5HBRA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
464
structure length
464
Chain Sequence
MNDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 170
structure length 464
sequence length 464
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hbrA01
3AI2A 5FWNA 1U7HA 3QY9A 1HDRA 1NASA 1BHSA 3K96A 1HWYA 4EJ0A 5G0VA 3DQPA 1T1SA 5KJFA 4IGFA 1PS0A 1D4FA 1PJQA 2PD3A 1PJ3A 1WW8A 1YWGO 3GMDA 4L9RA 3RKUA 4DRYA 1KBZA 2J5KA 1AHHA 2WYUA 1DSSG 4L0QA 3DTTA 1B8VA 4NI5A 4MIEA 3WSWA 3F1KA 3NJ8A 4KDFA 1MLDA 4FJ0A 3I1JA 2PGDA 1TT7A 2PD4A 4PLGA 4MVJD 3C1TA 4WJZA 4J1TA 1RM5A 2VTEA 3GGPA 2VNSA 3ZU4A 3T7EA 1EUCB 1YJ8A 4Q3DA 2X7HA 2Y0DA 4UVGA 4QFDA 4XYBA 2HJSA 3TZQA 3WICA 1YQDA 3F4BA 4IDCA 4MVJM 1N5DA 4IJKA 4MPDA 2QX7A 4FOOA 1G1AA 2Y1GA 3E6AA 2CVQA 3TZHA 4OGWA 3AUSA 4AJJA 3OIFA 2XXJA 1Y9AA 2OP0A 1BXGB 1QRRA 4E2ZA 3S8MA 4A5OA 1Y8QB 4WK6A 2BGLA 3I4CA 1DJNA 2Y1OA 1D7OA 4YAJA 4WE3A 1I33A 4IM7A 4YJFB 4YCAA 3JQFA 3PDUA 2EERA 2EV9A 2FZEA 3F46A 5DZSA 1TT5B 4JX8A 3ZWBA 4PG5A 4I1IA 3GF4A 2IXAA 5JYDA 3EAGA 3U3XA 1D8AA 2EGHA 2JAHA 3VPHA 1G0NA 2WWRA 1E3EA 4ZQHA 3RUHA 1H6CA 1U1IA 1AXGA 3I6QA 3CXRA 3ZU5A 5B37A 4B3HA 4XX0A 1E7RA 2DBZA 4C7JA 4LK3A 3TOXA 1ISFA 4D45A 4FR5A 4Z3DA 4WOJA 1U8XX 4ALKA 2X23A 1TB4A 1IYZA 1I36A 3VPFA 1O89A 3BMNA 5ER6A 4K28A 1PJ4A 4NIMA 3ZNQA 3BAZA 2ZYDA 2YV3A 4J91A 1TLTA 2JKVA 1JQBA 2VZ9A 1PGJA 4Z9XA 1DHTA 4EW6A 4A27A 3CINA 3TRIA 1ZJYA 1U5CA 3IDSA 2JFFA 3PHJA 1Y6JA 1EK6A 1JAYA 2CF6A 2W4QA 4RL6A 4NMHA 2VOEA 1GR0A 1E5QA 2W2KA 2HSDA 4RDIA 3I3OA 4EI2A 3ZI0A 2O7SA 4JBHA 2RIRA 2X9NA 2Y0EA 1E1LA 1O0SA 1K3TA 3FR8A 3RQSA 1EDZA 1XR3A 3SVTA 4BNIA 3L9WA 1E77A 2AEJA 2B4QA 1GUYA 4Y6SA 5EINA 1OC4A 1H2BA 3VPXA 3GN2A 1GUFA 5EMHA 2IYOA 2CY0A 1X15A 2VYVD 2AQHA 4AJ1A 2OP1A 4WPGA 4GPD1 3O8QA 1C0IA 4AJ2A 1J6UA 1ONOA 1SMKA 2AEFA 2YZ7A 3PHIA 1PGOA 4YT5A 5CAEA 1JLLB 3GVCA 1QORA 3BA1A 4RVSA 3A28A 2NM0A 4NJOA 5DBFA 1NQOA 3SC4A 1ZO8A 2BFMA 2VQ3A 3D3EA 5IXSA 5T6BA 2Y05A 1GD1O 3DMTA 4UEJA 3UCXA 4HNGA 4CQLA 1XG5A 4GX1A 5CPBA 4AICA 2D5CA 4PLFA 2VHVA 2VYNA 1J4AA 1R4NA 4FPXA 4ND4A 3QSGA 3GN1A 3H9UA 4BNHA 2NQ8A 1R4MA 2AXQA 3K6JA 4GX5A 4A7PA 4D46A 2ILTA 1JVSA 5B12A 2C7GA 4HFJA 4IDEA 3SEFA 3JQEA 2Y68A 3NDJA 5JO0A 2Q2VA 3AOEC 3L77A 5JO9A 4CMHA 3NV9A 2PR2A 3UGKA 1AE1A 4I5GA 3Q0EA 3V1YA 1EE2A 1HDXA 1M75A 3TN7A 4YRBA 4WNCA 1WLYA 2YYYA 4YJGB 4NU5A 1I2CA 3N7UA 4O5OA 4KUGA 1EQ2A 4FFNA 2DVMA 4H16A 1ENPA 3RC9A 3WWYA 3UFXA 5EESA 4W99A 3ICPA 1QP8A 3OMLA 3PZRA 1Q7BA 2JD1A 3QA9A 4Y6RA 3RFXA 5A9SA 4E5YA 1UXGA 4JP2A 1P31A 2AMFA 3MOIA 3AY3A 4RV9A 4XD2A 2GGSA 1WVGA 1AXEA 2X6TA 3G79A 1IUKA 1VJ0A 5KIAA 4W82A 3R3JA 2GYYA 4LMPA 1LUAA 1B0AA 3DAPA 3TF5A 2YHUA 1QV6A 3EYWA 3CH6A 3NX4A 1PQWA 3D5TA 5T8KC 3WTBA 2CNBA 2ZTLA 4QSMA 1C0PA 5CEJA 1MG5A 4XB2A 4XEHA 4IPTA 3ZWXA 1E5LA 4CV0A 1MC5A 3I6IA 1RKXA 3W8EA 1I32A 4IQ8A 4R4JA 4XIJA 3G1UA 1HDYA 2NU7A 2RHCA 2IYPA 4A2CA 3Q2KA 4ND1A 1LBEA 3H2SA 1XELA 2YDYA 3WG9A 3ZCXA 4HX5A 2WEKA 4WGGA 4FFOA 2H1SA 3TL2A 1JW9B 2D4AA 3FRJA 1V3UA 3H65A 3R0IA 2FY8A 2GO1A 3HNPA 4IINA 1M66A 4DPMA 1ULSA 2D0IA 3GNTA 3H9QA 4K6CA 4LVUA 3GUYA 4CM7A 3R1IA 3NTOA 2ZB3A 4D42A 3MWEB 