5HBHB

Cdk8-cycc in complex with 5-{5-chloro-4-[1-(2-methoxy-ethyl)-1,8-diaza-spiro[4.5]dec-8-yl]-pyridin-3-yl}-1-methyl-1,3-dihydro-benzo[c]isothiazole 2,2-dioxide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
b'DDDDKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hbhB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hbhB01
5LMKB 1OIYB 4F6WB 2UZEB 2W9FA 2WPAB 3BHUB 4BCJB 1H1RB 1AISB 2WHBB 2WMAB 1F5QB 4KRDB 4ELLA 1H1QB 1OKWB 2PK2A 4CRLB 3TNIB 2F2CA 4CFWB 3POMA 1W98B 3O0GD 1OL2B 2WIHB 2IW6B 3M03A 4OR5B 3TNWB 4EC9B 3DOGB 5L2WB 1QMZB 3G33B 4YC3B 5LQFB 1AD6A 3EIDB 4UN0A 2I40B 4Y72B 4CFXB 1OI9B 4BCFB 4BCPB 5CEIB 2WEVB 3BLQB 1N4MA 1GH6B 4EOLB 4F6UB 2EUFA 4CFNB 2C5XB 4G6LB 5EFQB 4BCGB 1H28B 5BNJB 1OL1B 1URCB 1VINA 2CJMB 4KRCB 3TN8B 2BPMB 5HVYB 4EONB 4BCHB 3EJ1B 1E9HB 4II5B 4F7LB 4F6SB 3MY1B 4F70B 2PHGA 2JGZB 4I3ZB 1PKDB 3K7AM 4EOJB 1OGUB 2WIPB 4CFVB 4NSTB 2C5VB 5HQ0B 4EORB 3BHVB 4BCND 4ELJA 1H24B 1XO2A 4ROCA 2I53A 2C4GB 2QDJA 5HBHB 4BCOB 2X1NB 1H26B 4EOSB 3BLHB 1H1SB 5IF1B 2IVXA 3F5XB 4EOMB 1VOLA 4YOOA 4BCQD 1JSTB 3EOCB 4ROEA 4CFUD 3TNHB 5IDPB 1GUXB 1FINB 1KXUA 4EOQB 4EOPB 4EOKB 4EC8B 5FGKB 2WXVB 1JSUB 3BHTB 1H4LD 3QHWB 4EOOB 5HBEB 2PK9B 2C6TB 1GUXA 1GY3B 3LQ5B 1ZP2A 1UNHD 2W96A 2BKZB 4CFMB 5IDNB 1OIUB 4BCMD 1BU2A 4BCNB 4YOZA 4EOIB 1C9BA 5HNBB 3QHRB 1UNGD 1UNLD 1O9KB 2PMIB 3MI9B 5CYIB 2CCHB 4OGRB 4YOSA 2WMBB 2CCIB 2C5OB 3MIAB 1OKVB 1P5EB 3DDQB 1O9KA 1VYWB 2W99A 3DDPB 3MY5B 4BCQB 4RODA 2UZDB 2W9ZA 4CFUB 2IW9B 1H27B 2R7GA 3BLRB 1H25B 2UZLB 2WFYB 2UZBB 1JKWA 1FVVB 4IMYB 4TTHA 2UUEB 1G3NC 4FX3B 2V22B 4F7NB 2B9RA 5ICPB 2C5NB 3H4CA 5HBJB 4BCMB 2IW8B 1H1PB 1D3UB 4F7SB 4BCIB 1JOWA 4CXAB 3RGFB 1TFBA 5I5ZB 5ACBA 4BCKB 4F7JB 2W2HA 2G9XB
chains in the Genus database with same CATH superfamily
4JX4A 2WPAB 2BS2A 1H1RB 3A8HB 1UGRB 5DQWA 4KRDB 1OKWB 4AKGA 3POMA 2ZPIB 2ZPFB 4BBSM 1OL2B 5L2WB 4BBRM 3EIDB 2I40B 1OI9B 4BCPB 3X20B 2WEVB 4Z6YA 3BLQB 3QWLA 4EOLB 3NDQA 2ZPHB 4BCGB 3A8OB 4ZGJB 4M6VA 4QSHA 2BPMB 5HVYB 3EJ1B 4F70B 2JGZB 4HNVA 3QXEB 3K7AM 1UGQB 4NSTB 1H24B 1XO2A 3VKHA 3X28B 1H26B 1H1SB 3DTOA 4EOMB 1VOLA 4BCQD 4ROEA 4NC6A 5IDPB 3HBLA 4EOPB 3BHTB 