5HBRA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
464
structure length
464
Chain Sequence
b'MNDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
molecule tags Ligase
source organism Korarchaeum cryptofilum (strain opf8)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
total genus 170
structure length 464
sequence length 464
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hbrA01
1DRVA 4EUFA 1R4NA 1GY8A 1X1EA 3RBVA 3U62A 3VKUA 5JW6A 2R2GA 4YQZA 3FN4A 1SCUB 2DT5A 3TZ6A 1EUCA 5EERA 1H94A 4PVDA 1C1XB 1DC3A 1PJCA 2EGGA 3O4RA 1M6WA 2G17A 1PS0A 2Y05A 3DOJA 4XIYA 3D3WA 5IAAA 3E5RA 3TQHA 4II2A 3UGKA 4D7AA 5IDYA 4BNYA 4G5HA 4CR8A 2LDXA 2X8LA 2VOEA 1DBVO 4Z0HO 1OAAA 3FNHA 3ADOA 3I9MA 2E48A 1Z6ZA 1MX3A 4NU5A 2JFFA 1ZK3A 4ZRMA 4KP7A 2DC1A 4R1NA 3X2EA 5K6AA 1E0DA 4MVJF 1N5DA 3L9XA 1EVYA 5A3VA 3V5NA 3ZHBA 2AA3A 3RUFA 4A03A 1G0NA 3DAPA 4JCOA 4G81A 3H5RA 3ITDA 3S2FA 1GQYA 2EIHA 1GPJA 3GZNB 4YJFA 1EVZA 4RPGA 4KMSA 4M1QA 2WE7A 8LDHA 3DOCA 5LCXA 3T7EA 1BW9A 3DL2A 3AM4A 4Q3AA 3I9OA 4A0SA 1WNTA 1Z45A 2O3SA 3GAFA 3V2HA 1O95A 1ZK0A 3STHA 3IJPA 4ALKA 3PJEA 4ZVVA 2DAPA 4MVJI 3GMDA 1NYTA 4CM9D 5A04A 3G1UA 1VKNA 3QVWA 1YONA 3PJDA 4CQMA 5L7YA 4AL4A 5BSHA 4L74A 4MIOA 3L9WA 1ISMA 4FFNA 5BNIA 1K6IA 4YPOA 3ZWXA 3INTA 2W2LD 2PH3A 5L95A 1PWZA 2IZ1A 3WIDA 1EUZA 4PZEA 4L4RA 2X4GA 1OZAA 2E37A 4IDGA 4PLYA 3G1TA 4XQGA 4W99A 1JVSA 3JQGA 3Q2IA 3ZU3A 4XCVA 2AG8A 3KM0A 1H6CA 1WVGA 3PHHA 3KO8A 2VWHA 3T4XA 3P2YA 3U4CA 4DIOA 2FP4B 4ALMA 1K5HA 2EERA 2G1UA 3Q11A 2QZZA 1O5IA 1P45A 4YCAA 4ND4A 4C7JA 5JAZA 1IE3A 1HRDA 3RIHA 1B8VA 2H5LA 3OH8A 3K31A 2PV7A 1DJQA 3ZCXA 4XRGA 2PA3A 2R00C 4MIYA 3RUEA 2CZCA 5DOZA 1KEPA 1LQUA 1I10A 3DBRA 1NPDA 1PZGA 5MGBA 4MDHA 2EJWA 3WTBA 4RVHA 3FSRA 3H9QA 3EZLA 4NHEA 1K6XA 4RPKA 3RJ5A 3TRIA 2D3TA 1GZ6A 5H83A 3OIGA 4KWIA 3ZNOA 1OI7A 2BH9A 1ULSA 1YXMA 2BFOA 2V7PA 1XR3A 4XB1A 1X15A 3C7DB 3K30A 4OKNA 4TKMA 1F8GA 5I7VA 4D41A 4DC0A 4E4YA 3MWDB 3TL3A 1OBFO 3ROMA 5TC4A 1XCBA 1V9LA 2ZTLA 5ADHA 1EQ2A 5TNXA 3ZNNA 4OYRA 2EHDA 4W7HA 2Q2QA 3JQ9A 1LC3A 2J3JA 1U7TA 5A02A 2FR8A 4NBWA 1CQIA 1BGVA 4IDCA 3I9JA 1E3LA 4TROA 3OQ1A 3SVTA 4IJKA 1U3UA 4YA6A 1HYGA 4CPDA 4FC6A 1LLCA 3I52A 1NWCA 3I83A 4E21A 1CERA 3GDOA 3OF2A 1GQ2A 3KV3O 5TGDA 1XDWA 3KEOA 4YTEA 3UN1A 2QRJA 1XYGA 2VUUA 4WNIA 1EFKA 4CM8B 4BO1A 1PZFA 2Q1WA 1B3BA 3DZIA 3DO5A 2EW2A 3MEQA 1XWFA 5CG1A 3VPFA 3SLGA 1C0KA 1Y6JA 1VC2A 4UVHA 4DLLA 1P9LA 1HE5A 2IXAA 3P19A 4BNVA 1Q0LA 2BMAA 3GG2A 5B4VA 3PXXA 1LXCA 1GU7A 1WDLA 1RJWA 5A1TA 1SOVA 3SXPA 3VC7A 4UAGA 4WLVA 3UFXA 1KVQA 1X7HA 4KWHA 2B4TO 4RVDA 2D5AA 4JQCA 2P9CA 4LW8A 4U6SA 1IYZA 3QVOA 4ZU3A 1IUKA 5JCJA 2OL4A 3OFSA 1UXHA 2P91A 5ICSA 1Q0HA 4BO6A 3UH1A 3B20A 3WGHA 1BW9B 4N5LA 1PGPA 3WX0A 5I8WA 1QYVA 1S7CA 1LSUA 4XEHA 4B4WA 2IYPA 2FZEA 4YXFA 1ZKMA 3UW3A 4J6FA 3CZMA 4BGEA 3TOXA 1YDWA 3NDRA 2B0JA 2B83A 4KTVE 4A26A 5FI3A 4YB8A 2YHIA 2PNFA 2IYOA 3TZKA 4AG3A 1ENYA 5EL0A 4NFSA 3VZRA 3TL2A 5DF1A 4C4OA 3MJ4A 2JAHA 4IIUA 1HWYA 3DWFA 4NBRA 5AXCA 1EBUA 3MCVA 1EDOA 4JJGA 3H7AA 4Y6SA 3D7LA 3PHIA 3AOGA 4WCFA 2A4KA 3ST7A 1FJHA 2Q1TA 4J9VA 3L4BC 2PFGA 2D4AA 2YYYA 2P2SA 4M86A 4INAA 4E30A 4DYVA 2FWMX 3WWZA 5K0ZA 4CMBA 1U5AA 1B16A 4I5DA 4QX6A 3LF2A 3ZV4A 4CLRA 2LDBA 2X86A 2H63A 1XSEA 1QKIA 1V3TA 3MOGA 1DRWA 3UUWA 3ZW8A 4RORA 1Y8QB 2AQHA 2UAGA 5JBIA 4UVGA 5ICMA 3PQEA 3C24A 1RKXA 2PZMA 1GUFA 1C1DA 1VSVA 4LCEA 4FJ2A 3D5QA 3GEGA 4ID9A 4EZBA 1SMKA 3OETA 3DTTA 3RU9A 4JBHA 2Q3EA 4PG7A 3W8FA 1NQTA 1FDSA 2WWRA 1GL3A 3H2ZA 3L6OO 1E7MA 4NH4A 4TVOA 1A4IA 3C1OA 4BGVA 2RH8A 2H1SA 4OSPA 1LTHR 4A5OA 4YRDA 1DOHA 5A05A 4E32A 1A7AA 1ID1A 3BA1A 2NSDA 2FPPA 4GX0A 4W4TA 1GTMA 1TT7A 3WICA 2CDBA 2RAFA 3PYXA 2HSDA 5JO0A 2A94A 3RC7A 5KCZA 3PYMA 1H0KA 1F14A 3AOEC 3ZU4A 3L07A 4PCVA 3RUCA 1IHXA 1HT0A 3PPIA 3PWSA 1IULA 1OMOA 1RM3A 4FR5A 2Q1SA 1WP4A 1EK5A 4OJNA 3WG9A 3UCFA 3F4LA 4NZ9A 4XGKA 3GEDA 4RDIA 3AFNA 1JQBA 1UDCA 4RVGA 1NVGA 1UAYA 3IUPA 3B70A 4RLHA 5FFFA 2PTGA 3AWDA 1WAMA 2CMDA 5JYDA 2VZ0A 4GL4A 1CRWG 3O38A 2X58A 3ZWVA 1P1RA 2OFPA 4GSLA 5K9ZA 4IINA 3WGZA 1NHGA 3K92A 3OEYA 4R41A 5BSEA 5I7EA 3K96A 1CF2O 3UFXB 2DLDA 3QRWA 3AJRA 2GASA 3LT1A 1QV7A 2GN4A 3Q9NA 4I8XA 4JJFA 4RZHA 1R4MA 4FS3A 4Z0TA 3PGXA 2X0RA 3UCEA 3MZ0A 4DTIA 3QWFA 3RC9A 1IOLA 2GN8A 5IXSA 5JMPA 1DFIA 3HWRA 4MOWA 2AEFA 3VPHA 5L40A 1C14A 1HKUA 1ZUD1 2CF6A 3WGOA 4XWYA 4LGVA 4BO5A 1NVTA 1CEQA 1PL7A 2FRDA 2YHIB 1PJQA 4E5KA 2GO1A 5AXBA 1RM4A 5G0TA 2J3HA 1N9GA 4R1UA 3NDIA 3BHIA 4JX8A 2C7VA 3D4OA 5L7TA 1H2HA 1H5QA 4ITUA 2J5QA 4DL9A 2V6BA 1UZNA 4CM3A 3CTMA 2P68A 2DFDA 3D5TA 3UVEA 3MJCA 3RCBA 1PX0A 3ZWMA 2PZKA 1NVMB 3JQ7A 1PSDA 2AXQA 2GZ2A 4JBGA 4WLNA 3WGGA 4CL8A 3KYDB 1NNUA 2NACA 1KVTA 1LDNA 4AJPA 1JKIA 1DLJA 3SX2A 2C2XA 3QVXA 4JJIA 1A7KA 2R00A 4BMVA 5JSFA 3QWIA 3I23A 3KHUA 3WYBA 3MJTA 3FBGA 4HFRA 3P7MA 1D3AA 1YQGA 4WLUA 1UJMA 1EVJA 1FDUA 3GGPA 4GMFA 1YVEI 4B3HA 4P8RA 4XYBA 3GDGA 4JGBA 1KVSA 4KQXA 4TKLA 5DNAA 3RROA 3GRPA 1HLPA 2JD2A 3Q2KA 4HP8A 1XLTA 3WIEA 2RHRA 5JCJD 2NU8B 1XKQA 1J5PA 3TZHA 4DMLA 4WEOA 4QTZA 1A71A 