5HA5A

Crystal structure of an nad-bound oxidoreductase from brucella ovis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
250
structure length
250
Chain Sequence
MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an NAD-bound oxidoreductase from Brucella ovis
rcsb
source organism Brucella ovis intabari-2002-82-58
molecule tags Oxidoreductase
molecule keywords Brucella ovis oxidoreductase
total genus 95
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ha5A00
1A72A 3FRJA 1Y5RA 4EDFA 1V9LA 3OJOA 4B4OA 3ASUA 2R00A 1ZXLA 3AFMA 4PCVA 4YJFA 3MWDB 1JKFA 2AW5A 3KV3O 5KJCA 5J23A 4MKRA 4A26A 3Q6IA 3D4OA 1ZSNA 1B16A 1EBUA 4HUJA 3RCBA 4RVDA 4BNVA 3NTOA 3BMQB 1E1LA 1LSSA 4FQ8A 1KC1A 3X2EA 1HF3A 1XWFA 1XEAA 3R3JA 1V8BA 4YAGA 3DZBA 4S3MA 5FF9A 1UR5A 4E12A 5BNFA 4ZQEA 4E33A 3HSKA 3LF1A 3CMCO 3SEFA 2O7SA 1U1IA 1LX6A 2Q1SA 1DC4A 4HADA 5C37A 1HYGA 3ANMA 5DNAA 1CIVA 2G17A 2G76A 3LZ6A 1TA4A 2YHIA 3PJEA 4DXHA 1YB5A 2B4RO 2NV6A 1EFLA 1EK5A 3LT0A 9LDTA 4HNGA 1LUAA 4CL3A 2PZJA 5BSEA 1U2DA 3E9QA 2C2XA 1DAPA 2GDZA 5EERA 5IDQA 4YRAA 4FPXA 2Q50A 5F5LA 3DMYA 4PLHA 3NGLA 3L0DA 5A9SA 1LLUA 1IHYA 1WDLA 3PRJA 4RF4A 4E4YA 1N1EA 2ZJ1A 4DMLA 4GKVA 3AW9A 1M2WA 3ADOA 1NPDA 2QRJA 3U3XA 4BV8A 3RBXA 3STHA 4IDDA 1OBFO 1QYVA 4J0FA 3UXYA 4ZJUA 2QZZA 3JYQA 4E5MA 3R1IA 1DC6A 3W4IA 1T24A 2I9PA 1E77A 3OM9A 3E48A 3ZNQA 1GQQA 2UDPA 2JAHA 4KDFA 3AWDA 4EZBA 3ONFA 5EL0A 1LDYA 1YDWA 4MO2A 4BKUA 2GCGA 3JQ9A 4OOFA 5DBIA 5FFFA 3S1LA 4CMIB 1NTOA 1PJ3A 2PLAA 3ANNA 3OJFA 4NBVA 3RBVA 4URFA 4P38A 3UFXA 1KYQA 2Y1OA 3EHEA 4YVFA 1JN0A 1I33A 2PA3A 3FWNA 2YW9A 1VJTA 1T26A 4KZPA 1GL3A 1Z7BA 4UVIA 3WJAA 1LRKA 2H63A 4WASA 1LA2A 2VNAA 4Z3DA 4A2CA 2Y67A 1LLQA 1B8VA 2FP4A 4UUMA 3RFVA 2IDZA 3WB9A 1LDMA 3MJVA 2GZ2A 3OICA 4N5NA 3SJ7A 3WBFA 4KUGA 3SC6A 3AI2A 1VSVA 1DRVA 1SOVA 5FI5A 2FR0A 4ZRMA 4ZVVA 1P9LA 1JTVA 4YT2A 1K6IA 4BNZA 1LNQA 3JD1A 3LC1O 1PQWA 2B0JA 3PGXA 2EWMA 2VUSA 2H5LA 4RVSA 1EQ2A 3ZU5A 4R01A 4NU6A 5DOZA 4FJ0A 4E2ZA 1DLJA 3JQ9C 3I9LA 3DZKA 4U0KA 4EUFA 2EW8A 1ONNA 3H9UA 1ZEMA 4L76A 2NADA 1KVUA 2JD2A 4M8SA 2X58A 5CEFA 3UICA 2O50A 4MPDA 4BO1A 1Q7BA 1E5LA 1R0SA 5ICMA 3TF5A 2HDHA 1DXYA 4TKMA 4Y9DA 4XWYA 1T2CA 2NU6A 2DBQA 3ZV3A 2D8AA 1PS9A 4DTIA 2PGDA 2Z1MA 1U5CA 5IDYA 1R4NA 5L7TA 3JQCA 4WLNA 4KWHA 1JLLA 3KSUA 2W2LD 4ALKA 4B79A 1O8CA 3KRTA 3K31A 1MLDA 3V8BA 4AJKA 1EDZA 2HK7A 4ND3A 4FW8A 1PJ4A 1B14A 3NDIA 2CZCA 3DBRA 2I3AA 2JAPA 3ZDFA 3CXRA 3GZNB 4GX5A 4K28A 2FY8A 2W2LA 4MP8A 5FWNA 1GTMA 1N7GA 4L75A 3LSYA 4JGBA 3FNGA 4IPTA 4L0QA 2J3JA 2HRBA 4RVFA 3WQSB 5C7OO 4DIOA 4W9NA 4BS9A 3IQDB 3PZRA 3Q2KA 4NBTA 3VKVA 2C29D 4BKPA 3B1KA 2GASA 3JQ8B 5IN4A 3S55A 3RUFA 1UXGA 1C0KA 1CDOA 5ADHA 3KYCA 4NJMB 2AHRA 5DP2A 3RC1A 2VYNA 3ZWXA 5L45A 1P1FA 1XA0A 4WCDA 4BMSA 2O23A 4NU5A 3ITDA 4YAKA 2PZMA 1I01A 3MJCA 2HMUA 2DQ4A 1DOHA 1VRWA 4J90A 5T67A 1Q0LA 4KP7A 1E3IA 1E3WA 3RFTA 4CPDA 1PGPA 5U4QA 4ZQHA 4WLUA 2EKLA 1UDCA 5GZ6A 4FFMA 1W8DA 4PRLA 4FFNA 1ZIDA 2YUTA 5L9AA 1WLYA 4GQAA 3IL2A 2VWQA 4J49A 1JKIA 3AU9A 3JQAD 3PHIA 1UXKA 3TFOA 4GX2A 4IDGA 3DC2A 2O3UA 3WIDA 1UXJA 1GPDG 2W2KA 3K30A 5I7FA 1RM5A 4TWRA 1E3EA 2NVUB 5G0UA 4HKTA 2FR1A 2FSSA 4IBOA 4AJHA 5A04A 5BSFA 4O5OA 2NTJA 4E5PA 3NKLA 3PEFA 1I5RA 5JAIA 5COBA 3WLEA 3QVWA 1VC2A 1BHSA 1O89A 4RQUA 3TFQA 4J2HA 4A73A 3M6IA 1Z73A 1GY8A 3VH2A 1R6DA 3A14A 4AJIA 3OH8A 2Y1CA 1SB9A 3A06A 2X0JA 4I5EA 3B1FA 1PTJA 3DZJA 1I3LA 4FFRA 1XU7A 2XXJA 2BFMA 5JC1A 1ZNQO 2PY6A 4LVUA 3LU1A 4GX0A 4OO3A 3RUEA 2ZJ0A 3ZHXA 3AOEC 4QT0A 3AY6A 1V3TA 1X0VA 3BAZA 2I76A 2DUUA 1YVEI 2Z5LA 1JW9B 4BKQA 5JAZA 1YB4A 1KVQA 2P4QA 5HS6A 3NAQA 4AJ1A 4OXKA 2VOJA 4J43A 4ZQFA 4ALJA 1PJCA 4YB8A 2X7HA 1Q0QA 2EP7A 2G0TA 4NBUA 4P22A 2YHUA 3GH3A 2BRUA 2HJRA 5L3ZA 5MDHA 4C7JA 3ZWOA 2IE0A 2PK3A 1PS0A 4GMGA 3VPGA 2VUUA 3G79A 3GFBA 3Q9NA 4OIMA 4M1QA 3LC2O 4ND2A 5EPOA 1E7QA 2ZQYA 3L9WA 3NJ8A 3KBOA 1DLIA 1WNTA 2P9CA 4OSOA 4KMSA 3U0BA 3VPHA 3WFIA 2YZ7A 2GF2A 1Z82A 3CINA 1H6AA 1C1XB 2ZCUA 1H93A 4QQRA 2GO1A 4XJTA 5JMPA 3ZWBA 2OBYA 4BGUA 1EQUA 1SEPA 3PDJA 4MKXA 2VZ0A 4E2YA 3RWBA 2A9FA 1N92A 3TZHA 1M67A 1NM5A 4LCEA 1ZJYA 2OOSA 3JQ6A 1GV1A 1PX0A 4JJIA 4IS2A 1H6CA 4H3VA 1QYCA 1DJNA 2VWPA 1E6UA 2W4QA 4BO2A 1RPNA 1QSGA 5TRTA 2O3SA 3PXXA 1YB1A 5AXCA 3GDOA 4A7PA 1ONPA 1ZSYA 5KOIA 2Y0CA 4NDNE 5F1KA 1YBMA 4YT4A 3I9KA 3GGPA 4J4BA 4LVCA 3UVEA 3BIOA 4WNIA 4HV4A 5L95A 5G0WA 2CMDA 4YRBA 1CRWG 2HMTA 3DEYX 4GGOA 1PQUA 2Q49A 3GK3A 3LDHA 4CQMB 1MG0A 1PGQA 2EXXA 3KVOA 2DFVA 2DPGA 3LLVA 4TRNA 2V65A 5JO0A 1Y9AA 3BZUA 1DSSG 4BGIA 3ETEA 5G4KA 3RU9A 4MP3A 2ZYGA 4BB5A 3KM0A 8ADHA 4Q39A 3QWBA 3DHEA 4R9RA 1IY8A 2OXIA 4KUEA 2JD1A 3OF2A 3DL2A 4D79A 1UZMA 4GPD1 1OC4A 1GZ6A 1R0KA 1MC4A 1SMKA 3FNFA 3ZHZA 3QVXA 3ZWCA 1EVYA 3ZH2A 5KJ1A 5HS4A 2JHGA 2Y0EA 2EV9A 3LK7A 3UH1A 2ZTLA 4LRSB 1O95A 5JMWA 1D7OA 3JQFC 3GLQA 4XDYA 5G4LA 3QWAA 3RROA 1E7YA 4CLRB 3BTOA 1DIAA 2AE1A 2PD3A 2IODA 2X5JO 2HK9A 2GGSA 4HY3A 2J5KA 3Q2IA 1C14A 4J16A 5IAAA 4G2NA 2F00A 3AFNA 2UUOA 1MA0A 3JYOA 4XKJA 1U4SA 4E5NA 1PGNA 5JE8A 1XU9A 3MJ4A 1IE3A 4CUJA 4PVDA 4IJWA 2AE2A 3RD5A 3P2YA 1EVIA 