5HBEB 2PK9B 2WJ9A 2LW4A 2ZPBB 4YOZA 3A8MB 2PMIB 5CYIB 4HLQA 2CCHB 2CCIB 3DDQB 1VYWB 3MY5B 2UZDB 2ZPGB 4CFUB 1H25B 4JX6A 4TTHA 2B9RA 3H4CA 4BCIB 4OB2B 4ZGEB 5I5ZB 2DD4B 2W2HA 2CZ1B 2G9XB 1OIYB 3BHUB 4AKIA 3DJBA 4CRLB 1TD6A 2F2CA 4BXXX 1W98B 3DL1A 3O0GD 2WIHB 2IW6B 1ENWA 1QMZB 3G33B 4YC3B 5EJCA 1AD6A 4UN0A 4BY1X 4CFXB 4BCFB 4HNTA 5DQVA 5IHYA 3A8LB 4F6UB 2EUFA 4CFNB 4MIMA 3TN8B 4KRCB 2CZ0B 4II5B 4F7LB 4F6SB 2PHGA 1PKDB 4CFVB 2C5VB 3BG9A 1E7PA 3BHVB 4ROCA 3X25B 2ZZDB 2X1NB 3BLHB 2IVXA 3F5XB 4CFUD 1FINB 1KXUA 4EOKB 4EC8B 2WXVB 4EOOB 1AHJB 1GUXA 4MFEA 5IDNB 1OIUB 4EOIB 1C9BA 5HNBB 3QHRB 1UNGD 3VKGA 3MIAB 3QYEA 4MFDA 1OKVB 1O9KA 3DDPB 4HNUA 2R7GA 3BLRB 4OB3B 4HL4A 1JKWA 2QQ8A 1FKMA 2C5NB 4BCMB 1H1PB 4F7SB 4ZGDB 2DXBB 3X24B 4F6WB 2W9FA 4ELLA 2PK2A 2AHJB 3TNIB 4CFWB 3VYHB 3M03A 4OR5B 4EC9B 5LQFB 3BG5A 4Y72B 2BS4A 3BG3A 5CEIB 3B57A 3GTMS 2C5XB 4G6LB 5BNJB 4OB1B 4BCHB 1E9HB 3HB9A 4FM4B 4EOJB 1OGUB 2DPPB 2WIPB 5HQ0B 4EORB 4ELJA 2C4GB 5HBHB 4BCOB 4EOSB 3QYHB 4LOCA 1JSTB 3EOCB 2IN3A 3X26B 1JSUB 1H4LD 3QHWB 3LQ5B 1ZP2A 1UNHD 2W96A 2BKZB 4CFMB 4BCMD 4BCNB 2KR6A 2WMBB 1P5EB 1V29B 2W9ZA 2D0QB 2IW9B 1QLBA 4IMYB 1FVVB 3WVDB 2BS3A 2V22B 2KMGA 5HBJB 2IW8B 3QZ5B 1D3UB 4CXAB 2ZCFB 3RGFB 5ACBA 4BCKB 4AI6A 4F7JB 5LMKB 1AISB 2UZEB 4BCJB 4JX5A 2CYZB 2WHBB 2WMAB 1F5QB 1H1QB 3TNWB 4BY7X 2DD5B 2PJQA 3DOGB 2QF7A 3HO8A 1N4MA 1GH6B 3TW7A 3HZJA 5EFQB 1H28B 1OL1B 1URCB 1VINA 2CJMB 1UGSB 4EONB 1UGPB 3MY1B 3QYGB 2QGSA 4I3ZB 4BCND 2QFZA 2I53A 2QDJA 2DMEA 5IF1B 3PO3S 4YOOA 3QZ9B 3TNHB 1IREB 1GUXB 4EOQB 3WVEB 5FGKB 3A8GB 2C6TB 2CZ6B 1GY3B 1BU2A 4OB0B 1UNLD 1O9KB 2ZPEB 3MI9B 2G77A 4OGRB 4YOSA 3TW6A 2C5OB 4RODA 4BCQB 2W99A 3KHIA 1H27B 2UZLB 2DXCB 2WFYB 2UZBB 3HHTB 2UUEB 1G3NC 4FX3B 4F7NB 3QYBA 5ICPB 2QDYB 3VYGB 1JOWA 1TFBA 2CZ7B 4AKHA
chains in the Genus database with same CATH topology