3H65A 5CFZA 4K26A 3WGQA 3BHJA 3G3EA 1LA2A 2AQ8A 1R12A 1PU2A 1VL8A 3V1YA 1BXGA 3M1LA 1ADCA 4Q3NA 3VTFA 4BNGA 4TMFA 3UKOA 2JAPA 1DIRA 3PWZA 2F1KA 3H3FA 1GAEO 3RUAA 2VTDA 1LLDA 4E33A 1KETA 4ROSA 5JLAA 2C20A 3GHYA 3KEQA 4BV8A 2PR2A 3ANLA 3DBLA 5IN4A 1ZBQA 4DQVA 1IHYA 3S1LA 1O89A 4GSKA 3GOHA 1DSSG 2V65A 1SC6A 4M87A 1BHSA 1YL6A 4GLOA 2ZIZA 2VZ8A 3V2GA 2J8ZA 4MPDA 1QYWA 4ALLA 4QEDA 3WJ7A 4B79A 3QVSA 3H2SA 4MINA 2HMVA 4J16A 1SB9A 2NU6B 3BMOA 4JIGA 1UDAA 1N7GA 1XA0A 1DXYA 1WLYA 1Y5MA 3C85A 3H5NA 2C82A 2HCTA 1Q2XA 3AY6A 1M66A 1B14A 1E5LA 4XA8A 1GUYA 2HMTA 4ZA2A 1GEGA 4R54A 3DHEA 1YJ8A 4JLWA 3OEWA 1PJLA 3PEFA 4NDNE 4WKGA 2ET6A 4DLBA 3CXRA 4J9UE 1UP7A 3DEYX 1QYCA 4QFDA 4I9UA 1PIWA 5CDUA 4YWJA 2J5KA 2C0CA 1T1SA 5CDGA 3K5PA 4ND2A 4J1TA 1I30A 1I5RA 1P1FA 2ZB7A 3OQBA 3DZBA 4GVXA 4LK3A 4XJSA 3GHHA 3GF4A 2IDZA 1BDMA 4EDFA 3NTQA 4Y6RA 2W4QA 1R4MB 4NU6A 3TSCA 4GX2A 4TSKA 4M54A 2HMSA 3PGJA 2YUTA 1C1XA 5DBGA 1NM5A 1ZXLA 5BSFA 4XR4A 5FWNA 1AXEA 1JKJB 1YE3A 2VHZA 3ITKA 2HO5A 1SOWA 1CIVA 2BGLA 2ZATA 1FXSA 4CMCA 3SBOA 1FDTA 2AG5A 4J90A 4WCFC 1SEPA 2GLXA 4HXYA 1EE9A 2HRBA 1GZ4A 1N9GB 2NTVA 4B8WA 4IJWA 3IUSA 5A3JA 3JD3A 2ZTUA 1X0VA 3AI2A 3ROPA 1KVRA 3ONFA 1R0KA 1DO8A 4U0JA 4CLXA 1N2SA 3I6IA 1KYQA 3VVCA 4BHTA 5A9TA 2Y0DA 3B1FA 1QSGA 3WYCA 1IY8A 1PR9A 1QMGA 4FW8A 1Z7BA 1TXGA 4EJ6A 3WB9A 3NKLA 1CYDA 1I3LA 4YJFB 4RVSA 4RJTA 1E92A 2CVQA 1BXKA 2DUWA 3NDJA 4D44A 1NP3A 4FSHA 1W0CA 4EJMA 1JWBB 1HTBA 1ISFA 5A5FA 1A4UA 5GZ1A 1DAOA 3Q6IA 3GN2A 4GPD1 4EUHA 2NADA 3EZYA 4NJMA 4D79A 2XXBA 3F4BA 5DBFA 4RVFA 4F46A 5B4UA 1NHWA 4BNTA 1PGQA 4ZQBA 2VUTA 4XGIA 1RWBA 1NFRA 3QWAA 1ENPA 3U4HA 4XYGA 2CD9A 3MTJA 2NVBA 4RVUA 3GLQA 1Y9EA 2Y1FA 8ADHA 1ADFA 1HDCA 5EN4A 1WDKA 4JP3A 4NFYA 4CODB 5EQDA 3KRTA 1Q0QA 4BO3A 5IZCA 1GR0A 4HFMA 3VPXA 1N7HA 2V6MA 1ISGA 4OIMA 4BO2A 4JBIA 3DQPA 5IFLA 1H93A 3GPDG 1FMCA 2GERA 4IBOA 4TWRA 2A9FA 2GDZA 1XELA 3IIEA 1KIFA 2Y67A 2RHCA 4I5FA 3DFZA 4R5HA 3ZV5A 1P77A 1BMDA 1NWHA 1HYEA 3ZDFA 1NPTO 3ZWBA 3FCOA 3RU7A 4Y8VA 1EVIA 5G0WA 4NBTA 3RC2A 3JQBA 4PN3A 4N18A 3WDSA 3KSZO 2NU6A 3BMOB 4UVIA 5JDCC 4E6PA 3FBTA 2GZ1A 3GPIA 2OORA 4TRMA 1GPDG 4YT5A 1KY4A 1HEUA 5T6BA 4Y98A 3OJOA 2P5UA 4FFMA 4WK6A 2Y66A 5JDIC 1UXJA 3KUXA 1YL5A 4XYLA 1YKFA 3JQDA 2ZB8A 4QO8A 1B8UA 4FJ1A 1PS8A 3GUYA 5ENVA 3SLKA 2YV1A 2X5JO 3VTZA 3QV1A 3NJ8A 4AJNA 3BMCA 4RDHA 1E3JA 1L7EA 2PK3A 3WMXA 3F47A 4GKBA 4IQ0A 4K1LA 4MP3A 1NXQA 4R9SA 2O50A 2Y0CA 3K9QO 5TRTA 2EKPA 1YBVA 2V6GA 3PVZA 2NTNA 4MJLA 5C7LO 1LDMA 1ISHA 4LMPA 3OIFA 2DPGA 1U1IA 3D4NA 5KOIA 3O26A 3QSGA 4IZHA 5CPBA 2NQ8A 2XAAA 3ADPA 1NQ5A 2GN6A 2ZK7A 3EYWA 3WLEA 4A10A 5LDHA 4D46A 2VWQA 4BNNA 2QYSA 4OMUA 3ANNA 1UR5A 4D0SA 2PKRA 1EBFA 2PLAA 4O63O 1V3UA 2XPCA 2GRAA 4PLWA 1OC2A 4BOYA 3ON5A 4CM8A 3WFJA 1DC5A 4AJLA 2YY7A 3EGOA 1TVEA 1GCOA 5KNLA 3R0IA 3RJ9A 5BSGA 2IXBA 1KERA 1LLQA 3I1JA 3MTGA 2FR1A 1ULUA 2JHFA 2HKIA 2C07A 4AJ1A 4JK3A 4XX0B 3KYBA 4PRKA 2ZTVA 2NUAA 1MA0A 2HDHA 1WDMA 1E7QA 3PLRA 3SJUA 1EFLA 2QIOA 3TZCA 3PZRA 4NK5A 3ZU5A 1PGJA 4M89A 3WQQA 4FBGA 3IKVA 1E1MA 1MXFA 3F46A 4RGBA 4YJHA 3DZGA 1D7OA 1QG6A 5B1YA 3HE3A 2QHXA 3TNLA 1M2WA 3BHMA 3PP8A 4BIIA 4DLAA 4FC7A 2BD0A 4Y67A 1NTOA 2AW5A 2QX7A 3RFVA 4K9DA 1Z73A 3ZHZA 3AY3A 4CMGA 1T2CA 2CVZA 4FFLA 4GQAA 4KQWA 3JYLA 3ZI0A 4CLEA 4QO7A 1YWGO 1T2EA 3QY9A 1E5QA 1ENOA 4EI2A 3OECA 1PS9A 3AU9A 4CM7A 3U49A 3C1AA 3M2TA 4PLCA 3O8QA 5COAA 3L77A 3DMTC 4DVJA 2OBYA 3CH6A 4E5NA 3JQCA 5HTOA 2WSBA 2EP5A 2CDAA 3KVOA 2C5EA 1N92A 4ALIA 5A9RA 3A28A 3E18A 5DOVA 4PG4A 3PI7A 2DM6A 4XDYA 1XIVA 1V3VA 5C7OO 1ENZA 5CEJA 1WW8A 3Q1LA 4MKZA 4BNWA 2VHYA 2WD7B 3MJEA 5HA5A 1H9AA 2D59A 3VOSA 2IEBA 5DCUA 5JXWA 4MVJG 4HY3A 1R37A 4N5NA 1KBZA 2BLLA 3BTSA 4BQRA 4EUEA 4R68A 2CNBA 4BNMA 5BNFA 4E2ZA 1D8AA 4F6LA 4E2WA 3TN7A 1V6AA 3OBBA 3U3XA 3M2PA 2BRUA 3UICA 4AJKA 5IDXA 2X22A 2Q46A 1ZMTA 1Y9AA 1MLDA 4UVEA 4F45A 3GY0A 1HDZA 3WBBA 4ND5A 2VYNA 5KJ6A 5B12A 5DN9A 1YOVB 1KEWA 4UUNA 4P4GA 1X7GA 3OJEA 3ZWPA 5JS6A 1ADGA 2WDZA 3BMCB 2PD6A 4LSMA 3OA2A 1O8CA 4I9NA 1MC5A 2CDCA 5IN5A 1YDEA 2Y1GA 4W9NA 5DCYA 5LC1A 2WEKA 1Y8RB 3ZHYA 4WEQA 4DC1A 1SEVA 3IJRA 5FI5A 2CVOA 2ZB3A 5T8KA 1UXKA 3JQFC 1VL6A 2W98A 5A9SB 4MVJD 5DULA 3C3XA 4CUZA 2SCUB 3M6IA 1XHLA 3ICCA 3S2EA 5TJ9A 2VTEA 3VKVA 3HADA 2X0NA 1LSSA 3KYCA 3F1KA 4GI2A 5DDIP 5ER6A 4NK4A 1P33A 4AFNA 5BR7A 1R0LA 4DMMA 4OM8A 3RD5A 3JQAD 4OAQA 3GN1A 4PVCA 1P1KA 3CEAA 3RKRA 1E7YA 4UVDA 1P1JA 3NT4A 2QYTA 4FD3A 3C7AA 5J23A 4YVFA 7MDHA 3NTOA 3T7CA 5DP1A 1C0PA 4NJOA 3CUKA 2EW8A 4DXHA 3OQ6A 3L0DA 3JSAA 2DKNA 4XX0A 5JDCA 4OL9A 1YRLA 5TS3A 1DFGA 1NBOA 5THQA 4XB2A 1NR7A 3EY4A 5DCWA 3LQFA 4WPGA 2OUIA 3HQ4O 3NRCA 3OIDA 1G1AA 4YAJA 1QR6A 1XEAA 1T2AA 3ETDA 4DGSA 2VQ3A 5A4DA 3R6DA 4P22A 5A5EA 3W8EA 3AUUA 2HJRA 2CY0A 1IPEA 2IZZA 3GQVA 3WTCA 1YBAA 2D5CA 3I4CA 1YQDA 4IGEA 3GC6A 4PGFA 2OP0A 4DA9A 1LRKA 5CAEB 3DZKA 5HWSA 2AQKA 4R69A 4UREA 2G82A 5CPFA 3EDMA 3B1JA 3NT2A 1V8BA 4R9RA 3AM5A 2FPPB 2OGUA 1ZEMA 3FD8A 4FN4A 1PJ3A 1MGOA 4O59O 2PH5A 2VZ9A 4R3NA 4YJGB 5L4LA 4PIVA 1K0UA 2FPIA 5IZ4A 2PKQP 3JQ8B 4YRBA 1E3WB 