5F1PA 3ANLA 1YJQA 1BVUA 3Q11A 2WD7A 3ZN2A 2A92A 5JCJD 3JD2A 4NPCA 1DXYA 2GZ1A 1DIHA 2WYWA 2FPPA 2J3KA 2ZQYA 3RU9A 2I3AA 1ZVMA 3RUDA 2J5QA 3AM5A 4Z9YA 2P9CA 4J3FA 4ALJA 1KEUA 4IDAA 4N54A 5JS6A 3DMYA 2JCXA 3DONA 4TKLA 1BMDA 3EY4A 1GY8A 2IZZA 3A14A 4D3DA 4WCFB 1U3TA 5C5IA 4WECA 1HZZA 3S2GA 3I9MA 5THQA 3KETA 3OBBA 4CQMD 4J2OA 3PLNA 5JAZA 5I9NA 1PR3A 5IZCA 5KJ1A 1H6BA 2HDHA 2YHIA 4BNYA 3MWDB 4YRAA 1ML3A 1AGNA 3F6YA 2X0IA 3ZWOA 1I3MA 2UAGA 3DEYX 1BG6A 2HK9A 3PZBA 4IJUA 2NU6A 1MUUA 2GASA 4R5HA 2E4AA 3TZCA 1SB9A 3TJRA 1RM0A 2B35A 1ISMA 5L7WA 4I9UA 3PIIA 4D7AA 1ZKMA 5JLAA 2UUPA 3QQPA 4CMIA 4PG8A 4Y9DA 5J23A 3UOGA 3EZLA 4NJMB 1HT0A 1JA9A 4HFRA 4IDFA 4IMPA 4XYMA 1YB4A 3MTGA 1ISIA 4NFYA 5MGBA 3OEYA 1VE9A 4O6VA 2GUGA 4NBVA 1I3NA 3KYBA 3KM0A 4CLDA 1P77A 3ZWCA 2P5UA 3EK2A 5JAIA 1HE2A 5JMPA 2DAPA 2NSDA 2IZ1A 3D3WA 1P45A 4BO5A 3NTQA 1M6WA 3LC7O 1GYQA 1N2SA 3L4BC 1ID1A 3K31A 4BV8A 4I08A 1N8KA 4BKOA 1B3RA 1AN9A 1PR9A 3OETA 4XRRA 4DLLA 1P33A 3RFTA 3BMCA 1DFHA 1E3JA 1V9LA 3OJ0A 4Q39A 1LJ8A 4BGUA 1ORRA 2C20A 3H8VA 2P68A 5ICMA 4WLVA 3JYQA 3QVTA 2HCTA 1Q1NA 4RVHA 4BS9A 1SO8A 4QX6A 4RF3A 3D4OA 3I4FA 5A9TA 2P2SA 4DMMA 1E7QA 4R1TA 3U5TA 3WIDA 2XF8A 2CMDA 1NFQA 3ITDA 5G4LA 3RUEA 1ZK0A 1DFGA 2QRJA 4WEOA 4NQZA 1H94A 2VUTA 2YUTA 4A73A 3WMWA 2PY6A 2C2XA 2FZWA 3AY6A 3RUIA 3JCZA 1HRDA 4JGBA 2AA3A 2FRDA 2WD8A 3PWZA 4OHUA 4ILKA 3WXBA 1WZIA 4YWJA 4IXWA 4R1NA 3DBRA 4W7IA 3DZBA 4Y8VA 2Q50A 1BDBA 4IQGA 3JQBA 1DO8A 2NTJA 3B1FA 3OEWA 1N92A 4DIFA 3AFNA 1PQPA 3PPIA 1A5ZA 3IJPA 1BXKA 2G1UA 3RJ5A 1YL5A 4R54A 2DTXA 4LW8A 2AG5A 2DUWA 2GLXA 4CMJA 4E5MA 1F14A 1WMAA 1QG6A 3KEOA 4YT2A 2X5OA 4GKBA 1YH3A 4Z3KA 3DDNA 4LCEA 5U1PA 1DRWA 2UV8A 4PVDA 2J3JA 4BQRA 1X0VA 3RBXA 3WQSB 5DULA 4BL5A 1MG0A 1R0SA 1ZMTA 5L53A 5CHEA 4JXKA 4MOWA 1IPEA 1X13A 1XWFA 4DQXA 4IJVA 4M86A 2HU2A 4K9DA 3WQRA 1Z6ZA 3QHAA 4RLHA 2IXBA 4DL9A 1EQUA 5HA5A 2WDZA 2I67A 4PLVA 2Q1WA 4R69A 1SCUB 1KVQA 3PHGA 4YT8A 3OJFA 4L4RA 2Z1NA 3I9OA 5C7IO 2IEBA 3OH8A 1C3VA 1KS9A 1F8FA 3BHIA 4ZA2A 2C7VA 3ADOA 4QTZA 2PWZA 4AJPA 1O8CA 2RH8A 5JAQA 3RI3A 2NU9B 2NADA 4KUHA 5TQVA 1B15A 1XYGA 4CM6A 4ZICA 5BQFA 3GLQA 1HTBA 1I2ZA 5ITVA 3GAZA 4YEDA 3UICA 5A06A 4AJ4A 3GDGA 1GAEO 3ABIA 1LDNA 3NGLA 5IG2A 4CV2A 2FPGB 2HK7A 4IS3A 1IB6A 1O94A 5JDCC 2PZJA 3FPCA 1ZUD1 1Z45A 4YB8A 3V2GA 2P91A 1KC3A 1WP4A 1H0KA 2PZLA 3H4VA 4TMFA 1U5AA 3S1LA 2BH9A 4OXNA 4EBFA 2UDPA 1AHIA 1HLPA 3JQGA 3RBVA 1W73A 3FNHA 5HM8A 3KSDO 2J5RA 3BTOA 3ICCA 5L4LA 4HP8A 1P1KA 5A3JA 4H3VA 4WLUA 1CIVA 4D43A 3JQ9C 3VAZA 2QW8A 4AJLA 1PL7A 2WE7A 1U9JA 2J6IA 4PZEA 4MDHA 1CWUA 4XJSA 5H81A 3FWZA 3C24A 1KEPA 2EKQA 1F0YA 1PZFA 4PN3A 1GU7A 4FJ2A 2C2YA 5DN9A 3V2UA 3ROPA 1DFIA 1Z7BA 3BMQA 3ZV3A 5JC1A 4BNTA 1LC3A 4RVUA 1I5RA 3VKUA 3DB2A 5EQFA 3E9MA 1E6WA 3SLKA 1Q0HA 2WYVA 2GNAA 4CM4B 1XIVA 1QYVA 4F6LA 1NWCA 4DQVA 4CMBA 1VSUA 1B2LA 2WTBA 3OQBA 3SX2A 4IZHA 4ALMA 4N5MA 1FDVA 3PQEA 2Q46A 3SBOA 4Z0HO 4DVJA 2Y1DA 2P9GA 1Y5MA 4GH5A 4D79A 3T7CA 1L1FA 3UHAA 5L7TA 2Y93A 1K89A 2PH5A 4DBVO 5K0ZA 1KY4A 4RPHA 3B6ZA 4YQZA 3GT0A 3DZJA 4YJGA 1Q0LA 3INRA 1HE3A 1T4BA 2XXBA 4F45A 3DC2A 5B1YA 2I99A 5IDQA 2ZTUA 