5HBMB

Crystal structure of a dihydroxycoumarin rnase h active-site inhibitor in complex with hiv-1 reverse transcriptase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
424
structure length
413
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of a Dihydroxycoumarin RNase H Active-Site Inhibitor in Complex with HIV-1 Reverse Transcriptase
rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
total genus 108
structure length 413
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hbmB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmB03
1XR5A 1IKXA 4ED8A 3V81B 3DDKA 1XR7A 2D7SA 3QYYA 1S1WB 4QWCA 1S1XA 2HNZB 1VRUA 4H4OB 1CSJA 4J9RA 5DGAA 1NNDA 3OSPA 2BANB 3GIKA 1C1CA 1NHVA 4YR0A 4IR1A 2RF2A 1RT7B 5KFGA 3UDLA 2B5JA 3PVXA 3KMQA 3FSIA 4Q8EA 2OPRB 4F4XA 1JLAB 1DTQA 5J1EA 3RB4A 3DRRB 2R8JA 5K14B 1HQUA 4RW6A 4KBIA 2FJXA 3PW2A 3BSCA 4NRTA 4IR9A 1S1UB 5I42A 1YVFA 1MMLA 1HQEA 5L1IA 1LWEB 5KG7A 3Q8SB 2BE2A 1OS5A 3QGIA 3M9OB 3RBDA 4XO0A 2IM0A 1BQMB 4J9NA 3T1AA 5C42A 4Y34A 2JEIA 2AGOA 2R2SA 3MEDB 4WFYA 4U6PA 2VG7B 4NCGA 1C1BB 4NLRA 2IBKA 5J2PB 4RU9A 1RTIA 4U7CA 4LSNA 4WXWA 4MH8A 4O3PA 5JXSA 5DLFA 1KHVA 1MU2B 2AQ4A 5F9LA 2IJNA 4ID5B 3V4IB 4ZP8A 3NGDA 3FFIB 4R8UB 2VG5B 3C6TA 5KFDA 5F8NA 2RDIA 3CJ3A 4ZVGA 5KFMA 4RW8B 1JLBA 5J2MB 3DM2A 4KB7A 4TYBA 4NLSA 4FBUA 3NKYA 1S1VB 3DRSA 1HNVB 3MFIA 4EYHB 5F8GA 3E01B 3RB6A 5DGBA 4MFBB 3OLAA 3G86A 3KHGA 3IN5A 1JKHA 3CO9A 1UWBB 3FQKA 5KT6A 3MECA 2GIRA 2YKMA 3V6DB 3LANA 2HMIB 1XR6A 1JIHA 3HVWA 4J9SA 3GV7B 2JC0A 2W9CA 1EP4B 1LW0A 1RT2B 4IG3A 4MKBA 1HYSA 3MR5A 1SV5B 3OL7A 4IDKB 4PUOB 2R8GA 1IKYA 3KLIA 1SH2A 1S48A 2BRKA 3N6MA 1HNIB 4OL8A 3GIMA 3V81A 2IM1A 5KFUA 4EO8A 3EZUA 3HVTB 1DTTB 1S1WA 3PZPA 2AU0A 1JLQB 2FVSA 1RT3B 2I5JB 2HNZA 3ICLA 3QIDA 4H4OA 4RW4B 1C2PA 5KT4A 2BANA 4NLTA 2R8HA 4ZP7A 1TKTB 5DQHA 4O3NA 2IAJB 3LALA 4YMEA 2OPRA 3KHRA 1JLAA 4HYKA 5KFKA 3DRRA 4EO6A 5K14A 4H4MB 4DEZA 4ZP9A 4JV1A 2AGPA 3I0SB 5KG4A 3OHBA 1QAIA 4NLXA 5KFIA 4PWDB 4NLOA 4NLYA 1TVRB 1S1UA 2R2UA 3D28A 1LWEA 3DOKB 4MIBA 4WXOA 1S97A 2VA2A 1BQMA 4I7FB 1HMVB 2F8EX 3IS9A 3MEDA 4HKQA 4ECXA 2VG7A 1C1BA 3ITHB 3TQ1A 5J2PA 4YP3A 5L9XA 3NMAA 4XPEA 3KK2B 4QW9A 1MU2A 5KFXA 1W25A 4QWAA 1FKPB 4ID5A 3V4IA 5C25B 1T05B 3FFIA 5J2NB 4R8UA 2VG5A 4ED0A 4RW8A 5J2MA 2FVQA 2UVWA 1S1VA 1HNVA 2ASLA 3E01A 2ZKUA 5HLFB 3FDSA 4RNHA 5KFRA 4MFBA 5KG1A 3H4DA 2OH2A 1UWBA 4ZPCA 4DL4A 3DOLB 5DG7A 1RDRA 4ZHRB 5DG9A 3LAKA 3V6DA 2HMIA 1QE1B 4DG1B 4MKAA 2WONB 4YQWA 3BGRB 3BREA 3RBEA 1DLOB 1EP4A 4MK7A 1RT2A 3RB3A 2HAIA 5KT3A 1ZETA 1SV5A 4NLGA 4IDKA 4PUOA 5KT5A 4WYLA 4Q43A 4Q44A 3ISND 4RUAA 2WRMA 4EBDA 1HNIA 3KLIB 3EPIA 3HVTA 1DTTA 4LQ9A 4TN2A 2IC3B 1JLQA 3GIIA 4J9LA 1HARA 1RT3A 1S9GB 2I5JA 4ICLB 4F4ZA 4KFBB 3T5KA 2FLNA 4RW4A 4ED1A 1RTHB 4IRDA 3CJ4A 2AX0A 3HVAA 3CJ2A 5KFSA 3M9NB 4DL7A 5KFHA 1TKTA 4TQSA 1JX4A 2IAJA 3KLGB 1N5YB 3LP1B 4EBEA 1S4FA 4K4XA 3RAXA 4O3RA 4G3IA 2OPSB 5JUMA 4ECYA 1FKOB 3VQSA 4K50A 1RT6B 3CJ0A 4H4MA 2BQ3A 3BSAA 3I0SA 3SI8A 4PWDA 3IGNA 5KFYA 3KK1B 1TVRA 2WCXA 2AX1A 3CJ5A 3N6LA 4Q45A 1JLGB 5I3UB 4TQRA 3DOKA 3JSMB 4GC7A 3IG1B 4RNFA 3KLVA 4I7FA 3Q8QB 2UVUA 1HMVA 4YR3A 2J6TA 2JEFA 4ZMMA 4RNNA 2XI3A 3M8QB 3ITHA 4EBCA 3DMJB 3IGVA 5KFNA 3QZ7A 1IKWB 2V9WA 4IRKA 3IS9B 2UVVA 3KK2A 3C6UB 1TL1B 1FKPA 4ED7A 1T05A 5C25A 5J2NA 1N56A 4KO0B 3PJWA 3QGGA 4ECRA 2VA3A 1RYRA 3RAQA 4GC6A 4O4GB 1S49A 4RW9B 1N6QB 4QWEA 3GV8B 1C0TB 4J9KA 4QW8A 2BQRA 3M9MB 5HLFA 4I2PB 1RAJA 3I5BA 3MR6A 1TV6B 1Z4UA 5F8JA 3DOLA 4J9MA 5C24B 4ZHRA 3H5UA 1FK9B 2ZD1B 1KLMB 2AWZA 1QE1A 3I5CA 4DG1A 3HHKA 1RTDB 2WONA 3G6VA 3BGRA 4KKOB 4RZRA 4IH5A 1DLOA 3DRPB 4MIAA 3KHHA 3PW0A 4JV0A 4I2QB 5T14A 2JEGA 2C22A 4K4SA 5EWGA 1T03B 2JLEA 4ZPDA 4EYIB 3MEGB 3QIPB 4FS2A 4URSA 2HWIA 4QPXA 2JC1A 2VG6B 2IC3A 4X2BA 5KFPA 1S9GA 4ICLA 4NLVA 3HKWA 1S0NA 4KFBA 3BR9A 3KLEA 4JV2A 1RTHA 4KAIA 5KFQA 3DLEB 3G6YA 2R8IA 4O4RA 5HBMB 3MF5A 2C2EA 2R2RA 4IH6A 3V6HA 2XCAA 3CWJA 3UQSA 4K4WA 3E51A 2HNDB 3KLGA 1N5YA 3LP1A 4KE5A 3PW7A 2XGQA 2OPSA 1S1TB 5KFZA 2XC9A 3N6NA 1FKOA 1S6QB 5J2QB 4J9QA 1RT6A 3PW5A 4R0EA 2V0NA 3KK1A 2IA6A 4TXSA 4IFYB 4Y3CA 2RKIB 5KFLA 1JLGA 5I3UA 1REVA 3JSMA 3IG1A 5L1KA 3DLGB 1LW2B 1S6PB 2YNFB 4K4TA 4O44B 1N4LA 3OHAA 3JYTB 5KFJA 4ECUA 3M8QA 4WE1B 4ECZA 3DMJA 4NRUA 1IKWA 3C6UA 1TL1A 3QLHB 3TAMB 4O3OA 3GIJA 2C28A 4IFVB 1GX6A 5KFWA 3OL9A 4KO0A 4TY9A 3UPFA 2GC8A 2XCPA 1EETB 4IOBA 2UUTA 4URGA 4O4GA 3OLBA 1HPZB 4RW9A 1N6QA 4DL2A 1C0TA 4KHRA 1TKZB 1J5OB 3PW4A 2B43A 2BR0A 4I2PA 2IJFA 3I5AA 5KFCA 1LWFB 1TV6A 4ED2A 2FLLA 5C24A 4NLPA 4YR2A 1FK9A 2ZD1A 5KFFA 4FS1A 2RDJA 1KLMA 3H2LA 1IKVB 2ASJA 1T94A 1RTDA 4ZP6A 1BQNB 1RT1B 4KKOA 3BQ0A 3V6JA 4WZQA 3DRPA 2W7OA 3H5XA 3MFHA 4I2QA 4ECQA 1SH3A 1I6JA 1T03A 3KNAA 3QGHA 3MEGA 3QIPA 2QE5A 5HROB 3KHLA 3EPGA 4TY8B 2VG6A 1JLEB 4IKAA 3KOAA 1QUVA 3OL6A 3CDUA 4R5PB 5F8LA 5L1LA 2ZE2B 3DLEA 3LP0A 5HBMA 3MEEB 4NLDA 4IG0B 3KLEB 4K4VA 3CVKA 4QWDA 3UR0A 4IH7A 3MTKA 2W9AA 2HNDA 2WTFA 2V4RA 3SFUA 5KG0A 3NBPB 1NHUA 4ECSA 1S1TA 3CDWA 3BQ1A 1S6QA 1LWCB 5J2QA 4ZVEA 1TKXB 1JLCB 2FVRA 2XWYA 3V6KA 