2HRZA 3DAGA 4JNKA 4F6CA 5TT0A 1E7RA 2I99A 4DWVA 4I5GA 1X14A 4Y9DA 3B1KA 3TPCA 4RPLA 4W82A 3LZ6A 2VWPA 4CLOB 2B5WA 4HV4A 5TSDA 1PQUA 1AXGA 3CSDA 3HFGA 4H16A 1PL8A 1AHHA 3FPLA 5EQFA 4KTTE 4DREA 2FPGA 3RWBA 1TB4A 2PD3A 3UAGA 2YDXA 1LQTA 3ZNPA 3EVTA 3JCZA 2O3QA 3HZZA 3QWHA 4H3VA 5JDIA 3O03A 4MVJP 2YFQA 2ZCUA 2YW9A 5B4TA 1KOLA 3RBXA 5BQFA 3I6QA 3D4PA 2NU8A 2AQIA 2X9VA 5JO9A 3PDJA 4NI5A 2VRCA 1P3DA 5TJHA 3GEMA 4E0BA 4CLHA 4ILKA 1UZLA 4OOEA 4YT2A 2FR0A 3WJAA 4WUVA 3WSVA 1QORA 1YL7A 3PLNA 3E9NA 4L8VA 1E7SA 3JTMA 3AU8A 3QQPA 4I9HA 5C3MA 2Q2VA 2GSDA 4OSOA 1JVBA 4RLSA 5FEUA 2Q99A 2E6UX 1MV8A 3JYQA 1R0SA 3GVCA 2X5OA 2YDYA 3AK4A 2CSUA 3DHNA 3K73O 4Z9YA 4Q3BA 2Y99A 1LC0A 4J0EA 1ORRA 2PGJA 5ITWA 2YQ5A 4BO9A 3GA0A 2DBZA 3I9LA 1J49A 1EUCB 2OHXA 1ZXBA 1O6ZA 2FHSA 3FHLA 2YV2A 3ASVA 5I7SA 3NAQA 3EAGA 3A14A 3D3WB 2JL1A 2ZKLA 5KJFA 2SCUA 3W4JA 1KEVA 3RKUA 4BNHA 2C59A 2DTEA 3KYCB 2IE0A 5ES3A 4CL3A 3RSHA 3RAJA 3DTYA 3L4SO 3E6AA 3BYZA 2Y1CA 5IDQA 2AEJA 1AN9A 3GNTA 3C7CB 4YR9A 1ZK1A 5KTKA 3DZFA 1T24A 4A7PA 4EYEA 1M6HA 3BMQA 4BNKA 4CMIB 3PWKA 3IL2A 1EUDA 4UULA 3WQSB 4E2XA 3ZWWA 1G0OA 1X0XA 3UHAA 1IPFA 3WGIA 4HNHA 4FGWA 2RH4A 2GN9A 1ISIA 4ZQHA 2I65A 1HSZA 4GLLA 1EK6A 3PIIA 4PZCA 3ZW9A 1JLLA 3F1LA 5F1KA 2OBNA 4B7XA 4IDBA 4EBFA 3OHSX 4IY1A 2J3KA 4LCJA 3WXBA 5ENDA 1DFHA 4MKXA 1LDYA 4IDDA 3TJRA 5CDYA 1H6BA 5C5IA 5L7WA 4NBVA 4R1SA 2O4CA 1XGKA 1UUFA 4CM6A 4LN1A 2VRBA 2FN7A 6ADHA 3A06A 2BI7A 1Q7GA 4AJJA 3IC5A 4BVAA 3ZV3A 3AOEA 3O9ZA 5L4SA 4NMHA 2O3TA 2WYWA 4TQGA 1LSOA 3LDHA 4BNJA 4FB5A 5I9LA 1LDBA 1PJTA 2VHWA 4LMRA 4Q9NA 3UCXA 4J91A 4G2NA 4YYZA 4BGIA 2Z1MA 3JQGB 3PQDA 4DPLA 2AHRA 4NPCA 1YJQA 5EJ2A 2HMWA 3NV9A 2IEDA 5TIIA 1R15A 2W8ZA 4CMHA 3DBRB 3JQ8A 4YAKA 4PG5A 5CHEA 1JW9B 4IXTA 2WYUA 3V1TC 2O2SA 2W2KA 1Y1PA 3KZVA 1N1EA 2I6TA 4RF4A 5LDGA 4Z9XA 5H82A 3VPGA 4CLOA 5KWEA 4P4LA 1U9JA 4WJZA 2Z1NA 2TMDA 7ADHA 4GVLA 4XDZA 2JCVA 2PZJA 3CE6A 2FPGB 1H6AA 2DU8A 5CP8A 3PJGA 4QUKA 3RI3A 3E82A 4HBGA 1PJSA 4W7IA 4RPHA 4B7UA 3HDJA 1GDHA 1E3EA 4Z3DA 4OH1A 4BKQA 2C5AA 2HK9A 3QP9A 2O2YA 1BXZA 2Q2WA 1GV0A 3INRA 3B6ZA 1CQIB 3HNPA 1P44A 3I9KA 3CMMA 3OJLA 2W2LA 2ZB4A 4Z9FA 1V0JA 2B69A 2D8AA 1JKFA 3K2BA 4W9NC 3JD4A 2AMFA 4BO0A 4OXKA 5HBRA 2V6FA 1RPNA 1J4AA 4DUPA 1MG0A 1PR3A 3KSDO 1QRRA 3EMKA 4FQ8A 4O5OA 4OXNA 1RM5A 2DBVO 3CIFA 1BSVA 4M49A 3H9JA 4CUJA 1PTJA 1W4ZA 4MVJH 3DMTA 4IDEA 3LU1A 2HU2A 3PDUA 4PZDA 3VH3A 2Q4BA 5IG2A 3ZV6A 4B7CA 5I9MA 2VT3A 3IP1A 3ROKA 2ZJ0A 3FTPA 1TLTA 2C2YA 2DUUA 2J5RA 2VWGA 3VZPA 2BGKA 1M76A 2Q50A 3QHAA 1ZMOA 4J7CA 1VJ0A 1F06A 1R6DA 1B0AA 3KTDA 3V8BA 1PWXA 3W8DA 5H81A 4BKUA 5CEEA 4WE3A 1VJ1A 2WE8A 2HK7A 4YACA 4WLOA 5JY1A 1B3RA 4CM4A 4CMKA 3CMCO 3KLPX 5JY6A 5KJCA 1E7WA 1NASA 2P5YA 3ZWNA 4XR9A 1HDOA 4GMGA 3VAZA 1ARZA 2X23A 4PFJA 5JAQA 1KC1A 2A92A 5JNLA 3COSA 2C29D 1DIAA 4RF5A 4XYMA 4CMAA 2NV6A 4XKJA 1VLLA 2VYVD 5G2OA 1LUAA 3HDYA 1E6WA 1H9BA 2TMGA 3ZZNA 4BL5A 4R1TA 1DIGA 3MOIA 2GCGA 3U0BA 2BGMA 4WECA 4MIEA 3RC1A 4AJIA 2VT2A 3QLJA 4FPXA 4U7WA 2NNLD 4OOFA 4DRYA 1WWKA 4BB5A 1G6KA 2VOJA 3JYNA 3NX4A 2GR9A 2EKQA 4FFOA 4WNCA 5IZCC 2FSVA 2GPTA 4KUGA 4RQUA 4P38A 2I5PO 5GY7A 2NLOA 4LRTB 1HE3A 1LEHA 4BKPA 1F8FA 4RZIA 2BKAA 4PLGA 1EZ4A 9LDTA 1U4OA 4B4UA 4DIBA 1B7GO 4AJHA 3AM3A 3EUWA 3VZQA 2NVWA 2ZTMA 1UH5A 3OICA 4E2YA 1XQ6A 1LRLA 2NM0A 3OJ0A 5T57A 1HDYA 3DMYA 2E82A 2DTDA 1NR1A 1DIBA 2WTBA 1X13A 1Z7EA 2PGDA 5JAMA 3GVXA 3JQBC 2YJZA 9LDBA 3T4EA 3RUIA 3IOYA 4YBZA 2CUKA 1YB1A 3GVPA 1Q7CA 1U3TA 3F5QA 3RVDA 4CQLA 2VHVA 4BQPA 1NQAO 1H6DA 1NAHA 1UP4A 2NVUA 2BFAA 1HL3A 1U3VA 2C7GA 3DBHA 1GEEA 4UEJA 4BB6A 5JC8A 1BVUA 2E4AA 2GUGA 1FK8A 1Y8QA 3F6YA 4P4NA 4EJ0A 4OXYA 1QXSA 1OFGA 3HFSA 1W73A 1VRWA 3H6KA 2RBEA 1LI4A 1NFFA 3AI1A 1IZ0A 1LU9A 1O0SA 2ZQYA 5JAIA 3ICPA 4K28A 3D3EA 5AVOA 1U5CA 1GUZA 3EHEA 3RQSA 1Y7TA 1QYDA 4H15A 1P74A 1B8PA 2X6TA 3E1KA 2ZYGA 4IDAA 2YV3A 3IAHA 4K6FA 5DZSA 4IUYA 1VJTA 5KVVA 5HS6A 4ND3A 1HDRA 1CQJB 2I76A 2JKVA 4J0FA 5AXDA 3EW7A 4N54A 3JD1A 4XZ3A 3PYLA 4J3FA 4BGUA 3K8ZA 1WPQA 3NYWA 3L6DA 4YJDA 2Q49A 3LLSA 3BZUA 5JYEA 3FWNA 1TA4A 4PRLA 3AUAA 3JQ6A 3NJ4A 2CF5A 2X9GA 4ZRNA 2YZ7A 3CINA 2OOSA 2PZLA 5L51A 1LSJA 4Q3CA 2X0IA 4CR7A 4DPMA 4OKIA 3U5TA 4ZN6A 2I66A 3W1VA 4W6ZA 1E6UA 2P9GA 2P4QA 3RFTA 4BO8A 2GD1O 1ONNA 2DBQA 1IB6A 2Z5LA 1I01A 4L4XA 4WLFA 2X9NA 1UXGA 4RCVA 2EEZA 2NUAB 4L4SA 1SO8A 5G0VA 3BTUA 5A06A 5HRUA 3AUTA 4CMEC 2NU9A 3EC7A 4QSMA 1JTVA 1T25A 2ZCVA 4D3DA 4ND1A 1RYDA 3S2GA 4II3A 4CM4B 4YEDA 1DHTA 1YOVA 4FFRA 1ZEJA 3WR5A 3HUDA 1VE9A 3HN2A 3BMNA 4URFA 4BNUA 1T2FA 4PLTA 3CKYA 1BG6A 4B3JA 3GRKA 1A5ZA 1AE1A 1ZFNA 3GFBA 5CEFA 5I8ZA 1P1IA 4ZD6A 3GGGA 2I3GA 4TZKA 4XIJA 5EMHA 4BKOA 5U9CA 3TZQA 1CETA 1I32A 4GX5A 4XRRA 1Q1NA 1PEDA 1I33A 3PFWO 3FRJA 1TEHA 1K6JA 3GUCA 1AUPA 5G4LA 4UUMA 1DEHA 4J4TA 4HNGA 5JE8A 2PD4A 5TF4A 1F12A 2BFMA 3KSUA 5KIAA 3MWEA 1B26A 4IQ8A 4CV3A 1F17A 3EK2A 4MVJM 3EVNA 5L4NA 1KVUA 1VKOA 1T1RA 4QT0A 1U28A 4UUOA 3QW2A 4BV9A 3LC2O 4R3WA 4UEKA 5IJZA 3IS3A 3LSYA 5F5NA 3D0OA 3WNVA 4AVYA 1E77A 2AE1A 4LVUA 1WZEA 4TZTA 1W8DA 1YQXA 3PIDA 3P2OA 