1R4MB 2QIOA 4DPLA 2ZB3A 1YS4A 5KVSA 4CM3A 3WYBA 3H3FA 4J1NA 4ILKA 5T8KA 5TT1A 4B7XA 4E32A 1A9YA 1C1XA 2FZWA 2HAEA 3LYLA 4FJ2A 1OI7A 3P19A 5H83A 3RBZA 3GN1A 1EBFA 4DA9A 1N1GA 5IDWA 4DQVA 4BO3A 3GDGA 5JDIA 1MXFA 3U5TA 2J5QA 2IYPA 4D0SA 3PJDA 5CP8A 1FJHA 2B5VA 4GKBA 5LDGA 1GYRA 1JWBB 5KVCA 1PGOA 3I4CA 1E3SA 3U09A 2FN7A 3B6ZA 4LSWA 2JFGA 2PGLA 4UAGA 4K26A 3N74A 4UULA 3WGOA 5JNLA 3BHMA 3FNHA 4EJ6A 3WQQA 1E0DA 4NBWA 2P5YA 2O4UX 3QLJA 5TNXA 4QX6A 2VHYA 4XEHA 3OMLA 2POQX 4QECA 1WPQA 2BGLA 3KXDA 4YWJA 4B3JA 3HB4X 4R3WA 1QV7A 4XYEA 3L4BC 1R4MA 1IB6A 3TZKA 2ZYAA 2BHLA 2VHVA 3WMWA 1DIBA 4RPHA 2HKIA 1ZK0A 4EYEA 4GSKA 1FMCA 1HKUA 3PZBA 2EHDA 5EMHA 4LGVA 2GERA 4IDEA 1JA9A 4OHUA 2ILTA 4KUHA 3V5NA 3KHUA 3ROKA 1GUFA 1GEEA 1HXHA 3VH1A 4XCVA 1J5PA 2BMAA 1DB3A 3PLNA 3SC4A 3IP1A 2BFPA 1P1IA 1P1HA 4PLPA 5TF4A 1E5QA 2D0IA 4PLCA 3UKOA 3VPSA 5U9CA 1Q2XA 3WS7A 2HMSA 4C4OA 5HWSA 3UW3A 5C5IA 1CEQA 3BMNB 2OFPA 3K96A 3HE3A 3W1VA 2GD1O 3G49A 4CMJA 2Z95A 4IJVA 3NT2A 3D5TA 4ID9A 5HTOA 2DBZA 1LU9A 5IJZA 1B3BA 3WTBA 5G4KB 4BUCA 4WEOA 1AHHA 4HNHA 3A9WA 4FBGA 4D42A 4IM7A 1L1FA 3ZNPA 1K89A 2Q2WA 5I9LA 2BH9A 3ZW8A 3JYNA 4FOOA 5C3MA 4ESOA 2JL1A 1R37A 4J1SA 4XQ9A 2FOIA 1K6XA 1P45A 2FPGA 4XYLA 5JCXA 1J4AA 1B8UA 4GVXA 1NQAO 1H6BA 1IPEA 1Y8QB 4J9UE 1HE5A 4XYBA 2Y99A 1DIGA 3ZU2A 3H9GA 1HTBA 5CDYA 3TSCA 1HEUA 1LLDA 2NLOA 5I7VA 3HUDA 1Q0HA 3JQGB 1J6UA 1X7GA 4J1QA 4D3SA 4OXYA 4W82A 3ROQA 1SPXA 4CR6A 1ZXBA 2B37A 4FFOA 2FZEA 5GZ1A 4LSMA 1U28A 1YOVA 2B83A 2J3KA 4Y6RA 5TLSA 3E5RA 1UP6A 5ER9A 4A5OA 2DT5A 1DIRA 5A05A 4PLZA 3L6DA 4LN1A 2WYVA 4RVGA 4UVDA 1I3MA 3AK4A 4WOJA 3BA1A 4BNTA 3I5MA 5T6BA 4R4JA 3F5QA 3PPIA 3H2ZA 2D4AA 4I5DA 1OFGA 3UCXA 1NQTA 5AQ1A 2BI8A 1NYTA 4PLYA 4A0SA 1J49A 4PG4A 3NTRA 4E0BA 3GRKA 3KYDB 4MIOA 4ZRNA 4M49A 5I8WA 4JK3A 4HWKA 5BSGA 5K6AC 4BNYA 1YDEA 4KQWA 4OAQA 2TMGA 1A7AA 4RVUA 1KEWA 5KVQA 3QWHA 1GQYA 1KC3A 4II3A 2NU7A 3VZRA 2EW2A 3GAZA 2Y1GA 3I9JA 4RORA 1I2BA 1U7HA 1Z75A 4IINA 5CHEA 3I4FA 3RVDA 4BO8A 2NVUA 1ZMTA 3IJRA 2W2KB 3FCOA 1EE9A 3WTCA 4R5HA 1I30A 1XSEA 3ANLA 2QRLA 2WDZA 2Q45A 4AJNA 5A1TA 1NQOA 4GAEA 4F3YA 1YQDA 3A4VA 2IZ0A 1Q7GA 2JD0A 1ENOA 4JXKA 4Q3DA 4ALMA 1ZZEA 1RM0A 3CUKA 4B4WA 3BTSA 3RKRA 1Y9EA 1N7HA 3TL3A 1YJ8A 4TZTA 2BGKA 3WOHA 2O3TA 3FR8A 4JJGA 1NVTA 1O0SA 2E82A 2FMUA 4FC6A 2C0CA 4IMPA 4XJSA 1DEHA 4PLFA 4YCAA 5CG1A 3S2IA 4UEKA 3GFGA 4QSMA 4CQMD 1BDMA 4IY1A 3E5MA 5EINA 1HDGO 4TMFA 3KZVA 4HFRA 3K6JA 2DPHA 1MC5A 3OQ1A 1Y8QA 1TB4A 4MOWA 3C7AA 1U3TA 2A4KA 1B26A 4FD3A 3ZCXA 1AN9A 1HZZA 4YJDA 5F1PA 4AL4A 4B7UA 2FR8A 2X0RA 4MJLA 1P1KA 2NVBA 5TQVA 1LXCA 5JAQA 3AI1A 1ZBQA 1QYXA 3L9XA 4WKGA 4ZHSA 1PZHA 4DMMA 1SAYA 5IDXA 3OJLA 3ZWYA 1M6WA 3EK2A 4K9DA 3CTMA 2YHIB 3QHAA 3GZNA 2EERA 4D45A 1UZLA 3L4BA 3OA0A 4LMPA 1KETA 1P0CA 4MVJA 3TDKA 3EDMA 3OSUA 2VYVD 2JCYA 4GLOA 4BO7A 2NUAA 1VLLA 3DBLA 5AYVA 5MGBA 1GFSA 1NFRA 4L73A 2O7QA 3W4JA 4BIIA 4BNMA 5KIAA 3U9LA 4PFJA 1CYDA 2ZTMA 1KEVA 4MVJF 3H9JA 2UYYA 4WUVA 1I32A 3JYPA 3JQ8A 2B4TO 2NTNA 4JP2A 1E1NA 1U3WA 1L7DA 3F47A 5I8ZA 2C5EA 3H7AA 2P4HX 2B69A 2I6TA 3FWZA 1R12A 3KEQA 2I99A 1CWUA 1P33A 1B7GO 1GU7A 2YDYA 4D46A 3BHJA 4FDAA 5JBIA 3F4LA 4J1TA 1JDJA 1B8PA 2IEBA 2VHWA 3PLRA 4ZQBA 4RPJA 1R0LA 2PH3A 4ZQGA 4JX8A 5IZCC 3ZWVA 2HCTA 3GY0A 1LDEA 3ZHBA 2WMDA 4PZDA 2HMVA 3QRWA 1PR9A 4GLLA 5KKAA 4E31A 3MWEB 3X2FA 2R2GA 3C1TA 3QVSA 1G6KA 4CMKA 3PGJA 5A5FA 3GT0A 3WQRA 4NG5A 2VT2A 4P4LA 3BMQA 4YJHA 4HXYA 1ORRA 3ENKA 2G82A 2J5RA 4D44A 1HE2A 1ULUA 1T2DA 1KEUA 4A10A 1V3VA 2CVZA 2HLPA 5COQA 5H82A 2ZATA 1K2WA 1ISJA 3ON5A 3PI7A 3PQDA 4H15A 3EVTA 3C3XA 4GMFA 5BQFA 4MVJI 4BNXA 2EGGA 2C07A 4OJNA 3MZ0A 4IZHA 4BMVA 3JQEA 1F0YA 1IZ0A 1NVMB 2YY7A 4IIVA 1TVEA 1N9GB 3EZLA 4N5LA 4J4TA 1FDVA 1PU2A 1LSJA 2X1HA 3NX4A 3I6QA 2PZLA 4U0JA 3GN2A 4DREA 3D4PA 3O03A 1DBVO 3VPXA 1M6HA 4NFYA 3RUAA 1LDBA 5A3VA 4L4RA 5KJFA 3PFWO 2A92A 3JYLA 3LT2A 4XIYA 1PS8A 4KWIA 2I5PO 4OL9A 4CM4A 1G1AA 4JJFA 3V1TC 4ZGWA 3GNQA 2D5CA 1AXGA 3G3EA 1GCUA 1XGKA 2CDBA 3RASA 3LT1A 2ET6A 2X0NA 4AJLA 5DBFA 4Y98A 4DC0A 4EBFA 4ALIA 1HYEA 1XKQA 2QRKA 3R0IA 4U8GA 3TWOA 4DVJA 1I24A 2EF1A 3PHHA 4J7UA 5G2OA 4PG8A 5JY1A 4JP3A 4I9HA 4FB5A 2OGUA 3KSDO 2AMFA 3DZIA 4QUKA 4CJXA 2BI7A 2WYWA 3KYDA 2Q46A 1YL5A 3UGKA 5A3JA 5JYEA 4E6PA 3GVCA 3IKTA 1VE9A 3C24A 1IUKA 1LSOA 3IS3A 5TC4A 3D4NA 4EGFA 2DLDA 3D64A 4CMAA 1NP3A 4JNKA 4FOSA 4BNLA 1E1MA 4FS3A 1BSVA 1KOLA 2I66A 1Q7CA 4XYGA 3D3WB 4RDHA 1SNYA 2CF6A 3DBVO 2BFAA 2Y1FA 2VZ8A 3K2BA 3K73O 5JO9A 4R1NA 1HT0A 1KVSA 1WAMA 4OSPA 3SBOA 4RCVA 2B5WA 4E5YA 3HADA 4IZIA 3W8FA 3ZNOA 2QQ5A 3W8DA 1P44A 1XQ1A 5BT9A 3JD3A 5BR7A 1MB4A 1A5ZA 1U3VA 3I23A 3AU8A 3UCFA 1TT7A 3GMSA 5ICSA 1LSUA 3H6KA 1LRLA 4OKIA 3KLPX 4DYDA 1ISFA 1DRWA 3WGZA 3QY9A 1VKOA 5DN9A 3VZPA 1TEHA 2DM6A 3O26A 2VOEA 5A9TA 1I3KA 2P9GA 3PVZA 5CAEA 3BMCB 4MINA 4B8ZA 4D3FA 3IIEA 4QO7A 4DC1A 4Q3AA 4DIBA 3K5PA 4KDEA 1EK6A 5AVOA 4I1IA 3QA9A 4GWGA 4O1MA 3BTVA 2NQ8A 3VH3A 4CM5A 3MOIA 8LDHA 3F4BA 1PZGA 1SOWA 3BMCA 1RJWA 3EY4A 1CF2O 3GC6A 1U3UA 2P2SA 2PKRA 1SCUA 1LQTA 1PJQA 2H6EA 1MX3A 2R6JA 3BYZA 1DFIA 3A28A 4GX1A 