2JEJA 5F8HA 2W9BB 4ZPAA 3M8PB 3OL8A 2C2RA 3GV5B 3LP2B 4PQUB 5KFVA 4IFYA 2RKIA 2HWHA 5KFBA 2E9ZA 3H59A 1TQLA 4LQ3A 3DLGA 1LW2A 1C0UB 1S6PA 2YNFA 3DLKB 4O44A 2FJWA 2D41A 3JYTA 2IM3A 1REVB 2B6AB 3PR5B 4NYZA 2FLPA 4KV8B 2WOMB 1RT4B 1VRTB 4WE1A 2DPJA 4Q8FA 4G1QA 3IRXB 3D5MA 3RB0A 1JLFB 3H5YA 1S0OA 3QLHA 3TAMA 3KLFB 1ZTTA 4IFVA 4RW7B 1SH0A 2QV6A 1EETA 5DQGA 2ATLA 1S9EB 3Q8RB 1HPZA 2YNGB 2YNHB 3KK3B 1RA6A 2IM2A 3SFGA 2R2TA 5HP1B 2CKWA 1TKZA 1GX5A 3H4BA 1J5OA 3FQLA 2IMWP 4EEYA 5FDLB 4O3SA 4ECWA 3QO9B 3KLHB 1LWFA 4LSLB 4Y2AA 2I1RA 5KFEA 5KG2A 1IKVA 1QAJA 4K4ZA 1R0AB 1BQNA 1RT1A 2OPPB 5DLGA 2XI2A 1T3NA 4ZVHA 5F8IA 1K1SA 3NAHA 4WZMA 1RT5B 5HROA 4ED6A 3OSNA 4TY8A 1RYSA 5KT2A 1SUQB 2WK4A 1JLEA 5EUHA 4IRCA 4R5PA 2E9TA 2OPQB 2HNYB 5CYMB 2ZE2A 2EC0A 3MEEA 4IG0A 5KFTA 2BQUA 5KFAA 4DL3A 4RUCA 1S9FA 3LP0B 1JXLA 4J9PA 4NZ0A 4QWBA 3I0RB 2WHOA 5CYQB 4Q0BB 3NBPA 3Q8PB 3T19A 3BJYA 3PHEA 2WB4A 4WYWA 3MR3A 4MK8A 1LWCA 4NLWA 1TKXA 2YNIB 3KJVB 1JLCA 5DG8A 3BSOA 4K4UA 3BQ2A 4TYAA 2W9BA 2R8KA 2D3ZA 4ED3A 4XPCA 2AGQA 3M8PA 3LP2A 4PQUA 4ZPBA 4TLRA 2ALZA 4IQXA 2YKNB 3DI6B 5EWFA 1C0UA 3DLKA 3QZ8A 1RTJB 4B3OB 5KFOA 4RNMA 2XGPA 2B6AA 2DPIA 2W8LA 5D3GB 1TL3B 2WOMA 1RT4A 1VRTA 3DYAB 4KV8A 1ZTWA 3PR4A 2ILZA 5KG6A 1IKXB 3IRXA 4WFXA 1D1UA 2D3UA 3MR2A 1JLFA 3GQCA 2BRLA 3KLFA 4G1QB 1S1XB 4RW7A 1VRUB 4NLUA 4J9OA 1RT7A 2W8KA 1C1CB 4DL6A 1S9EA 4O3QA 5F9NA 1RA7A 3CIZA 2RF2B 2YNGA 2YNHA 3KK3A 5HP1A 2B5JB 4M95A 5EDWA 2FVPA 3BSNA 5FDLA 3QO9A 3KLHA 1DTQB 4LSLA 5J1EB 3PJXA 2UVRA 1HQUB 2O5DA 4URQU 4RW6B 1U09A 4F4WA 2J6UA 3CDEA 3H5SA 2GIQA 2V4QA 5KT7A 4M94A 1R0AA 2OPPA 4ZVFA 5KG3A 4RNOA 5I42B 2ILYA 1WNEA 1HQEB 1S0MA 4DL5A 2BE2B 5L1JA 1D0EA 4JUZA 2W7PA 2J6SA 5C42B 3NAIA 1RT5A 4NCGB 2ASDA 5DQIA 2FJVA 1TP7A 1RTIB 1SUQA 4LSNB 5KG5A 3H40A 4KHMA 3T5LA 4KSEB 2OPQA 2HNYA 4F50A 5CYMA 5EWEA 3T5JA 3C6TB 2FVCA 3FRZA 4K4YA 1JLBB 3DM2B 1IM4A 4MK9A 3I0RA 5CYQA 3DRSB 3GYNA 4Q0BA 3LAMA 4WFZA 3GILA 3KMSA 4H54A 5C5JA 3TVKA 2YNIA 3KJVA 3H98A 4Y2CA 1JKHB 4F4YA 3G6XA 3MECB 2YKMB 1K1QA 4ECVA 3ISNC 2CJQA 4NLQA 5F8MA 4ECTA 1S10A 4FBTA 2C2DA 1N48A 2W9CB 2YKNA 3DI6A 3T5HA 1KHWA 1LW0B 4IG3B 2UUWA 1RTJA 4B3OA 1HYSB 3NL0A 2E9RX 1IKYB 5D3GA 1TL3A 3DYAA
chains in the Genus database with same CATH superfamily
2R7OA 4HDHA 1FDNA 3K89A 2CDRB 1TTHB 1CJVA 2C3YA 3RB4A 5K14B 3FEZA 2ADCA 3R2CJ 2KYXA 4DQSA 5K20B 1YZ6A 4P74A 2ADBA 3GWCA 2GMLA 1RAAB 1U8SA 2Y0BB 4PEOA 1RWUA 2AQ4A 1RWNB 5FLXU 3HF5A 5DDOC 2ZM6F 4DS4A 1D09B 3NS5A 2E1AA 3CO9A 5LMUJ 3LANA 2ZHBA 3FC9A 2OD6A 2M8HA 2MZ1A 4UY8T 2AYMA 4C6AA 2ROPA 1L3TA 3UD5A 2QSWA 3AH6A 2R7TA 4NLTA 1R8CA 3R5AA 2I2YA 5KFKA 3FEXB 1IWGA 2HHQA 3W66A 3NRBA 4NLYA 4MIBA 2VFRA 1HMVB 4Z7CA 2GQ2A 2QA2A 2RHSB 4ZPWR 3DLHA 3BPSP 2VG5A 4F8RA 1FRLA 3M6WA 2GAGC 5I3PA 1R8HA 1NK6A 4KHPJ 1RJJA 4PXEA 4ALZA 3V6DA 4FP9A 1QE1B 3RBEA 2C3MA 2WBRA 4NLGA 3PYEA 3IBWA 3K2YA 3VAKA 1JJ4A 3CCVS 1UW4A 4LR8A 4LQ9A 3H5XA 3H7HB 4X4TA 3M9NB 3J81j 2GIFA 4K4XA 1ZH5A 1RT6B 3IMQJ 4Q45A 3PR4A 1AB8A 4JI1F 3IS9B 1FKPA 4QIVA 3P96A 3R5DA 5GAHI 3DXSX 3WX4A 3MR6A 1FK9B 4FDFA 3DRYA 5L46A 2CQPA 4MIAA 3G8SA 3M8RA 3MWBA 4B08A 3A3OB 3QAUA 4URSA 2JC1A 3X1LB 1BD6A 3SQGA 1RTHA 1WC6A 2BE9B 3UW1A 3MF5A 1RKJA 4K4WA 2CQIA 2OD4A 1URRA 3BKFA 1SIZA 2DTJA 3Q2SC 5JMNA 2JHEA 5KTQA 3O1LA 2E5JA 4FNHA 2HHXA 1R27B 2BKNA 3MPYA 4QR1A 2H4WB 4ED5A 2DIVA 2HHPA 5KFWA 2KFZA 2XO6A 1HNXF 1EETB 1HR0J 5IFMA 4J7CA 1GFWB 2IHR1 4O4GA 3WHIA 1SKRA 3GR1A 3HD1A 1J5OB 3UFCX 2WVCA 1K47A 1BQNB 4OI6A 4CM0A 4PRFA 3R6GB 1JMTA 2EVZA 1TELA 3KNAA 4F3MA 3KHLA 2ZBQA 3OL6A 2F63A 2CQCA 2QL9B 1NPKA 1H0HB 2HNDA 4ZVEA 2VPXB 4ZPAA 1VC6A 3PRVA 3FZBA 4LFCJ 2RE1A 2L3MA 4KGMA 3MM8A 2D9OA 2JNJA 5CZXA 3HFVA 2JVOA 2X3GA 2EI5A 4NYPA 3CC2S 5HP1B 2GZOA 4KGVB 4O3SA 1KRPA 3CJKA 1OO0B 1NDPA 2KN4A 4RX6A 2GVDA 1R31A 4DS5A 3MEEA 5AXKA 5B08A 2Y1RI 3MM7A 3NBPA 3T19A 4RPFA 4TYAA 5M2RA 5IV4A 3LP2A 2QMWA 2LQ8A 1R43A 2YKNB 2IDLA 2V94A 4ZJOA 4QJVA 5IC4B 1NK0A 4B3SF 1CJTB 2OSRA 4ZS6A 3PJXA 3BN4A 1R0CB 4KPYA 3MM9B 1T9TA 2J6SA 5IV3A 5AXNA 2B8QA 1RTIB 5KG5A 3KFWX 3D1OA 3FVYA 4CCHA 1IQZA 5B09A 1DQ9A 4Q0BA 2CDQA 2XO7A 3KJVA 4X66J 1U48A 2LXUA 3V4MA 4GKKF 4WKRA 1LV5A 2E9RX 2XMMA 1C4AA 2VBXA 1YWXA 3RZAA 1QLNA 1I94F 5BYRA 3BSCA 4OYAA 3Q8SB 3M9OB 5ETQA 4Y34A 4ANDA 3DXBA 4RU9A 2F4VJ 4JOUA 4OHWA 1SXLA 3NGDA 2VL1A 4HI2A 3TEHB 2CZ4A 1JLBA 2UUAF 4EYHB 4AXJA 3E01B 4A47A 4NXNJ 1RB0A 5ETSA 2OTJS 1SV5B 2E5LF 3CCMS 1SH2A 4ILLA 1T8EA 2KZZA 2C2KB 5KFUA 5ETPA 5DJBA 4DX7A 1VFJA 4XIUA 1Y5IB 1KONA 3EVWA 4ZP7A 3MMCB 3LALA 2YTCA 4YMEA 3UNGC 3HCXA 1XNRF 2B4OA 3I0SB 2M4MA 1S1UA 1LWEA 2ZOFA 4CLTA 2XMKA 2MQOA 3D0GE 2GQCA 3I9V9 5DDPC 2COLA 4LJMA 4LUBA 3KK2B 4NI2B 5HATA 1RAFB 5BXIA 5HQLA 2BEFA 2CNKB 2YWEA 1M0SA 2Y8WA 2FVQA 2E5IA 2ZKUA 5HLFB 4MFBA 3J80U 2R7WA 3OUYA 4AQYF 1RDRA 1PJ7A 1T02A 4IDKA 5KT5A 1CS4B 1HNIA 1M5KC 5K8MA 4PG8A 1DTTA 4F4ZA 2I5JA 1WF1A 3QJPA 2AX0A 1V5VA 4DL7A 3RAXA 4U7UD 1FRIA 5JUMA 4HHHA 3BSAA 3P5TL 2W2MP 5K8NA 3CMAS 5I3UB 4LF7F 1Q8IA 2HS0A 4ZVUB 3ITHA 4NCBA 1EAYC 3DMJB 2V6AA 1Q7LB 2NYHA 4ED7A 5C25A 1PBUA 2EBGA 2GO8A 1UVMA 