3DC2A 2VUSA 3I3OA 3NTRA 4TRRA 2RCYA 3GZNA 4E31A 3MJSA 2ZYDA 4E5YA 3BAZA 5COBA 3H3JA 5B37A 1A9ZA 3F9IA 3VHRA 4L0QA 1M75A 3LT2A 3GVHA 3Q3CA 2NVUB 3E5MA 3A9WA 3AI3A 3ONEA 4U8GA 4D42A 2O7SA 3PHJA 2QQ5A 4OO3A 4J7UA 5U4QA 5JFOA 5IDWA 2DFVA 5G0SA 3VH1A 3BXXA 1PJ4A 1ZVMA 3ETGA 3DXFA 4E5PA 1EQUA 4NBUA 1PJ2A 1AGNA 2R6JA 3SC6A 5CAEA 3DBLB 3H4VA 3ZHXA 1QYXA 5F21A 5F5LA 4N5MA 1PL6A 2BHLA 1NFQA 3F5SA 2JD0A 3L6EA 5T8KC 4PLPA 1JWAB 3BTVA 2A35A 3M1AA 3DONA 3TF5A 1U2DA 3PQFA 4M8SA 1NQOA 4IXWA 4YJGA 4D45A 2QZ9A 5I7FA 3W6ZA 1JAXA 1UP6A 2X7HA 3ZN2A 3HB5X 1PZEA 1AHIA 3FTNA 4IMPA 3TWOA 4S3MA 2Z95A 5CDTA 4YDRA 4NR0A 2HJSA 3GZ4A 4MVJA 4DIFA 3A4VA 2I9PA 2O3RA 2OO5A 1H2BA 4QXMA 5COQA 3GR6A 5THKA 4BNXA 2QG4A 4ZJUA 4J1QA 4HFJA 4D3FA 1DDOA 5KVSA 4BMNA 4M55A 1ZO8A 3GMSA 2X5KO 1YB4A 3FNGA 3CZRA 1QLHA 5JCXA 4ZHSA 4GWGA 3NGLA 1PQPA 1PGNA 3HN7A 1KEUA 5MDHA 3IMFA 4U0KA 1LLUA 3RFXA 1NPYA 4XQCA 5IXYA 1ZNQO 2O3JA 2Q4EA 1MC4A 1VPDA 1MFPA 1T2DA 5TLSA 5G0UA 2O23A 5KJEA 3ULKA 3R1IA 1ZJYA 3V1UA 4BNZA 3DOOA 2NU9B 4G65A 4BO4A 4MO2A 4O1MA 3HG7A 4GWKA 4EEXA 1MB4A 3PRJA 2BELA 5GZ6A 1U7HA 3WSWA 1J0XO 3ANMA 1GYPA 1YO6A 4NIMA 1DRUA 3Q9UA 3UF0A 3JQ9C 1ZSYA 4YRAA 2EJVA 4A2CA 5BNTA 3ETEA 2PKQO 4TRNA 1K89A 3VDQA 4GGOA 1WZIA 4IJUA 3S55A 2Y0EA 4TVBA 3VH4A 5ILOA 3S2IA 1BDBA 2EWMA 3G0OA 1ZIDA 1SBYA 2I3AA 3SC4A 3ZWAA 1ZSVA 4E12A 4IPTA 2XOXA 1FDWA 2GF2A 3DFUA 2FPIB 1J6UA 1SB8A 1BTOA 1I36A 1PQWA 3ZWOA 2RIRA 1ZSNA 1EMDA 3Q0EA 2H9IA 1ISJA 1V35A 3X2FA 1Z82A 3R3JA 1ZZEA 2Y1OA 5KKAA 5KKCA 1KY5A 2Y68A 4DBVO 2HMUA 3MWEB 3PFFA 4UEOA 3BTOA 2EKLA 3ZGYA 2NWQA 2DVMA 4CM5A 2QRLA 1HZZA 2Y1DA 1B2LA 3DHYA 4JROA 4O0LA 4CMIA 1YB5A 5HS4A 2J6IA 1D1SA 1EUDB 1SPXA 3U4IA 4PG8A 4KUHA 5AOVA 4B4VA 3GK3A 4Z6KA 4Y6PA 3H5AA 5BT9A 1VSUA 3GNSA 3WOHA 5ITVA 4FIZA 1E3SA 4CMEA 3VPSA 2UDPA 1JLLB 4JXKA 1SZJG 1ZJZA 4GKVA 1I24A 4I08A 2DQ4A 4CR6A 4KOAA 4NJMB 3RUDA 1E3IA 4IZIA 2VNAA 5KJ1A 4PG6A 3LT0A 4KZPA 3GAZA 4ONEA 3JQFA 2C54A 2GNAA 5CG2A 4BUCA 3KXDA 2JHGA 4XD2A 3ZH2A 4J1SA 4YAIA 2XXJA 3E8XA 4BNIA 4C7KA 1U8FO 2BFPA 4HKTA 2CFCA 4CV2A 4ZQEA 1E1NA 1C0LA 4YQYA 4CQMD 2JCXA 2UV8A 4LRSB 4DQUA 1U2GA 4RV9A 1X7DA 1YBMA 3OSUA 4F3YA 3WNQA 4WCFB 4NG5A 4OGWA 1GFSA 2B4RO 1BWSA 2EP7A 4WLEA 3G49A 5L3ZA 4WGGA 1NAIA 3LLVA 2AEMA 3S8MA 4B4OA 4OQZA 3GH3A 2NTJA 5F1OA 3ZU2A 1X1TA 2FZWA 3OJFA 1MG5A 2JFGA 3E9MA 1P0FA 3GVIA 3MJVA 4O6VA 1O94A 2GYYA 3ONDA 1DB3A 5ILGA 1JU9A 3WGYA 5EIOA 1PJBA 2W2KB 4QFCA 1YGYA 2FMUA 1MXHA 2HAEA 2JFHA 3HDHA 2O3UA 1ZW1A 3D1LA 1DAPA 3BMQB 4U6QA 4XQEA 1DPGA 3JQEA 3K2EA 3RASA 1QV6A 3U9LA 2E49A 4YT4A 1ONOA 3AUSA 3JD2A 4IIVA 4AJ4A 4BNLA 1NX6A 1Y5RA 1C1DB 4FFPA 1Z74A 3ENNA 2QRKA 1OOEA 3P5SA 4ZQGA 4CMJA 2WM3A 3PZBA 1P31A 1QP8A 5DP2A 5G4KA 2G5CA 3AY7A 3JD0A 3FWZA 4RF3A 1SAYA 1T4DA 1R66A 1XQ1A 4OQYA 4N7RA 1EDZA 1XU9A 3IDSA 3H9EO 4E13A 1GCUA 1MFZA 4LVCA 1D1TA 3PJFA 1UDBA 4HWKA 4XGNA 3NT5A 1ADBA 1KC3A 4KUEA 2GGSA 4PLVA 2YFHA 4R4JA 5C37A 4YAEA 2O48X 3HSKA 3PK0A 1WMAA 3WYEA 1A9YA 2VN8A 5JMWA 2IODA 4BMSA 3C1TA 1PZHA 3I9NA 2G76A 3KBOA 4IDFA 3ZNQA 1RYEA 4GBJA 4J4BA 3OM9A 1XG5A 2VHXA 4XJTA 4WASA 4J43A 4I5EA 3TOZA 2WYVA 3TDKA 1R16A 3FF4A 5JPIA 5FF9A 1JDJA 3IKTA 2AE2A 1YS4A 2B4QA 4NNJA 3WWYA 1I2ZA 3H9UA 4Z0PA 4ZQFA 4UUPA 5K6AC 4CLRB 1S6YA 2PWZA 1VL0A 2Y93A 4L73A 3QIVA 5JC1A 2UUPA 2NU7A 5A03A 1U3WA 1XU7A 1I2CA 3VVBA 3ABIA 4J7XA 4A73A 1DJNA 3BIOA 4R01A 4WOKA 5EPOA 4J2HA 3TFQA 1CWUA 5T5QA 4R51A 1ZK4A 3N7UA 2GZ3A 3N74A 3JQAA 4YJHB 1HF3A 1A27A 4WOJA 2YHUA 2EG9A 3FNFA 4B3IA 3FPCA 2G0TA 1A72A 2PGLA 3W6UA 4HFNA 4FGSA 4D43A 2F00A 1HSOA 4J1NA 1O9BA 4DQXA 3LYLA 4BO7A 1HDGO 4EW6A 4KDFA 1I0ZA 4CJXA 1LJ8A 1YH3A 3H9GA 4RPJA 5AQ1A 1WMBA 1BRMA 3NUGA 1OC4A 3GGOA 3LVFO 4Q3DA 1F0YA 5GMOA 3KETA 3E48A 3TFOA 1I3NA 5FYDA 4X54A 2Q1UA 5F1PA 4NFHA 1SNYA 1ZH8A 4YAGA 3PTZA 3VH2A 3DDNA 4RF2A 4EEZA 1JA9A 2QW8A 3C8MA 3ENKA 4IS3A 3I5MA 1L1FA 1E6EA 2P9EA 2B37A 5L9AA 1T26A 4AJEA 1FDVA 3IQDB 1I3KA 3GFGA 1I8TA 3IP3A 4IS2A 1VI2A 3KB6A 4CUKA 1GD1O 2VCYA 2VYND 4FJ0A 1T4BA 2P4HX 1Y81A 3QVTA 3O8QB 2WD7A 1DC6A 1TT5B 2DBRA 2WJPA 3LK7A 5KVQA 4D3SA 4L9RA 3WS7A 3V2UA 2EV9A 3QWBA 4J2OA 1TI7A 2BI8A 4Z3KA 3SEFA 4JN6B 4IMRA 1M67A 1E1LA 1RM0A 1BVRA 1LRJA 3AW9A 2OMEA 2JD1A 2OZPA 3RUHA 2EXXA 1P1HA 6LDHA 1GADO 4J4HA 5F3RA 4YT8A 3WLFA 2J3IA 3N58A 5GZ3A 4A27A 1B15A 1U8XX 4MVJE 1L7DA 1C3VA 3JYOA 4EITA 1HETA 1MUUA 4RQTA 4GAEA 2HQ1A 3OA0A 3DBHB 1QLJA 3W4KA 4AJ2A 4AJOA 3INGA 3DZHA 2PY6A 5AYVA 1GQQA 3QJ5A 3R3SA 1D4FA 5L45A 3FNEA 1R4NB 2D2IA 1JAYA 1I2BA 2I67A 4GGPA 5G4KB 1SCUA 1N8KA 4MP8A 2B36A 4E5MA 3JYPA 3WMWA 1CDOA 1BXGB 2DTXA 1WXDA 4ALNA 1GZ3A 1LX6A 2JJYA 3LC1O 1K3TA 5I9NA 1P0CA 2OP1A 2EF1A 1CQJA 5HM8A 3GG9A 4TRJA 4OHUA 1U4SA 1Y8RA 4JP2A 5AXAA 5T67A 3PHGA 4DPKA 3W4IA 2DPHA 1CJCA 2FSSA 4CM1A 5IF3A 5L53A 3U4DA 5A9SA 4CV1A 3OMLA 1UXIA 3WFIA 1KS9A 3F3SA 3OP4A 4PLFA 4LSWA 3JQ7B 1C0IA 2Y1EA 3LT4A 1VM6A 3FI9A 3I4FA 3KYDA 4CV0A 1EE2A 4HADA 1ZK2A 4L76A 1W6UA 2ZQZA 4B8ZA 4EGFA 4K6CA 2WMDA 3VZSA 2ILTA 3KLMX 3WBFA 3RBZA 2D1YA 3FR8A 4WCDA 5DT9A 4AICA 3U09A 1HXHA 2HLPA 3QA9A 1ML3A 2X1HA 