4R1UA 5IN5A 5T5QA 3ZV6A 1K5HA 4CQLA 1ISHA 1K6JA 1V3UA 3F46A 3F1LA 4RZIA 3ZWMA 4ND5A 5TT0A 7MDHA 4ND1A 5JDIC 3ZZNA 1F14A 5I9MA 4R1TA 3GG9A 4K1LA 3ROMA 3TZ6A 1DO8A 4BGEA 5LC1A 3SLGA 2GSDA 3GDFA 1T4DA 2C54A 2UVDA 2GRAA 1E3LA 4WOKA 5BNIA 3RUHA 4U5QA 4ONEA 4DRYA 4FIZA 2WYUA 4BQPA 4NNJA 2GZ3A 4R69A 3PK0A 4TKLA 3FPLA 4PRKA 1SO8A 3NRCA 4CR7A 5K6AA 3LLSA 4J7CA 3T4EA 4RQTA 1XLTA 3U49A 4WCFB 4A27A 1HSZA 4WK6A 3DO5A 4EEZA 2HK8A 2PR2A 3W6UA 2VWGA 1BVRA 5IZCA 1ZK3A 4N54A 4OMUA 4WNCA 3ZHYA 4B8WA 4WLFA 1ENPA 3BHIA 3GPIA 3MOGA 1I8TA 3E03A 1E7RA 1U8FO 2I65A 2YQ4A 1QXSA 2Q2VA 3SLKA 3GPDG 4JBIA 5KWEA 5L51A 1KBZA 1YL6A 4RLHA 4L9RA 5I7SA 2WE7A 4NQZA 2W8ZA 2IRWA 5CEEA 5C7LO 3C1AA 4XDZA 2ZIZA 2Y68A 3DB2A 1LC3A 5A06A 3GNSA 3Q0EA 1KERA 4BNHA 1ZK1A 1TT5B 2P91A 3DBHB 2VYND 3GEGA 4WCFA 3JV7A 1HZJA 5U1PA 3MJSA 2XXBA 2Y93A 3E82A 5JCJD 4D7AA 3ITKA 2X5OA 3HFGA 2EP5A 4L4XA 1YE3A 3TJRA 1M66A 1IYZA 1DC5A 4CM1A 1T4BA 3FBTA 1BXGB 2GNAA 2GUGA 5JCJA 2D2IA 1H5QA 2YJZA 4EEXA 2FRDA 2RCYA 3GA0A 2RHRA 3KYBA 2VZ9A 4CM6A 5AXBA 4Y67A 3HN7A 4C7KA 5THQA 2C59A 3I1JA 4BNIA 1BRMA 4A03A 4W7IA 2ZB7A 1QMGA 4PG6A 4CLXA 2DBVO 5JY6A 3JQ7A 3DBLB 4OXNA 1HRDA 2X8LA 2G1UA 1FDUA 3F3SA 4NK4A 3GZ4A 4B3HA 2C5AA 2SCUA 4XRGA 1SBYA 3H9QA 6LDHA 3HWRA 5HM8A 1A4UA 2IZZA 2C2YA 3EZYA 3MJTA 4TROA 4YEDA 4NR0A 4CUZA 1GUYA 2Q2QA 5TGDA 3DBRB 3OFSA 2D59A 4OYRA 1BDBA 4Z0TA 2NACA 1K3TA 1BTOA 1GQ2A 1UUFA 2AQHA 2QYSA 3CZMA 2XF8A 3ETDA 2F1KA 3PTZA 5DCUA 3OIGA 2C7VA 1BMDA 2RHCA 1H9BA 1KS9A 2QYTA 4DGSA 4R5MA 1ENZA 4F6LA 4AJ2A 4XGNA 5LDHA 4WPGA 1MXHA 4QFCA 3UUWA 4J91A 2PH5A 4Z0PA 4QTZA 2DU8A 1GUZA 1I10A 3HN2A 4MKZA 3O8QA 5IG2A 3HJAA 4MVJM 3F9IA 4UREA 2WE8A 1ZMOA 1FDTA 2D1YA 1NR1A 3TOZA 4CV3A 4OQZA 3JSAA 3S2FA 4R9SA 5IXSA 4U6SA 2VTEA 5ER6A 2O3RA 2OORA 4KTTE 1XG5A 3MJEA 3INRA 2YQ5A 4IJKA 4I5FA 5IZ4A 4ITUA 3WX0A 1EEHA 1RKXA 1GEGA 2EIHA 3V1UA 1DFHA 1YWGO 1H94A 3WIEA 1NPTO 1LI4A 2YFQA 4MVJH 3GF4A 4WJZA 3HZZA 3NTQA 2V6FA 3IMFA 3RJ9A 2E49A 5FEUA 2EG9A 2Q1UA 4MIYA 3VZSA 1PWXA 3QE3A 2Y1DA 1FDWA 3JQAA 1GADO 1H2HA 4ROSA 3W6ZA 3FN4A 3IOYA 3JCZA 5L4LA 5TS3A 3PWSA 5IF3A 4BL5A 1HE4A 3OECA 4EJMA 5JPIA 2DTDA 2OMEA 3WSWA 4HBGA 1Z45A 3EGOA 4CM4B 3NV9A 5FI3A 1QR6A 2X23A 3ORFA 1HDXA 2WD8A 1GYQA 4CV0A 2FHSA 4IDBA 3S8MA 3C7DB 3OIDA 3PWZA 1F17A 3DDNA 2CFCA 4TRRA 1FF9A 5KKCA 1M76A 3WGTA 1MFZA 4XYMA 1WWKA 4P8RA 5DDIP 2PZKA 3GG2A 2AEMA 3UF0A 3EUWA 5DBGA 1QYDA 6ADHA 3RC2A 3RAJA 4II2A 1GV0A 3AY7A 3O8QB 1PL8A 3F5SA 4M86A 1HETA 5GMOA 4NJMA 5K0ZA 4CMEA 4YJHB 1OAAA 2JHFA 3JQAB 4PG5A 4Q3CA 2ZTVA 1W6UA 4N7RA 5ENVA 3UHAA 4YR9A 4E2WA 3LQFA 1O6ZA 4UUNA 2FSVA 3MCVA 1ZW1A 1JVSA 5AXDA 5B37A 3I52A 2GN4A 4K6CA 4B7CA 3HHPA 4GWKA 4RF3A 1A4IA 2JJYA 2Y1EA 4Y6PA 4ZA2A 2OBNA 1U9JA 2GN9A 2OUIA 3FTNA 4BNKA 1QKIA 3L4SO 1NHGA 4LRTB 1FDSA 4AJPA 2AEJA 1NNUA 4XA8A 5FYDA 2GLXA 3GEMA 1EUZA 3ONEA 4WLEA 1X14A 4RJTA 5JC8A 1SEVA 5JAMA 3E6AA 4EI2A 4TRJA 3E1KA 2NQTA 1E3WB 3AOEA 5JS6A 3FD8A 4BKRA 3FR7A 1R15A 1OZAA 1EDOA 1YOVB 4BNFA 5EIOA 1ZH8A 3LT4A 3VPFA 1DFGA 3RJ5A 4Q3EA 3RC7A 2PV7A 1AGNA 3GR6A 4JROA 4IGEA 3GGOA 2OO5A 3OEWA 2Q1WA 4FGSA 5DP1A 4XGIA 5A9SB 4PLTA 1GDHA 3AM3A 1KVTA 1A27A 1NFFA 1MUUA 3JD2A 3V2HA 1AXEA 4M55A 3NT4A 3NGXA 3M1LA 4NK5A 3GAFA 1NQ5A 1QORA 3NDJA 3L6EA 3P2OA 1MGOA 4J9VA 5ITWA 2HMWA 1HDCA 2DFDA 3PP8A 3H9EO 5AXAA 1I2ZA 2Q1TA 3QV1A 5H81A 1F8GA 3KUXA 3MTGA 3VDQA 1VSUA 3HB5X 1YJQA 2BD0A 4YAJA 1DRUA 5A4DA 1VJ0A 4INAA 4IQGA 5CDGA 5JXWA 4TQGA 4B3IA 1B0AA 4IJUA 2V7PA 3Q3CA 4CV2A 4AJEA 1PL7A 4OH1A 5KCZA 1HSOA 1X13A 1HWYA 3TNLA 3BMNA 4Q9NA 3V2UA 4YQYA 1LDGA 2WD7B 1F06A 3DQPA 4ND4A 3SX2A 4XB1A 2Q4BA 5KVVA 3AY3A 3WR5A 1DDOA 2WJPA 3B70A 3W4KA 2VHZA 1NX6A 1ZEJA 4RDIA 2BF7A 4B4VA 5L40A 2E4AA 3IAHA 4YYZA 1DHTA 4JN6B 5CPBA 2W90A 3FI9A 3AUUA 4AJJA 3DR3A 1V35A 4Q3BA 3E9MA 2O2SA 3ICCA 2CSUA 4WLVA 1CJCA 2BKAA 1E7MA 4LCJA 3ROPA 3ZWPA 1FK8A 2PD4A 2GYYA 4JBGA 3JD4A 1F8FA 3L6OO 4OKNA 1LRJA 5JW6A 4JIGA 2J3IA 3QQPA 3AM4A 1HL3A 4QEDA 4DLAA 4EUEA 3DAFA 5ILOA 1ULSA 4GL4A 3L77A 4BNUA 4FR5A 1BW9B 5EJ2A 1X1TA 1P31A 3WGQA 1EUDA 4TVOA 4E2XA 3O38A 2IZ1A 1X0XA 4PVCA 2PWZA 4E3ZA 1KIFA 4IXTA 2A35A 4Z0HO 1NXQA 4IGFA 4R3NA 4PLWA 1WW8A 3WGIA 2OZPA 3C7CB 1ENYA 2JCXA 3IKVA 3QP9A 3TZQA 3ZI0A 4KQXA 4N5MA 1O9BA 1ZUD1 3UOGA 1FXSA 1LEHA 4EJ0A 3PYLA 3QJ5A 3CPSA 5LCXA 2BELA 4I9UA 4CMHA 1YBAA 2EEZA 1Z6ZA 3S2GA 4F45A 4RZHA 3ZV4A 1HLPA 1EVZA 1G0NA 1D1TA 3A1NA 3WWYA 4S1VA 4CM8A 4DL9A 2NSDA 2Y05A 3H5RA 1TXGA 3DZFA 4FJ1A 1HYHA 4RPLA 3GRPA 4NJOA 5A9RA 3D3EA 2JKVA 4MDHA 1ZFNA 1XYGA 2EJVA 1U5AA 1AHIA 4XR4A 4ZICA 1AUPA 2AQ8A 4JBHA 3WGHA 1I2CA 2J8ZA 4AG3A 4NHEA 3MEQA 5CFZA 4PLVA 4E21A 2FPPA 1M75A 3DZGA 3WWZA 5B1YA 3DMTC 4Y8VA 3B20A 2YV3A 4BO9A 1K0UA 4Z9FA 3WBBA 3PIDA 3F6YA 1N5DA 1VI2A 3BXXA 3FBGA 3UCEA 3T7CA 1U7TA 1CETA 1YH3A 4NMHA 1RYEA 3DFUA 4I5GA 4MIEA 3G1TA 4OOEA 3D3WA 3V2GA 3ZU4A 5JYDA 3JTMA 2CNBA 2AG8A 4X54A 5KTKA 4CM8B 5JLAA 4ZD6A 4FFPA 2G5CA 3OEYA 2PFGA 3ULKA 1ZK4A 4DPMA 1P1RA 4J4HA 1UZNA 3D0OA 2QW8A 1XR3A 1BVUA 3U4CA 3GVXA 4IXWA 3CZRA 2PKQP 2ZK7A 5K9ZA 3VH4A 1X7DA 5A02A 1AE1A 2ZTUA 2C20A 5G0VA 4LMRA 3U4DA 