2WZ1A 3GV8B 3BDEA 1R3NA 3LO3A 4ERDA 2FPHX 5C24B 2WVDA 4C0OC 1WF0A 1VBYA 4QPXA 4UY85 4P2XA 3HKWA 2Q43A 4IH6A 3T9ZA 2MEWA 2OP5A 3N6NA 3PXGa 1KFSA 4IFYB 4Y3CA 3R5GA 1VBKA 3Q83A 5D0GA 5HMZA 3PDNA 4USVA 4ECZA 5DO2A 1S7HA 4CO3A 1XMOJ 1IM6A 5ADZA 3CJTA 4PWUA 4DPUA 4KHRA 3R7NB 2NZCA 1TMJA 1WORA 1BY9A 1MNEA 2MKSA 3DRPA 2W7OA 1HBUB 2CRLA 1U26A 5DZ6A 1T03A 3QIPA 3R7BB 3W60A 4DX6A 5L1LA 1N34J 3DLEA 2VD3A 3UR0A 2CJYB 2F1FA 2C2RA 1U0SA 3ET6A 3IWNC 2VB6A 3U1NA 3SSSA 2WOMB 4WE1A 1NSQA 4P72A 3PRBA 4EU0A 3QLHA 5IT9U 2EC2A 2LYVA 2XULA 4LFAF 5DM6Q 2YNHB 4CLSA 2K2PA 1QAJA 2XMJA 4DXLA 1Q4RA 4ED6A 3OSNA 3OR1B 2JL9A 1IBLF 5CXTA 3M32B 2E9TA 2AJ2A 2DT9A 5AXMA 1U1MA 4A8YA 2YNIB 4P2MA 1VISA 3LGMA 3CCSS 5HANA 3DI6B 5KFOA 4B3OB 4DR7J 2W8LA 2NPFA 3W8GA 1CQMA 5KG6A 3MM6A 1JLFA 3K17A 1J2VA 1C1CB 2ZC4A 3QJLA 1RA7A 3AQPA 2L9WA 3D67A 1TK8A 3QRQA 2D69A 1HWLA 4RW6B 4TU7A 3ILOA 2HHHJ 3CJRA 2EFVA 2OPPA 3TARA 3BN7A 4I64A 1GAOA 3LGHA 3ZNUA 1WUUA 4FVCA 4RO0A 3FRZA 3G82B 1IJFB 5LMUF 2WBMA 2IY5B 2QLJB 1AA1B 4EZ9A 1ZM3A 2AEMA 2R42A 3MMAB 1RTJA 2B9XA 4UOHA 1SKSA 1TL3A 4BWJA 3K5OA 1QM9A 3C15B 3UCUP 1HBOB 4CDIA 3N4WA 1YJTA 1SQEA 3MTJA 3PVXA 3HI9A 1RCOB 3P5BP 3RGIA 1TL7B 2BJ9A 2Y9HA 1ZM2A 2IVMA 2B56A 1FTCA 2J6TA 1VR6A 4YOEA 2MKKA 5C42A 5J2PB 2MZTA 4U7CA 3PX4A 2LVWA 4KH1B 4ID5B 2LXIA 5KFDA 3MMJA 1RHJB 5HSPA 4KHPF 1V3ZA 2HFVA 2UZAA 4UQTA 2DRDA 2GIRA 2HMIB 2H9ZA 4UT4A 3HVWA 3GV7B 3ILLA 1V3RA 1LW0A 3HHLA 3MR5A 3HFZB 4PUOB 5GAGI 3GIMA 2ZFHA 2LP4A 2HNZA 2KB2A 1RHQB 4RW4B 4A8XA 1U0HA 5DQHA 4OQJA 2KFYA 3S1TA 4DEZA 2NYIA 4YB1P 1N5TA 3QRPA 1VRQC 3CCQS 1ACMB 1HLWA 1CULA 1PIEA 2HKEA 1FESA 4OYIA 4RWWA 2UXDJ 5ETTA 4AL5A 1TFWA 3DOLB 5DG9A 3EWGA 1DQAA 4WP9A 2HS3A 4DPOA 1PKUA 3AY0A 1N5YB 2MY8A 4OMFG 1RWVB 2MKJA 4B9VA 1NKBA 2CG8A 1TVRA 4C8OA 2YPYA 3CCTA 3KLVA 4I7FA 3RG6A 3Q8QB 5G0RA 4ZMMA 1QVGR 5KFNA 1HR0F 1N56A 2HQDA 2CJ9A 1FDDA 2ZUGA 3TX0A 1NB2A 1S12A 1HHQA 3MPUB 3I5CA 2N7YA 3BGRA 2NPIA 5IS2A 1HWUA 3GFHA 3MEGB 3TVYA 1S9GA 3BR9A 3JTOA 4YFUA 2KJWA 3L9ZA 3T6JA 3AOBA 2OPSA 1FNMA 2XC9A 3UD4P 2EXUA 2K8GA 4LFCF 4HI1A 2C2ZB 1DURA 2OUGA 1N4LA 4DF4A 2CYYA 4NRUA 1KQSR 9RUBA 3CUNA 2QSFA 4DV2J 3UPFA 4WWSA 3NGUA 2HIQA 2CWXA 5EX0A 1N6QA 1M5HA 3D7SB 5KFCA 1VQNS 4ZLJA 3M2VB 2G0IA 4USKA 2WVBA 4KKOA 3V6JA 2B8PA 2AV5A 3H90A 4C3MA 2O67A 3ZTQA 3GB0A 3NNHA 3BKTA 1NJIT 3LP0A 1X7VA 4EFAC 4ECSA 1ULRA 4OJ3A 4PQUB 1OQ6A 4NE9C 1LK7A 3AA9A 2C2NA 1NAQA 4ELVA 3C66A 3IR7B 2GCFA 1ELOA 4USMA 3KK3B 2GMHA 2H65B 5EX3A 1LWFA 3NS7B 1DZ5A 5E3QA 3MCOA 3H25A 4C8NA 1U24A 1K44A 2F3JA 3MI7X 5F8IA 4ZVQB 3BZQA 2AYGA 1WG4A 1H72C 4DI6A 3ZNJ1 2WK4A 2DXEA 2HFNA 3VGUA 1F5BA 2I6WA 4IG0A 5KFAA 2MLXA 3VVUA 3P3DA 4X66F 4DWIA 4M8LA 1LWCA 4NLWA 2HHTA 2HFOA 4XPCA 1UPPA 2VOPA 1UW9A 2KKHA 4TLRA 3DCAA 1C0UA 2DNLA 3DGVA 2ILZA 4TVAB 1IBMJ 3IRXA 4WFXA 2DY9A 1A7GE 1HD0A 5F9NA 3QSIA 3JSYA 4I6AA 3M2RA 1U1LA 1U02A 2E5HA 4LF6J 1XQIA 1HQUB 1QY7A 3DKDA 2R7SA 3K5MA 4M94A 5I42B 5CQGA 2A0FB 4MT1A 3ZZTA 2F4VF 2R7UA 2GVZA 2MMYA 3HHDA 2VONA 4M5DB 5J1NA 3T5JA 5EWEA 5E0OA 3C6TB 1TUGB 5CYQA 4Q5VA 1KVIA 2XMWA 2V2VA 3ENWA 2XSJA 4F3OA 4CH7A 4P9SA 1Y5LB 5E3PA 4GVBB 1TMMA 3W1YC 4DFMA 3M2UB 4PPZA 1NH7A 4DLGA 3DYAA 3ENAA 2BM0A 3GCWP 2BANB 1NHVA 4L3NA 2EFGA 5KFGA 3G8QA 2OPRB 5J1EA 2EWHA 4CH1A 2V9KA 1YSJA 1OS5A 4WFYA 4CLPA 2E44A 2P9EA 4FYDA 3IAS9 3KTQA 2FC9A 2V5HG 3I82A 4B9UA 4ZVGA 1VQKS 1LFWA 4WF9Q 2LLZA 3NKYA 4PG6A 4C0HA 3SEOA 3OXLA 4J9SA 4K8RA 2W9CA 3HD2A 4B9SA 1WEXA 1WELA 3KLIA 4QQBA 2GHWA 2AU0A 2V68A 1GK8A 4OYBA 1VI7A 3E8OA 3VTIA 1DJ0A 2ZNYA 4LVOP 1JLAA 3MDFA 4A4JA 2CNOB 2MQ8A 4X84A 2GQQA 1M1HA 2WSFC 4K2XA 4JP8A 4DUYJ 1Y9OA 3MCNA 1MU2A 2FLOA 3A8KA 5K8OA 4R8UA 2ZKTA 1MSWD 2UVWA 3NCQA 3ZTRA 3ZZZA 4QZVB 1RLDA 4TKTA 1UVKA 3SCLE 2ZC3A 3OTEA 3SIPB 4ZVTB 3W64A 1VQ9S 2MKHA 3O5TB 2HHVA 1NZ8A 1HARA 2XMAA 1SQFA 1L3VA 1G2EA 3F44A 2RU3A 5KFHA 3R7SB 1YI2S 1RWPB 3P4UB 3C16A 3WC2A 4QYZJ 4OYPA 4ECYA 3GYXB 2U2FA 1N5VA 4HACB 3RW7A 2AX1A 1JLGB 2RT3A 1XMOF 1ZA1B 3FKBA 1FDAA 3N28A 1BQXA 2DO4A 1FRHA 4ILMA 2CZVC 2G9OA 1RYRA 1YDLA 3W3SA 4OYOA 2JLGA 4UUXA 3I5BA 3I56S 4J9MA 2ZD1B 4R25A 2AWZA 4RZRA 1W26A 5EN1A 2H1YA 5EWGA 2M5YA 1N34F 3EMTA 1X4HA 4J9UE 5KFPA 4JV2A 4ICLA 4DSKA 1PCAA 3B82A 2R8IA 2EFOA 2XCAA 2W24A 2IJRA 2SXLA 5E33A 4GKJJ 4DN9A 2ZBCA 4R0JA 1YIJS 5GAEU 2M0GB 4MIWA 4X4OA 3C19A 1N33J 4NCAA 1OIAA 2C28A 2Z2ZA 4LFBJ 1C0TA 3VHQA 4I2PA 3F41A 5AE2A 5KFFA 1YGYA 2C3PA 4WU3A 1RT1B 1VCTA 4PABA 3EVMA 2LKZA 2ZE2B 3MTKA 4MMOA 1YTYA 1YJNS 4DR7F 1FXLA 2E9ZA 1VK3A 2XYGB 2HBYB 2G2YA 2YNFA 3DLKB 2FJWA 4TU8A 3ZFVA 4ITSA 3KLFB 1UEKA 1Q8BA 2IDEA 1X4DA 2KFNA 3EYZA 3V5RA 1WKJA 2HHHF 5B0BA 3AJ2A 5F3TA 1R0AB 1K1SA 2BMBA 1EKSA 1WWHA 4WZMA 2VASA 1RT5B 3EXYA 2HZVA 4P73A 4R5PA 3IM8A 3TYTA 1TUWA 3I0RB 1UETA 3VVTA 4NA3A 2CVEA 1TKXA 2MKIA 2IYIA 4F67A 5E3AA 1FNOA 2LECA 2BX6A 3FBFA 5EWFA 2G2OA 2DPIA 3IP0A 2OFHX 5C2CA 1YJVA 1SC1B 3MR2A 2JDJA 2M52A 4G1QB 1SJQA 3CCWA 3BBFA 5EDWA 3SV3A 2GO9A 2VBYA 3BSNA 2DCLA 4L73A 3D68A 3Q24A 3CCLS 1UVNA 2ILYA 2BKOA 3LQVA 3AA8A 3HO1A 2BJDA 2OMLA 3BM7A 2XSFA 2HNYA 3L09A 2HVDA 4K4YA 3DM2B 1UJ5A 