5LMKB 1OIYB 4F6WB 2UZEB 2W9FA 2WPAB 3BHUB 4BCJB 1H1RB 1AISB 2WHBB 2WMAB 1F5QB 4KRDB 4ELLA 1H1QB 1OKWB 2PK2A 4CRLB 3TNIB 2F2CA 4CFWB 3POMA 1W98B 3O0GD 1OL2B 2WIHB 2IW6B 3M03A 4OR5B 3TNWB 4EC9B 3DOGB 5L2WB 1QMZB 3G33B 4YC3B 5LQFB 1AD6A 3EIDB 4UN0A 2I40B 4Y72B 4CFXB 1OI9B 4BCFB 4BCPB 5CEIB 2WEVB 3BLQB 1N4MA 1GH6B 4EOLB 4F6UB 2EUFA 4CFNB 2C5XB 4G6LB 5EFQB 4BCGB 1H28B 5BNJB 1OL1B 1URCB 1VINA 2CJMB 4KRCB 3TN8B 2BPMB 5HVYB 4EONB 4BCHB 3EJ1B 1E9HB 4II5B 4F7LB 4F6SB 3MY1B 4F70B 2PHGA 2JGZB 4I3ZB 1PKDB 3K7AM 4EOJB 1OGUB 2WIPB 4CFVB 4NSTB 2C5VB 5HQ0B 4EORB 3BHVB 4BCND 4ELJA 1H24B 1XO2A 4ROCA 2I53A 2C4GB 2QDJA 5HBHB 4BCOB 2X1NB 1H26B 4EOSB 3BLHB 1H1SB 5IF1B 2IVXA 3F5XB 4EOMB 1VOLA 4YOOA 4BCQD 1JSTB 3EOCB 4ROEA 4CFUD 3TNHB 5IDPB 1GUXB 1FINB 1KXUA 4EOQB 4EOPB 4EOKB 4EC8B 5FGKB 2WXVB 1JSUB 3BHTB 1H4LD 3QHWB 4EOOB 5HBEB 2PK9B 2C6TB 1GUXA 1GY3B 3LQ5B 1ZP2A 1UNHD 2W96A 2BKZB 4CFMB 5IDNB 1OIUB 4BCMD 1BU2A 4BCNB 4YOZA 4EOIB 1C9BA 5HNBB 3QHRB 1UNGD 1UNLD 1O9KB 2PMIB 3MI9B 5CYIB 2CCHB 4OGRB 4YOSA 2WMBB 2CCIB 2C5OB 3MIAB 1OKVB 1P5EB 3DDQB 1O9KA 1VYWB 2W99A 3DDPB 3MY5B 4BCQB 4RODA 2UZDB 2W9ZA 4CFUB 2IW9B 1H27B 2R7GA 3BLRB 1H25B 2UZLB 2WFYB 2UZBB 1JKWA 1FVVB 4IMYB 4TTHA 2UUEB 1G3NC 4FX3B 2V22B 4F7NB 2B9RA 5ICPB 2C5NB 3H4CA 5HBJB 4BCMB 2IW8B 1H1PB 1D3UB 4F7SB 4BCIB 1JOWA 4CXAB 3RGFB 1TFBA 5I5ZB 5ACBA 4BCKB 4F7JB 2W2HA 2G9XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMK B;  1OIY B;  4F6W B;  2UZE B;  2W9F A;  2WPA B;  3BHU B;  4BCJ B;  1H1R B;  1AIS B;  2WHB B;  2WMA B;  1F5Q B;  4KRD B;  4ELL A;  1H1Q B;  1OKW B;  2PK2 A;  4CRL B;  3TNI B;  2F2C A;  4CFW B;  3POM A;  1W98 B;  3O0G D;  1OL2 B;  2WIH B;  2IW6 B;  3M03 A;  4OR5 B;  3TNW B;  4EC9 B;  3DOG B;  5L2W B;  1QMZ B;  3G33 B;  4YC3 B;  5LQF B;  1AD6 A;  3EID B;  4UN0 A;  2I40 B;  4Y72 B;  4CFX B;  1OI9 B;  4BCF B;  4BCP B;  5CEI B;  2WEV B;  3BLQ B;  1N4M A;  1GH6 B;  4EOL B;  4F6U B;  2EUF A;  4CFN B;  2C5X B;  4G6L B;  5EFQ B;  4BCG B;  1H28 B;  5BNJ B;  1OL1 B;  1URC B;  1VIN A;  2CJM B;  4KRC B;  3TN8 B;  2BPM B;  5HVY B;  4EON B;  4BCH B;  3EJ1 B;  1E9H B;  4II5 B;  4F7L B;  4F6S B;  3MY1 B;  4F70 B;  2PHG A;  2JGZ B;  4I3Z B;  1PKD B;  3K7A M;  4EOJ B;  1OGU B;  2WIP B;  4CFV B;  4NST B;  2C5V B;  5HQ0 B;  4EOR B;  3BHV B;  4BCN D;  4ELJ A;  1H24 B;  1XO2 A;  4ROC A;  2I53 A;  2C4G B;  2QDJ A;  5HBH B;  4BCO B;  2X1N B;  1H26 B;  4EOS B;  3BLH B;  1H1S B;  5IF1 B;  2IVX A;  3F5X B;  4EOM B;  1VOL