1PJ2A 5HBRA 4RVHA 1IL0A 2AQIA 2W98A 3DZHA 3NYWA 5F1OA 2H1SA 3Q9UA 3PHGA 1RM3A 2HSDA 4M87A 3UN1A 4BO5A 1H0KA 1A9ZA 1X7HA 2WSBA 1EFKA 1PWZA 1YL7A 4Z6KA 1UH5A 4IDAA 3LVFO 1JWAB 4I08A 1ADGA 5BSHA 5CDUA 2O48X 4HFJA 1T2FA 1P1JA 4YJGA 2GPTA 4GGPA 4UVGA 4WCFC 3M1AA 2EKPA 4UEJA 5T64A 1Z7EA 4B4UA 1EZ4A 4CM9A 9LDBA 3QSGA 3PHJA 3P7MA 1ZVMA 4YT8A 1T25A 1UXIA 3JD0A 3HDYA 1NVGA 2ZCVA 4KOAA 2QZ9A 3E8XA 4WLOA 1B2LA 2P9EA 3PWKA 1PIWA 1C3VA 3AUAA 4R54A 3DOJA 5GZ3A 3TPCA 3JQBA 1GD1O 1IULA 3RC9A 1T2AA 1P77A 4I9NA 4CUKA 2YV1A 3M2TA 1YONA 4DPKA 5L7WA 4D0RA 2RAFA 3GHYA 3HG7A 3KOUA 4IS3A 5KNLA 4I8XA 5TSDA 3OHSX 1PEDA 4CR8A 3Q11A 1HLDA 2O3JA 1BXZA 3G1UA 3IUSA 3MTJA 4JQCA 7ADHA 3BMOB 1U8XX 4LISA 1PZEA 2NTVA 5I7EA 4XZ3A 5DULA 3KSZO 1DAOA 1ARZA 5COAA 3WXBA 1YKFA 3I9NA 1DHRA 4Z3KA 1ZJZA 1WMAA 3WG9A 3H3JA 1J0XO 3OETA 4IQ0A 2AQKA 4DQXA 4OQYA 1KY4A 4LW8A 2EGHA 2V6GA 3TZCA 3EMKA 4CLHA 1T2EA 3DAPA 3OBBA 5ITVA 2V6MA 1G0OA 3U4IA 1LQUA 3BTUA 3TQHA 3ZW9A 4W7HA 3WMXA 2XOXA 3CEAA 3EAGA 3IUPA 4NIMA 4PIVA 1ZK2A 1NPYA 1YGYA 1C1DA 3EC7A 4IMRA 1WZEA 2O2YA 2X4GA 3ICPA 4DYVA 1PJTA 1T1SA 2H9IA 4CLRA 3PJGA 3NT5A 4EW6A 2VCYA 4TRMA 4XX0A 3TRIA 2GZ1A 1NAIA 3DAGA 3HQ4O 4BO6A 3SXPA 4JCOA 1YBVA 1VL8A 1UAYA 3T7EA 3VOSA 4DUPA 2D5AA 2B35A 2O4CA 2Q3EA 3FHLA 1OC2A 4W9NC 1ADBA 1BG6A 1P3DA 2RBEA 3AM5A 4OM8A 2ZQZA 4U7WA 4YAEA 4BV9A 3OJ0A 2JFFA 1N8KA 1Y8RB 3R3SA 1WDKA 3I3OA 4L8VA 1Y6JA 1QRRA 4OGWA 3INTA 1MG5A 1NFQA 1CERA 4IDCA 3WICA 3CMMA 3RU7A 1MFPA 1Y81A 1GZ3A 5IFLA 3D1LA 1ISIA 3ZWNA 1NBOA 1GYPA 1GPJA 3WGGA 2X86A 3FNEA 5CEJA 4BKOA 1B15A 3DTYA 4IDFA 1Y5MA 1JAYA 1LC0A 1PR3A 2J6IA 4R16A 5HRUA 1NHWA 1NASA 2VYVA 3RKUA 2VRBA 3M2PA 1NAHA 1EVJA 3ASVA 4RPKA 4TZKA 2FWMX 1UJMA 2VUTA 4HP8A 2OP1A 3C1OA 3FPCA 3HDHA 4W6ZA 1DPGA 5JDCA 4FN4A 1MV8A 4UUPA 4AVYA 2VTDA 2UV8A 3WNVA 1X15A 4XQCA 3KETA 1P74A 5EESA 3RUIA 1C0IA 4RF2A 4H7PA 3VKUA 2E37A 1C0PA 2DTEA 4L4SA 2ZYDA 4O63O 2XPCA 3PFFA 2D3TA 2NM0A 3KO8A 1YXMA 4PZCA 2Y0DA 1NWHA 2CVQA 3COSA 1QG6A 1E6EA 2DAPA 1LTHR 5B12A 2P5UA 4NFHA 2UUPA 5DF1A 3DMTA 2QG4A 4FGWA 1R4NB 2Q99A 1JU9A 3C8MA 2X0IA 3DHYA 2OL4A 5T57A 3PYMA 2X9GA 1UDBA 3GVHA 4RLSA 3PHLA 4GH5A 3LF2A 3EVNA 3NDRA 1F12A 2BLLA 4XQGA 5L53A 1EUCA 1TLTA 3QIVA 4F6CA 3ADPA 3CSDA 3GUCA 4YBZA 4CLOA 4Q3NA 4IUYA 3D7LA 4WECA 5B4VA 4P4NA 1BW9A 1PSDA 4U6QA 4E5KA 5B4TA 5B4UA 4NPCA 1ONOA 3INGA 4XRRA 4BNJA 5IXYA 1ZSVA 3L07A 2PTGA 4EUHA 3QVOA 4AFNA 4YT5A 3VAZA 1H6DA 4CMIA 3EYWA 1JAXA 3PQFA 3H65A 3ST7A 1UP7A 2C82A 2VNSA 5AOVA 3C85A 2DBRA 1D1SA 1ADFA 5CDSA 3CKYA 4BHTA 3SVTA 1QV6A 5GY7A 4F46A 1UDAA 2BGMA 1A7KA 3GGGA 2ZB8A 3JQFA 4YXFA 4BOYA 4MVJG 1EE2A 4O6VA 4DIFA 2E48A 4UEOA 5EN4A 1UXHA 3VVBA 4PN3A 1ZKMA 4DBVO 2CD9A 1VL6A 3NEPX 4UVHA 5TIIA 3IC5A 4GSLA 4BGVA 4H16A 3WLFA 1SB8A 1L7EA 4KTVE 3E18A 4YTEA 4RGBA 4WGGA 2ZB4A 3D5QA 3N7UA 3AUTA 5KJ6A 4NBRA 3CE6A 2OHXA 2WD7A 2ZKLA 1HDYA 3AUSA 1QLJA 1HDOA 4NFSA 3WYEA 3G17A 5L4SA 2WWRA 1WDMA 3UAGA 3DTTA 2TMDA 4G65A 2CY0A 2E6UX 1IZ9A 1R16A 4PLGA 4Z9XA 4NZ9A 1V6AA 2RH8A 4R41A 1KEPA 1A71A 1DC3A 2R00C 3GVIA 1XIVA 2Q4EA 5DCWA 4GVLA 1ML3A 1I3NA 4RL6A 2JCVA 4TSKA 1T1RA 4P4GA 2CVOA 3FTPA 3PYXA 2J3HA 4J0EA 1X1EA 3K2EA 2Y66A 1JQBA 3JQGA 3GNTA 2C7GA 5L7YA 4D43A 4RPGA 3ZV5A 4XB2A 3KYCB 1KVRA 2VT3A 4L74A 4ZU3A 1VL0A 3H8VA 3VHRA 4D41A 2EKQA 1HE3A 2CDAA 3F1KA 3H2SA 4NH4A 3RUDA 3KLMX 1C1DB 1BGVA 1O5IA 2VHXA 3WGYA 1H9AA 1DJQA 1MP0A 1UP4A 3AI3A 2BFOA 4RO0A 2HRZA 4WEQA 3WFJA 1CQJA 3WNQA 3H4VA 2HJSA 3AJRA 4IIUA 1BWSA 4YQZA 2GN6A 1GZ4A 1LDNA 4ALNA 1XDWA 4HX5A 3T4XA 1N2SA 3GQVA 1LBEA 1O94A 3DOOA 3DBHA 2GR9A 4YDRA 2DUWA 3WJ7A 4CODB 4FFLA 4J3FA 1E7SA 4J7XA 3RI3A 3V1YA 2YV2A 3E9NA 4ALLA 3JQ7B 2DC1A 4AJ4A 1IHXA 2HUNA 1RM4A 4O59O 4EITA 5TX7A 3FSRA 2LDBA 4YACA 1E7WA 1GAEO 3KB6A 4R1SA 1W4ZA 1HDRA 4Y6SA 5F5NA 3DFZA 3QVTA 3OP4A 4YRDA 1ID1A 3CIFA 3HDQA 4YJFB 2NWQA 5I9NA 2HQ1A 4QXMA 2QX7A 3GUYA 4AICA 3I9MA 4G5HA 1YRLA 1BXGA 4CM7A 3H5AA 2VRCD 2V6BA 4FSHA 3QWFA 1PJSA 1WXDA 1D8AA 3DOCA 1PZFA 4HFMA 3DWFA 3W8EA 2VWHA 3G0OA 4CMCA 1U2GA 2VQ3A 1W73A 2VRCA 1KY5A 1TI7A 5C7IO 3VC7A 3ZU3A 3VVCA 4BB6A 2GN8A 2X5KO 2XAAA 1I0ZA 3DHNA 3IDSA 5HA5A 5T8KC 3FF4A 3K9QO 4CMEC 3OQ6A 5F3RA 3GOHA 3OQBA 4CLOB 4MVJP 4QO8A 3WSVA 5ENDA 1IPFA 4LK3A 1U4OA 2AA3A 2X9VA 4R51A 1PJLA 1E6WA 3RQSA 2FPIA 3NUGA 4FC7A 5CPFA 1YQGA 3VTZA 3I83A 2VN8A 3DXFA 1PJBA 2O3QA 3K92A 4HFNA 4CM9D 2OP0A 4XIJA 2I3GA 3EW7A 1NWCA 5DCYA 2EJWA 4PG7A 3PJFA 3N58A 3K8ZA 4D3DA 4DQUA 3RIHA 3LC7O 1ISMA 3GEDA 4MVJD 3KTDA 1Y1PA 1RWBA 1P0FA 1ZO8A 2WEKA 4PGFA 5G0TA 4UUOA 4CV1A 4JLWA 5JSFA 4RV9A 1IOLA 1W0CA 3OJEA 2AG5A 2NU8A 1E3JA 2X22A 3H5NA 4M54A 2P68A 3U62A 3ZWAA 3ETGA 2CDCA 2IEDA 3NJ4A 3WYCA 3JQDA 1WMBA 2DTXA 5G0SA 4ZN6A 1GCOA 4MP6A 2DKNA 4DBZA 4K6FA 1EMDA 3HFSA 3ZNNA 4BQRA 1VKNA 2X9NA 1QP8A 3TOXA 2PGJA 4W4TA 2HO5A 2I67A 1JKJA 3Q1LA 2DVMA 2AEFA 1Y7TA 4CQLB 4XR9A 1SZJG 4O0LA 3WDSA 4FCCA 1DIHA 2NVWA 1Q1NA 2YYYA 4M89A 2RH4A 2UAGA 5DOVA 4R68A 2NNLD 1WP4A 2JFHA 1HDZA 2CUKA 1PL6A 5CDTA 4E13A 2LDXA 4YA6A 1R66A 4J2OA 4CMGA 1Y8RA 1S7CA 1E92A 4IQ8A 4DWVA 2QHXA 4BNGA 3ZGYA 3VTFA 1XHLA 4BO4A 