3GYNA 5A2QU 3N0VA 2NXCA 3TUIC 1SC3B 4HT5A 4H54A 3TVKA 3H98A 1FXRA 4P10A 1SJ3P 3AD7C 3CNQP 2B9YA 1FE0A 1KQKA 2QA4G 2YQ3A 4OLPA 4QWCA 4C3LA 4N7TA 1CSJA 4ZLLA 2CPYA 2HSEB 3POTB 4KBIA 3AOCA 4M5NA 5T41A 2NXEA 2O3DA 3LUYA 1KQGB 4RUHA 1HQEA 3MAAA 3PX0A 3QBCA 3T9NA 4L3KA 2UXDF 4BHQA 4IOCQ 4ILRA 1WC0A 5DLFA 4ZP8A 1LFPA 5J2MB 2VJVA 1WTFA 3HK2A 1FJEB 2HIYA 3RB6A 1JKHA 4HHUA 2XBPA 1JQGA 3QWUA 2BABA 3KG0A 1XEZA 4EO8A 2FVSA 2OSQA 1MWQA 4A8QA 3FBEA 2R8HA 2C3OA 1JNRB 3EDRB 4KRWA 3BH6B 4UZBA 1EX8A 1KOHA 3SV4A 4PWDB 3GR0A 2PSZA 2VA2A 3A8JA 1XK8A 3FCVA 2F8EX 2VG7A 4DQIA 4LF8J 4OYZA 3OFGA 3VZHA 5KFXA 1FDBA 1WF2A 3V4IA 2LQBA 2Q66A 1U7LA 2VJUA 5E2QA 3R3TA 2LEAA 4YY3J 2DHAA 4RNHA 3ZZ0A 3HZEA 1WEZA 3SSRA 3BF4A 4N41A 4N76A 5ETMA 4YQWA 1FRXA 1APSA 3RB3A 1WG5A 4WYLA 2BKPA 3MD1A 1J5EJ 1EIYB 4JI7J 2FLNA 3QNWB 5ETKA 4C8ZA 4Q2LA 1XMQJ 2IAJA 3KLGB 1ZYQA 2NQPA 4OI2A 5B0FA 2Y1LB 3IG1B 3LTOA 3RRKA 4N77A 4DV2F 2HQCA 2MGZB 3VR1A 3U7JA 3P6YC 5J2NA 3BBBA 4U96A 3OXGA 2Q1LA 1WD6A 2QX0A 3K58A 2DGSA 1EARA 4JV0A 2C22A 2VG6B 4KFBA 3GFXA 5IQ6A 5HBMB 4GMKA 3W2VA 3CCZA 3LP1A 2QGFB 3UD3P 2DH7A 2MLYA 4J9QA 1S6QB 3HHLC 3NS6A 5HJYA 3KK1A 1VJQA 2JZ5A 3JSMA 4LIWA 3DLGB 2CVIA 1QSYA 3KKFA 2HVZA 1DAXA 3IXQA 4IO9Q 3RTVA 2P5VA 4KO0A 4TLQA 2GC8A 1FFSB 2EG2A 3HSZA 5F0WA 1TK0A 2HK3A 2ZVSA 1EB0A 1VGYA 4ZKAA 1RTDA 5E41A 1AROP 1WOOA 2N82B 1WC3A 3QGHA 2B9WA 5KOXA 1F5AA 2AZ3A 1JLEB 4IKAA 2ZH9A 1LXJA 2XNRA 3CDWA 3BQ1A 1OSDA 2JEJA 3VAIA 1F6TA 1T9WA 4LQ3A 1IBMF 3H8YA 2W2PP 3HULA 4ER8A 3H5YA 2M7SA 1FWPA 4H4KA 1HWJA 4LF6F 2Z2MA 2H51B 2V4JB 2QTWA 4Y2KA 2DYAA 4FF4A 3DDNA 2QN6B 5KG2A 4YHHJ 3NCPA 1I5OB 4K4ZA 1NLKL 2ZZMA 4OZ1A 3TW0A 2XI2A 2QL7B 1GXLA 3DLBA 2XMTA 1VJWA 3R9LA 2XG8A 5KT2A 5EUHA 1L3SA 1WC1A 2C2OB 2PMZD 3MMBA 5CYMB 3A1YG 1S9FA 1JXLA 2WW8A 5T7LB 2IRYA 4HEA9 4MK8A 4AE5A 4K4UA 3W9JA 2W4DA 5JVGQ 3HHLD 2XGPA 1U49A 4ZCMA 4A8MP 1CJUB 1S1XB 3FBBA 2CQ3A 4CO4A 1S9EA 4LRCA 5H9FJ 4FXDA 2UXBJ 2O5DA 3UCGA 2PT0A 4NMLA 1DQ8A 3I96A 3K8WA 3VGTA 1QAYA 4KHMA 3M1VB 2JX2A 4NA1A 3BO4A 2FVCA 1T3OA 3J7A1 1MMDA 1TZ0A 2HRYA 2A1BA 3NXZA 4DZ6A 2YKMB 4ECVA 4S0MA 3CCJS 4DN0A 1N48A 4C11A 2FJBB 2K06A 4B3RJ 1IKYB 2XMVA 1T95A 4DOZA 2AEFA 4J91A 3OR2B 2MKYA 3HLUA 1JJHA 5HJXA 2R8JA 3LPYA 2DGTA 3S8SA 2V8HA 3VAHA 1ZPVA 2BE2A 2E7VA 4DUYF 1C1BB 1XTZA 2POKA 2RUSA 4HT7A 4LSNA 1I3OB 3FFIB 4RW8B 1B64A 4E2FB 1HNVB 2LQ5A 3B8HA 3KHGA 3WC0A 3MECA 1VQ4S 3CMQA 5HK4A 2YQ0A 1RT2B 2VICA 2R9LA 1JLQB 1RT3B 5B0EA 1TKTB 1U1KA 2V69A 5K14A 3PO4A 1TL5A 1U25A 5LT5A 1CVJA 3N5FA 3NMAA 1W25A 4QWAA 3PJ9A 3G96A 1Y0HA 2UU9J 1U1PA 4DL4A 2MJNA 2WONB 4MK7A 4NX9A 3DU5A 3D0HE 2WRMA 3W5ZA 2P9CA 1OYDA 3CJ2A 4GKJF 2PGCA 5IWAJ 3UWTA 4LF5J 4U8YA 4OFZA 1N33F 1HMVA 2YY3A 1N36J 4RNNA 2XI3A 3M8QB 1K9MT 3C6UB 3M8YA 4LFBF 3NNCA 3FZ2A 3HSGA 2Z2YB 3CT9A 2JFDA 1FTRA 1VDHA 3W5XA 1QE1A 1WTBA 2QA1A 3NG8A 3IBCB 4DPXA 1B99A 4ZPDA 2YKQA 2HEKA 3PNIA 4DZDA 3G6YA 2PN6A 2UV8G 1GTEA 5A8RB 2VPYB 5J2QB 1RT6A 2ZOGA 2CQ1A 5D4OA 3MXHP 3N5BA 2J9DE 1YITS 3EE3A 2XCPA 3GLJA 3OLBA 1PAEX 3W65A 3RJMB 5A8WB 2BR0A 4DQRA 2HWTA 4ZVOB 3NGKA 4NLPA 4YR2A 1FK9A 4B02A 1IKVB 1M5SA 2H5EA 2DNQA 1KDNA 3ETOA 1FWLA 3EPGA 2N4CA 4QIGA 4DR6J 3KYLA 3U1LA 1SJFA 2FTRA 2ZH5A 3U27A 4DV0J 1Y5NB 4X4QA 1XMBA 3PYFA 2NXNA 2B6AB 4NYZA 4Q8FA 2MY7A 1KEKA 1HBNB 1HA1A 3W5YA 1EETA 1FJGJ 2CPFA 1J5OA 2HQ3A 3QO9B 1S5ZA 2K3IA 4L74A 2NR0A 2I1RA 4ED4A 4X62J 1BQNA 4KPCA 2FZCB 3D0IE 1ZAWA 3BEGB 2DGQA 1VLYA 1PC4A 5IXUA 4RUCA 4J9PA 1D9DA 1MWYA 2WB4A 2LXFA 3PHEA 2LU1A 2CQGA 1CJKB 2M8DB 1WSVA 3BSOA 4HH0A 2VODA 4FYWB 1RP5A 2FY8A 4ZITA 3DOMB 2MQLA 2G1DA 4LBHA 3PEHA 2VKZG 1D1UA 3TX8A 4NL5A 2QFIA 2FHJA 3ZTSA 1G6BA 5HP1A 2AF6A 4DCPB 2B5JB 9ATCB 1LOUA 3K0JA 1DTQB 4URQU 2DNZA 3PIOQ 1HHSA 3T1HJ 2BM1A 2K7KA 4Z2XA 4LRAA 1JXVA 2BJEA 4C97A 1FX2A 2XS7A 1HHTP 2B4PA 4NCGB 4QR0A 2PE8A 4MYTA 1R89A 3T5LA 5LJ5Y 3OJUA 1MN7A 4CLYA 3DN9A 2Z30B 3GILA 4HTJA 1GXTA 2HAFA 3CCUS 3GCXP 2DHGA 2CJQA 3UN3A 4I4BA 3C14B 2YKNA 2CPZA 3QGPA 1UZHA 2OTLS 1TK5A 4Y2IA 1QTNB 1QJHA 3GJQB 1CJTA 3H20A 3UDLA 2EPIA 1X5OA 3M05A 3DRRB 3PW2A 3MM9A 2PO4A 2E66A 5KG7A 2BJ3A 1BQMB 4LF8F 2DITA 3T1AA 1S76D 4OHXA 1NK9A 3MEDB 2IBKA 4NLRA 1W2IA 1RTIA 1F3VA 4LMZA 4U67Q 2CADA 2D3O1 4YY3F 2M3DA 4KB7A 3CDBA 3G87A 3R1LA 4DQPA 1UWBB 3FQKA 2PEBA 4PG5A 3T41A 1J5EF 2HBRB 2CNNB 1Q5YA 4CLWA 4JI7F 1FFWB 3OFHA 3EZUA 1XMQF 4OI1A 5C7PA 3SCKE 2CPIA 3TEGA 2Y1IA 4DV1J 1BWEA 1U45A 4JV1A 4C9DA 2J8AA 2AGPA 3R5BA 3UVJB 5L39A 3D54A 2CQDA 2YWHA 2HGNA 1RHRB 1FKAF 2KRBA 3J80Y 2J0SD 1U6BA 2DIUA 2P6TA 3E01A 5KG1A 4JB8B 3H4DA 3HJFA 1NSKL 2ZUAA 2BUNA 1BXNA 3BREA 2HAIA 1SV5A 2FJDB 4RBUA 2BVZA 2IC3B 1KR4A 4F0HA 2J8SA 1NJWA 1YRXA 4TQSA 3CB4A 1S4FA 2OLWA 3NOCA 2QT7A 2C3UA 4K50A 3I0SA 1CPZA 5IM0B 3N6LA 4GC7A 2UVUA 3OVAA 3AJDA 3KK2A 4NI2A 3EICA 3VALA 3R5JB 2GV1A 1UEUA 3Q2TC 3WIVA 5HLFA 5HL7Q 3G9CA 1T9YA 2YH0A 1M90T 5ETLA 3CF5Q 4CZCA 3HHKA 1S99A 2HRTA 5SZTA 2FJEB 2R7RA 1CS4A 1SC4B 3DLJA 4DV4J 1B0VA 1X4AA 1QSLA 2ZJRQ 3U1MA 2NUUG 3D2WA 1WI6A 4YUDA 4FYXB 2V0NA 4ZIWA 5I3UA 4FXVA 3JYTB 1B4SA 4ECUA 1TU0B 5GADI 3DMJA 2HBZB 4L72B 1M5OC 5HMXA 4J90A 