4HV4A 2C07A 3ONFA 2B5VA 2C54A 3G17A 1LDYA 1QXSA 3HUDA 5JDIA 4HBGA 2NTVA 2FSVA 2Z1MA 3WLFA 2V65A 1H5QA 5T5QA 3ZV4A 2F00A 3OJEA 4XGNA 3HE3A 3LQFA 3M2TA 3NUGA 4ZRNA 3IKVA 2BMAA 3ULKA 2ZIZA 5G0SA 2Q49A 3OICA 2OOSA 1Z73A 1ADCA 2Q4BA 1DHRA 1H9AA 1UXHA 4KZPA 4BO1A 2EWMA 3GEDA 4J2HA 3JQ7B 4ID9A 3L0DA 4CR8A 3RD5A 2EJVA 1U2DA 1GADO 1ZSYA 4AJKA 1GDHA 1HYHA 1LQUA 2EF1A 3Q3CA 3VH4A 1VPDA 2X0RA 4MVJA 1NR1A 3ENNA 1GTMA 3GVXA 4URFA 4GMGA 2FR0A 5ENDA 3WGQA 1EUDB 2F1KA 4EZBA 1E1MA 2DUUA 4MJLA 1K6JA 4J4TA 2H6EA 2P5YA 3U0BA 1MA0A 5KKCA 1C1XB 3VDQA 4E6PA 2DPHA 1RYDA 2C5AA 1T24A 1N9GA 1U3WA 1GCOA 2D3TA 4OO3A 3GPDG 3Q9UA 3VH3A 1E6UA 3UN1A 5DP1A 4MVJG 1I8TA 1TXGA 4JCOA 4MIYA 4OAQA 4PVCA 1W8DA 2ET6A 3KSUA 2VWHA 1SEVA 3ON5A 3HB4X 4QT0A 3U4CA 4BNVA 4EITA 5G4KB 5CG2A 4CMEC 4KWIA 4CLXA 3GNSA 4NBRA 3C1AA 1OMOA 3GDFA 1WXDA 2YY7A 1XU9A 1E7MA 3NT4A 4B7CA 3K8ZA 2Z95A 5I8WA 3DO5A 2O2YA 2O3UA 4ALLA 3LLSA 2E6UX 1YONA 4ZD6A 3DZIA 2HJRA 3JQDA 1TVEA 1JAXA 4LN1A 3PWSA 1NR7A 1KVRA 3FTNA 3H2ZA 3QWHA 1C1DB 4MP3A 3RBZA 4BB5A 1PZHA 3WSVA 3X2FA 1IPFA 4FFLA 5TJ9A 3EC7A 2NVBA 4XQCA 3LT0A 4WCFC 4J7CA 5HRUA 2O3JA 2PKRA 3JQ8B 3RC2A 3S2IA 3OJLA 2CDCA 1NFFA 3EZYA 3DHYA 1CQIA 1V3TA 4J43A 3HZZA 1P44A 1M76A 1VM6A 2HAEA 3GRKA 5F21A 4BNNA 4X54A 3MJ4A 4CR6A 2FHSA 3WJAA 2QG4A 5COAA 3SC6A 4P38A 1HSOA 3JYLA 2Y66A 1ZK4A 3V2HA 2BHLA 2Y1EA 4KP7A 3ZHYA 1DIGA 4PCVA 2BGKA 3DL2A 2VT2A 3AU9A 3BHJA 4U0KA 1D3AA 4CLOA 5IJZA 1WZEA 4MKZA 4FDAA 2XAAA 4I9HA 4KWHA 3UUWA 3DZFA 2PA3A 1GV0A 4IMRA 4RF4A 1CYDA 4EJMA 1XEAA 4BO7A 4B4OA 2B4RO 5DCWA 1UP7A 1LRKA 3QIVA 3GRPA 1YQXA 3KHUA 4BNWA 2G82A 1Y81A 3GMSA 1DRUA 2FPIB 3JQCA 2RH4A 5JNLA 3W1VA 5FFFA 5JW6A 2B83A 1QSGA 4GAEA 4S3MA 3NEPX 3AUUA 1Z82A 1LLQA 2O7QA 3HSKA 1ZIDA 5B4TA 4CL3A 4A0SA 3LU1A 2H63A 4Z0TA 4CM8A 3KYCA 3HG7A 5FYDA 4CM9D 2PZMA 1NX6A 1T2FA 1U3VA 3F9IA 3TDKA 3ZHBA 4XDYA 3ZH2A 3H5NA 3JQAB 3P5SA 2ZJ1A 4E5NA 1WDLA 5G2OA 1YBMA 3GUCA 5JMWA 5F5LA 5C7LO 1DEHA 4G2NA 4BNLA 1E3IA 3L6DA 3NDRA 1YDEA 3S2EA 3K73O 3R3SA 1CERA 1E1NA 4MVJF 1B3BA 5KOIA 4RCVA 3S2FA 1YB5A 1GYPA 1PU2A 1S6YA 4B8ZA 4E33A 1M6HA 2W8ZA 1HLDA 5EL0A 4N7RA 2X58A 2AE1A 2GF2A 5EQDA 2NUAA 4RZIA 4J4HA 2GD1O 1Y8RA 4U0JA 1KOLA 3FHLA 4O63O 4Q3NA 4PIVA 1OFGA 4R3NA 3DBLB 2QRKA 1DLIA 1E7YA 4P4NA 2QZ9A 4E31A 1C0KA 4RO0A 1ZK1A 2A35A 2JHGA 5F3RA 2YV1A 2ZB4A 1EBFA 3EW7A 2RBEA 3D1LA 2XPCA 3Q1LA 1BWSA 3DBHA 5ER9A 1KY5A 1DIRA 4PLZA 1LU9A 3O38A 2YQ5A 2G17A 1HETA 1EVYA 1XGKA 1LQTA 4RPGA 3ZV5A 2QIOA 3BYZA 3C85A 2JHFA 3AW9A 4ZQEA 4PZCA 3HDYA 4ALNA 5AVOA 3BZUA 3HFGA 3TZKA 3A4VA 1VSVA 3PGJA 3VH2A 1DPGA 3ZU3A 1GQYA 5IDWA 5T67A 4IUYA 5IZ4A 4XKJA 1LDMA 3WLEA 3P2OA 4JBGA 3BXXA 3WX0A 2ZYAA 4NBUA 1DDOA 2JL1A 4OKNA 4HADA 4AFNA 2GN8A 3GZNB 4CV3A 4UVDA 5CDSA 1GL3A 5G0UA 3ASVA 3ETDA 5JSFA 1CQJB 1HF3A 3KV3O 3ONEA 5KTKA 1LNQA 3PQFA 4J0EA 2A94A 3JD4A 4GQAA 1FDTA 4LSWA 3I9KA 2NACA 1SCUA 4BO9A 3E9QA 3WFIA 6ADHA 4PLHA 2HKIA 2A4KA 3V1TC 3KLPX 3BMOB 3CMCO 3DMTC 1NVTA 4NFSA 2FP4B 1R6DA 2A9FA 1MFZA 4TRRA 2DT5A 1ZFNA 4TVBA 3T4XA 1KEWA 3AOEA 3JV7A 3WDSA 2TMDA 4XQ9A 4EUHA 2NU9A 4G65A 5JAMA 1DRVA 4W4TA 1XKQA 3N58A 4XQGA 3DOCA 3Q6IA 2GCGA 