4W99A 4CQMA 3OA2A 3IJPA 1CQIA 2HU2A 2IYOA 1BXKA 5CG2A 4YAIA 4G81A 3GMDA 3JQBC 4QFDA 4BVAA 1Z74A 4RF5A 5EQDA 3ENNA 2A94A 1I36A 5F21A 1C0LA 1V0JA 1YQXA 4GBJA 1ADCA 1XCBA 4DLLA 3I9OA 5DZSA 3PQEA 5JDCC 2YFHA 2WM3A 2B36A 3B1JA 3TN7A 4NI5A 4AJOA 3GHHA 4BNNA 1RYDA 5A5EA 2WTBA 3TL2A 3R6DA 1SC6A 4XGKA 1OMOA 3AOGA 3VDRA 2RIRA 4CLEA 4YPOA 1WZIA 4GI2A 2YDXA 1PGJA 1UAGA 2CF5A 2PNFA 3ABIA 1LLCA 3RSHA 3ONDA 1B3RA 2B4QA 5TJ9A 2AXQA 3ZWWA 3KEOA 3IP3A 1GR0A 3QWIA 1TT5A 5THKA 3GVPA 2PD6A 2Z1NA 5A03A 1YO6A 3ZN2A 3SJUA 5ILGA 3P5SA 1S6YA 4YJGB 3HDJA 1WVGA 1NR7A 4CLDA 3PIIA 1LJ8A 4BMNA 3O4RA 3U4HA 1XQ6A 1PQPA 2IXBA 3BMOA 5KJEA 4PZEA 4BO0A 5DT9A 3PDUA 5BNTA 2X6TA 3RFXA 4BNWA 1XELA 3I6IA 3RUCA 4TVBA 4Z9YA 3QW2A 5L4NA 3OIFA 4XD2A 1QLHA 1QYWA 1JVBA 5JFOA 4DLBA 4J6FA 1OOEA 4CMBA 1ZCJA 4CL8A 4MVJE 5EQFA 1D4FA 3VZQA 1E1KA 4N18A 3HNPA 4WE3A 1VM6A 3DONA 4UVEA 1ISGA 2NU9A 1N9GA 1VPDA 3CH6A 4E30A 4XQEA 1D3AA 2IXAA 2PKQO 5TJHA 3S2EA 1H2BA 5ES3A 3O9ZA 1VJ1A
chains in the Genus database with same CATH superfamily
5JWHA 4RKQA 3MHTA 3RVJA 1E4EA 2R00A 3BJZA 3HKEA 2F8TA 2QP4A 1CQPA 4MMXB 2JJ1D 3MWDB 3AZQA 4ENUA 3BB1A 3KV3O 1FB5A 3DWEX 4DMUB 4A26A 2B8EA 4C06A 5LYJF 3DEFA 5C5EA 2IDKA 5K0TA 1ZSNA 3A8TA 1EBUA 3DV2A 4IYRA 4BNVA 1JLHA 2X3UA 2FZKA 1E96A 4RC9A 2QK4A 2CHUA 1LV8A 3CT4A 3OEHA 2OR3A 5KHOC 1QUFA 3UK1A 4ZC8A 2HADA 1XWFA 2BFNA 4WZAA 1ZGAA 2ZIUB 3H1BA 3LZDA 3R3JA 1V8BA 4UBMA 5K3SA 2XCRB 3KTAA 4S3MA 1G18A 5GV7A 4C14A 2FFAA 3HSKA 3KQPA 3AR2A 4H7FA 3SEFA 2JDIA 3LPDA 1LX6A 1NJ8A 2P62A 4OGLA 1IRXA 4HRAA 4BVGA 5C37A 2OD7A 4H7EA 1KIAA 4TL8A 1RYHA 4KXQA 3LLCA 2QZ4A 3KELA 1NN0A 1QTRA 4DXHA 4KRGA 1H2AS 1YB5A 1RE1A 2ZEJA 1F2TB 2B4RO 3M6FA 1R8SA 1C9JA 3LXUX 1JR3E 2E4VA 2H07A 3EG5A 4G85A 4QREA 1RJEA 1G3RA 3LT0A 3PNQA 4KSBA 1KIMA 4D6YA 5B55A 2KQUA 9LDTA 1A5AB 1WV0A 1R4ZA 1V5IA 2O2EA 2ZT8A 3LWDA 4PYJA 2RGDA 1G6Q1 1G64A 5HKBA 2Q5OA 1JDUA 1QGZA 1YZQA 1L6IA 5IDQA 4FPXA 1I4DD 5A4IS 2PZEA 1P4SA 4X1KA 1A9RA 3ASYA 3DTVB 3FUXA 1Z29A 1B41A 3N0WA 5BRAA 5C53B 1DXHA 3DMYA 5IYZB 1IZZA 2QZJA 3NGLA 4OHXA 1WDLA 4UCWA 1H42A 3AG5A 3QVKA 4CG0A 1N1EA 4O4HF 3EPKA 3K4PA 4G8CA 2A8YA 3ADOA 4LPSA 4X6XA 3I0ZA 1CVRA 3TRJA 5LM3A 3O8CA 4LQDA 3U3XA 3WLRA 4BV8A 1UPTA 3STHA 2I91A 1GDTA 1CY1A 4C0LA 1QYVA 4HSEA 4ZJUA 4DDVA 3STTA 3R1IA 1RXIA 1WHSA 5FPYA 1T3GA 1T24A 1XCGB 2JGAA 3WGMA 1R0BA 3E48A 2NUTA 2C3UA 2GUWA 4AMUA 4KDFA 4OX9Y 4QUEA 3AWDA 2PXCA 2V0NA 4UCFA 3ONFA 3R74A 1JHQA 3KR2A 3GFFA 2H18A 4HI0E 4BKUA 2GCGA 4R1MA 5JTTA 4C4AA 4ENPA 3CEHA 1SXPA 2GSWA 3ANNA 1GQRA 3OJFA 2FEWB 3ZVLA 5AKEA 1I6KA 1EBBA 1ZHHA 3BIFA 3QEAZ 4UATA 3FDIA 3A58B 4A6EA 2Y1OA 4YVFA 3K9HA 1XZLA 2WVGA 1I33A 2CL0X 2PA3A 1NW6A 4FIDA 1VKZA 1ZCBA 2VK2A 1CVLA 2A5GA 2F43B 4DE5A 1QKKA 4KMMA 1GL3A 4MRRA 5JUWA 1Z7BA 1XZKA 2MR6A 3OO0A 2IEYA 3HCFA 1GSAA 2H63A 1GN8A 2PUFA 2IY9A 1M6VB 3HV0A 2ZVQX 2XMSA 1B8VA 2JEZA 4N03A 4RK7A 1WSAA 5FQNA 2DCMA 3T0FA 2QD1A 2E4YA 4IEEA 2PHZA 1IWBB 3SC6A 3AI2A 2I4OA 5ILQA 4F3NA 1ZH4A 3NXSA 2WBLC 2NV2B 2FPSA 1YIAA 3MG9A 3Q8WA 2G67A 1QAMA 1FW6A 2PIAA 1XMSA 2XY4A 5I9IA 1OWNA 1JH8A 5K3AA 3IAEA 4REOA 5KYTA 1LS1A 1WPXA 1CUAA 3GFTA 2EWMA 3A6FA 4JLSA 1PEAA 5GM1A 1I2AA 2VPIA 1XZFA 1RPZA 2NZUG 4RVSA 1I4EB 1EQ2A 2DEUA 3RAEC 3BFKA 1W93A 3DULA 1GQSA 4FJ0A 1DLJA 4IAOA 4IIJB 4K88A 4QQFA 4WAUA 4YQEA 1MIOA 2J87A 5SY9A 2WU4A 2R65A 1ZEMA 1AB6A 3U7QA 2AN1A 2BLNA 2X58A 4LF8B 2XUJA 1VGVA 3QE4A 1EE1A 3FNQA 5EZ6B 4I7EA 2J3MA 4OQXA 4JI7B 1R0SA 3SDSA 2HDHA 1FTYA 1DXYA 2PAAA 2X42A 4OK3A 4B2PA 1THGA 1D6NA 1FJ2A 2D8AA 2J6HA 1U94A 3A4NA 5IARA 1SZPA 1TECE 3P9RA 2JLUA 2BFBA 1W4RA 2FW0A 2WWWA 5L7TA 1L3BA 2VCEA 4MRSA 4WLNA 5D8DA 1PV1A 1W2WB 1AO0A 1M7BA 2Q4RA 4BP8A 4ALKA 1QU2A 1GRRA 5DSTA 2FB9A 3C4VA 3IJEB 4MI1A 2FOLA 2O2XA 5DNDA 5AVVA 1T9DA 5EHGA 2VJCA 4FW8A 1Y4DE 1QIMA 1B14A 4B82A 1OR8A 3L3BA 3RAFC 2JAPA 3HY4A 3OAAD 3GZNB 4GX5A 3EDCA 3KEFA 4K28A 4MP8A 4XI9A 3R8XA 1DKPA 1LF5A 3LP5A 4DCNA 3I61A 1GTMA 2B1GA 1G8JA 1ZD2P 3BEDA 3LSYA 1NN1A 3P52A 4JGBA 2QMYA 2JLVA 1GO2A 2DE0X 1F3OA 3D6NB 4FE3A 4IPTA 4WT7A 5JO0A 2NIPA 4L0QA 3UB2A 1N6KA 4Y30A 2VA9A 3CLSD 4GOOD 5C7OO 1GGKA 2Z04A 1ZKDA 5E3JA 1KQGA 3GRAA 4P3KA 4HMOA 3IMGA 3MT0A 4W9NA 2J6CA 4EEKA 4AWBA 4HVLA 4GQBA 2Q6KA 1P2FA 4EG6A 1S89A 2VKTA 2GASA 1GILA 1UBCA 1KH3A 1T5BA 3GA7A 4C07A 1M73E 3NZEA 1UXGA 1C0KA 2GBCA 2PJDA 2VBCA 3D2BA 1CDOA 3TW4A 1H1DA 3QG1A 4GM4A 3K35A 4NJMB 4G41A 2AHRA 2ZDHA 3RC1A 2VYNA 1Q1ZA 2CE2X 2QSZA 1XA0A 1FSFA 2I62A 4WCDA 5BNZA 2A0WA 1MEOA 2O23A 4BLVA 3B3QA 3IOBA 1BXRA 2H2AA 2PLRA 3LM8A 4RHUA 4HYQA 4X60A 4DG8A 4YAKA 1FVHA 1G8FA 3EPPA 3WRYA 3KLNA 3WXMA 3PFHA 1VRWA 2WB4A 3F4KA 4CDRA 4FEEA 1KJYA 5A6SA 3QYPA 1XWIA 2JGNA 2IF2A 1QIKA 4CPDA 3LV8A 1TUEA 5JV5A 3EXHB 3KHSA 4WLUA 4ZQHA 5J4LA 1OROA 1EP9A 2KI5A 2BGGA 4TOIA 4ZO6A 4X66B 5DHPA 1FTNA 4DC9A 4FFNA 2UU9B 1ZIDA 4OGKA 5CYFA 2YUTA 3RVSA 1WLYA 4OQDA 3V8RA 1JJBA 2QTZA 2WAYA 4RADA 5E1BA 3C5HA 1G59A 1UXKA 2PDAA 3T9CA 5AUPB 1VLMA 1T2VA 4GX2A 1JS1X 3IQHX 1Z35A 1Y9DA 2W2KA 1OH5A 1H8HA 1YMUA 1SOAA 1EJ2A 2P9ZA 2QTRA 1TUIA 4JJ7A 1TM3E 2FFRA 2QD4A 4QU0A 2XB2A 4AYWA 