1B0PA 3K7RA 3HPOA 4TY9A 4URGA 1S0VA 3TR5A 1HPZB 2CPHA 5HO4A 3E3XA 4YHHF 5C24A 3HT0A 3K5LA 1VIXA 4ECQA 2AIRB 2AJQA 2A10A 5HROB 3QT6A 3FSXA 5L8RC 3I9ZA 2HGLA 5BJRA 1OY6A 4QWDA 2OEKA 1LEOA 2XTJP 3A13A 1VC5A 1JLCB 2MSSA 2XWYA 1WHYA 3IFEA 5IT9Y 4IFYA 4RKUC 1TFYA 1RGVA 3SCJE 4F4AA 2J0QD 1S0OA 4AT1B 4BC7A 2AP6A 1FJCA 5F0UA 5HVHA 3AD9C 2UXBF 5FDLB 1RE1B 3KLHB 1Y3JA 2C2MB 4Y2MA 3M6UA 2JOQA 1HBUA 2QC3A 3DLLQ 4DV5J 1QAXA 2LQ9A 1SUQB 5LM7E 3O2IA 2E7WA 1X4BA 5KFTA 1RCXB 3LP0B 1IXKA 4G1IA 3DU6A 3MR3A 3I55S 4LREA 2D3ZA 4ED3A 4L6V3 4B3RF 4EWTA 4ZPBA 1PYSB 4LRFA 1FRKA 2WOMA 1U1QA 1U4BA 1VRUB 4F2RA 1RT7A 1HNWJ 2RF2B 2YNHA 4ZVPB 3EVOA 1GTHA 4N47A 1UJ4A 1S6OA 3AB4B 1H3DA 4ZVFA 1WNEA 3AAWB 5L1JA 1D0EA 2ASYA 4WK1A 4WKYA 3OR1A 1AZSB 4QYRA 2XLIA 3TZZA 3M32A 1WKKA 4WP3A 3PRDA 3E2EA 4DUTA 4HH1A 4EZ6A 2YNIA 4KH0B 2YKAA 2XNQA 1H7XA 2JRSA 1NK8A 3DI6A 3HP6A 4B3OA 4ED8A 2J0XA 4C2MA 2ZH7A 1XR7A 2D7SA 2JFKA 3QAEA 2RQMA 2VQEJ 3W61A 4H4OB 4WCEQ 3GIKA 1C1CA 3QT7A 4FYVB 4RW6A 2LCWA 4BS2A 4XO0A 1V9OA 2AGOA 4H4KC 4QPTA 2GA7A 2XZTB 2P9GA 2UU9F 2RDIA 2ZWOA 4PZVA 2Z8QA 4ZOSA 3G82A 1R8BA 3C2PA 1YZ7A 1S1VB 4ZPTR 1J27A 3O6QA 2FZGB 3IN5A 1L3KA 3MUVP 2B51A 1QVFR 1OWXA 4ELUA 3MMAA 2APOA 3G8TA 2E29A 2RJZA 2QIFA 2DGXA 2J9CA 3C15A 4WP8A 1N88A 1S79A 5KOWA 1HBOA 5IWAF 3EZ5A 4LF5F 2KXFA 1FD2A 3C8YA 2IVYA 1TL7A 3OVSA 3RYLA 4YDXA 4NLOA 1N36F 2OMOA 3KDNA 3TQ1A 5J2PA 2YWFA 4ID5A 1RU2A 5HN0A 1NBEB 2LA4A 2VUGA 3HVRA 4RJVA 2HURA 3MD3A 5DG7A 4ZHRB 2HMIA 3G71S 7FDRA 4PUOA 1HWIA 2L41A 4Y65A 3KLIB 4J9LA 3DFEA 2W2OP 1HKAA 4OI4A 4RW4A 3HVAA 3LW5C 5KFSA 4FXWA 4DSJA 1RTZA 1AFJA 4MKVA 1O6XA 2CXEA 2KVIA 3ULHA 3JTNA 2HFUA 2J9EA 1VQ6S 2BW2A 3I4HX 3EDQB 1H6KX 2JWNA 2VA3A 1WHXA 3CIMA 4DSFA 2J7WA 3DOLA 1R7IA 2K1RB 3ELHA 1BGXT 3OPKA 2BE7D 3Q8UA 3GJSB 4CIOA 3DHXA 2V8GA 4DR6F 3L7OA 4CYUB 5LSRA 4O4RA 4CQ1A 2VKRA 4DFKA 1N5YA 4DV0F 2KH9A 1R0BG 2EFNA 3J7YU 2IRUA 2PFFB 2MHEA 4KY3A 4ZN3A 4O44B 2VQFJ 4UF4A 4M5IA 4ZDNA 4BCAA 3OTBA 3TAMB 4DCOB 4IFVB 1FJGF 2UUTA 2LDYA 4X64J 2M70A 1TKZB 2HLUA 3I5AA 2J7KA 4X62F 3EZOA 1T94A 2FC8A 1TR0A 3L7UA 1H7WA 4DF8A 4YB7A 2NSBA 3VV2B 2MQQA 4DV7J 3MEGA 1FA0A 3TUPA 3CDUA 3QRRA 1GNKA 3CVKA 4ZK7M 3SFUA 1NHUA 2NS1B 4UZCA 1NJZA 5F8HA 3GV5B 4NMXA 4PWWA 3F73A 1X4GA 2IM3A 1YRUA 3D1HA 2Q3PA 3D5MA 1D3WA 1ZTTA 2H48B 2RQKA 2X3DA 5DQGA 1GQEA 2BYCA 3CD5A 3SFGA 1NDLA 2DGVA 1NU4A 5AE1A 4EEYA 4LSLB 4AUKA 1V3SA 1WKLA 3M2VA 1QSSA 2VPZB 5IOLA 2V2QA 2MXYA 1NKCA 3RAMA 3OV7A 1T3NA 1GXUA 2VHGA 1NCLA 3PHTA 4GO5X 2PIIA 3FRYA 4UQGA 3GONA 3CC4S 1ZAXA 3BJYA 2A6OA 4KTQA 2PMWA 2L9DA 4B17A 4DQQA 4PQUA 2Y1JA 3W9HA 3MM5B 1SKWA 1RWWB 4OHVA 2BRLA 1WJ9A 1Q1KA 2C42A 2W8KA 4DSIA 3UDCA 2PA8D 3KK3A 2W2QP 3WIUA 1OYEA 3MPVA 2QFJA 5KT7A 4N8OA 3O44A 4DL5A 4I68A 4OX8A 1T11A 3OTDA 3A8EA 1QD1A 2W1BA 3HSJA 2G4BA 3M8ZA 5D4NA 4LBPA 4RBTA 3J81U 3MR7A 3G6XA 1KTQA 1G7CB 2CUYA 5CCMA 3WQPA 1OPZA 4CO1A 4WU2A 5CYJA 3FSYA 1RAIB 2HK2A 3IM9A 3OSPA 4YR0A 4DV1F 5HMWA 1OY8A 1HBMB 4F4XA 1HQUA 5GMEA 5EHHA 1RU1A 2DVIA 3D6HB 5I42A 3RBDA 4Y0FA 4PR6A 8RUCA 2FIUA 5FJ4A 4HL9A 2DR9A 4M5DA 3UN5A 1WOSA 1YG0A 3C6TA 1EKRA 2P2CB 1HD1A 1EZZB 2H4YB 5DGBA 3G86A 2Z58B 4USTA 4GVBA 2JC0A 3KG4A 5LL6d 1N5QA 3M2UA 3ZXWA 3I31A 2VFVA 1U2FA 4JI3J 3T1YJ 2ZH4A 1C2PA 1KTVA 2BANA 3B4DA 2OPRA 2NXUA 2KZMA 2XY5A 4EO6A 1RKIA 4H4MB 5E3RA 5KFIA 4ZJQA 4WXOA 3DOKB 1YBUA 2CPDA 1ZM9A 4ECXA 2BDPA 5L9XA 3JSBA 2E5GA 2ABYA 3IC1A 2DBBA 1RQ0A 1D9AA 1E6YB 2F9JA 1DLOB 4O0NA 3W62A 4DV4F 5HQMA 1UVIA 2GJ2A 4NWBA 3TZXA 2NREA 4TN2A 2HHUA 3OVBA 3IWXA 4EBEA 1ZM4A 5H9EJ 1SJ1A 2RVJA 3TNVA 2N7CA 5HAOA 2DY1A 4YB5A 3LF0A 4MAKA 2E1CA 1IKWB 1HNZJ 1VQ8S 3J7ZT 3M6VA 4GC6A 2I0XA 4J9KA 4QW8A 2MZSA 1MROB 4WIIA 3HX9A 2YPZA 4LR7A 1NEEA 2O01C 2OIHA 2JLEA 1W2BR 4FN5A 5LSOA 3H2VE 4AYBD 4BBYA 1UA1A 3CWJA 4CH0S 1RWMB 3E51A 5E5NA 3MUMP 5HI7A 3PW5A 3GTYX 4R0EA 4HACA 2BXJA 1F1BB 2EK6A 2LU2A 1JLGA 2A3JA 1REVA 3SDEB 1S6PB 4A8FA 3GPAA 2EKNA 4A8OA 3CC7S 2JJ4D 1RBAA 2FHJD 4PXCA 3UR3C 2ZNZA 3GFZA 4P52A 3TA2A 1PSDA 3W2WB 1UFKA 4OYXA 2ZD1A 4DV5F 3PCOB 4PXDA 2Z2LA 3C3LA 1SH3A 1I6JA 1OMSA 2CPJA 2P8IA 4FF3A 5F8LA 2F7VA 4M5KA 2FGOA 2D3OR 4G1PA 2RQCA 1L5UA 3K57A 1EQ0A 2HWHA 3PFEA 3GJTB 2I38A 3H59A 4JI2J 2X1FA 2OFGX 3NWRA 1HNWF 1RXOB 1RBLA 1SH0A 2DNRA 1RA6A 5D0RA 1YLXA 1GX5A 1RWKB 2RNEA 4E0DA 1NO8A 1PAUB 5IT4A 1WACA 2DH8A 3WBZA 1GEHA 1RT1A 4PKDB 5DLGA 3UN2A 3AJ1A 1UP1A 4I69A 4JI5J 2D74B 1X9WA 5B0AA 1K8AT 4CLUA 2ZE2A 1A9NB 2OELA 1M5VC 3C46A 4LF9J 4I67A 1WG1A 2FJAB 4PXBA 3BQ2A 1IVZA 3BGFA 4OZLA 1N54B 3DLKA 3BGUA 2VQEF 1N0VC 1SVDA 3KLFA 2Q79A 4J9OA 2ZBRA 3MAQA 3CIZA 2RILA 4M95A 1BMQB 2D9PA 2JLFA 1U09A 2B4VA 2Y3YA 3L3CA 1R0AA 5FD1A 1OJ4A 2RRNA 5DDRC 5A0YB 1Y7PA 4P2FA 1XNQJ 4FZVA 2DRBA 1RT5A 4F0MA 3M30B 1ZZFA 3R5CA 2D1CA 2WSEC 5MLCV 3I0RA 3LPEA 3LAMA 4A48A 1UZDA 4DV6J 4F4YA 2J76E 4NLQA 3U02A 2C2DA 3QMQA 1RAHB 4IG3B 3TJ9A 1HYSB 5AJ3J 2Z57B 1ZOTA 1FT8A 1S1WB 3OT9A 1Y4ZB 5D0EA 2BBEA 1KC8T 3FSIA 3A12A 2IA0A 5BYSA 4OZ0A 1H73A 2PI5A 1YVFA 3QGIA 4M5LA 4PAAA 5CCLA 4X4UA 4U7UK 4ZJLA 1WDDA 3DM2A 2DXFA 3G2XA 4OHZA 3SQOP 1Y00A 2GMJA 3UO0A 1EP4B 