3SJ7A 2ZYAA 1GV1A 2XF8A 1I3MA 1Q7BA 4RO0A 4R16A 5C7IO 4QECA 4GH5A 4CQLB 1LDEA 5CDSA 3JV7A 1HE4A 5TT1A 3WQRA 4FOSA 1LBEA 1IL0A 3H8VA 4ZICA 2NU7B 1HE2A 4FCCA 1IZ9A 2VYVA 4GX1A 2FOIA 4KDEA 3NEPX 2EGHA 3ZWYA 1GYRA 3LF1A 3UOGA 3JQAB 4IJVA 2H6EA 3E03A 4CQMB 4QQRA 3NGXA 2UYYA 1JN0A 2YQ4A 2VNSA 4R5MA 5EINA 2B5VA 4MKRA 2NQTA 4ALJA 3ASUA 4IM7A 2WD8A 2Q45A 4ESOA 4LISA 1UAGA 3LC7O 3DB2A 4RL6A 3WGTA 1DIHA 1EEHA 5TQVA 4CM9A 2X0JA 4Q3EA 4E3ZA 4PLZA 4PLHA 2IZ0A 4FDAA 1Z75A 4CLDA 4BKRA 3G17A 1JKJA 3FR7A 4ZGWA 3K6JA 2FY8A 2O7QA 5U1PA 2FP4A 4IGFA 3CPSA 3GNQA 4BNFA 3GDFA 3HHPA 1GYQA 4Q39A 4I1IA 3QE3A 4NQZA 1LNQA 3ROQA 4S1VA 2D0IA 2VRCD 3KOUA 4BS9A 3VDRA 4DYDA 1HZJA 1E1KA 1HDXA 3PHLA 3L4BA 5TX7A 5KVCA 1HLDA 2HK8A 3HB4X 4MP6A 3ZWCA 2IRWA 3UXYA 1TT5A 4HUJA 1MP0A 1N1GA 1E3WA 4IQGA 2UUOA 2O4UX 5EESA 3HJAA 3ORFA 3HDQA 1FF9A 3AFMA 3D64A 4XYEA 3DZJA 2OXIA 2POQX 3DR3A 1PGOA 2JCYA 2ZJ1A 4FOOA 3GT0A 4H7PA 3MWDA 2HUNA 5ER9A 3DBVO 1DLIA 3G79A 4L75A 1LDGA 2BF7A 5T64A 1ONPA 4D0RA 3DAFA 1DHRA 5DBIA 3E9QA 2W90A 1HYHA 4HX5A 3BMNB 2B35A 1K2WA 1UZMA 1ZCJA 4XQ9A 2UVDA 4DBZA 3A1NA 4U5QA 1DC4A 4J49A
chains in the Genus database with same CATH superfamily
3OZCA 4JYBA 2I91A 1I6MA 4N8EA 4OA5A 3QENA 1KJNA 3AF3A 1K8YB 2FN4A 3VKUA 3CLSC 2X76A 1ZI8A 2VDOB 2WHXA 3HSYA 1QK5A 3FN4A 1SCUB 2ZT6A 5EERA 1GPAA 1KYVA 2J31A 2EGGA 3H1PA 3LE8A 4DN6A 2QTGA 1PS0A 4IKOA 3A37A 5DN6D 2BEWA 4XIYA 4UD6A 4D7AA 3TQHA 1N2CA 1DKQA 1L5MA 3DOFA 2LDXA 2J09A 3TAHA 3W2FA 4Z0HO 1QMPA 1VE5A 1HMYA 1E2JA 4WESA 4EO9A 4YRPA 1JEQB 4JJEA 2EFGA 3COYA 3I9MA 3MIIA 4Z99A 4EMSA 3GLTA 2JIQA 2V58A 2JFFA 1TJNA 4H4CA 4D9JA 2J5BA 1OLUB 4MWZA 4KP7A 1Z2EA 2SBTA 5AW0A 5C8VA 4O4JA 4CEIA 1J24A 1W34A 4MVJF 4YLYA 5JQGA 3H2YA 1E32A 4D98A 1EVYA 1G8MA 2ARKA 3CF2A 2PWAA 2VDWB 3DAPA 3G89A 4JCOA 1T5TA 3PXBA 3X1XA 3D59A 1Y4SA 1CBUA 4PINA 3QXHA 3V7FA 3S2FA 1GQYA 4UJ3A 1GPJA 5FOVA 1TAHA 5LBUA 5BT9A 3CNQS 3V1NA 5EGNA 4JVLA 2EOAA 4YP6A 3VTKA 4BUJA 1VZ2A 4HGQA 5B3JA 1DRJA 1HQYE 3IAXA 4Q24A 3DL2A 3AM4A 2I33A 1JFTA 1S7GA 1JLMA 4GKJB 4A0SA 1E2UA 1T8WA 1DBWA 3A1DA 4N3CA 1EZZA 1N4AA 4ALKA 2CXQA 3DAHA 3KJGA 3EEQA 3J7AC 1THZA 4V3BA 4XEUA 1NYTA 2A5LA 5EMKA 3G1UA 3LL7A 5TPZA 1YONA 3PJDA 4PGGA 4PHGA 4P93A 4C9BA 1D6MA 1N5MA 1QOZA 3F78A 2X8JB 4YPOA 3RPEA 1BXRB 3WL7A 3INTA 1WU7A 3ZWXA 2EQAA 3AVWA 1IRXA 1PWZA 1YFJA 1O3YA 1EUZA 1TGYA 2DLNA 4FSXA 1GN8A 3EGWA 1IQRA 3C41J 1V5WA 3CUVA 4XQGA 2H4ZA 2XZLA 3OZEA 2ECOA 3COJA 3FZEA 2AG8A 2XHEA 1QHIA 4Z4IA 1ICIA 2DPMA 3K5HA 3QF7A 2A0UA 4LZLA 2G4VA 3KAJA 3P2YA 3OLYA 3ZYZA 2WKSA 4CHGA 1Y6FA 4DIOA 4YJ2A 3HO6A 2ZRHA 4ITRC 3QGMA 1GG2A 1K5HA 1O5IA 2H4WA 2J45A 3BDIA 2C7OA 4WY8A 1B0PA 3FF1A 2VHCA 2Q6TA 3TEJA 2VK8A 2P40A 5DO9A 2O8EB 2V03A 3WWEA 1XZJA 2AG1A 4Y0AA 5EJIA 3KLOA 3DUWA 1DJQA 4QYMA 4X7BA 2F48A 3QVJA 1LGYA 2PA3A 2R00C 2VSNA 5EWLA 1VJDA 4W8GA 4E03A 4E3WA 4EHBA 1VPWA 1I10A 1O9HA 4FUQA 5E6RB 1PZGA 4NXNB 1PHPA 3COPA 3O1IC 3FSRA 1UODA 3WTBA 3ZNOA 3RJ5A 3AIMA 2YRWA 3CM0A 3E5NA 3DP7A 3G6KA 4OJQA 5H83A 3WB0A 3ZPXA 4KWIA 5KTNA 5LOVB 3ZTWA 3ES9A 1ULSA 1YXMA 2V7PA 5JLJA 3O90A 1FS5A 4A16A 1XR3A 5P8WA 4XB1A 5I7AA 4PNZA 3IEIA 2WPNA 3CLKA 3ECSA 3PFCA 2JLQA 4GYKA 4MV9A 1MX1A 4TKMA 2GAOA 2CBXA 2YINC 5I7VA 4ER0A 3B3FA 3EXAA 4MQBA 2ZG6A 1IN7A 3ROMA 2Z8XA 2YC2C 2E4YA 3CXUA 1S2MA 3EAQA 3IUEA 4CTMA 1V9LA 5JAOA 2ASEA 1M3SA 2WJWA 4OI0A 1Q0ZA 3DM9B 4OYRA 5FL7D 4F91B 2WAMA 4R8SA 1G20B 4H1HA 4ZMBA 3LFUA 5EOVA 4X1YB 1UIRA 4DR3B 3ILVA 1LC3A 2QQEA 4Z3OA 1G19A 5A02A 3TKAA 3ZJUA 2AOXA 1U8CB 4IKPA 1UPXA 4WZAA 3ZE8A 4NBWA 5LA6A 4P4SB 3F3KA 4L5YA 1B0ZA 4TROA 3LXXA 4NP6A 3LV8A 4U8HA 3WKAA 3RQIA 3NNSA 3B1VA 2YHSA 1H1DA 4U2DA 4B3CA 3FPJA 4TKVB 4AUMA 2OHIA 4NENA 3MAJA 3NXKA 4FC6A 1LLCA 1E0SA 1NWCA 1WXXA 3OU6A 3K0CC 3HJTA 3INNA 1GKLA 5BV2P 2KB0A 2B0CA 5SZIA 1RZUA 3UZUA 4KACA 2OSVA 3KV3O 4CZ2A 1XDWA 3KEOA 4MR8A 4PYRA 3UN1A 1M74A 1BHQ1 2LV8A 2WJ3A 3C8HA 2YCLA 3NHYA 3ZXYA 4BO1A 2Q1WA 3MELA 3T35A 1GZUA 4NCXA 1B3BA 2EW2A 3THSA 4UHEA 4X9XA 1QTRA 1ZU5A 4MI9A 3SLGA 2CJYA 1AKWA 1AQLA 1C9DB 1P9LA 4NX2A 4XSVA 4BVKA 3T54A 1KI7A 5B36A 1E9DA 4NF2A 3PXXA 4DNOA 1GFWA 1EUQA 3EVFA 1GU7A 1MH9A 3OLXA 5BUQA 1EFCA 5A1TA 1CHNA 1D1QA 2AZMA 3EMBA 1D2AA 4PIMA 3MWLA 3N3AC 4URYR 4JQCA 5BWNA 1JQLB 2GD2A 1F20A 4PFSA 1IYZA 3FYUB 3WO0A 2OL4A 2NSJA 2DQSA 2P91A 3E81A 3HA5A 1CS4C 1M7BA 4KMOA 4R8RA 3SHTA 3UH1A 4B9AA 3B20A 4KVGA 2QMUA 2BFCB 3ZY3A 3WX0A 5I8WA 3CF4G 2INGX 4B4WA 2IYPA 1P3Y1 4Q9AA 1FP6A 3UW3A 4BGEA 4EY7A 3TOXA 1YDWA 4RKYA 1ZRHA 2XDAA 4V0SA 4WXRA 5K0TA 1NLMA 1Y9JA 1I14A 3TLGB 3VSCA 3WY9A 5G02A 2V6JA 1UJ5A 4HUTA 1D9XA 1QHFA 3MGKA 1ENYA 1IDN1 4JA2A 2FSUA 4OJTA 3TZKA 2PKCA 3VZBA 3TL2A 3OE5A 5DF1A 5HDQA 3E9DA 3BWBA 4EEKA 2QRZA 1G9SA 3UJDA 3BAFA 3BFPA 1R27A 1LI7A 4NBRA 4KR3A 4XPIA 3MCVA 1ZRMA 4X6XA 3RAGA 1QAOA 4G8BA 4Y6SA 1V5IA 3ZR4B 3OJCA 3ZDRA 5EHZA 4WCFA 4K3UA 4I99A 2IITA 2JFQA 2G8LA 3H6GA 3PUKA 3MPOA 4Q1CA 4OHRA 2M9MA 4GPTA 2QTZA 4I4TB 3QUAA 1JIIA 3RC3A 3M3HA 2D4AA 3IAM6 3NAGA 1QU2A 4RD3A 4DYVA 3H11B 1N2IA 1A98A 1O97C 1TTPB 5K0ZA 1NXWA 4TVKA 2VK4A 3TQRA 4UNSA 