1FDSA 4TZTA 4PG6A 3QW2A 2B4TO 3COSA 1ZZEA 4W9NC 1HL3A 2VZ0A 2YQ4A 1YRLA 4J49A 2PKQO 4I8XA 5CPFA 3VPSA 3PJDA 5CDGA 4NBTA 1PJSA 5IN4A 4OXKA 4CL8A 4FSHA 5JCJA 1AUPA 4PG4A 2PNFA 3KRTA 2FN7A 1FDUA 1GQ2A 1E3SA 2GZ2A 2ZCUA 2HQ1A 1ONNA 5EIOA 1YGYA 1MP0A 4MVJP 4LRTB 3LDHA 1GZ3A 3SXPA 5THKA 4KDEA 1T2DA 3ZW8A 3C8MA 4WNIA 1UZNA 3WGGA 1A71A 4CQMA 4FFPA 1A27A 4BNJA 3NGXA 1GEEA 1QLJA 5T8KA 1SPXA 2D2IA 1J49A 3RVDA 4B3IA 1BW9B 1I30A 2D1YA 4LVCA 2HMUA 4E5PA 4CJXA 3D7LA 4DUPA 3HADA 5JCXA 1JKFA 4UVHA 4AG3A 4D41A 1UAGA 1LC0A 3GGGA 3PHLA 4XQEA 4YJHB 2IEDA 1P3DA 4BNUA 3KLMX 8LDHA 1NAHA 4GX0A 1HDCA 3IUSA 4XJTA 1VI2A 4GVLA 1A9ZA 4FD3A 1H6DA 3OIGA 4AJOA 2QZZA 2R00C 2X4GA 3GH3A 2ZJ0A 1NVMB 3O26A 4OQYA 3ETEA 1EZ4A 1KERA 4M55A 4YAGA 4BO6A 2Y67A 1LLUA 4R68A 1EFKA 5DOVA 3WGIA 4Z0PA 1SAYA 2VN8A 4BUCA 5A3VA 1NM5A 1XLTA 3HWRA 4MP6A 4XYGA 4DLBA 4YTEA 2O4CA 4UAGA 3K9QO 2WM3A 3FN4A 3H3JA 5AYVA 3A06A 1E3WA 3I9LA 4J1SA 5HWSA 1ADFA 1OAAA 3K30A 4CV1A 2JAPA 1PS8A 2PH3A 1EVIA 4F3YA 3Q9NA 3KYDB 4YQYA 3WQQA 4BVAA 7MDHA 1IE3A 3G1TA 5L95A 1LTHR 1QKIA 2RHRA 5I7SA 3B20A 1NNUA 4C4OA 1YO6A 3C3XA 1ZK3A 5JFOA 1DC3A 3GZ4A 4EEZA 1KEVA 4YACA 4E12A 2UUOA 2OUIA 1ZK2A 1HYGA 4ITUA 4P22A 3AI3A 1MXHA 1ZJZA 4E21A 2BI8A 4DC1A 1WMBA 1T1RA 4BO8A 5AQ1A 4J7UA 4DC0A 4P4GA 4AL4A 2AQKA 5I9LA 3VZPA 1XQ6A 5ADHA 1DIBA 2H9IA 1LDGA 1PSDA 3AM4A 3BTSA 2GERA 4CMCA 2NU8B 1W4ZA 4II2A 3PYLA 1WPQA 2FMUA 1JKJA 3SLGA 4AJHA 3EGOA 2DFVA 2C59A 3OSUA 4OIMA 4Q3EA 4FS3A 1V3VA 4BQPA 3H3FA 1K6XA 2BLLA 2Y99A 4FFMA 4BO0A 4RF2A 4E13A 2JJYA 2VRBA 1F06A 3AU8A 3AI1A 2EKPA 5CEEA 4ZGWA 3L4BA 3C7AA 1ZXLA 1Q2XA 1NAIA 4WOKA 5H83A 3PXXA 5BSEA 3TNLA 1LDBA 1DLJA 4YXFA 2BKAA 1B14A 1QYWA 3FD8A 2J8ZA 3M1LA 2X0NA 3ENKA 2DTEA 2HMVA 1B8UA 5CDTA 4L76A 3M2PA 5L51A 5IXYA 3V1UA 3RFVA 5JC8A 1QV7A 1DC5A 1BSVA 4PRKA 2NNLD 1Y7TA 4XYLA 1A72A 4B4WA 4QEDA 2HK8A 3U09A 5EN4A 1IULA 1P74A 3ROMA 4MVJE 5BNTA 4CMAA 4F46A 4BO2A 3PWKA 3OM9A 4XWYA 1DC4A 2VWGA 2BD0A 4IDGA 4BMNA 2PGLA 3GG9A 3AFMA 3BMNB 1EUCA 1GEGA 2B36A 2I66A 2YFHA 2GPTA 1PJCA 4YBZA 1YS4A 5CEFA 1UP6A 5TS3A 5A9RA 3IOYA 4QECA 1E92A 3KVOA 4DWVA 2HMWA 3WNVA 1BXGA 1UDBA 4TRNA 4JQCA 1CEQA 3WGYA 4E5KA 4ZHSA 2O3TA 1NXQA 1P1FA 1Y8QA 4B8WA 4BGVA 2OBNA 1N7GA 2VCYA 2W2KB 3IMFA 1E6EA 1G6KA 4FW8A 4YJFA 4WLNA 1V8BA 1TT5A 3VHRA 3K5PA 4ROSA 1BXZA 3MOGA 5A04A 2VUUA 4MKRA 3FNFA 5JXWA 3QV1A 3HN2A 4CM3A 2X9GA 2JD2A 3LC2O 2GZ3A 1P1JA 3B70A 3NRCA 3T4EA 2CSUA 4MVJI 1YQGA 2SCUB 5KCZA 5ILGA 1JU9A 2V7PA 5HTOA 1NHGA 4J90A 4MIOA 4EEXA 3EMKA 4FC6A 2OFPA 1PQUA 4J7XA 1EK5A 3MZ0A 5CAEB 1YL7A 1IHYA 3E9NA 3PRJA 4OH1A 3HJAA 5DF1A 4DYDA 5KWEA 1HEUA 1KIFA 4CUZA 4UUMA 1ZSNA 4NHEA 4UULA 5GMOA 4BGEA 1PWXA 1R0LA 2DBQA 4CQLB 1H9BA 4HWKA 5TNXA 1H93A 1P0CA 1P1RA 3D5QA 3VC7A 1EEHA 1JWAB 5AXAA 2C29D 3VTZA 4CMKA 4PLPA 3W8DA 3HFSA 5DCYA 4O0LA 1HXHA 4UUOA 3EUWA 1IY8A 4YVFA 3ZDFA 4L4XA 1KETA 3FBTA 1YBVA 1CETA 1OOEA 3AK4A 4L75A 3M6IA 5JDCA 2RCYA 3V8BA 2DBRA 3RCBA 2UVDA 1PJBA 1ZH8A 2IZ0A 4GGPA 4DYVA 3LT2A 1ENOA 2VTDA 4YYZA 2C82A 2G76A 4LRSB 5AXCA 4HUJA 4IDDA 3UCEA 2VT3A 3LYLA 5B4VA 5C37A 1PJLA 4OQZA 1L7DA 4IIVA 1M67A 2W2LD 3GG2A 1ISJA 3UFXB 