4MKBA 3T6BA 3OL7A 5F41A 2MJUA 3HVTB 5D15A 1UVLA 4XTTA 3RRGA 1AT1B 4O3NA 2W7AA 3POTA 4HYKA 4ES1A 4HVZA 1PGZA 5KG4A 3OHBA 1WC4A 4NLXA 1R8PA 2RAQA 5CABA 3M6XA 4QYZK 2Q6CA 2A2CA 4YDDB 4YP3A 1RABB 3PYDA 2AT1B 5J2MA 1S59A 1NDCA 2N3LA 1B3TA 3D4JA 4JV5J 4DG1B 4WBFA 3KG1A 2I8EA 3EGNA 3MAHA 5AE3A 2YXLA 3S6EA 1Q7YT 1U1RA 2GGPB 1OQ3A 3CCES 2KL8A 3CJ8A 1JX4A 4OZNA 4G3IA 4A46A 1FKOB 4FPRA 2KT2A 3CJ0A 1XN9A 4PWDA 4ZCKA 2VQFF 4UTGA 2JEFA 4YR3A 1JB0C 2RUGA 3IGVA 4KYZA 3HZGA 4I6WA 1TL1B 1TL4A 3GFYA 4X64F 4ECRA 3LA0A 2BQRA 4B9TA 2EKYA 3H5UA 1KLMB 4RL1A 1FI4A 4DBQA 3BPDA 5BYQA 1H2TZ 3VGSA 4IH5A 4DV7F 2ZDPA 4I2QB 4K4SA 4EYIB 3B4MA 1A6LA 3WZ0A 2G1HA 4EK2A 4USUA 4USIA 1HI1A 3KLGA 1MLAA 2IA6A 5KFLA 2F8HA 4JYAJ 3IG1A 4YN3B 2MGZA 3GIJA 1GT8A 5H1SV 3OL9A 1GH8A 4X4SA 3H2UB 1RHKB 1VK8A 5LSLA 4FS1A 1BLUA 5J1PA 2GX8A 1DARA 4ZP6A 1X0PA 1LKZA 3MFHA 2UXCJ 2ZEJA 4TY8B 2VG6A 1FEEA 3TWZA 2ROEA 3VGVA 3JQJA 5HBMA 4NLDA 1U8WA 2YX1A 2W9AA 3TZWA 4NXNF 1S6QA 3I87A 3B78A 2FD2A 2NXJA 3DLGA 1V6HA 2FLPA 1RT4B 5A6WA 3VZIA 3QQCD 1HWKA 4RW7B 3JQKA 4LSZB 2YNGB 4ES2A 4OZJA 4EI2A 4Y2AA 3J7Z5 1MG7A 1FO1A 1VLOA 2A2DA 4KIAA 1M1KT 1HQ2A 5GAHU 1JLEA 5A6PA 4IRCA 1VQOS 2XB2D 4CTAB 4K7QA 2F40A 1C4CA 4HLBA 3V2UC 2R8KA 4OZ3A 1IBKJ 2OGUA 3HXMA 4ZVSB 1PYOB 5D3GB 4OV6A 1IKXB 4F26A 2OKQA 4W4MA 4O3QA 2V4JA 3M8WA 4DFPA 4LR9A 2CQBA 1KKHA 3KDOA 2QJ3A 3DGPB 4RNOA 1Q82T 4CO0A 2MQPA 2U1AA 2ASDA 1B0TA 5CYMA 2RS8A 2L48A 4MK9A 5T7LA 3BDPA 3DRSB 4M63A 1YJRA 3GIRA 4J5OA 1AXQA 2WAQD 3O8WA 2B7CB 3VCDA 4FBTA 2FY1A 2H3EB 4PCQA 4JI3F 3T1YF 3G4SS 3V81B 3QYYA 1CJUA 2RS2A 1S1XA 4BC9A 1NNDA 2QLBB 4E98A 2E1MC 2ZH8A 1BUXA 2RU9A 1O5JA 2E1PA 2DISA 4OZ5A 1VS3A 4J9NA 2RIJA 4U6PA 1OY9A 4WXWA 5JXSA 4DPWA 3M1VA 1T9UA 4V19X 3TAPA 1H2VZ 1VBXA 4DLEA 2YX7A 4NZ6A 4B9MA 4F25A 5DDQC 2YKMA 1XR6A 3FEYB 1JIHA 3AXKA 1A0OB 4ZN1A 3X3UA 1NMEB 1IKYA 1RHMB 3VAJA 4OL8A 3JSRA 3IBFB 4U9RA 3PZPA 4QIFA 5GAEI 1U1OA 3OR2A 2PFDA 2DNGA 4DPYA 2F4FA 3QJJA 2B7BB 3ZZPA 1VQMS 2PEHA 3PX6A 2ZWPA 4DU7A 4QU7A 4P2SA 4DR1J 3HSDA 3N9UC 3OTCA 1Q8KA 1HNZF 1C1BA 4DV3J 3TRGA 1KVKA 2X51A 1T05B 5A8KB 2DNHA 2ZJQQ 3FFIA 4RW8A 1JJCB 1F60B 3JAMU 1HNVA 4M1KA 2OH2A 1T0TV 4NASA 3LAKA 4DJBA 1YRTA 4MKAA 4F3QA 1RT2A 5D0HA 2OEJA 3WDOA 4Q43A 4AD6A 1Y3KA 2VPWB 4EBDA 3Q8YA 3W8PA 4PYAA 2HBQB 1JLQA 1RT3A 3R2DJ 2L08A 5CAAA 3AFGA 1TKTA 4I1TA 4O3RA 1HI8A 3CSKA 4KR0B 2WCXA 5FIIA 1N52B 2V63A 2DHSA 3BO2A 2A6MA 3PJWA 3BO3A 3FMWA 4RW9B 2IVFB 1Q53A 1VQPS 1RAJA 1KD1T 1TV6B 1FWKA 2WONA 3G6VA 1NUEA 2LFVA 3SMZA 5LJ3Y 2AJ1A 5T14A 4FS2A 2ATCB 2HWIA 4X2BA 3UCZP 3TI0A 2ZHAA 5LOQA 3MOZA 4KE5A 3ISZA 2J9DA 2MLZA 1S1TB 1VQLS 1F2GA 3FCWA 4HTIA 4JI2F 4M5HA 2M88A 2RKIB 1UKUA 5L1KA 1LW2B 3M8QA 2HQGA 3C6UA 4O3OA 1E6VB 4YS2A 4IOBA 1D9FA 4B3MJ 2YWKA 1OPIA 2B43A 4OX9J 1FJ7A 4JI5F 1VYAA 3VAGA 4FKYA 1FERA 1KBRA 4FKXA 4WPAA 4CI0B 2QLXA 2H5JB 4CRJA 4LVNP 1AW0A 2EBEA 4LF9F 2PMHA 4KC5A 2DGOA 2V4RA 5KG0A 5A8RA 2ZDOA 4LT6A 1XJWB 4M5JA 4U8VA 5J2QA 3V6KA 3TOQA 2W9BB 3CJSA 3M8PB 3OL8A 1HW9A 4UOGA 1X0FA 4C48A 2X1GA 2JH3A 5B0DA 4KV8B 1VRTB 2JSXA 4PPDA 2LA6A 3Q89A 5B0GA 5A8WA 4ECWA 3K5NA 4L76A 1RUSA 1IKVA 1XNQF 2DNKA 2VU5A 1N5SA 5H9FK 5CHCB 1RBOB 4F0KA 3IRWP 3N79A 2OPQB 3QPIA 3GE9A 3PACA 4CNYA 2DNNA 4DL3A 1IN0A 4NZ0A 4DV6F 6AT1B 2GFFA 2IMOA 3TVZA 3HHNB 1K73T 5AJ3F 3QZ8A 2KG0A 1NJYA 2B6AA 3HJVA 1UFLA 3PKMA 1Y11A 2D3UA 4X4VA 1HBNA 2G2ZA 3MCSA 3GG0A 1IBCB 1CJVB 2FVPA 3QO9A 3MPWA 3OTOJ 3EJMA 2XMUA 1YQHA 5KG3A 1YHQS 3PM9A 2ACMA 5RUBA 2FJVA 1WHWA 3Q22A 4X4PA 3TANA 3HT3A 4Y28C 4O0IA 1PJ5A 3A3PB 1IM4A 4FF1A 1CJKA 5HVFA 3CJQA 4C0BA 3GSIA 3UDVA 2LMIA 2M2BA 1S10A 3ZC4A 3ZTPA 3DOMA 4JI8J 3NL0A 1N32J 2Z0GA 2O66A 1ZA2B 4LF4J 4J9RA 4IR1A 2AZ1A 1FE4A 1RT7B 2B5JA 2CQ4A 1MMNA 1DTQA 4WFAQ 4LBIA 3B54A 2ZH3A 2FJXA 3R27A 1X9SA 2VBWA 1AUDA 2VFTA 5HVGA 1AFIA 2IM0A 1FD8A 2BOPA 1NM2A 4U95A 4NCGA 4USJC 4O3PA 1PYTA 1KHVA 3FNNA 1GMUA 2VG5B 4LRBA 2RQ4A 7AT1B 2KJVA 3PG9A 4CM2A 4JV5F 7FD1A 5F8GA 1NK5A 1KFDA 3TJAA 1BWVA 5ETNA 3ZZOA 3V6DB 3C14A 2MYFA 1K0VA 2J7UA 2VV5A 4OI0A 3CGIA 1DHMA 1S48A 1RI7A 2FQQB 4ZA1A 3ICLA 4ENOA 4BWMA 5KT4A 5E7OB 2KM8B 2DEIA 3OD2A 1U2CA 3RUBL 4QIWD 3DRRA 5K5MA 1TAQA 2DR5A 2HG4A 4DU8A 2W01A 2GNKA 2PDAA 2ZHOA 1BQMA 2GJFA 1NPRA 4WTYA 4DFJA 3MEDA 3P8BB 4KGXB 1GMWD 1FKPB 5IC6B 1UA0A 3IR6B 2M9KA 2IRXA 1UWBA 2VF3A 4Z7YA 1MWZA 1UL3A 5KT3A 2NSCA 1M1GA 3THPA 3DRXA 3GIIA 4C4WA 3SQGB 1RTHB 3CJ4A 4MKYA 4A8KA 2BZ2A 3OFFA 2KT3A 1S57A 3VQSA 4JYAF 3UVJA 5IZHA 1X4EA 1LNQA 2QLWA 3W7BA 4RNFA 2NCKL 3IA0A 2DHXA 1XWLA 1X5SA 5GVQA 4M5GA 1F3FA 4WIQA 4O4GB 2AYBA 4P71A 3OJSA 5DS7A 2GAHC 3DDIA 2UXCF 3PW0A 2JEGA 1JXEA 3RW6A 4CP5A 2DNPA 2IC3A 2UUCJ 1S0NA 5M2PA 3KLEA 5KFQA 4KAIA 1FF2A 3P49B 2R2RA 1YJUA 2KVQE 2HNDB 4JI6J 1F9FA 5KFZA 3NY0A 2YKPA 5IM0A 5GAGU 2MQNA 3OHAA 5CD4A 1S72S 4BDPA 5G4DA 1FXDA 4LRDA 3MM8B 1NH8A 3BR8A 1RSCA 2ALYB 2IJFA 3VAMA 2ZVIA 3CJKB 4Z37A 1B70B 4F02A 2KU7A 1Q86T 3AQOA 3KNGA 2GVDB 3KOAA 4OJ1A 1YJWS 1CC7A 2UUBJ 3MEEB 2AMCB 3MM7B 3NBPB 2XZWA 1K0TA 2FVRA 1IBKF 1X8DA 3LP2B 4DUZJ 1WC5A 1TAUA 3PR5B 3JYTA 2DPJA 1XBWA 1NJXA 3BYRA 5I3QA 3OW2R 4ID8A 