3O1IC 1U65A 1ZAKA 1S5PA 4HKTA 4BQOA 3U60B 5A0VA 2OFXA 5CH3A 5H0IA 5DWQA 4MGHA 4AJHA 2G63A 1D8TA 2WF5A 3RK0A 3L8CA 1DARA 3NKLA 2QG9A 4E5PA 5HVNA 3K4QA 5COBA 3VSCA 3WLEA 1RLJA 3QVWA 2PUEA 1YV9A 5ERXA 1VIDA 2G70A 2VNKA 1QG0A 4A73A 4KR0A 1T5HX 2ZAIA 4EB6A 3K70D 3HBLA 4L0DA 4MULA 2XA2A 4LYAA 5HF6A 2Y1CA 1NSTA 3A06A 5HG0A 4ZEOA 1DBQA 4BMOB 4CKXA 1PTJA 4H27A 1I3LA 4KO4S 2XXJA 2BFMA 4XSHA 4ZCSA 4IDQA 5JC1A 5LIRA 4J0CA 3E3AA 3KJGA 4OO3A 2GHIA 5D7NA 3RUEA 1A2BA 4G8BA 2ZJ0A 3G89A 4QT0A 3T3DA 3WL7A 5J2UB 4TV8F 3CRQA 1RHKA 1T4GA 2I76A 1RWNA 2CXQA 1DO2A 4C03A 2ZVJA 1N2ZA 5KINB 5FR1A 3JVIA 3SS8A 2AVDA 1KVQA 5AJZA 3LUFA 1OKKD 2V97A 3KXLA 4ZQFA 1I7DA 1G66A 1PJCA 4TXNA 3ZDZB 4RA9B 1PYDA 2NUBA 3PVSA 2X7HA 2EP7A 4P22A 4WZAE 1AXRA 1Z83A 5EWJB 4HNTA 2W5UA 2BRUA 2HJRA 4DNOA 3FPJA 4NY1A 3ZTTA 4MW6A 2WSSA 1JYEA 1A9XB 4IJ6A 1EFRA 1PS0A 4MMZB 3G79A 4YRPA 3GFBA 1TF2A 3D3KA 3T99A 1VCMA 3VAYA 2XB8A 2X9QA 2XTJA 2ZQYA 5SY6A 2ZYIA 1ZOOA 4HEQA 3OFND 5EHNA 4DQ0A 5KPDA 5HTKA 4LY9A 1QO0A 4NKRA 4A91A 3LQ2A 4ASUD 3U0BA 1HE8B 2AZDA 2R4UA 2OGZA 2C4NA 4AO6A 1E4YA 4ZJZA 2O0HA 1DE0A 2OBYA 4BGUA 1OZHA 2PIDA 1SXJC 2QUZA 3VGPA 2VYQA 4K6GA 2F1JA 3NH9A 3PDJA 3OTIA 2PT6A 4HNUA 1W46A 2RB5A 2BEVB 4BEWA 4LY0A 3C4JA 1NUQA 1NT2A 8ABPA 4TXLA 4RTRA 4ZOLF 4HJXA 4ED9A 3HBNA 4QYMA 3DAYA 3KWMA 3LQQA 4MLZA 1NM5A 4FDVA 4PO9A 2JI9A 4X62B 1W2HA 7REQB 1OXSC 3U3OA 3ZBPA 2FJPA 1G7RA 1OXKB 1BDIA 1P5ZB 5DCLA 1H6CA 1EYZA 1RRGA 2ZRDA 4GRIA 2ZSDA 4H3VA 4OQMA 1GSHA 4BVLA 1QFYA 3K9WA 3JARB 1QSGA 4LOLA 3PXXA 3FMIA 5AXCA 1OGYA 4G8DA 4I14A 5CFOA 5KOIA 2FMIA 1KSHA 4GR9A 5F1KA 2HYDA 3WYNA 1SCDA 1ZN2A 2OEPA 2VXYA 3OZFA 1VMEA 4JLAA 5KYXA 2AYXA 1KDPA 3MA0A 4L5JA 4PNEA 4ZTUB 1AGYA 1CRWG 2HMTA 3GRCA 4GGOA 2PJRA 2Q49A 5FEMA 1K2VN 1YB6A 4H1TA 1TTPB 2FN9A 4P9NA 4CE6A 1L9XA 1D2EA 3G0CA 1PGQA 3KVOA 4TTAA 2DFVA 4P7BA 1QZ3A 3U31A 3LLVA 3IEMA 2YVAA 1VE1A 2V65A 2RGAA 1XT6A 2OQRA 3LBAA 3NTVA 3O8NA 4FMPA 4I9FA 4RYLA 1NNSA 4M0CA 4V2UA 5EKUA 5E0OA 1I0IA 1P4GA 3NVDA 3B5IA 1CUVA 3RU9A 4OH7A 4DV0B 5JZBA 3KM0A 3PDIA 1J2JA 4F38A 1PR5A 3MJFA 4R9RA 1IY8A 1I4OA 5DLQC 4G1MB 3OCJA 1BS2A 4KUEA 3W5CA 2CW5A 2JD1A 3LVBA 1UBNA 1DKOA 3DL2A 4PFQA 5EHQA 3WDMA 1WMFA 2C9CA 2ZU0C 4YDQA 2ZJ8A 1SMKA 2B0CA 3UENA 3LL4A 1ESNA 1N5JA 3A6LA 4YONB 1O08A 2W8BA 1KMMA 4KPYA 3ZH2A 2B4KA 3FZEA 5HS4A 1P2GA 2LCQA 1YCFA 2WQZA 3NOQA 3G5TA 4TLAA 1A4XA 1U2QA 4CLRB 3Q8KA 1DIAA 2PD3A 2IODA 3IT0A 2HK9A 2GGSA 4IW3B 3RADC 3NVAA 1LFAA 4XARA 1C14A 2I55A 3KPYA 4Y2GA 4D8TA 2UUOA 2QAGB 3AFNA 1X7ZA 1R1DA 4N6GA 2XHZA 1Z9BA 1XVAA 1JMVA 1IE3A 1ZGGA 2E87A 4R2JA 3OE1A 4WGFA 4IJWA 2AE2A 3WNCA 3ZK8A 8MHTA 1L5RA 4AP6A 4BP3A 3WMRA 1D6JA 4N7MA 1XMOB 1ETUA 3SGLA 4V1CB 1JEQA 5P8WA 1C7IA 1YS4A 3R75A 3WYBA 2AUNA 2Q5EA 2ZIWB 3MXTA 3W5SA 3ZK9A 2WTMA 2HAEA 1GFIA 2QBYA 1IY0A 4NE9A 1VHQA 3P19A 2JLWA 3TUIC 3RBZA 5JHHB 4CI0B 4I4TF 2UZ4A 3KD2A 4RABA 1YK1A 4PFSA 3OQIB 1L5FA 3OOSA 4RZSA 2WJZB 2ZP1A 4DQVA 1QR2A 2Q0HA 3MGGA 2YKGA 4B3MB 2H16A 3PU6A 5E4TA 4C6RA 4E3WA 5BT8A 1NQUA 3H0CA 2PMBA 3PJDA 2W71A 1R2QA 3QU9A 1FJHA 5LDGA 2F64A 1SVMA 2HMYB 1XMIA 1JE1A 2IOHA 3MT8A 3QGMA 1V71A 4PZPA 2PKWA 4XJVA 3RRZA 2W2OA 2WJAA 4A8PA 3B6ZA 3ZDBA 4LSWA 3KHKA 4UAGA 4K26A 4UULA 1U8EA 1ZM4A 2HLDA 2HL6A 2OV4A 5SZHB 1U7DA 1GVHA 2HSZA 3UYKA 1HL7A 3PC6A 1AUXA 2PRZA 2H5IA 4PNZA 4RLFA 3WQQA 5KHAA 1B8OA 1OAOA 3G5UA 1SKBA 1ZOLA 1N6HA 4OJTA 2OCBA 1GLNA 3P26A 4NBLA 4WTOA 4CQNA 3OE4A 5CBKA 1E3QA 1T5OA 5C1IA 2EX0A 4ZI2A 2MTBA 4F4UA 4Y9TA 1QB7A 1WPQA 2ZSKA 4QDKA 4D8WA 3KLOA 3AHCA 1T34A 2BGLA 3HA5A 4YWJA 4B3JA 2W6MA 3FYSA 3HB4X 1EFCA 1JZTA 3K1TA 3L4BC 3PCTA 1L7QA 2Q3CA 3ZTWA 4Q4CA 2WUGA 4XFKA 3GLFE 3SDZA 2DFNA 2IYTA 3OKAA 2VHVA 3U17A 1DIBA 4RPHA 4XASA 5HJ7A 3S99A 2NZVG 4EYEA 4GSKA 1FMCA 2R60A 2QM3A 3TM5A 2JJ8A 3IULA 1Z33A 4OHUA 1T2UA 2FKNA 3W2EA 3QLEA 3KPJA 3EWSA 4FILA 1AF7A 3GJ8A 2XYVA 3VH1A 3S5JA 2V96A 3ED5A 3KJQA 2BMAA 5SZJA 5LXTF 3N2GB 3PLNA 2FA9A 2NXJA 2EBHX 3LA8A 5TF4A 5BUZA 1E5QA 2OT3B 2D0IA 3B36A 1ZD3A 5U9CA 2DOKA 4E15A 3DL4A 3NB0A 3HB7A 5BSMA 1G3UA 3GCDA 4ZXFA 4QYWA 2JA1A 2OFPA 2B7LA 4A8TA 2BE7A 4QG7A 4YJ3F 4GOJA 4CMJA 3SZOA 1Z0SA 2A0FA 3DKPA 2OCGA 3BPSA 1E64A 3GLSA 2AZTA 3RJMA 4GLFA 3MAGA 3NIBA 5BSWA 1ZNZA 4TKZA 5IJZA 1LU9A 1B3BA 1RMQA 4UDOA 4WEOA 1NDUA 1AHHA 1PR6A 3ANTA 3EBOA 4HNHA 3A9WA 4PYIA 4FBGA 1AO3A 4D42A 4ZXPA 3Q7IA 4B76A 2Q2WA 3UG6A 5I9LA 4R0VA 3VSEA 2QTLA 3LKVA 3BFVA 4FOOA 4M1KA 4C3UA 4BFVA 1V47A 4C05A 2HNKA 2FOIA 4PO8A 4L5AA 4OHFA 1TUBB 1B8UA 1ULZA 4GVXA 2BEWB 4YDHB 3AHFA 2JZNA 1IPEA 1B76A 1JQJC 1Y8QB 2C8LA 4J9UE 4LHWA 3EXAA 4LJYA 4UM5A 1RHMA 8AT1A 2EFJA 3H9GA 4D4JA 3WLSA 1X8JA 1AN0A 5K1ZA 3Q87B 3TSCA 1HEUA 1LLDA 1AA6A 2MSKA 1Q0HA 2FUEA 2MT9A 1X7GA 2Q6IA 2YH2A 3HUDA 2QGZA 1F1BA 3CNLA 3O0TA 4J1QA 4OXYA 4W82A 4EGCB 3EVFA 4LSMA 5GZ1A 2FK7A 1WF3A 3VAAA 1IXZA 3MT7A 1BEEA 1L5WA 1IY2A 1W25A 2JIBA 2RARA 1YA8A 4KJZA 4Q9AA 1T35A 4Y6RA 5DBOA 4DWJA 1MT0A 2RKOA 1DBSA 4A5OA 2QQGA 3P9SA 4I3FA 4BVJA 1I7LA 1L2TA 1I3MA 2G0AA 3AX6A 3ZQ4A 3U4MA 2A3NA 1V4NA 3DLBA 4ZYLA 3A2MA 3VPBA 1E0AA 4I5DA 3ZUGA 1QQAA 2HTEA 1NQTA 1NMEA 4JBWA 