4FFRA 1HDOA 2YV2A 2AG8A 4UUPA 4XIYA 4FGSA 4Y67A 2ZK7A 4MP8A 3I9JA 4GLOA 1NTOA 5F5NA 3RROA 3WYEA 5EERA 1JLLA 2ZKLA 4BB6A 5A9SB 1R12A 3A9WA 3QWBA 4JP3A 1SC6A 3KB6A 4Y6PA 1ZSVA 1YXMA 3F5QA 1ISHA 2I9PA 1PL8A 3WS7A 3K92A 4RVFA 3JQAD 1T26A 3E03A 1HE5A 3GA0A 4R9RA 3GPIA 3RUAA 1TEHA 4L4SA 3E5MA 1UXKA 3JD3A 4HFNA 4LISA 1YOVB 1T4DA 3KOUA 2FR8A 4A26A 1OZAA 3E18A 1R15A 1YVEI 1L7EA 1UH5A 5IDXA 2C5EA 4BKQA 5A03A 3EVTA 1WDKA 2X22A 3I52A 5CDUA 1MX3A 4I5FA 2FOIA 4J1NA 3JD0A 3BMOA 3ANMA 4NG5A 2JD0A 3WGOA 4BNGA 3E1KA 4XZ3A 4Y98A 4YR9A 2VWPA 2X5KO 4BNKA 1B16A 3W4JA 2NU7B 3EDMA 1P1IA 4EGFA 1G0OA 1O5IA 4ZQGA 3NTRA 3FPLA 3TFOA 1CF2O 1W6UA 1T25A 1IL0A 1PTJA 2LDBA 4P8RA 3MEQA 3FNEA 1O6ZA 4RZHA 4IZIA 4RPJA 4BKUA 4B3JA 2BFOA 1CDOA 3AWDA 2HRZA 2R6JA 3P2YA 1E3LA 4R41A 3VZQA 4GBJA 4FQ8A 5FEUA 3E8XA 3OJOA 5ENVA 1J5PA 4OSOA 4U7WA 3U9LA 3C7CB 2XOXA 3FTPA 3GR6A 2WSBA 3CUKA 3CE6A 3IP1A 4N18A 2WD7B 4IBOA 3KEQA 3I5MA 2DM6A 5TLSA 3ZW9A 2FPPB 4DPKA 3LT4A 2PFGA 2I3GA 1D1SA 5L4NA 1YKFA 3IJRA 5F1OA 4BOYA 9LDBA 1WNTA 5TC4A 2AQ8A 5K6AC 4OOFA 1UXIA 4L8VA 2JFHA 3ITKA 4RF5A 2O48X 3ZU2A 5U4QA 9LDTA 5LDGA 2GN6A 3OF2A 4XR9A 1EVJA 4EUEA 4B4VA 1NHWA 4R16A 1B26A 1BW9A 4WCDA 1XDWA 4TRMA 3RSHA 4H7PA 1PX0A 4OJNA 3NKLA 5TF4A 3H9EO 1FMCA 1RJWA 1N1EA 5TX7A 5KJ6A 4R9SA 5H82A 2CDAA 4YJHA 2YHIB 1IZ0A 3U4HA 1H2HA 5JBIA 1VKNA 2IRWA 3ZHXA 4UREA 4GSKA 1FXSA 1F12A 3WBBA 2NU6B 3ZNNA 3CSDA 3L6EA 4MVJH 1GQQA 5L45A 1T2CA 1Z7EA 4XDZA 3M1AA 3MJSA 1MB4A 2WMDA 1SOVA 1LSOA 3DHEA 3GK3A 4CMEA 1LEHA 1GZ4A 4CLRB 3MWEA 4UEOA 4CLEA 1MC4A 4GLLA 2ZB7A 2GN4A 3RU7A 3AM3A 3LLVA 3WB9A 5A5EA 4ZQFA 3ZWVA 3JQ6A 1A7KA 4II3A 5G0TA 1DC6A 5KVVA 1FJHA 2AEMA 2NTNA 2YJZA 1A7AA 7ADHA 2BRUA 1SB8A 3QVSA 4R5MA 3GC6A 3RC1A 3KSZO 1ZMOA 4QFCA 5TT1A 1C14A 4NFHA 1NWHA 3D3WB 2HUNA 3W8FA 5G0WA 4FB5A 3KYDA 4CMGA 3AUTA 1ADGA 3JSAA 3OHSX 4WCFA 2B0JA 1HYEA 3JYPA 4K1LA 4OM8A 1K5HA 4A03A 1U7TA 3U4IA 2BFPA 1YBAA 1R37A 4WLFA 3BMCB 4IY1A 1J0XO 3MWDA 4GWGA 4GMFA 1X14A 4KTTE 1RWBA 3OA2A 5FI5A 2P4QA 1DOHA 1X7GA 4FIZA 5I9MA 3KUXA 4KOAA 2ZCVA 3LSYA 3NDIA 4OXYA 3SJ7A 2DPGA 4DA9A 3IKTA 2CVZA 2QYTA 4OOEA 4NJMA 2OXIA 4S1VA 4XGIA 2J3HA 4BGIA 2NU8A 5DCUA 3ZWYA 2JCYA 5TGDA 4NK4A 1EMDA 1ZW1A 4IGEA 3BTVA 1U3UA 3PFWO 3DAGA 3PVZA 4ONEA 2GR9A 2Y0CA 3F5SA 3VOSA 5KJCA 5KVQA 1KYQA 3DBRB 4PLWA 5BSFA 1UR5A 1DAOA 2VYVA 2BELA 3GDOA 1Q0QA 5L3ZA 3BTUA 4YAIA 4PFJA 5B4UA 1Y5RA 3F3SA 1SZJG 1LRJA 1VJ1A 3PEFA 1GPJA 2Q2WA 4ZQBA 3PLRA 3JQFC 5TT0A 3D4PA 3P19A 4BO4A 4E2XA 4NR0A 4JIGA 4R1UA 1JTVA 4LCJA 1ZNQO 4DTIA 4DXHA 1NBOA 3S55A 4W7HA 3WMXA 2G0TA 2VRCD 3A1NA 3BIOA 5KJEA 1N7HA 4HXYA 1LA2A 4NBWA 1H6AA 2O23A 3GFBA 4DREA 3JTMA 3RIHA 2H5LA 1PZGA 1U28A 4LSMA 1YE3A 2NWQA 2Q1SA 3H9GA 4WEQA 3TSCA 1XSEA 3DZKA 1XHLA 3DOJA 1SEPA 1ENYA 5KVSA 3TL3A 2LDXA 4GX2A 1UDCA 2BFAA 3I83A 2D59A 4HKTA 4E2WA 3K2BA 2GDZA 4DIBA 3W4IA 4ALIA 1QLHA 3H5RA 2QYSA 4FGWA 4UUNA 2PKQP 4NK5A 2GSDA 1MGOA 2E48A 3F1LA 3UVEA 3GNQA 1ZEMA 1RM3A 3VPGA 5MDHA 4I5DA 1JDJA 2E49A 2YW9A 2PTGA 2V6GA 5DDIP 1ZBQA 4DIOA 3CPSA 3LF2A 4P4LA 4A10A 1IOLA 3WTCA 3GVHA 4XRGA 3GVIA 2B37A 3UCFA 4FCCA 3DTYA 1U2GA 2P9EA 5GZ3A 3DHNA 3ZWWA 