2ATLA 5JVHQ 1HPZA 1U2RA 3IO1A 4XK8C 3IWLA 1SJRA 5FLXY 2H5IB 1YX2A 2L9NA 2EG1A 2XEXA 4DDFA 5HROA 1IQTA 2HGMA 2V34A 3BGLA 3MGJA 1Q78A 2V2ZA 4IUFA 2EC0A 1N8RT 3CD7A 1RAGB 4Q0BB 4USWA 3Q8PB 4KT0C 3QFHA 2EK1A 1EHWA 3KJVB 1JLCA 2OJ3A 3KXDA 1ZPWX 2PC6A 4IQXA 1GMVA 3GG1A 3CULA 2F8MA 3W9IA 1ZTWA 2HVEA 4P6QA 4UW2A 5HMYA 3OXFA 3J7AN 4AL6A 2DH9A 5FDLA 3KLHA 3CDEA 4UOCA 5F3ZA 2GIQA 1HL6A 4GVLA 3NAIA 1P1LA 1SUQA 3AOAA 1FEHA 5LXYA 2LEPA 3NGTA 2P6SA 2HFZA 1JLBB 5M2UA 5CZVA 5E3CA 1S7IA 3KMSA 3TQEA 2UP1A 1ZS6A 1T9XA 1K1QA 2CJKA 4ECTA 4IOAQ 4NYOA 3QFWA 2J5AA 4OLOA 2MDAA 2ZBPA 4B3TJ 1B7YB 5AXLA 1XR5A 2BJ1A 2KM8C 2OHDA 2KHCA 1VRUA 2C1EB 2XM3A 2FHKA 2RF2A 1DBDA 4Q8EA 3NP5A 4DR1F 4V1Ak 4WFBQ 4USHA 3LWLA 1RWOB 1S1UB 3NNAA 3HM9A 1LWEB 4K5RA 4DV3F 3ILJA 1Q79A 1AZSA 3AT1B 5F9LA 3K8VA 3H0PA 3FUYA 1OSCA 4NLSA 4TYBA 4DSLA 3MFIA 2XS2A 2W4PA 3NLCA 2DCUB 2JVRA 4MFBB 3OLAA 3OUYB 4CLLA 1RISA 4K5SA 1X60A 2WB1D 2MHNA 3ETMA 2AW0A 2F65A 2R8GA 4IDKB 1HNIB 2XHWA 1DTTB 3MCMA 1M5PC 2I5JB 4H4OA 4LF1A 1TUVA 3KJFB 4KGKA 4B9NA 4ZP9A 1QAIA 1WI8A 4CT9A 1S97A 3ZZRA 2CIMA 8AT1B 3JS9A 3IS9A 2ZITA 3ITHB 2V8PA 1Q0NA 5C25B 1BE4A 5K9FA 1S1VA 3L7PA 4OJHA 3FDSA 1P9QC 1SL0A 4FYYB 1ZETA 4EUVA 1H74A 3WX8A 4IRDA 1XERA 2ZZTA 4UUWA 3FK4A 2ZZNA 4WFNQ 1H2UX 3SI8A 5KFYA 3RRHA 4TQRA 1QDUB 1X4CA 1UVJA 3DC2A 4JI0J 2V9WA 2W4CA 4B3MF 5I4MA 3QGGA 2X1BA 4OX9F 5DZ7A 2MQMA 1Z4UA 4BLGA 2RB7A 2XHCA 4ZHRA 5LMNJ 1KN6A 2CA9A 1DY3A 3DRPB 4K0KJ 2ZJPQ 4W98A 1T03B 3NEKA 3QIPB 5JJBA 4OYMA 3DLEB 3V6HA 3BH7B 4C8MA 2XGQA 5ETVA 1KOOA 4EMDA 3M8SA 5D77A 2V8VA 4L75A 2AKWB 4TXSA 3B6BA 3ET6B 4I6YA 2E7XA 4DX8H 4KQZA 4WE1B 4Y6IA 3QLHB 5ITHA 5D8HB 5U47A 2EW9A 3PW4A 2DD8S 1UPMB 1Z1ZA 4ED2A 2DXDA 2K1RA 2Q6BA 4OYWA 4NZ7A 1TKDA 2MZJA 2AHOB 2QE5A 2FUG9 3Q86A 4CYUA 1NB7A 2XY7A 3JXOA 1B7FA 1G4CA 5KFBA 1TQLA 4O44A 2YH1A 1YKWA 1REVB 1FVQA 2GW8A 3MM6B 1KNZA 3RB0A 1JLFB 3TAMA 4IFVA 3EGVA 2ACYA 1CLFA 2FHOB 3Q8RB 3I4PA 2IM2A 2R2TA 3HMJG 1TKZA 3OTOF 1P1TA 1VQ5S 3IR5B 3D6TB 3TA1A 1O51A 2OPPB 1ZAVA 4M5MA 2ERRA 3KUGA 2NUHA 3HFKA 5GMKa 1SB6A 5A76A 4ZLNA 2CQHA 4HDGA 1R6YA 2B4UA 3TJ8A 2AEJA 1P9YA 4JI8F 1N32F 2VC1A 2HRUA 1RTJB 4C8YA 1HFEL 1TL3B 3TA0A 4LF4F 3MPDA 4YB6A 4N56A 1U1NA 2MSTA 4DL0C 1PJ6A 1I1GA 3FJ2A 2IBOA 4LSLA 1P8GA 3SZ2A 3H5SA 2V4QA 3BB5A 1S0MA 2RRAA 2Z56B 5C42B 3RBXA 2VDHA 3J81Y 3THVA 3BS9A 1QTMA 3H40A 4OX7A 4F50A 2RDDA 2R3VA 2CQ0A 4Y2CA 4XDCA 2ZH1A 2HLTA 1RZMA 1NRKA 1LW0B 3HHLB 3NCRA 3MM5A 3ONQA 4Q7AA 1X31C 2HNZB 5DGAA 1U0HB 3MMCA 1X5TA 1WDTA 4CLZA 6FDRA 1UCNA 1BHNA 4FNIA 4PYDA 5MAOA 1V5IB 1IR1A 3ZO7A 4ZCLA 4NRTA 1MMLA 1NPPA 2AD9A 2RD5C 1CULB 1O0PA 2R2SA 2Z4PA 4MH8A 4RBVA 4JI4J 2O1PA 2IJNA 2N4DA 3KJNB 5KFMA 1CC8A 3Q8VA 1AYEA 3QT5A 2YX4A 1SCJB 2F5GA 1P27B 3CPWR 3NMRA 2W25A 2IPOB 1MW7A 4DMZA 4ETXA 3KUEA 5DETA 3HDSA 2DNOA 1HBMA 2WVEA 2CZ9A 4F2SA 4ZIVA 2Y8YA 4G65A 1TVRB 2R2UA 3D28A 4I7FB 1NK7A 5G0RB 3JQMA 2V8DA 3RR7A 3KJQB 2ASLA 2XYHB 1F9EB 4ZPCA 4OI3A 3BGRB 1JK9B 4C7QA 1PO6A 2UUCF 2G13A 2V67A 4J9VA 3EPIA 1S9GB 1SL2A 1LQ9A 2V50A 2GJIA 2KG1A 3CW2C 2QRRA 2PI4A 2YWGA 4JI6F 2CFXA 3TAQA 2OPSB 2OI2A 4H4MA 2BQ3A 4CWBA 1PILA 3CJ5A 3DOKA 1KWMA 5GMDA 2GHPA 1Y10A 1KLNA 1CBKA 3DNCA 2QA4S 3IAM9 4MJKA 1N6QB 1RK8A 2R7VA 4V19J 1JWWA 1JNZB 1E6YA 2CJAA 4KKOB 1DLOA 3NWGA 4DR2J 4DR4J 4ZCIA 1SC6A 4K59A 2UUBF 1F0XA 4JBCA 3UQSA 3QSYB 3PW7A 2FYXA 4DUZF 3FBCA 1Z2ZA 4C8KA 3D66A 1UEVA 3SYZA 1LK5A 1IKWA 2FZKB 1SIWB 1FNXH 1REGX 2CWKA 1R8AA 4LIRA 3W63A 4NPOA 4HHJA 4WTOB 1LWFB 2QMUB 2VFSA 2FLLA 4NXMJ 1MROA 3CTRA 3NGRA 2Y0SD 2ASJA 2WVFA 4GO7X 2KDOA 3US5A 1UWAA 4IG0B 4NOHA 2ZH2A 3UE2A 1LWCB 1XC9A 5KFVA 4RLEA 3SDEA 1C0UB 1S6PA 2VZ9A 4D3GA 3P45B 2QEXS 3IRXB 4DX5A 3UI3A 2MZQA 4DR3J 4HR2A 1NKEA 2QV6A 1KP6A 2XYPB 2IMWP 3W2WA 3H4BA 3M2RB 3KWMA 5B7WA 3EUNA 2KO1A 2IYGA 4W92B 2GVZB 3M4XA 1I51B 3TP2A 1ZZNA 2BQUA 5CYQB 4WYWA 5DG8A 2R4FA 2XSJB 2XS5A 2DJWA 4B3TF 2ALZA 5AT1B 1P6TA 4N5SA 2LDIA 4RNMA 1L3UA 3DYAB 3GP9A 2XQCA 3GQCA 2XLKA 4OHYA 4DL6A 3VQTA 1MN9A 3MUTP 5J1EB 1YJ7A 4F4WA 3OBIA 4CLFA 2YVSA 4A8SA 4JUZA 2KXNB 3R6LB 4FPIA 3CCRS 2ZOMA 5IT0A 2RRBA 4P7TA 4KSEB 3TZYA 4WFZA 1SQGA 5C5JA 4WJBA 3ISNC 5BR8J 1S6UA 2ZBIA 5F8MA 2W9CB 2UUWA 3GSDA 2VFUA 3R1HA 4ETZA 4C98A 4ZPVR 3JTPA 4P75A 1JLAB 2G0JA 2YWWA 1X9MA 3F0NA 4ELTA 4DR5J 5CA5A 4PG4A 1NHKL 5A0YA 3S7RA 2JEIA 2FB0A 2OEMA 1ZBTA 3AXMA 1WEYA 4B9LA 1Q16B 3M30A 4MYUA 1Q81T 1MU2B 2VDIA 4R8UB 5F8NA 1DRZA 1URNA 1FHTA 2HHWA 2CQ2A 2WSCC 1SL1A 1VHFA 5KT6A 5DRKA 3SXLA 2MB0B 1KVJA 4IG3A 1BC6A 1FRJA 3J7YI 3I32A 1HYSA 1KQFB 3FGVA 4X65J 3UDEA 3K5PA 2HW3A 2IM1A 1S1WA 2EFQA 1DFDA 3QIDA 5D6GA 5HQ8A 1SI9A 3C16B 4WK3A 2BOAA 5H9EK 4JI0F 3L95X 4XPEA 4QW9A 2B0GA 2QG9B 4ED0A 1RLCL 3QWPA 5LMNF 2CPEA 5KFRA 2ZM6J 2IIHA 3GU0A 3D3CJ 4K0KF 1D8ZA 2NLWA 2UV8A 2DHHA 1YBTA 1EP4A 3JB9k 2B9EA 1HIYA 2XZDB 4Q44A 3ISND 1WHVA 1PG5B 3HVTA 4QU6A 4ICLB 3T5KA 2EEYA 4ED1A 3TUJC 2DK2A 1Q8LA 2MTLA 2YKOA 1YJ9S 1RADB 1YBAA 1IUJA 1NXIA 3IGNA 2J0WA 3LWMA 1PBAA 3THTA 1HI0P 4QCLA 4IRKA 2RMLA 2UVVA 4NEZA 4DPTA 1ROFA 3RBZA 3PY8A 1C0TB 5IQQA 2QYCA 4OZ2A 4I2PB 3TUZC 3T1HF 4LF2A 2AJ0A 