4KJXA 3W3AD 2C2KA 3C3WA 1E1YA 2H63A 1XSEA 2FSPA 1Z7GA 4G4SO 1QKIA 1V3TA 1IRIA 2FXIA 2QE7A 2F90A 3DT8A 1W4LA 4PCUA 1ECCA 5J4HA 3JATA 1UK9A 4IF4A 4OI1A 4RORA 2F7SA 4DJJA 3KB1A 1Y3IA 1XZ8A 3W5VA 2JFWA 1H3NA 3F49S 4LXGA 3K9WA 2XE8A 3ZDYB 1Q3TA 4UVGA 4W5NA 1FNDA 2XLCA 2GM3A 1KH1A 3AHCA 4ICIA 5CLIA 2BSQA 1C1DA 1VSVA 1ZM4A 4FJ2A 4LCEA 3H97A 4PO1A 3V4LA 5JXJA 1JI0A 1F4PA 1AQIA 1W9HA 1XN4A 3DTTA 4G23A 3ZC3A 3UC5A 1NQTA 4ERNA 1GCGA 4CKWB 4ADSG 4M6WA 4NH4A 4DSTA 3PRYA 3FGOA 5CTAA 1JXAA 1OFUA 3VFDA 1UJBA 2QW0X 3ICOA 4PAQA 3AUXA 1F8XA 4UQLA 5E2BA 4A5OA 1U3GA 4YRDA 2AXEA 5EZSA 5E95A 2VAXA 4IIFA 1Z9BA 1M2OA 2J3MA 3BA1A 4QHTA 1RMQA 4LBYA 3ZJ4A 1EXVA 2FPPA 2Q6IA 5HX7A 4DLSA 1GNRA 4JA0A 4O4LB 2RAVA 3WICA 1Y8CA 2PXCA 3CZQA 5HRAA 2A94A 2JFVA 1KZ1A 3RC7A 4FE4A 4ZT7A 3OO1A 4C14A 3AOEC 3VU3A 3L07A 3RUCA 2JI8A 1JG6A 2DPLA 4QUAA 4JBNA 1HT0A 1VBKA 1IULA 1RC1A 1RPTA 4L78A 1NQVA 1WP4A 3KZXA 4GC9A 3CVWA 1PR2A 2Q5FA 4OJNA 1L4HA 1XZKA 3GJ3A 3T3MB 2EGUA 1C2TA 1IPHA 3GEDA 3D4IA 3E0QA 3JASB 4UQOA 4QDZA 1FNBA 4W5WA 5DNEA 4CCYB 1JQBA 1JXQA 4FXOA 4ENPA 1XYYA 1IJKA 5KX5A 2WUWE 1UAYA 3IUPA 1YQWA 1CNEA 3ZHVA 1NV8A 2Z83A 2QLJA 3HKEA 1AH2A 5JJLA 3EX7C 1JR2A 4GL4A 2QUJA 4EO4A 3ZWVA 1XLUA 4JY7A 3R09A 3WGZA 1SC3A 3KR1A 3OEYA 2ZSIA 1RQ7A 3KFVA 4F4IA 4QJ3A 4L85A 2L42A 2QXYA 1YUBA 2H5JA 3ESAA 2Q07A 4FFBA 1KRWA 2OE2A 3AJRA 1C3OB 2P4UA 3CNHA 3LT1A 3N75A 3Q9NA 3WQHA 2AMVA 1R10A 1Y6QA 5KOHB 5BV0A 4RZHA 2WF7A 3TCNA 1R4MA 3FNQA 4H35A 4Z0TA 3HZHA 3AJEA 1EA5A 2X40A 3UCEA 2W6IA 4RVOA 2VBCA 4RUKA 4O25A 3RC9A 2UZ1A 1IOLA 5T4HA 1OZFA 5JMPA 3A4YA 1YKSA 5L40A 4A8JA 5JASA 1O58A 4MVCA 1C14A 1TZJA 1FQWA 3D8NA 3RVQA 5I01A 4JQZA 1GPNA 3W6PA 2F1OA 4EGAA 2YV5A 2WUGA 1J8VA 2D00A 1PL7A 4N1AA 1PJQA 2WINI 2C2WA 2GO1A 1R6TA 2WWVD 4DZRA 2CWDA 5AXBA 3J80A 1ODKA 1RM4A 3M1IA 3K94A 1N9GA 3NIBA 3NTXA 5JSQA 3BHIA 3L8DA 2N42A 4JX8A 5L7TA 2NAFA 4FCVA 1C9EA 2PFKA 4DL9A 3DKPA 1GRCA 4O4HB 4CM3A 1EFDN 2J5XA 3D5TA 2DFDA 4IG4A 1NIJA 4ZYWA 4Q01A 3IUQA 3TNDA 1WBDA 2XUDA 5KBYA 1A2BA 3DPSA 4K9QA 4WT7A 5ALHA 3R0ZA 2DZDA 2QPLA 1U7UA 1LDNA 5DX1A 1JIVA 1CS0B 1DLJA 4I4TA 1N32B 3HEMA 3CEPB 4XSGA 2QGZA 4BMVA 2B5OA 3A32A 3KHUA 5IJXA 1ZA2A 3CO5A 4OJKA 4PSKA 3L5OA 1YSCA 4QUBA 4QA9A 1FDUA 4S1PA 4XUGB 3C6XA 2PLNA 4GM4A 3AERA 2VDPB 4MRVA 4XYBA 4TWZA 2XCTB 3ERCA 1TZBA 4KXWA 4DMRA 1GIAA 2CW5A 4H7JA 4D9MA 2HV9A 3BT7A 1M2NA 2LIPA 2P9BA 1FDOA 3A0UA 5JS2A 3TRFA 3KQMA 4C0SA 1PYDA 4CGZA 2F4VB 2NU8B 1ZICA 2J59A 1RXUA 2ZRGA 4LNUA 1R3UA 1Y37A 3TZHA 1T0HB 1ST2A 2BEUB 3D3KA 3JYHA 4HI0E 4QTZA 5CM9C 4DMLA 3PQCA 3ETCA 2GCEA 3TR5A 4M1MA 1XMXA 1GNSA 2AQ8A 5BW8A 2AKYA 2IEIA 1PU2A 3LQ4A 2NUTA 3Q85A 4K05A 4K3VA 5H59A 4JI8B 3IIKA 1BXGA 2HYDA 4WBNB 1OSNA 1GGEA 4W8HA 1JHAA 1OA0A 3OJWA 2NYRA 4INPA 1NJ1A 1Y8AA 3DVAB 2JAPA 1DIRA 1Q12A 2WYOA 1FB5A 3PWZA 4GR9A 2QP9X 2FMKA 5AWFC 4B80A 2GLTA 4YS6A 1VQ1A 1KETA 3RC8A 1KJJA 3MTEA 4RK6A 3GHYA 3KEQA 4YP7A 1XCLA 2I3ZA 2OM2A 1Z6AA 1AY0A 3DBLA 4KGZA 2HA6A 2QYOA 2GEBA 1XKXA 3AR8A 1QIHA 2KE5A 4HBZA 2CWWA 4FCTA 5KHLB 1EXDA 1IHYA 4GMXA 1V25A 3W2HA 3LRXA 1O89A 4GSKA 2B1GA 4HMOA 3RYHA 1WF6A 3TVDA 4YNBA 3PCRB 4Z53A 2WD9A 1SC6A 1UQTA 2AYXA 4GLOA 3N0XA 5C4IA 1IBCA 1VJGA 1ZD9A 4LY3A 4ZAWA 1S3IA 1TYZA 1VPTA 1SCQA 3P96A 3GRCA 5DKFA 3LSTA 3CUTA 4J16A 2NU6B 3A05A 4G86A 5SZHB 1NI4B 4A0HA 1N2JA 1XA0A 3C85A 2GJKA 2P75A 1TRHA 4B1FA 1ZD4A 2OV8A 3R6WA 1M1YA 3HSSA 3K1AB 1WU8A 4LRXA 2B82A 2O07A 4XA8A 5B5SA 3DMGA 3I2JA 4LCBA 2J6CA 1MOQA 3O8OA 3UAVA 2ZZNA 2W5UA 3Q8WA 1SGWA 3DXYA 3LC0A 4DIMA 3HEAA 1LW6E 4B0PA 1FOEB 2E5LB 2N46A 2R1UA 2VDNB 3FPHA 3CXRA 4J9UE 3GW8A 1U9IC 3U16A 4JQYA 1NW4A 3OTIA 3UJAA 2G8NA 1IATA 4UZFA 2H7CA 4XH9B 4R40A 2I8CA 4HJXA 2HWKA 1R4AA 2OK7A 1LPAB 2DPXA 3LXMA 4D4IA 2I6QA 1I80A 1L7OA 1CY0A 3BEOA 3IBSA 4L7VA 1P1FA 1FX0B 1I5RA 2HU5A 2ZB7A 3OQBA 1WW2A 4GVXA 2JKYA 3W2EA 4TV8A 2P2CA 3CCFA 4D0SA 3K72B 4F8YA 4C22A 1VSQA 2H5EA 2IDZA 3ETJA 3GRZA 4JC5A 3HO1A 5HGXA 2IH5A 2A0YA 4FGJA 2Y6UA 3JU3A 1J70A 1SXIA 1DBQA 4ON9A 5KYNA 3THXB 1LQ2A 3KJZA 1ZXLA 4L5BA 5IUNC 2HRQA 2IS1A 1AXEA 1CK4A 4XD7A 1KI2A 1LKZA 3CQ9A 3K8OE 1U2QA 5AW4A 1QRSA 1SZCA 3JY6A 2BKLA 1KIAA 2A88A 2J9RA 3EGCA 3OF5A 5F52A 2XB4A 1FXSA 3LUDA 3W34A 1P8JA 4CMCA 5JQWA 1W36D 1RRCA 5FUQA 5F4ZA 1SEPA 1BE1A 1GKUB 4HXYA 4IUBS 2JBAA 3F8SA 4GMDA 1RRVA 2OO5C 3BJIC 1HE8B 3HA3A 3NTUA 1A69A 4YCLA 1RBZA 3L4KA 4XPZA 3NOOA 5A3JA 2ZTUA 2EZTA 3DDOA 4NH0A 5KX5F 1XNGA 2P41A 5A5DA 1KVRA 1P2DA 3IBYA 1R0KA 5H3LA 5P21A 3B6EA 4LWQA 4ER6A 1RLMA 2PS9A 1QWOA 2VAVA 4UU7A 2YOGA 3BXPA 4BBJA 3VVCA 2G36A 3EDCA 3NETA 2OCXA 1Z0DA 1QMGA 3GD5A 4FW8A 1V8OA 13PKA 3CLVA 3FPBA 4EJ6A 1MO4A 1J21A 2YHAA 3QLUC 5FEUA 4EHDA 5DPMA 4R9VA 1F38A 2CVQA 1BXKA 4YV2A 1UEJA 3V7UA 2QI9F 3LHIA 1OD6A 2WJVA 5CXSA 4JVNA 1TM4E 3L0IB 2FZ5A 3CX6A 2H8GA 1DAOA 2IP2A 4QJBA 3VR1A 4BAUA 2RHGB 1U7XA 3MMNA 3G02A 3UTDA 3ETLA 2LGJA 4HCJA 1QCCA 1Z3CA 1PGQA 1CUCA 5A7FA 2WAYA 1DPFA 7YASA 1RWBA 5JJBA 2WKWA 3QELB 1NFRA 2OT3B 4GGMX 4UCFA 4KAXA 3UJ8A 4KGVA 1LTQA 2DCMA 3QWAA 5KSWB 4BMOB 3TI9A 3HS3A 3KIPA 3U09A 2LR0A 3KQKA 1XJ5A 