A;  4YOO A;  4BCQ D;  1JST B;  3EOC B;  4ROE A;  4CFU D;  3TNH B;  5IDP B;  1GUX B;  1FIN B;  1KXU A;  4EOQ B;  4EOP B;  4EOK B;  4EC8 B;  5FGK B;  2WXV B;  1JSU B;  3BHT B;  1H4L D;  3QHW B;  4EOO B;  5HBE B;  2PK9 B;  2C6T B;  1GUX A;  1GY3 B;  3LQ5 B;  1ZP2 A;  1UNH D;  2W96 A;  2BKZ B;  4CFM B;  5IDN B;  1OIU B;  4BCM D;  1BU2 A;  4BCN B;  4YOZ A;  4EOI B;  1C9B A;  5HNB B;  3QHR B;  1UNG D;  1UNL D;  1O9K B;  2PMI B;  3MI9 B;  5CYI B;  2CCH B;  4OGR B;  4YOS A;  2WMB B;  2CCI B;  2C5O B;  3MIA B;  1OKV B;  1P5E B;  3DDQ B;  1O9K A;  1VYW B;  2W99 A;  3DDP B;  3MY5 B;  4BCQ B;  4ROD A;  2UZD B;  2W9Z A;  4CFU B;  2IW9 B;  1H27 B;  2R7G A;  3BLR B;  1H25 B;  2UZL B;  2WFY B;  2UZB B;  1JKW A;  1FVV B;  4IMY B;  4TTH A;  2UUE B;  1G3N C;  4FX3 B;  2V22 B;  4F7N B;  2B9R A;  5ICP B;  2C5N B;  3H4C A;  5HBJ B;  4BCM B;  2IW8 B;  1H1P B;  1D3U B;  4F7S B;  4BCI B;  1JOW A;  4CXA B;  3RGF B;  1TFB A;  5I5Z B;  5ACB A;  4BCK B;  4F7J B;  2W2H A;  2G9X B; 
#chains in the Genus database with same CATH topology
 4JX4 A;  2WPA B;  2BS2 A;  1H1R B;  3A8H B;  1UGR B;  5DQW A;  4KRD B;  1OKW B;  4AKG A;  3POM A;  2ZPI B;  2ZPF B;  4BBS M;  1OL2 B;  5L2W B;  4BBR M;  3EID B;  2I40 B;  1OI9 B;  4BCP B;  3X20 B;  2WEV B;  4Z6Y A;  3BLQ B;  3QWL A;  4EOL B;  3NDQ A;  2ZPH B;  4BCG B;  3A8O B;  4ZGJ B;  4M6V A;  4QSH A;  2BPM B;  5HVY B;  3EJ1 B;  4F70 B;  2JGZ B;  4HNV A;  3QXE B;  3K7A M;  1UGQ B;  4NST B;  1H24 B;  1XO2 A;  3VKH A;  3X28 B;  1H26 B;  1H1S B;  3DTO A;  4EOM B;  1VOL A;  4BCQ D;  4ROE A;  4NC6 A;  5IDP B;  3HBL A;  4EOP B;  3BHT B;  5HBE B;  2PK9 B;  2WJ9 A;  2LW4 A;  2ZPB B;  4YOZ A;  3A8M B;  2PMI B;  5CYI B;  4HLQ A;  2CCH B;  2CCI B;  3DDQ B;  1VYW B;  3MY5 B;  2UZD B;  2ZPG B;  4CFU B;  1H25 B;  4JX6 A;  4TTH A;  2B9R A;  3H4C A;  4BCI B;  4OB2 B;  4ZGE B;  5I5Z B;  2DD4 B;  2W2H A;  2CZ1 B;  2G9X B;  1OIY B;  3BHU B;  4AKI A;  3DJB A;  4CRL B;  1TD6 A;  2F2C A;  4BXX X;  1W98 B;  3DL1 A;  3O0G D;  2WIH B;  2IW6 B;  1ENW A;  1QMZ B;  3G33 B;  4YC3 B;  5EJC A;  1AD6 A;  4UN0 A;  4BY1 X;  4CFX B;  4BCF B;  4HNT A;  5DQV A;  5IHY A;  