5F8JA 1VQSA 4DG1A 3AHPA 5D4PA 3VWSA 3R8YA 2R7QA 4D3HA 3AODA 4NLVA 2GGPA 3LOUA 3ENQA 4QOTA 3BV8A 4F4KA 2HVHA 4AXIA 4K2JA 1FKOA 3Q23A 3PO5A 1KS2A 3QATA 3F56A 1FVSA 2YBVA 4A8WA 2YNFB 3ZZUA 5KFJA 5D4LA 2KXHA 1TL1A 4JI1J 2DRAA 3GJRB 1GX6A 4DSEA 2GS8A 3MHYA 3RU0A 1U6FA 3EX7B 1RHUB 1VC0A 4DL2A 8ATCB 3A3NB 1KLMA 3H2LA 2QL5B 3MEKA 2CNLB 4I2QA 4Q2MA 3O3LA 4CT8A 3PFOA 4Y00A 5B0CA 1QUVA 4R5PB 3FCHA 3PIPQ 4NA2A 2WTFA 1EQMA 1YK9A 1TKXB 3BBCA 3OQ2A 1VIOA 3NGSA 3FMBA 2KI2A 2N3OA 2OO4A 3D6MB 2AJFE 3AD8C 1NK4A 3K59A 4AL7A 2DKOB 3DHWC 1HNXJ 1S4EA 5L38A 2HPUA 4EGLA 5CD4H 1S77D 5LXRA 1VQYA 2YQ1A 4TY8A 2PD1A 2HNYB 4DHVA 2WHOA 4TNOA 4YEAA 2BACA 1SJ4P 4W90B 2VC0A 3LGNA 4ATNA 4OV1A 2BA9A 2QO3A 3QT8A 4RU2A 4F7VA 1RT4A 4GRSA 2VIHA 4O23A 4RW7A 3GZ7A 1IWAA 4I56A 3MZIA 4CNZA 2DR7A 2YNGA 1CQNA 5ETRA 2X7IA 2K7JA 2BJ7A 2CJBA 2MKCA 2HQIA 1CG2A 2CAJA 1HQEB 3MAAB 2W7PA 4JI4F 1TP7A 2IFXA 2CG4A 4CTAA 3ZTOA 3VAFA 4ANCA 2FDNA 1JKHB 2DR6A 2CPXA 4OJGA 5C2GA 3T5HA 5D3GA 4RWXA 3D6FB 1IKXA 3DDKA 1KSPA 2LQJA 3CMES 2QYGA 1F5CA 1X4FA 1G1XA 6FD1A 1PC5A 4B3SJ 1RAOA 1RAEB 3RR8A 4ANEA 3KMQA 3PV8A 3CO0P 4E8UA 2AYEA 1NSPA 2DNYA 1ICEB 3DGPA 4IR9A 5L1IA 3CE8A 4G6VB 1RACB 1D8YA 2VG7B 4DCJB 1LWXA 4C8LA 3V4IB 3I6PA 3MURP 3CJ3A 3OFEA 2KRRA 2HHSA 4FBUA 3DRSA 1FFGB 1N0UA 1LXNA 1UMJA 3A8IA 3SCIE 2VOOA 2DGUA 4GKKJ 2BRKA 3N6MA 3V81A 1NSAA 1T9VA 1IR2A 1QUPA 1F9HA 1AUSL 1Q95G 1IR0A 2PA3A 1VOMA 2IAJB 3KHRA 2AJ4A 3PYGA 3VF0B 1I94J 1R6VA 4MTPA 1FRMA 3TO8A 1GMWA 4XAKA 3JAMY 2CJXB 4HKQA 1ITPA 5KAKA 2HYIB 4QR2A 1XIQA 3EGWB 1Z2LA 5J2NB 3D1QA 5THWA 3ENVA 4CO5A 2A18A 4ES3A 2W2NP 3T3FA 3MOJB 5DM7Q 2UUAJ 4PQAA 4DR2F 4DR4F 4FF2A 1SKUB 3D3BJ 2DNMA 3ADAC 4X4NA 3A4TA 4RUAA 1JJ2R 2E5LJ 3NOGA 2HZCA 5EGYA 4KFBB 3PKYA 4RR5A 3H42A 4P7VA 3W2VB 4CO2A 2MPUA 1X5PA 2XLJA 3LP1B 2QMXA 1VQ7S 2R7XA 3CDAA 2KT5A 2QLFB 2RH3A 1XNRJ 3KK1B 1VMBA 3JSMB 4EBCA 2WW4A 3UNYA 3QZ7A 2ZH6A 1VBZA 1T05A 5A8KA 4KO0B 1NDKA 4FVMA 1S49A 2BV3A 3HKZD 4QWEA 4NXMF 4TU9A 3M9MB 4F04B 3G6ES 1H98A 2HQFA 1RTDB 4F36A 4AQYJ 4KJIA 3KHHA 5D78A 1IJEB 2LEBA 4KGZB 1VHIA 4X4RA 2C2EA 3CD6S 4NEYA 3EXCX 3CEDA 3SBMA 3Q0AA 1T7PA 3PTWA 4OIXA 4C3KA 4QIEA 3ILIA 4K4TA 2HZAA 4LF7J 4DR3F 2ROGA 2RSQA 1SBRA 3BKUA 3GYGA 3SSQA 2MZRA 3BGOP 4RW9A 1TV6A 2RDJA 3BQ0A 2KHDA 4WZQA 5A2QY 3ZZYA 4ZVRB 1EJ7L 2XY6A 3MMBB 2E1RA 3KLEB 4K4VA 4IH7A 3PEJA 3CXCR 1S1TA 1U6ZA 2QZ8A 4CLKA 2HVIA 3LH2S 4I0WA 4QBUA 2RKIA 5CH7B 2EFPA 2NZ4A 2V2KA 2XWXA 1LW2A 2D41A 3RAQA 2DR8A 2BJ8A 4G1QA 4UOFA 1WSRA 4RUBA 3BYPA 1E6VA 1H38A 1WOPA 5SUHA 3CD0A 1S9EB 2H54B 2I9SA 2CKWA 3KUHA 1UFWA 3FQLA 4IQMA 1W7WA 5KFEA 4OX6A 1CEZA 1O8BA 4ZVHA 1SPBP 3NAHA 2VBZA 1UAWA 3N01A 1U47A 1RYSA 1UTAA 2B3TB 2X1AA 3GMGA 3EM1A 2FGCA 4QWBA 4AFFA 2RHQB 2KTQA 5BR8F 3L4BC 2K3KA 2W9BA 5L9NA 2AGQA 3M8PA 1RWXB 1FX4A 3M7VA 2HFSA 4C11B 1F2HA 2BW7A 2DB1A 3D9BA 2F9DA 4KV8A 1VRTA 2DGWA 5K8PA 4NLUA 2GHVC 2HS4A 4LFAJ 2FHMA 4DR5F 2UVRA 3HHEA 1HW8A 2J6UA 2DEJA 1FCAA 5GADU 3R97A 1UJ6A 2BE2B 2KYZA 1NZAA 3EGZA 1G3OA 5DQIA 4J37A 4LSNB 1Q5VA 4IYQA 2OPQA 4ZLPA 1IBLJ 3S01A 2OAUA 4XDDA 2VH7A 4N8NA 4IO1A 2G0CA 3MECB 3AB2B 5ETOA 4X65F 4PG7A 1KHWA 2DO0A
chains in the Genus database with same CATH topology
5AXLA 1FE0A 2R7OA 1XR5A 1KQKA 4HDHA 1OPZA 2QA4G 4CO1A 2YQ3A 4OLPA 4WU2A 5CYJA 2KM8C 1FDNA 2KHCA 3FSYA 4QWCA 4C3LA 1VRUA 1CSJA 3OSPA 2FHKA 4YR0A 4DV1F 2RF2A 5HMWA 2CPYA 1DBDA 2C3YA 1HBMB 4Q8EA 4F4XA 3NP5A 4DR1F 3POTB 3RB4A 5K14B 1HQUA 3FEZA 4WFBQ 4USHA 4KBIA 2ADCA 5T41A 2O3DA 3LUYA 5EHHA 1KQGB 3LWLA 2DVIA 2KYXA 4RUHA 1S1UB 5I42A 3NNAA 1HQEA 3HM9A 1LWEB 4K5RA 4Y0FA 4DQSA 4PR6A 3RBDA 4DV3F 2FIUA 3PX0A 2ADBA 5FJ4A 1Q79A 3GWCA 2GMLA 3T9NA 1U8SA 2UXDF 4BHQA 1RWUA 4HL9A 4ILRA 4IOCQ 5DLFA 2DR9A 2AQ4A 4M5DA 5F9LA 3K8VA 4ZP8A 1YG0A 3C6TA 3HF5A 1LFPA 5DDOC 5J2MB 1WTFA 2ZM6F 4DS4A 1OSCA 4NLSA 4TYBA 4DSLA 3MFIA 2XS2A 3HK2A 1HD1A 3NS5A 2W4PA 3NLCA 1FJEB 2DCUB 3RB6A 2JVRA 4MFBB 5DGBA 3G86A 3OLAA 3OUYB 1JKHA 2E1AA 3CO9A 2XBPA 1RISA 4K5SA 2WB1D 3LANA 2ZHBA 2OD6A 2M8HA 2MZ1A 4UY8T 2JC0A 2MHNA 2AYMA 3KG4A 3QWUA 5LL6d 1N5QA 3M2UA 2AW0A 2R8GA 4IDKB 3I31A 2ROPA 2BABA 2VFVA 3KG0A 1L3TA 1U2FA 1XEZA 1HNIB 2QSWA 2XHWA 4EO8A 1DTTB 2FVSA 2OSQA 1M5PC 2I5JB 2ZH4A 4A8QA 4H4OA 1C2PA 1KTVA 3AH6A 2R7TA 2BANA 4NLTA 1R8CA 1TUVA 2R8HA 2C3OA 1JNRB 3B4DA 4KRWA 2OPRA 2NXUA 3R5AA 2KZMA 4KGKA 2I2YA 2XY5A 5KFKA 4EO6A 1RKIA 1KOHA 4B9NA 3SV4A 4H4MB 3FEXB 4ZP9A 2HHQA 5E3RA 1QAIA 5KFIA 4PWDB 1WI8A 3NRBA 4NLYA 4CT9A 3GR0A 4MIBA 3DOKB 2VFRA 4WXOA 2PSZA 1S97A 2VA2A 2CPDA 3ZZRA 2CIMA 1XK8A 1HMVB 2F8EX 1ZM9A 3IS9A 4ECXA 2ZITA 2VG7A 3ITHB 2BDPA 4DQIA 2GQ2A 2QA2A 4ZPWR 3DLHA 5L9XA 3OFGA 3VZHA 5KFXA 1FDBA 1WF2A 3JSBA 3V4IA 5C25B 2VG5A 2LQBA 4F8RA 2E5GA 2Q66A 1U7LA 1FRLA 2ABYA 3M6WA 5E2QA 1S1VA 3IC1A 2LEAA 3R3TA 5K9FA 2DBBA 2DHAA 1RQ0A 1R8HA 3L7PA 4OJHA 3FDSA 4RNHA 1P9QC 5I3PA 1NK6A 1RJJA 3ZZ0A 4PXEA 4ALZA 1SL0A 3HZEA 1D9AA 3V6DA 4FP9A 1QE1B 1WEZA 3SSRA 3BF4A 1E6YB 4N41A 4N76A 4YQWA 2F9JA 1FRXA 1APSA 3RBEA 1DLOB 3RB3A 1WG5A 2C3MA 1ZETA 2WBRA 4DV4F 4NLGA 4WYLA 1UVIA 3IBWA 2GJ2A 4EUVA 3MD1A 4NWBA 3K2YA 3VAKA 1JJ4A