5E6SA 1D2HA 2P11A 4MWCA 1QZZA 1HRKA 1WHSB 2BH9A 4GLFA 1CRWG 5TV2A 1RRKA 2ZITA 3L5OA 3M5DA 3TKYA 4PZUA 4KUGA 5KWVA 3BILA 4JA0A 2Q3LA 4EABA 4FGJA 4OO3A 2ZU6A 2P90A 1MB2A 2VA8A 3JAKA 4NLLA 4QNRA 4BJHB 4MVJG 1EFHA 4QSHA 3VR5D 2IZ1A 3CVOA 4WN9A 4CETA 3AEKA 3S55A 5AW4A 3EXAA 3FBGA 4NIMA 1Z4PX 1DZ3A 2QSYA 4MI1A 1VI6A 2V7XA 3I12A 1IBRA 3L0YA 2O1EA 1W8IA 5J1SB 5AW1A 1LB1B 1QVWA 4KUEA 4YREA 3O84A 1ADYA 2D1TA 4IH1A 4JLVA 2HW8A 1U9ZA 3PK0A 5C1IA 2C07A 4JI5B 2FHPA 2KWIA 4QUEA 3OG9A