5EE0A 2BI8A 2RGNC 1RC8A 3KV1A 5B2FA 4DJ5X 1FL9A 4PLYA 1UEJA 4A0SA 3LUKA 2QJRA 1X7YB 3NTRA 3LHDA 4UEWA 4LJSA 3ECAA 5CLHA 1DQSA 3G6KA 4ZRNA 2FXVA 3DVSX 2IUYA 4D9IA 4WUTA 1FW8A 5K6AC 4J6EA 1FMTA 4OAQA 1WMSA 1BA2A 3LNTA 4RE5A 4LS3A 2XQGA 4F4DA 3N0VA 5KVQA 5ALTA 1WXGA 3JASA 2HHCA 2YWHA 3QLUA 4JBYA 3MMSA 3DBOB 2C1XA 3GAZA 3R7BA 4I0WB 5FOXA 4H6PA 1SG9A 4IINA 2AC7A 3CW8X 5HP4A 1CR0A 1KAQA 2BFEB 3I4FA 3GLKA 4BO8A 4QASA 3RO7A 1XAHA 3TGPA 5DNWA 2W2KB 3FCOA 3IVXA 1I30A 3ANLA 1Y9JA 2QRLA 2CGEA 2JAQA 4LJAA 2WUWE 3I92A 3DEIA 5EFOA 1MJGA 3TCNA 3WIBA 3E5HA 1YQDA 4F3YA 4ZAVA 4ZMRA 1Q7GA 4EABA 1WXIA 3QZUA 4KACA 3AJ9A 1ENOA 2CWDA 4AQ7A 3KDAA 4JXKA 1MJ5A 4B4WA 4NCAA 5KWIA 4JJ6A 1LPBB 1XX6A 3C6XA 1N7HA 1WOYA 1BWPA 3KCQA 3TL3A 3VR3A 2C2KA 4EY5A 1NW4A 3WOHA 2O3TA 2G06A 4GOMD 4MRMB 1E2UA 3FR8A 4OA8A 3RSGA 5A4AA 1FJXA 2OAGA 4XJSA 3WKDA 1ESDA 1SG0A 1UBRS 4AMVA 2QVGA 3IJ5A 4OK6A 5KSWB 1J1UA 3TZEA 3IUNA 1DQZA 4AXXA 4QVGA 1HDGO 2GKOA 1IMJA 1T5IA 3B7WA 4G0WA 1BFDA 1TM2A 2GZDA 2BWJA 1XA3A 5AKIA 1AV6A 3MPOA 1X19A 1Y8QA 3VQTA 4MOWA 4NMMA 1PP4A 4KGZA 1S1MA 3O95A 1B26A 3ZCXA 3HXTA 2YASA 3VDMA 4AL4A 4DCCA 3ZLJA 3Q3GE 3FYUA 4MJLA 3IAUA 2O5RA 5TQVA 2NVBA 3V8QA 5KVAA 3H1AA 2ZIFA 1A8SA 4LDZA 4ZVRA 4QWMA 4L6AA 1QYXA 3KJHA 3WZ2A 3ETLA 4YR7A 1KO7A 5IDXA 1SVUA 2VPYA 2C57A 3OJLA 4C3VA 2OGTA 4JEUA 1A96A 4OFXA 4EFMA 1N3LA 3K5WA 4MYDA 1YNSA 3EK2A 1SVWA 3LUPA 5ANRB 3O90A 2JLSA 3TECE 1U8AA 3I2FA 3CTMA 4UZSA 2MOKA 4RM2A 1L7AA 3BG5A 1JXMA 1KZ4A 3KP1A 3GV0A 5A3SA 1SM4A 3GZNA 1AH2A 4BLUA 1KHHA 5LPNA 3BF7A 3QK7A 3OA0A 1I9CA 2YWFA 1OGIA 1G20E 4MVJA 1CZLA 1HOTA 1QH9A 2JCYA 3IDQA 3OSUA 4MDYA 4BO7A 3PC3A 2NUAA 3DFKA 1O6CA 3A1EA 4Y2RA 3A6EA 1ITZA 1GFSA 1NOJA 5MGBA 2DXIA 4IHJB 4LNUA 1N33B 1GCGA 4V38A 4PFJA 1GL7A 2ZTMA 4FDMA 2R84A 3B1ZA 4XWKA 1CU1A 1G9TA 2UYYA 4ZYVA 1KPIA 3JYPA 1NMYA 5T4HA 4H4DA 2BEWA 3JQ8A 3FCXA 5F3DA 3SBEA 4ABTA 3V9PA 4CIAA 5K0CA 1E1NA 1L7DA 1X7XA 1HORA 2C5EA 3H7AA 3MTAA 1NJGA 1XA4A 2I6TA 2XHEA 3HCAA 5CB0A 4DMCA 3AEUB 1R12A 2I99A 3QENA 4G36A 4YP5A 3FFXA 3BXPA 3UK0A 1JILA 1GU7A 2BZ0A 3HKBA 2GLTA 3PPWA 3UV7A 3Q10A 3AO0B 2RCNA 3QKRB 2XIQA 2VHWA 4F91B 3HXOA 1JU3A 1N0VC 4IQ4A 1D2AA 1V6CA 2WKRA 3PLRA 2PH3A 3F2IA 3B8HA 2Y6VA 1M2EA 3EN0A 3H1TA 3RB8A 2HCTA 2P9FA 5AT1A 4GE0A 3TLGA 3VYUB 1GTJ1 2IV7A 1EDDA 1F2VA 2VPPA 1FBNA 2WMDA 3RDPA 1K7SN 1DJLA 2VIIA 3TNFA 4CW7A 2JFVA 2N46A 4ID3A 4MWGA 2EFCB 4UZFA 4DM4A 1NLFA 2X3YA 3QRWA 3NVMB 5LZ5A 3RU2A 2WG2A 3I0MA 4N5HX 4Z4GA 1ZUHA 2I6FA 4LQLA 4DSOA 1DQPA 4F60A 4OHWA 1MPTA 3L6CA 1LZLA 4KI7A 3HCOA 2XQIA 4NG5A 1JIKA 1H8EA 2R62A 4FE4A 1IIBA 1XRLA 3BMQA 3PNOA 3STVA 4IIDA 4AUKA 4YCSA 1GL6A 1PJ8A 3ENKA 4ZYZA 3R0QA 5ENZA 1ULUA 4NVRA 3Q7TA 5JI2E 2B8NA 5IM4F 3OLVA 2HLPA 5COQA 1YHYA 3BUSA 4HGQA 1OXVA 5CT5A 3C3XA 2R6CA 4GMFA 4KRYA 4PC1A 2QN2A 1TNDA 1ZRNA 3MD0A 2C07A 1S2GA 1Z5UA 5FUXA 2L0XA 2HLNA 3BORA 1URPA 4NNOA 4OHZA 1U3FA 2P1DA 4ND6A 3AR7A 1NVMB 2COEA 1Q20A 2KWIA 2YY7A 4GXRA 4IIVA 1DXQA 1ZD9A 4RZUA 4Y6QA 3EZLA 4N5LA 1NBWB 4M8NE 5K8TA 1LSJA 1DV2A 4WNAA 1KAEA 3NX4A 4WADA 3T1QA 2OK8A 2ZXUA 4U0JA 3GN2A 4NS4A 3KKZA 3TTYA 1QH1B 4KN8A 1ZJ4A 4H1WA 4Z3OA 4B6SA 2IOFA 3O93A 4TMZA 1BWQA 2A92A 2QTFA 4S24A 1PS8A 4HDAA 4KWIA 1JFSA 3ECCA 1O97C 3ENZA 2WY2D 3X3HA 1G1AA 5LB2A 3V1TC 4F96A 4ZGWA 1KY2A 2O6LA 2D5CA 3QUTA 1K68A 3W3AD 1XNJA 4B0PA 2FP4B 3EYAA 1GCUA 1NVXQ 4ZAZA 3T52A 4EDFA 2OFWA 1RLIA 3KKEA 1E1CA 4YNBA 3STXA 4DLYA 2BL4A 1W88A 4NONA 3LRXA 3FLMA 3R0IA 3MFQA 3W90A 3DPUA 1YRHA 5GJVC 4I9HA 4FB5A 2HHLA 1TTQB 2OGUA 3GJ4A 3OQIA 1VE6A 2QW0X 1GKKA 2BCEA 3DZIA 4CJXA 2BI7A 1JALA 1UPUA 5FB3A 2XD4A 5HRCA 3MM4A 2Q46A 3MTQA 1AK9A 2Q21A 3CLUD 3OFJA 4A6PA 3QEBZ 4DUGA 4RY8A 4M0EA 1D9XA 3SIWA 3IKTA 3NHJA 1VE9A 3BZWA 1IUKA 4HQOA 4Q7QA 2DLDA 3D64A 2QNIA 1Z22A 3SXUA 1U0OC 4ZDJA 1F7VA 2A88A 1ZITA 1JFFB 5CNIA 4BNLA 4QTUB 3LKZA 3OC6A 1KOLA 2ZITA 3M0EA 3S1AB 2G4LA 1DG3A 4D3ZA 4LHSA 4RDHA 2GK4A 5LMZA 2BC9A 2CF6A 3A3KA 4MCJA 4P0TA 5JO9A 4Z2AA 1HE1C 4AWXA 1KVSA 1WAMA 5DPMA 2SICE 2R8XA 3SBOA 4FUQA 2Z3VA 1OWMA 1FVFA 4LTDA 4QUDA 1TW2A 1ZU5A 4TXMA 3I45A 2DPMA 1LI7A 4H59A 1AZLA 3WYDA 3ZNOA 3W8DA 4PHHA 4MUYA 1O9GA 4QDZA 3JD3A 2ATEA 4UXHA 5BR7A 1FQOA 3TSYA 1CPYA 1OFUX 3C3KA 4QHTA 4DM7A 4BN4A 4JI6B 1TJPB 5DRYA 4MVCA 4HSGA 4ZV4A 1LSUA 1GLVA 5AKLA 2D74A 2AW3A 3H6KA 3C3YA 3C43A 1F2UB 5CYOA 1ORIA 4LXTA 3B6EA 4OKIA 1ISFA 4DYDA 3OPQA 3WGZA 3QY9A 5BMOA 3ILSA 1SULA 1VKOA 2R1ZA 5DN9A 1PUXA 1S01A 3SQNA 3OOYA 3O26A 1E62A 3ZY3A 3IOCA 1RJFA 1I3KA 4IF6A 1J24A 2ZI4A 4LJKA 3TM4A 2P9GA 2G36A 3B52X 1KQ3A 3PVZA 4QGAA 2A5YB 3WWPA 5AVZA 1H65A 3HCBA 5IKPA 1O4VA 4B8ZA 2CXUA 4Z4IA 5C8VA 1QF6A 1P60A 4DIBA 3K5PA 4DMKA 4LBZA 2ZYTX 3KT8A 4D3YA 1QWOA 4O1MA 3IO3A 4UMEA 5KNDH 3EXG1 4EF5A 2J33A 4V0LA 3TMKA 2HT6A 4JYCA 4KXFB 1E0JA 1U3UA 4HPXB 4EPXA 4ZK2A 4OSEA 3WLHA 5DX1A 1N77A 3KALA 1U7UA 2HWYA 2R6JA 1PWEA 3NHZA 3QLVA 5IN5A 5E3HA 3A28A 1M8JA 1QK5A 1P72A 4KWEA 1K5HA 2E21A 3ZWMA 2CMKA 1QZZA 1X1QA 2ZUEA 2J6BA 7MDHA 2RHJA 5IKXA 1ZONA 1QQTA 5JDIC 1EGVB 1F14A 1KMIY 1ZVKA 3HNRA 5I9MA 3ROMA 3M33A 3UH0A 3WLIA 3MCUA 3LI2A 2QXYA 2X0EA 