3QWAA 3PJGA 4FJ1A 3E5RA 2NVUB 5KVCA 4XGKA 3QRWA 3FSRA 1GCUA 1UJMA 3AY7A 1NQAO 3JQGB 3L4SO 2EGGA 1LI4A 2HMSA 3ZZNA 1OC2A 4WLOA 2CDBA 1XU7A 2OORA 5JPIA 3HDQA 2SCUA 3B1JA 4XB1A 2Q99A 1XQ1A 1ISGA 2EXXA 3EVNA 4GKVA 3VVCA 3JD1A 3LZ6A 4INAA 2Q1TA 1NYTA 4NZ9A 3SJUA 1JVBA 5LCXA 4UEKA 4QO8A 3FCOA 4B4UA 4KQXA 1VRWA 3NYWA 1Y9EA 2VHZA 2R2GA 1UDAA 4YAKA 3BMQB 2ZQZA 4U8GA 1ARZA 5A02A 3QVXA 3I23A 4Q3AA 3TQHA 3NAQA 2CVOA 3DOOA 4MKXA 3WGZA 4RQTA 2AQIA 3RASA 4ZJUA 1VLLA 3LK7A 4EJ6A 1KVSA 4ND2A 4BNZA 3ZNOA 3PJEA 1ONPA 2EHDA 3HDHA 2OHXA 1K0UA 4CODB 4PLTA 4R01A 1YB1A 2FPGA 4W9NA 2V6BA 3PDJA 2B5WA 4RPLA 1EVZA 4BV9A 4PLCA 2OMEA 3KO8A 4JJGA 1QYXA 3ZHZA 4G81A 3DFUA 1VL0A 3DXFA 8ADHA 1Q7CA 5TSDA 4H15A 2Q4EA 5COBA 4E4YA 2CFCA 3FNGA 3IC5A 5GZ1A 3X2EA 5CDYA 1QYDA 3MJCA 1V6AA 3FI9A 3ZNPA 3ETGA 3QVWA 2NV6A 3QJ5A 1X1EA 1U4SA 5FF9A 4RORA 2VZ8A 4OL9A 1WAMA 4XCVA 5HS4A 4U6QA 1S7CA 3D64A 4RDHA 4J9UE 4BMSA 1V35A 4ZRMA 1B7GO 2BF7A 4J16A 2X5JO 3TWOA 3ZGYA 2O2SA 1PIWA 4ND5A 3RJ9A 2O3RA 1X0XA 4ND3A 3H7AA 5FI3A 1GZ6A 4M8SA 1T2AA 2W90A 4GWKA 1V0JA 4HY3A 2FSSA 3ADPA 3GQVA 3L07A 4CM4A 2YFQA 1YOVA 2IE0A 1EBUA 2PD6A 1VC2A 2ZB8A 3HDJA 3NT2A 2Q3EA 2FWMX 1E1KA 3D4NA 4BHTA 3WNQA 4AJNA 2PLAA 2VYND 4AJEA 2EKLA 1EE9A 1F8GA 1UZLA 2EG9A 2Q2QA 4HFMA 4L74A 4QXMA 4OMUA 4U5QA 5KNLA 2HO5A 2ZATA 1ADBA 1C0LA 1SNYA 2R00A 4LMRA 2AE2A 1UXJA 4OYRA 2X86A 5CG1A 4IIUA 4JJFA 1YL6A 2DBVO 1W0CA 3AUAA 2GRAA 2DC1A 4GI2A 3IQDB 4TRJA 1N9GB 5JYEA 4KTVE 4RGBA 3GHYA 1QR6A 2VHWA 3RKRA 5TIIA 4FOSA 2O3SA 3H9JA 2ZTVA 3RUCA 1NPTO 3HN7A 4KUEA 3BHMA 3O4RA 1I24A 1UZMA 2QHXA 2VUSA 3FWNA 3OIDA 4WASA 4YA6A 1LDEA 5I7VA 1X7HA 1K2WA 4B7XA 1A9YA 2CD9A 2X8LA 4TWRA 4ZVVA 5ITWA 1GFSA 3CIFA 2EP5A 1MFPA 2NLOA 1A4UA 1LRLA 2X1HA 1MV8A 4M1QA 3H5AA 3LVFO 3PP8A 1RYEA 4HNHA 1NPYA 5A4DA 3TOZA 2VWQA 3QP9A 4IS2A 5BR7A 3JQ7A 5HBRA 3MCVA 3MJEA 3QLJA 5A1TA 4TROA 2AW5A 2PV7A 3DR3A 3WYBA 1I0ZA 3OECA 3GEMA 3ANNA 5AXBA 2DTDA 4Q9NA 1E7WA 3IP3A 5I7FA 1PJ2A 1EUDA 1CJCA 5T64A 1CQIB 4IJWA 4Q3CA 1HDGO 4NNJA 5IZCC 5IAAA 4KQWA 2OL4A 3ROKA 1U4OA 1DJQA 1C1XA 3OQ6A 3PK0A 3HB5X 1JN0A 1XA0A 4M54A 4TSKA 4AJIA 3UW3A 1ZCJA 3AJRA 4J9VA 4OKIA 4UVEA 4YT4A 5BSGA 4R3WA 1O9BA 3O03A 2Z5LA 4M49A 1GV1A 1HKUA 3I9NA 4Q3BA 4CLOB 4DMLA 5G4KA 4RQUA 4J1QA 1Z75A 4WUVA 2I65A 5L7YA 1DB3A 1GPDG 1M2WA 5L4SA 4CLRA 4I9NA 3VVBA 1ULUA 3PTZA 2JFGA 3F47A 3MJTA 4BKPA 1IHXA 1SOWA 1PJTA 4DQUA 2Y1CA 4BO3A 5EJ2A 1KVUA 4TVOA 3DZHA 4GVXA 3UH1A 5C7OO 4KMSA 4L73A 4IDBA 1C1DA 1SBYA 3UAGA 1PL6A 3STHA 4MINA 4XYEA 1NQTA 3OFSA 1LSJA 2NQTA 1VL8A 2O4UX 3E82A 4RVDA 2DLDA 2DU8A 1UP4A 1KC1A 5I8ZA 4Z9FA 4ZN6A 3C1OA 3JQ8A 4ESOA 3CMMA 3PFFA 2FR1A 1LLDA 2EP7A 3VKVA 5L40A 4XX0B 4CM8B 5IFLA 1A4IA 3KYCB 3ZWAA 3KXDA 1I2BA 1PS9A 3WBFA 1WWKA 1UUFA 4N5LA 4RLSA 1PWZA 2HMTA 3VZSA 4JNKA 3WYCA 5A5FA 3MTJA 3NT5A 3AOGA 1BDMA 1YDWA 2OZPA 5KKAA 4PGFA 3ROQA 4GGOA 1N1GA 4DLAA 4J0FA 1HSZA 3W6UA 4CM5A 1GUZA 3P7MA 2DQ4A 1JKIA 1NQ5A 4YAEA 2VHYA 5GY7A 5C3MA 1ZEJA 4NDNE 3ORFA 3U49A 2NUAB 4J4BA 3E48A 3EHEA 1Y8RB 4CR7A 1MXFA 4ZU3A 3QWFA 4IQ0A 3WFJA 3INGA 4RVGA 3KBOA 3O9ZA 2FPIA 1HZJA 5IN5A 2POQX 1IZ9A 3JQBC 1Q7GA 5I7EA 2W2LA 