3A8L B;  4F6U B;  2EUF A;  4CFN B;  4MIM A;  3TN8 B;  4KRC B;  2CZ0 B;  4II5 B;  4F7L B;  4F6S B;  2PHG A;  1PKD B;  4CFV B;  2C5V B;  3BG9 A;  1E7P A;  3BHV B;  4ROC A;  3X25 B;  2ZZD B;  2X1N B;  3BLH B;  2IVX A;  3F5X B;  4CFU D;  1FIN B;  1KXU A;  4EOK B;  4EC8 B;  2WXV B;  4EOO B;  1AHJ B;  1GUX A;  4MFE A;  5IDN B;  1OIU B;  4EOI B;  1C9B A;  5HNB B;  3QHR B;  1UNG D;  3VKG A;  3MIA B;  3QYE A;  4MFD A;  1OKV B;  1O9K A;  3DDP B;  4HNU A;  2R7G A;  3BLR B;  4OB3 B;  4HL4 A;  1JKW A;  2QQ8 A;  1FKM A;  2C5N B;  4BCM B;  1H1P B;  4F7S B;  4ZGD B;  2DXB B;  3X24 B;  4F6W B;  2W9F A;  4ELL A;  2PK2 A;  2AHJ B;  3TNI B;  4CFW B;  3VYH B;  3M03 A;  4OR5 B;  4EC9 B;  5LQF B;  3BG5 A;  4Y72 B;  2BS4 A;  3BG3 A;  5CEI B;  3B57 A;  3GTM S;  2C5X B;  4G6L B;  5BNJ B;  4OB1 B;  4BCH B;  1E9H B;  3HB9 A;  4FM4 B;  4EOJ B;  1OGU B;  2DPP B;  2WIP B;  5HQ0 B;  4EOR B;  4ELJ A;  2C4G B;  5HBH B;  4BCO B;  4EOS B;  3QYH B;  4LOC A;  1JST B;  3EOC B;  2IN3 A;  3X26 B;  1JSU B;  1H4L D;  3QHW B;  3LQ5 B;  1ZP2 A;  1UNH D;  2W96 A;  2BKZ B;  4CFM B;  4BCM D;  4BCN B;  2KR6 A;  2WMB B;  1P5E B;  1V29 B;  2W9Z A;  2D0Q B;  2IW9 B;  1QLB A;  4IMY B;  1FVV B;  3WVD B;  2BS3 A;  2V22 B;  2KMG A;  5HBJ B;  2IW8 B;  3QZ5 B;  1D3U B;  4CXA B;  2ZCF B;  3RGF B;  5ACB A;  4BCK B;  4AI6 A;  4F7J B;  5LMK B;  1AIS B;  2UZE B;  4BCJ B;  4JX5 A;  2CYZ B;  2WHB B;  2WMA B;  1F5Q B;  1H1Q B;  3TNW B;  4BY7 X;  2DD5 B;  2PJQ A;  3DOG B;  2QF7 A;  3HO8 A;  1N4M A;  1GH6 B;  3TW7 A;  3HZJ A;  5EFQ B;  1H28 B;  1OL1 B;  1URC B;  1VIN A;  2CJM B;  1UGS B;  4EON B;  1UGP B;  3MY1 B;  3QYG B;  2QGS A;  4I3Z B;  4BCN D;  2QFZ A;  2I53 A;  2QDJ A;  2DME A;  5IF1 B;  3PO3 S;  4YOO A;  3QZ9 B;  3TNH B;  1IRE B;  1GUX B;  4EOQ B;  3WVE B;  5FGK B;  3A8G B;  2C6T B;  2CZ6 B;  1GY3 B;  1BU2 A;  4OB0 B;  1UNL D;  1O9K B;  2ZPE B;  3MI9 B;  2G77 A;  4OGR B;  4YOS A;  3TW6 A;  2C5O B;  4ROD A;  4BCQ B;  2W99 A;  3KHI A;  1H27 B;  2UZL B;  2DXC B;  2WFY B;  2UZB B;  3HHT B;  2UUE B;  1G3N C;  4FX3 B;  4F7N B;  3QYB A;  5ICP B;  2QDY B;  3VYG B;  1JOW A;  1TFB A;  2CZ7 B;  4AKH A; 