3CT4A 3Q9LA 4DNPA 3GLQA 3C87A 4YFVA 3BL8A 5F33A 4C5AA 1CVRA 1STOA 1WDKA 3WYGA 4FMCB 2WYIA 5CB4A 2GEJA 1GR0A 1FRQA 8OHMA 1SHJA 1N7HA 3NNNA 4NEGA 4F1WA 1FFHA 1G9TA 1U1EA 1ZNWA 3DQPA 1H93A 5IFLA 3D7NA 4R2WA 4KR6A 3JALB 3TPFA 1HRKA 2GDZA 1XELA 4CKXA 2GFHA 1CR6A 2F3UA 3T52A 2TYSB 3CW8X 5FWYA 1E2KA 3DOUA 5IJ0A 4X65B 1LWOA 1NN3A 4R5HA 3ZV5A 3ZXXA 2DHQA 5JTUA 3SQDA 1NWHA 1RYMA 4F3CA 5JH7B 1GCIA 4AG5A 2PHZA 3KT3A 1A8UA 1NPTO 3ZWBA 3RU7A 4Y8VA 4BEWA 1XLVA 3UAYA 2C3MA 4EUSA 3JQBA 1WDWB 4TPKA 3RT9A 1LCIA 1MW9X 1J0AA 4NHOA 3WDSA 2P6NA 2NU6A 3OZDA 1Q0RA 1TYDE 1BRTA 2Z58A 1X7ZB 3O21A 4HWOA 3IV7A 4YLEA 4E6PA 1V5EA 4TRMA 3LQYA 1SXJC 1XN1A 3OFNA 1VP3A 2H1OA 4Y0VA 5EXXA 1B76A 3L8ZA 2HUPA 2R60A 3KUXA 3K9HA 1RBYA 2XVAA 2V7QD 1JEDA 2ZE5A 1YKFA 4EPTA 1QS0B 2WTXA 4WXHA 3GUYA 3PX2A 4PSCA 1L4UA 2YV1A 3L41A 5EHXA 1LJUA 2PUCA 1A77A 3QV1A 5FTKA 2HW8A 2O8FB 1GSAA 3LNCA 1E3JA 2GYVA 2PK3A 5JPCA 3GWZA 4K1LA 4IQ0A 4G24A 1ZU4A 4MP3A 4OBEA 2OC9A 1X8XA 2O2HA 2QOEA 3SDZA 1Y5IA 4IVPA 4K9KA 2EKPA 1YBVA 2V6GA 3OBIA 1XD2B 1JL3A 2NTNA 3AINA 3L1IA 3QLVC 3O1LA 4QRDA 3WC4A 1TMOA 1ISHA 1UXOA 2EZ4A 2VPPA 1XZEA 4FOTA 3WRVA 2GNOA 1AHPA 3VU9A 1ANKA 3FDFA 3IE0A 3OIFA 3PA8A 1CLEA 1GRQA 4H59A 4P84A 5FLYA 3PEYA 5J3JA 3A1EA 1XVLA 2C95A 1X74A 3BG5A 4GRAA 3ZK9A 5KOIA 1DAHA 3GWGA 3QSGA 4IFIA 4BNDB 4KXFB 1QDEA 3O8RA 1NQ5A 3L82B 1RQRA 1YU6A 3EPJA 1ODLA 3OLZA 1RAFA 4HN4B 1D2NA 1DQRA 5LDHA 3S2ZA 2VWQA 1P81A 1UR5A 3JWGA 1ZDMA 2PKRA 2PLAA 4B09A 4TTTS 2MYPA 3CX7A 1PFVA 3N76A 3WGVA 4MLCA 3LOPA 4QAQA 1CY6A 3DMPA 1C9YA 3RS2A 1DV1A 1OC2A 1KO1A 5J4YA 3E53A 1M8FA 4BQFA 4CEJA 4DF3A 1WMDA 1N3IA 4F56A 4HN2A 5KTYA 2MSLA 3GLFA 1QHGA 2P77A 3WLSA 3URMA 4DLVA 1NNI1 2IS4A 1FFSA 1TC1A 5BSGA 2W93A 4TN1A 1KERA 3CZ5A 2FR1A 4QICA 3OFND 1ULUA 2CUTA 4RA6A 2JHFA 4AJ1A 3WKEA 5K0CA 4RWEA 2WNSA 2Q0QA 4Q9KA 3OQMA 3KYBA 3LDGA 4IH9A 4IHQA 3ZHQA 3IRVA 2JLCA 4MR9B 4F1JA 2NUAA 3WQRA 1OBCA 5ALZA 1M5RA 3Q7QA 1KPHA 2Z5FA 4CL2A 1YTUA 2H0RA 1EFLA 2QIOA 3OIWA 2IYWA 3GZTB 1GUAA 1TK2A 5DWVA 1QH8A 4NK5A 5EKXA 3WJ2A 3WYDA 5IVKA 3ZU5A 1E6CA 3ESBA 1FJGB 4B44A 1QTNA 1YCFA 4M9RA 3EDRA 4LRUA 2FMFA 3HUFA 3RYIA 1QIMA 3FFWA 1B74A 4YJHA 2LKCA 2AJDA 5BQOA 3RWMB 2A5DA 3WWPA 1TYCA 5B1YA 4C4RA 3SF8A 5LLSA 4FEYA 4TN5A 5DTIA 4BIIA 3I5XA 4YWHA 4JQOA 2I6GA 2QX7A 4K0KB 1DX6A 3H84A 5C52B 2P4EA 2HCRA 5H9VA 4OM7A 1M1YE 2JGEA 3ZHZA 3ZZ1A 2HSEA 3GEHA 2GF0A 1WOMA 1T2CA 4FFLA 4GQAA 4IFTA 2O5RA 3L7OA 3H5WA 2JLAA 4CN9A 2A84A 2DWOA 1T2EA 1WVMA 1Z37A 2PMWB 4RU1A 5HF5A 3T3OA 1A9TA 1PS9A 2IIQA 3CVJA 3OY2A 4CM7A 3U49A 4OP2A 2JATA 1E9FA 1WUYA 3TL6A 3O8QA 4LYDA 5COAA 3L77A 3DMTC 2OBYA 2Z98A 1BEEA 3I58A 1Q77A 4JJ6A 5HTOA 2OV4A 2DHDA 1TU3A 2NAPA 4M83A 2EP5A 1HL7A 3KVOA 2I1WA 3PR3A 4PNHA 4C3UA 2C5EA 2VF4X 4CTJA 1A50B 4UFNA 3A28A 5EJGA 5A9RA 3E18A 3C39A 1G5QA 3PI7A 4BBZA 4MMYB 1U2ZA 2CNWD 2VLBA 5CYPA 5LZ4A 1CYEA 1C8KA 3M7IA 3PRKE 4UU8A 5C7OO 2Y0PA 3RRFA 5AK6A 3Q1LA 2GBPA 2D59A 5JXWA 2IEBA 5E9AA 1BEZA 1N0VC 3D6JA 4EMUA 4TTIA 1QX4A 1NJ8A 4N5NA 3TI7A 3CC8A 2BLLA 2Q2NA 3PQ7A 4EUEA 1DGQA 3TINA 3V8PA 1XMJA 5BNFA 3TLAA 2IYLD 4UXJA 1DAGA 4KRGA 3ENWA 2OGSA 5CNIA 4F6LA 3H0KA 1RHKA 3TN7A 1V6AA 1BFDA 2CHVA 5A62A 2X22A 3K20A 1YZFA 1T8YA 4G0UA 3DJYA 3H1GA 3HGMA 3NORA 4M4SA 5I9SA 3K0FA 1HDZA 2ON6A 4ND5A 3QX8A 1P39A 1MJGM 1FMTA 2W0MA 4ZPJA 3HK2A 5LB4A 5BVHA 1YOVB 4HH4A 5DGHA 4D9HA 5KYGA 2XKJE 4AK9A 1P7ZA 2FMHA 3OJEA 3ZWPA 1JAZA 2DHCA 4G85A 5I7RA 2PSJA 2GKSA 3V6MA 2O8FA 3EFHA 1AKUA 3OA2A 3TW0A 2XZDA 4EKYA 3C45A 1RWPA 3X1KA 2IF2A 3SM3A 4D9KA 3TG2A 2ERXA 4JSTA 5DCYA 1L9KA 5JEEA 3ZHYA 5ALVA 4DNXA 1KWGA 1KFKB 4DLLA 4D9EA 2VDLB 1QAMA 1ZUHA 2RGBA 4B7AA 4MVJD 3EQ8A 5DULA 3FCXA 5C9ZA 3RKSA 3PL5A 4GOMD 3UHPA 3T7SA 3TLBA 3S2EA 3VUFA 4H3KB 3IVAA 4JVSB 1WCXA 3KYCA 3DG9A 2P2DA 4GI2A 1LW7A 2ZRCA 2IZ7A 5ER6A 1I0IA 4DV4B 3HVKA 4XVUA 1R0LA 4OM8A 3JQAD 2HLDD 3GFQA 4K6OA 2Q0SA 1J39A 4I6EA 4OAQA 4B76A 3WBKA 4BTEA 1P1KA 4IFBA 1C80A 5SY4A 3L7MA 2YZNA 3RKRA 4CCYA 3HM9A 3UMYA 5EFZA 2O7VA 1GWNA 2YIJA 4YCCA 4FD3A 2BCJQ 1EDDA 2C4MA 3C7AA 2YASA 5J23A 4Z4EA 1U2PA 2X9QA 3FMFA 2G63A 1V26A 2Y1LA 4LNHA 4MV4A 4YVFA 5AKXA 3C8ZA 4MV6A 5AJUA 1C4KA 3WXMA 1I2AA 1QO0D 1SXJB 3CUKA 1XKLA 4NJOA 5DMXA 4WN9B 5AW7A 4ZYZA 1XTTA 3DCIA 3R4VA 1QFYA 3GPLA 1WBBA 3L0DA 2BBOA 5JDCA 4JYMA 5TS3A 4QAJA 2GJ8A 3T0IA 4R0NA 4BC1A 4UZSA 4UTVA 3KQLA 1P5ZB 5THQA 3V8MA 3VVMA 1DAEA 1OYVA 1P0MA 2P6MA 4UTZA 1VIAA 3PB3A 4LYJA 2XWJI 3ESZA 3LO5A 4OU5A 4E5DA 2L82A 1P7WA 3G8BA 3L6BA 4C0JA 3G7NA 1XEAA 3ETDA 4DGSA 5A4DA 4K9OA 1ZM9A 3W8EA 5A5EA 2FJUA 1UPFA 1B6GA 1MEEA 3GQVA 1IM2A 4JI0B 2Y0BA 3WTCA 3OT4A 1U98A 4LDJA 2B3DA 4PGFA 1DZIA 3GC6A 3WRYA 3PJRA 2ZJ5A 3CZCA 3FMPB 3ORSA 2OECA 4ZIRB 3VR5A 3W5IA 1LV7A 4BB9A 4MWTA 3DEFA 5CVVA 1I4LD 3PSAA 2I03A 1KI9A 4J3JA 1F6DA 4FN4A 1NBHA 3S1AB 5A4AA 3RGWS 3V8VA 4YGXB 1PJ3A 5I3CA 4PSAA 3R7SA 1A5TA 2VZ9A 1KZYC 3EOZA 3GT3A 1JDSA 4YJGB 5L4LA 3DDWA 3H7IA 2B99A 4Y1RA 2VVTA 4FGLA 5IZ4A 1OIVA 5FNVB 3NOXA 1GM5A 2PKQP 4OLBA 4LV5B 4YRBA 3M70A 1E3WB 1M33A 3DAGA 1K0FA 4A0FA 5FUYA 3C5VA 1SUDA 1PE0A 2FEOA 3U1VA 4DWVA 