1RPNA 2G5CA 3QWIA 1VJTA 3D0OA 2NVWA 3PQDA 3TZ6A 3UKOA 1DBVO 2OGUA 3GOHA 2I76A 4IXTA 1F17A 5U9CA 4CPDA 3DBHB 4D0RA 1B8PA 2VHXA 1BRMA 3HHPA 1R0KA 2DKNA 3ZWMA 4YJDA 2CUKA 3JQAA 3GEGA 1I10A 3O8QB 4XR4A 2J3IA 3TPCA 2UYYA 5COQA 3LF1A 2HRBA 2PZKA 1BGVA 3NJ4A 3DZGA 4GL4A 4G5HA 3ST7A 3GHHA 3R6DA 2BI7A 2IODA 2QRLA 4EDFA 5DBIA 3V5NA 5ILOA 3VH1A 2WJPA 1RM4A 3VZRA 4RJTA 1E7SA 1R4NB 4TQGA 3DFZA 3OQ1A 1UAYA 1OI7A 4AVYA 1R4MB 1ENZA 3PJFA 2C0CA 4JBIA 4PZDA 4U6SA 5AXDA 3DBLA 3CZRA 4NU6A 4QO7A 3UXYA 3ONDA 5DBGA 4E32A 6LDHA 1P0FA 2V6MA 4F6CA 4D3SA 2EIHA 3IL2A 3PYMA 2E37A 1I3LA 4BIIA 4JN6B 1EUZA 3VTFA 3ZWNA 1XCBA 3WGTA 3LC1O 3ZV6A 3WGHA 3KZVA 3WR5A 1BVRA 5JY6A 3VDRA 4M87A 4YPOA 5CP8A 3RWBA 3WIEA 4DBZA 4LGVA 1TA4A 3JQ9A 4NH4A 2Q1UA 4DPLA 1CRWG 1LSUA 1FK8A 3GVPA 4R51A 2D5AA 1X1TA 2NVUA 3PIDA 3QE3A 5DNAA 4D0SA 3W6ZA 5JE8A 5L9AA 3IUPA 5IDYA 5ICSA 3OA0A 1T2EA 2ZYGA 2P4HX 2I6TA 3IIEA 3U4DA 3FF4A 4CUKA 3KTDA 3GZNA 3WJ7A 2TMGA 3IS3A 3JYOA 1I3KA 1LX6A 1R66A 1CQJA 1O95A 4E30A 2O3QA 1WDMA 5F1KA 4O59O 2DFDA 1TI7A 1PGQA 4XA8A 1I01A 3Q2IA 5IF3A 3FBGA 4D3FA 4CQMB 1BTOA 1NPDA 4C7KA 1PGNA 3PGXA 2FP4A 3PHHA 3PYXA 2QQ5A 4B7UA 1R16A 4D44A 3K2EA 4BNMA 1VKOA 2E82A 2PK3A 1LSSA 3ASUA 3L6OO 1E0DA 1JWBB 5EPOA 3UF0A 5JY1A 3GAFA 4JROA 3RC7A 3ZWPA 3QVOA 1EDOA 5K9ZA 2OBYA 1PGPA 3PI7A 4W6ZA 2EW8A 4BNFA 1EFLA 4GSLA 4M89A 4QUKA 4FC7A 1NVGA 4J6FA 1FDWA 2B69A 3TFQA 1DAPA 2JCVA 3GGOA 5DP2A 5DT9A 4RPKA 4K6FA 4TZKA 4WKGA 2EEZA 1NFRA 2V6FA 2IDZA 3H6KA 5JDIC 3U62A 5LC1A 1LXCA 2VOJA 1P9LA 4E3ZA 4EYEA 2HLPA 2GN9A 4I5EA 4YDRA 1E3WB 2AHRA 4PG7A 4JK3A 3G3EA 5TRTA 3CKYA 5ES3A 4E0BA 3HQ4O 4BNXA 5K6AA 2X9VA 3DBVO 1U8FO 1PZEA 2X0JA 4JLWA 1ZXBA 4Z6KA 1LLCA 5BT9A 5TJHA 5BNIA 1X7DA 1GYRA 1Y1PA 3L9XA 2EW2A 4PLYA 5BNFA 1KVTA 1PEDA 5BSHA 2PGJA 1HE4A 2YDXA 5DOZA 2CZCA 1Z74A 3GY0A 2RAFA 5AOVA 5GZ6A 4N5NA 3F4LA 4CUJA 1HDZA 3B1KA 4TKMA 4QQRA 5LDHA 3WOHA 4CM1A 2WE8A 4R1SA 4DGSA 3CEAA 3G49A 2ZTMA 3W4KA 2CF5A 2I5PO 4FN4A 4K26A 2Y1FA 3N74A 4JJIA 4MO2A 4BKRA 4FBGA 2EJWA 4CMIB 3FR7A 2Q45A 3C7DB 3GFGA 1FF9A 2O50A 3IAHA 1P1HA 5HS6A 1QYCA 2D8AA 4UVIA 1NP3A 4WLEA 1D1TA 2VNAA 1DIAA 3OP4A 3G0OA 3CTMA 2W98A 3LT1A 1JKJB 1QMGA 5A05A 5CFZA 4OSPA 1OBFO 3DWFA 1K6IA 3INTA 4YRDA 5T57A 4B79A 3WWZA 3RAJA 4CLHA 2BGMA 3JYNA 3CZMA 4CM9A 2OO5A 3RUFA 4E2YA 3MJVA 3DAFA 4BMVA 4EUFA 4O1MA 2VRCA 1VL6A 4PRLA
chains in the Genus database with same CATH superfamily
1R64A 4F8YA 2OAQ1 1B43A 1HDRA 1XZKA 3ZHOA 1BXRB 3VRHA 2Y1KA 5AVKA 3KPJA 3A1WA 1UKEA 3ECCA 1ESNA 2IOHA 4H3SA 4YFYA 5G0VA 4BZZA 3LWNA 3SEAA 5KYWB 4JI6B 3AHGA 3T95A 3PBKA 1LVGA 1PS0A 5B3AA 3ZDEA 1D4FA 1R0ZA 3EZ7A 4ZYTA 2ADMA 2PUAA 2OZEA 1YWGO 1WW8A 2PD3A 1K5PA 2X14A 3OAAD 2HA3A 4L9RA 1P91A 4QRHA 1R0WA 3U2QA 2J5KA 4GKAA 2O8DA 3TQFA 1M6YA 1OX6A 4U4AA 3V46A 4F12A 1TTHA 1RHRA 3C7TA 4KNYA 4GFDA 4MIEA 2PEYA 3GIDA 2J31A 4HGPA 4G85A 3H1GA 3WSWA 1MLDA 2VIIA 5LKRA 1O96A 2PGDA 1TT7A 1VLZA 2VI5A 2XRMA 3KZ1E 4MVJD 4QC2A 1NMSA 3C1TA 1CB7A 5FA6A 3VU9A 4KKXB 1L3BA 1OR8A 2C2WA 4QD3A 4C4ZA 2VNIA 2XZLA 1Y3CE 3QELA 4JUDX 2RAPA 4LF9B 1PD0A 3HXTA 1NI3A 3EGIA 3ZU4A 1G8SA 1VIVA 1M1YA 3OZXA 4KQMA 3T7EA 