#chains in the Genus database with same CATH homology
 5LMK B;  1OIY B;  4F6W B;  2UZE B;  2W9F A;  2WPA B;  3BHU B;  4BCJ B;  1H1R B;  1AIS B;  2WHB B;  2WMA B;  1F5Q B;  4KRD B;  4ELL A;  1H1Q B;  1OKW B;  2PK2 A;  4CRL B;  3TNI B;  2F2C A;  4CFW B;  3POM A;  1W98 B;  3O0G D;  1OL2 B;  2WIH B;  2IW6 B;  3M03 A;  4OR5 B;  3TNW B;  4EC9 B;  3DOG B;  5L2W B;  1QMZ B;  3G33 B;  4YC3 B;  5LQF B;  1AD6 A;  3EID B;  4UN0 A;  2I40 B;  4Y72 B;  4CFX B;  1OI9 B;  4BCF B;  4BCP B;  5CEI B;  2WEV B;  3BLQ B;  1N4M A;  1GH6 B;  4EOL B;  4F6U B;  2EUF A;  4CFN B;  2C5X B;  4G6L B;  5EFQ B;  4BCG B;  1H28 B;  5BNJ B;  1OL1 B;  1URC B;  1VIN A;  2CJM B;  4KRC B;  3TN8 B;  2BPM B;  5HVY B;  4EON B;  4BCH B;  3EJ1 B;  1E9H B;  4II5 B;  4F7L B;  4F6S B;  3MY1 B;  4F70 B;  2PHG A;  2JGZ B;  4I3Z B;  1PKD B;  3K7A M;  4EOJ B;  1OGU B;  2WIP B;  4CFV B;  4NST B;  2C5V B;  5HQ0 B;  4EOR B;  3BHV B;  4BCN D;  4ELJ A;  1H24 B;  1XO2 A;  4ROC A;  2I53 A;  2C4G B;  2QDJ A;  5HBH B;  4BCO B;  2X1N B;  1H26 B;  4EOS B;  3BLH B;  1H1S B;  5IF1 B;  2IVX A;  3F5X B;  4EOM B;  1VOL A;  4YOO A;  4BCQ D;  1JST B;  3EOC B;  4ROE A;  4CFU D;  3TNH B;  5IDP B;  1GUX B;  1FIN B;  1KXU A;  4EOQ B;  4EOP B;  4EOK B;  4EC8 B;  5FGK B;  2WXV B;  1JSU B;  3BHT B;  1H4L D;  3QHW B;  4EOO B;  5HBE B;  2PK9 B;  2C6T B;  1GUX A;  1GY3 B;  3LQ5 B;  1ZP2 A;  1UNH D;  2W96 A;  2BKZ B;  4CFM B;  5IDN B;  1OIU B;  4BCM D;  1BU2 A;  4BCN B;  4YOZ A;  4EOI B;  1C9B A;  5HNB B;  3QHR B;  1UNG D;  1UNL D;  1O9K B;  2PMI B;  3MI9 B;  5CYI B;  2CCH B;  4OGR B;  4YOS A;  2WMB B;  2CCI B;  2C5O B;  3MIA B;  1OKV B;  1P5E B;  3DDQ B;  1O9K A;  1VYW B;  2W99 A;  3DDP B;  3MY5 B;  4BCQ B;  4ROD A;  2UZD B;  2W9Z A;  4CFU B;  2IW9 B;  1H27 B;  2R7G A;  3BLR B;  1H25 B;  2UZL B;  2WFY B;  2UZB B;  1JKW A;  1FVV B;  4IMY B;  4TTH A;  2UUE B;  1G3N C;  4FX3 B;  2V22 B;  4F7N B;  2B9R A;  5ICP B;  2C5N B;  3H4C A;  5HBJ B;  4BCM B;  2IW8 B;  1H1P B;  1D3U B;  4F7S B;  4BCI B;  1JOW A;  4CXA B;  3RGF B;  1TFB A;  5I5Z B;  5ACB A;  4BCK B;  4F7J B;  2W2H A;  2G9X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...