4FZ3A 3OZSA 3GDFA 1Z4LA 2QV7A 3UXMA 3B6IA 3IVMA 2PCJA 5J1TB 1RRMA 4EFDA 3RYCB 4BB0A 4KE6A 2C2HA 3L7JA 1MW9X 1FRFS 1U3DA 4KKXB 2IE8A 4GPTA 4REQB 2WYUA 4RENA 4UBJA 5HFNA 1CNEA 3L4JA 2GAJA 4H7DA 1KZ1A 5J2UA 1JFFA 1RYMA 2A0KA 2QN6A 3PK0A 4BN5A 2I4MA 1OBCA 4GYYA 4X8LA 1SO8A 3NRCA 1AKEA 2HPVA 5K6AA 4KQFA 3HFRA 3E7WA 4J7CA 3U37A 4R0NA 3BXGA 4P3OA 3H7IA 4WCFB 1HSZA 4WK6A 1W0JA 3DO5A 4EEZA 4G84A 3W6UA 3TTTA 5ALUA 1V8PA 1SCAA 1PYOA 4WNCA 4HH4A 4B8WA 1WETA 4FHCA 3GPIA 4UNIA 1U1EA 2NSLA 3E03A 4J29A 3JR3A 2I65A 2YQ4A 2IBSA 2RKWA 1VCOA 1RT9A 3VR6H 4EFKA 3KJEA 2GJ4A 1Q7RA 1MNAA 3H4IA 3HCDA 3L1VA 4HRYA 5JG7A 5KHLB 3JPWA 2XH8A 4RLHA 5I7SA 3ORYA 1LX7A 2WE7A 4HYYA 1SURA 4IG4A 3ZX5A 3D54D 5D00A 2QTAA 3D8UA 3K1ZA 4M0LA 4B9EA 4C22A 4EB8A 4G56A 4XDZA 1UMBB 3GCGA 2J31A 4ZDWA 5CT9A 4N4AA 1GZ5A 1YDFA 4DLTA 2D7CA 3B7PA 4OYLA 5ALSA 1YB7A 1KK0A 4DIMA 5AW8A 1CUHA 3FWYA 3GIWA 4QBHA 4X64B 5IBRA 3DBHB 3NTLA 2PLWA 3GFRA 4MTLA 3N0RA 4ZVLA 4MUFA 5U1PA 1C7JA 1K8QA 4PYRA 1JT9A 2NZYA 4OHRA 3FPGA 4ZOCA 1RPAA 3NAGA 2EP5A 5C8XA 2NGRA 1L8XA 2IUEA 6AT1A 3HL4A 3NOOA 1YE3A 3D6AA 4L95C 2YIDA 3E4CA 1R0ZA 1M66A 4OVKA 3UQZA 3N6XA 2FPOA 1CSEE 1JR3D 3V7YA 4CM1A 1UBSB 1FNMA 4WBSA 2IIQA 2QUBA 1L5HA 4ZCRA 4EG3A 2GOYA 4WIAA 3GQBB 4R6XA 4P2BA 2D2IA 5EE9A 5JCJA 1H5QA 2BGNA 5BMVF 4IIFA 4EEXA 4EQ6A 3GA0A 4L08A 1PQYA 2R11A 2LZ0A 3KKQA 3M6XA 1EESA 1Q6ZA 2YOGA 3CEJA 1JKJB 3PQCA 4MRPA 1CB0A 3LE8A 4Q37A 5AMXA 4B8YA 4MWBA 1M6EX 1JTEA 4PSUA 4RTLA 2CYCA 1QTQA 4BNIA 1UEXC 2HIMA 3B9BA 4IYJA 2P4EA 4MJ3A 1N8SA 1UPBA 4NZOA 3WADA 1FQKA 2CFSA 3OTOB 3FHCB 2CE7A 3MJRA 1WB9A 4B7ZA 1Z37A 5BO5A 3QNUA 1E2QA 1OYWA 3W77A 4OI0A 1Z0KA 5KCMA 5T3YA 2C5AA 1SVOA 1SBYA 3H9QA 3NBQA 6LDHA 1LI5A 4G0VA 3IEIA 2IZZA 1HO3A 4LG1A 4TROA 1SU6A 3NV7A 4FYHA 5EE1A 3B82A 2QF7A 2QJFA 3U7FB 7GPBA 3R3WA 3N8DA 4BFUA 1Q19A 1REQB 2B20A 4ZAGA 2Q2QA 3Q7QA 5TGDA 4FKZA 4EF6A 3OFSA 2D59A 5A6SB 3K70B 3PX7A 3SC2A 1CUUA 4XJXA 3NM5A 2NACA 1K3TA 1BTOA 1KXJA 1UUFA 3CJQA 3CZMA 3DLAA 3PTZA 5AI4A 2F1KA 1UBUS 4M8LA 5E4FA 3ZQJA 6REQB 5KB3A 5KWVA 2FRXA 5L3SA 1QF9A 2ZBPA 4L9AA 3HBFA 4HMQA 1H9BA 3BB3A 2ZUFA 3LDUA 2IEGA 4UXIA 1NV8A 2C9BA 3PR3A 4F6LA 4YRZA 1QWSA 3QELB 4WPGA 2ISQA 3L8ZA 4C7BA 4DJAA 3EGIA 4DMGA 1MJGM 1UBMS 1TL7C 1KFBB 2PH5A 1AUOA 4MX8A 4M1MA 4QTZA 5FUBA 5LQSA 2C4UA 3VR0A 2NUAB 1I10A 2F3TA 1VSBA 2J46A 3F96A 3HN2A 4MKZA 1NVVR 2ERXA 2K87A 1FYEA 5DV9A 2ZXFA 3F9IA 2IOYA 4H60A 3LD9A 2HF9A 3K6SB 1QAQA 1YFJA 1NR1A 4PYQA 1JXQA 3ZI7A 1O54A 4Q9LA 4L72A 3CEPB 1VFNA 5ALGA 5LP1A 1EIWA 4U6SA 4LMBA 1D6SA 1OXUA 2C8JA 2VTEA 1PV4A 3PC2A 3P97A 1K6MA 5JSHA 3KB8A 1I1HA 2GHRA 4IJKA 1LPAB 2ZSUA 4YPVA 1A76A 1J90A 4HYEA 4EG7A 4F97A 5AM1A 3QXJA 3MTEA 4Q16A 3DQQA 3EIFA 3R3VA 3SNHA 3FHOA 5FNVB 3VSDA 1EJ6A 4ER3A 3DKVA 3WIEA 2NVOA 1NPTO 3UBTA 4RHYA 4WJZA 3CVJA 4JLJA 2AJ8A 3V8VA 2CVFA 3RWMB 2E49A 1E9EA 3JAWB 2ON6A 4MIYA 5FPTA 5J59A 4C08A 1FDWA 1R4AA 2GZAA 3JQAA 4QTTB 1XZDA 2IYZA 4PIPA 4Z9BA 3W6ZA 4ROSA 2A33A 4JZKA 5G41A 4C6SA 1IBLB 5D87A 1J2TA 3PWSA 1T8TA 1JG6A 1NC3A 3OECA 3FWHA 4RNCA 3SJBA 4QICA 2PUHA 4O4LA 1RLOA 2DTDA 1SXJE 2B99A 3ID6C 3WSWA 3DBIA 1Z45A 4CM4B 3OCZA 1R6TA 5FI3A 2H59A 1QR6A 2E1PA 4GZLA 4RJJA 3E9RA 1I6LA 2X23A 2ZE8A 1CUYA 4CDMA 2M32A 2XADA 1W36B 5HMLA 5IVIA 2YXNA 1JLMA 5FTWA 3S4YA 3HB9A 5AVWA 3RRYA 2M2IA 3AZPA 1PBNA 3FX2A 4FQ5A 1IJFA 3N75A 2DG2A 1FUUA 4TRRA 1BYUA 5E1OA 2ZI7A 3IAM6 3O83A 4F6RA 3GBVA 3N2IA 5HF9A 2WJGA 4HDKA 1ADYA 1NJFA 1WWKA 2OKCA 4S2EA 3MERA 5DDIP 1OUMA 2ZYRA 3GG2A 1ZJJA 1XXHA 2AEMA 2ZBQA 3MC1A 3E8MA 3IUJA 1KQPA 2ZVDA 1TU3A 1T1GA 3GEIA 3EUWA 1IN5A 4LC1A 4XX1A 2EJUA 3PEWA 1B23P 3L6RA 1ZI8A 4CCAA 1SC3A 1ZINA 2NX2A 1O0BA 3AINA 2BTOA 3EDYA 4IHQA 2CEAA 4MZDA 3B12A 1BE0A 4QYTA 4KQ6A 4X95A 4LGCA 2IS6A 3K71B 3M9XA 4M46A 4RJ2A 5FA8A 5HRAA 2HUPA 4M86A 1WDTA 4NMLA 5D3MA 3MB5A 5GAJA 3URMA 3W2GA 2JHCA 4NJMA 1YQ9A 5IJAA 5BYJA 1G5RA 2FR8C 3PXEA 3TEMA 4EIWA 4RTJA 1W6UA 4N7RA 3MLEA 2FSVC 3V8MA 4E2WA 1O8BA 5F64A 4UUNA 2K2WA 5HFJA 1T43A 3MCVA 1DI0A 1WXFA 3S5UA 3T3IA 1WCWA 4GPZA 3W7VA 1S8FA 4DSZA 2O20A 4D57A 2J0EA 4ZA2A 4Y6GB 2IPMA 1CZOA 5HEKA 4BNKA 1ADJA 1EVLA 2D5IA 3GJ0A 5HIMA 3RYHB 1NHGA 3SD7A 3JALB 1RADA 4DW8A 3S2ZA 1IG3A 3WIVA 5AVUA 3GCXA 1NNUA 4XA8A 4LCBA 5B30A 1Q22A 4G07A 1FP6A 1ECPA 5JC8A 3BXHA 1P6QA 1SEVA 3KB1A 3KZNA 2P78A 5FKJA 3WJ1A 4TRJA 4HQ0A 2NQTA 5ALHA 3TKYA 1Q16A 5JS6A 3JALA 1G8YA 1MH1A 4BKRA 3K5HA 1QH8A 4TV9F 1YOVB 2QUAA 3K2IA 5FHQA 2H1RA 3FLAA 3TXAA 4ANFA 3NH6A 1T29A 1P4AA 9GPBA 3VHXA 5HKKD 3LT4A 5C31A 3PNBA 1VB5A 4CZ2A 2ATXA 3VNRA 1W5SA 5KOYA 3UK7A 3T7JA 4IGEA 3R7LA 2HRRA 2PX5A 5D86A 5DP1A 5ERYA 2GZSA 4RZXA 3M5WA 2UUBB 1KVTA 1A27A 1NFFA 3V2HA 3V46A 1EP2B 1WE2A 1AXEA 1J22A 2P67A 2RGYA 4N0QA 2XAUA 3SM9A 4ZI7F 3RRNA 3RRBA 3F98A 3HKCA 4R2KA 4JV5B 3W5DA 3GAFA 1NQ5A 3LHIA 2AOUA 3DVLA 4J9VA 4DV5B 2FMTA 3AL0C 1JAZA 3R3ZA 4URXR 3V1NA 4AY6A 4PPYA 1KBQA 2DFDA 2AG6A 1GKIA 3PP8A 3RIGA 5H81A 4QFBA 1JLKA 3K70C 4HNQA 3L7NA 1U8YA 1RD4A 2AI1A 1EFVB 1EFUA 3HB5X 3FWKA 4TMTA 2BD0A 5C8YA 4D4GA 4HT3B 3PVCA 5DTIA 4INAA 4BE7B 1E2IA 2OGSA 3C8ZA 5FA5A 4B3IA 5CB8