4EARA 5JRJA 5FL3A 4I5GA 1AA6A 4Y7DA 3TPCA 2HMYB 4CLOB 1CJBA 4NAUA 4XDGA 3ZKAA 421PA 1YQ9A 4HTFA 4DQLA 1WMEA 4AI6A 5TSDA 3R9WA 2P3LA 3U7HB 2EZUA 3DFKA 3MLEA 3NIGB 4H16A 1ESZA 1AHHA 1P91A 3FPLA 1QU3A 3OQHA 1KU0A 5ECYA 1NMYA 2PD3A 4E5VA 3O8LA 3HR4A 2IIBA 4PHHA 3UAGA 4FYHA 3ZNPA 4DGQA 3JCZA 4ETWA 4Z51A 3EE6A 1J99A 2O3QA 2QLMA 4YRIA 3K70D 1T8TA 3QPDA 3E05A 2XIQA 4RLFA 4C4YA 1LK5A 2EZ8A 3ZE7A 5HM6A 3O03A 1GCAA 5ALKA 3BS4A 4MVJP 2YFQA 1FTYA 5DISB 4RZ3A 8GPBA 1W44A 1N5LA 3DUFB 2NU8A 5IX8A 5JO9A 1IONA 1J20A 2PN1A 1RXSA 2QAGB 2G1KA 2QE7D 2VRCA 2XUKA 3COVA 3GEMA 2IE8A 3OMXA 5TJHA 4CLHA 2AFVA 4WUVA 4C0HA 2QI9C 1C3OA 1YL7A 3Q1KA 2G80A 4L8VA 2IY9A 4Y9SA 2ICAA 3GQBB 2WMNB 2GOYA 1RNLA 2GSDA 2Q2VA 5C3MA 2PQMA 3KPJA 5ALQA 5EIBD 1ZR2A 1MV8A 4B6SA 3QXCA 3GVCA 1P0PA 1T0PA 3UV7A 4BB0A 3L4EA 5J2UB 1FU8A 3AVTA 2BFWA 2CSUA 2VDUE 4RABA 4BFLA 4Q3BA 2OPHA 1LC0A 4E2FA 4UAUA 2WILA 2NOAA 2UYQA 5BRJA 2P3OA 4HPXB 4GDFA 2BMJA 1AMNA 4EFDA 1C7QA 4KXXA 1H0HA 2OHXA 4ARCA 4Q4AA 4DJEC 4O1HA 2FHSA 1MAWA 4CU2A 2C97A 1KH2A 4HH3C 4LY6A 4P7GA 4QULA 4F97A 3ASVA 3THOA 2YVUA 5IVPA 4ECAA 5AOCA 2B1IA 2ZKLA 2SCUA 2I1VB 1WO8A 2Q1XA 1WXWA 2OBBA 4G4SP 1WW3A 4CIDA 2JFBA 1IZZA 4KQHA 2C59A 5GONF 5DLEA 3MT9A 2VXOA 3GPBA 1ZCFA 3OUUA 4XFJA 4YCNA 1KSHA 2RB5A 3RSHA 1E58A 5C35A 1MZPA 3KT6A 3MRVA 1G5HA 3I73A 4RZQA 3IKJA 2AEJA 3RVOA 3P9XA 5A4KA 4E15A 1K5PA 4KBFA 3ZZTA 1ZK1A 2JZCA 2PQ6A 3DL0A 4MEBA 1B43A 4WK4B 4A7PA 4B6GA 1W93A 3U3MA 3TBHA 4DR7B 4BNKA 1XD8A 2IDMA 3NYQA 4CMIB 2ECPA 2B34A 3ORQA 3HBJA 4Q3KA 1HG1A 1J1ZA 1KDVA 3WQSB 3ZWWA 4EG7A 4JVOA 4D8XA 3IIIA 4HWTA 2NUPB 1AK2A 3B82A 1E1CB 2OQIA 4QLAA 1KDTA 5FTJA 1ZIOA 4ZQHA 5A7GA 3O8DA 3CS3A 2PX3A 3CSSA 5FPQA 4L50A 3VAAA 3KVNA 3PIIA 2P3QA 3FOZA 2ZUSA 4XIGS 2L69A 4DMUB 4Z54A 3AKEA 4DCPA 3CBGA 3K7EA 1TVMA 2HF9A 5KAPA 5KYXA 1P0QA 1G8SA 4M9XA 1XO1A 1OY1A 4FYIA 5EUQB 5D7NA 5EIWA 2NV0A 4MKXA 5ENDA 2I4NA 4RFSA 3IHWA 4XLLA 2CLHB 5E4JA 1OA1A 5BSMA 1XA3A 1N3BA 1GKYA 1KK3A 4K0RA 5TQ0B 4FBLA 3TX2A 3WNCA 4DCNA 1XA4A 5L7WA 5A4IS 2A9QA 1DOZA 4C2BA 1CUHA 1DQZA 3FMIA 2BIFA 2PRJA 1VJ5A 1OLXA 4IR7A 1HC7A 4YRJA 2O4CA 1XGKA 4TM8A 4LE0A 4TL7A 4J29A 5EZYB 1OWLA 1PFUA 4LN1A 2FN7A 3DFIA 1GSHA 1Q7GA 2VF2A 1DDIA 3CUYA 1E0AA 4HDKA 2LCFA 2X8JA 3ZV3A 1L7AA 1BXRA 2RGAA 3AOEA 5EHGA 1MDFA 1N5JA 1QB7A 1YZHA 2X41A 5L4SA 1X9HA 2WYWA 4TQGA 3B3JA 3LDHA 4BNJA 1TJPB 1PJTA 1PUXA 1YULA 2VHWA 2WM2A 3B8EA 3G2IA 3VYWA 4JT8A 3S28A 4YYZA 2Z1MA 1JYSA 5E0OA 3N8KA 4DAOA 1K06A 4U2EA 1S9DA 1E59A 2HMWA 4QIHA 5C34B 3W9BA 5TIIA 3U4QB 1DG3A 1R15A 3PNQA 2CCKA 4CMHA 1RHRA 2PRIA 4N6GA 4NZYA 4YAKA 1HPLA 3VNAA 3FIJA 3MLAA 3MSXA 3FTCA 4W7SA 1Y1PA 2E89A 4FHZA 4QOHA 4RF4A 4Z9XA 3RNLA 1XTJA 1OX6A 2Q5HA 1Y4DE 2QD5A 1VKJA 5ALNA 2V7XA 2QXUA 2W0SA 2D1RA 2J7KA 1JU3A 4KC0A 4UHCA 3Q15C 4Y1GA 4MV7A 2JCVA 2PZJA 3CE6A 2QVXX 4KYUA 4Q03A 4JL5A 2DU8A 1AU9A 4P34A 3KXIA 5JRDS 3WYAA 2O0JA 4HDNA 4PC1A 1GUDA 3CKLA 1JG1A 3HMKA 3QE0A 1ACMA 4CDNA 1R7RA 1KO5A 2R66A 1VPVA 2CZGA 1PR1A 2QD1A 4D74A 5KWVA 3CX4A 2JJ2D 4V3CA 5FEMA 5F3WB 3QP9A 4ZVRA 3STTA 2A5GA 4OHYA 1B23P 2DGDA 1BXZA 4EHHA 1GV0A 2CJWA 1U80A 3SK0A 3HNPA 4AT1A 2LD4A 3I9KA 4GEGA 1T5BA 1R6AA 1QHHA 3GV0A 4DYHA 2B69A 1DKLA 1QK4A 1X80B 3NZEA 5AT1A 3JD4A 1GA6A 1UMBA 4WXPA 3LK6A 1YI1A 1NOKA 5IANA 4S2UA 1FPQA 5LL6P 2UXBB 1J4AA 4K6GA 3ZLBA 2KX7A 4XFKA 3FZNA 2OG2A 1QRRA 1UOEA 4BNGA 3KWFA 5DM60 2IEAA 1RM5A 1T5DX 1X19A 2DBVO 4EPWA 1D04A 3VBEA 4K81B 1W4ZA 4UTPA 2AUTA 1RLTA 3DEAA 5KMGA 4Q9LA 2PPLA 2VTKA 1V6CA 3I42A 3PDUA 2R2AA 2OYSA 1OH6A 3VH3A 2UVPA 3QOXA 2Q4BA 4TSFD 2JGNA 1FFXA 2RMKA 3F7TA 1BROA 2HT6A 4B7CA 5JECA 5I9MA 2OXCA 3CLHA 1WSAA 4DCGA 2ZIEA 4QYXA 3FTPA 4O08A 1N8SA 1JA1A 2DUUA 1SHTX 4RIEA 2J5RA 5LZ5A 3JRWA 3NHJA 4LOHA 4P2BA 1JLHA 5NLLA 4OQMA 3DLPX 4G3XA 1ZMOA 1JMKC 5K4AA 4EFKA 1BE6A 3LNTA 2ZJBA 5E7JA 4AMGA 1I5OA 5CLQA 4C0XA 1B0AA 4F71A 1CV2A 3BIWA 1M34A 1PWXA 3KTDA 4GPZA 4U7GA 5H81A 3V8BA 4WE3A 1VJ1A 2EEPA 4BKUA 1BFUA 2WE8A 5CEEA 3QLUA 5E0KB 2ZKIA 2XBUA 2AJBA 4MQUA 1JLSA 4ARSA 5TDHA 2AH5A 2ZBDA 4IDHA 2PZ8A 1BE8A 5JY1A 5GAJA 1B3RA 1EBBA 2QR2A 1UQRA 3H2KA 1IN4A 4CMKA 4FVTA 3HKBB 4RKFA 1TKBA 3T8YA 5KJCA 5BMOA 2SKEA 2JRLA 1QS0A 2XB6A 4XR9A 2OR3A 4GMGA 1ARZA 1QH0A 4JBWA 4PFJA 2P6RA 2DE0X 4A0RA 2EJTA 1YR6A 2ZSEA 3HPQA 3I2IA 3WBJA 2C5SA 5CVJA 4BX3A 3RVBA 5G2OA 1Z7WA 3TUZC 4TV9A 1O77A 2ZFUA 3HDYA 4KIUA 1E6WA 2MINA 2BE9A 3BOSA 5K8LA 1WSBA 2J85A 3FJYA 3KQSA 3RANA 4MIEA 5AVSA 3EOBI 2K4MA 2VT2A 4AMZA 2NNLD 4B32A 2KLHA 3DDCA 1FXWA 1WWKA 1QFSA 2IXTA 3KWLA 4WA8A 1TUEA 2GR9A 2EKQA 4FFOA 5B1SA 2FSVA 2GPTA 4QUIA 1VYHA 3MUEA 2B7BA 2WKRA 5GY7A 1JSXA 1OJLA 4JUBA 1K1EA 3RABA 1LEHA 3SIWA 3TMYA 2Z8YA 4G9EA 2HJ9A 3L0PA 2AF3C 2BKAA 2G25A 2C5HA 1EZ4A 3MF4A 2QMYA 1RCTE 1UM9A 2V4MA 4TT3A 4DIBA 1B7GO 1C4OA 2R3SA 3KT0A 4PW0A 4J16C 3P45A 2QMQA 2NM0A 3OJ0A 1RBQA 1MRSA 4LGMA 4QREA 4N7JA 5H9WA 1XL1A 2OY0A 1VDMA 2FWRA 3LGAA 2DTDA 3EQ6A 3AIIA 4YMGA 1DIBA 5JSZA 1X13A 5JAMA 3L0YA 2WSSD 2FPLA 4QGBA 3EEIA 5D5HA 2Y6VA 4JP5A 5B3JC 3JQBC 1C3LA 2XI4A 3HRIA 1OX4B 3OOWA 4H27A 4LYAA 5B7QA 5EY5B 3RUI