4DPKA 2WLSA 4NH0A 5E1DA 3FWKA 4UAJA 3PKJA 2UYQA 3CJRA 5HUJA 1NUSA 1N5DA 1TF5A 5FBQB 4OI4A 4ZP1A 4MPDA 4Z54A 2QX7A 4FOOA 3E6AA 3TZHA 2CVQA 4OGWA 4OQLA 4AJJA 1U63A 1WEKA 2XXJA 4YC7A 1BXGB 3L7YA 1Y8AA 3ZHTA 3VYWA 4DM4A 1RHJA 1GTSA 2ZRLA 3S8MA 5DX1A 2GBGA 1M34B 2ECQA 3L8DA 1Y8QB 4MYCA 3CLSC 1ZDMA 3I4CA 4QPJC 4WK6A 2Y1OA 4AKIA 3L8CA 1SVUA 4ZJPA 4IWXA 2RBGA 1I33A 2IPAB 5DSZA 2FW1A 4YCAA 3PDUA 1DX6A 4JC8A 2A4MA 4GXQA 2QUZA 1S2NA 1TJPB 1T4CA 1UBCA 2BGRA 5JR3A 3OM1A 3HJTA 1G0NA 2NPFA 1E3EA 3HSYA 1JT2A 3O0DA 4O1IA 1OYWA 1U1IA 5DHRA 1AXGA 3KOMA 2VF8A 3I6QA 2VPTA 2XWBF 3ZU5A 1BA3A 4LRQA 4B3HA 1QHHB 3RVOA 3PQ4A 2H1OA 1E7RA 1SUIA 3NVDA 1DBPA 3B9BA 2PGOA 3DLTA 4D45A 1ISFA 1TKAA 1WMDA 4MNTA 1WMFA 3CCCA 4HL6A 5EZQA 2EFHB 2YFYA 2AB0A 3U4GA 4K28A 1GLGA 1Z7YA 3ESZA 3PNLA 3QEMB 3E7FA 3V3KA 1C3XA 1P8JA 1TLTA 4KVAA 3DOFA 5AK6A 1JQBA 1UEXC 2O2CA 4L78A 3RYFA 4EW6A 1NI4B 1YUMA 1WHTB 4OMDA 3CLUD 3L1UA 2HHLA 1U5CA 3BKWA 5CA0B 2JFFA 1VKJA 2COKA 4P32A 3HNOA 3LNCA 4RTJA 2AZMA 3BA6A 1E5QA 2L0XA 3HJNA 3QK7A 1AZSC 3ISVA 4JJEA 4G1BA 5EUQB 3MJDA 1OCEA 3ZI0A 5LLSA 4JBHA 4ZI5A 3BEDA 2X9NA 3TRFA 2QTBA 2PL9A 1GGNA 2Y0EA 2WHPB 4HH1A 1K3TA 3AUKA 3FR8A 1TU0A 4XTCS 4ZCQA 1EFRD 1TMYA 3FOAA 4BVJA 5K3BA 4D4GA 2PUEA 3E81A 1I4OA 3N07A 4TTVA 3AUXA 2VDUE 2QLBA 2APJA 4GP6A 3ZCQA 3RHZA 4NE2A 1V11B 2OK7A 3DOUA 3QMPA 1FCJA 2B4QA 2YHBA 3OJCA 3N5CA 2BMDA 2OV4A 4X0EA 2CFTA 1JFTA 2YYAA 2ZIVB 2CZGA 3LKVA 4AMZA 4YGYA 1H2BA 4GC9A 1KQNA 1GUFA 1TM2A 2F67A 1XTZA 3MQ4A 1X15A 2AQHA 4RXMA 3WLIA 1SD2A 4R9UC 2IBMA 1Z0FA 1KO7A 4PY2A 4GPD1 2PUGA 3O8QA 2NPOA 1EXNA 3A6LA 3ILHA 2AEFA 1K97A 1C1HA 4F92B 1PGOA 3GVCA 1JLLB 3KPYA 5CAEA 3O8LA 3SC4A 3JY6A 3MCTA 1YR8A 3OURA 3ZBUA 3WBKA 4QQNA 1GTZA 1ZO8A 2QG9A 3FH0A 3I76A 3F5DA 2Y0BA 4QUHA 3S8EA 4G4GA 4OXXA 2FWAA 3DMTA 2JG3A 3UCXA 4Q1AA 3EASA 4POOA 1BHJA 3LQRA 1XG5A 2E5LB 4GYWA 4R6XA 3TO5A 2VP3A 4KBYA 3S28A 1QFSA 1IZ8A 3S7ZA 4AICA 4CGYA 1FSSA 5JXIA 1J4AA 1G2QA 1KPIA 3RVMA 4JR0A 1R4NA 3SKYA 3DFKA 2H7XA 3QSGA 1WMSA 4MQ4A 3RM3A 5JATA 2AXQA 3L0BA 4GX5A 5AW6A 2Q5HA 4L9AA 2H08A 3RVPA 1SVWA 1M2FA 2CJXA 2CHGA 2JBWA 3QW4B 3M5PA 2Y68A 4IDEA 3V97A 4EB3A 4UNPA 2CEAA 3EQ9A 1JPNA 2Q62A 4TQ9A 2RG1A 3NV9A 2PR2A 2H1LA 2UZ1B 3ZGVA 1W48A 4EJSC 3Q0EA 4G5FA 2OZVA 3L84A 4AX8A 1HDXA 1Y98A 4MGHA 4BAGA 3RS2A 1DS6A 3SZOA 5EJ8A 3B1WA 2E5FA 2G5TA 3DL4A 4HZUB 4NU5A 4YJGB 5B7PA 1I2CA 5FBVB 4LXIA 4H7DA 4RIHA 4O5OA 4MQ5A 3F7NA 1E9BA 4H16A 4XJXA 5ALHA 3ENQA 1QO9A 1T9CA 3UFXA 1YBHA 4W99A 5EESA 4INZA 4C7OB 4HRXA 4DUGD 3PJRA 3OMLA 3HFJA 2CXSA 3SZLA 2Q1YA 5HQJA 1RJFA 3PXDA 5ELXA 3RFXA 3COYA 3MPOA 5A9SA 2BUAA 3K70B 1FFYA 3C1UA 3O8OA 4DWOA 1OAOC 1P80A 3K0EA 1P31A 3OCUA 4ISBA 1LK7A 4JP2A 3SMVA 3BD9A 2CLCX 3QMWA 4LV5B 1KOGA 4B3RB 1JHXA 3NHMA 2RHDA 3NC0C 1WVGA 2X6TA 4B84A 1TRKA 4X62B 1DZIA 1VLJA 1F8UA 2B8NA 1ZH0A 2B21A 1USVA 2HSEA 3Q3JB 4IYRA 3RGWS 4ZI7A 1TKCA 5AUOB 1B0AA 3DAPA 4KC0A 2CD7A 1DWOA 2VCEA 1W36C 3AETA 3TF5A 2WILA 2YHUA 3EYWA 1HNNA 4ZOLB 1U80A 3NX4A 2QTTA 3BJIC 2RI0A 2ZTLA 2IYSA 4HPJB 2FG7C 5LP6C 4O4JB 5T8KC 4ZK2A 4LOHA 2XZOA 3H99A 1PR4A 2H07A 1N6HA 5DLEA 2BTQA 4FYPA 2AOXA 2YQZA 3UJ6A 4PRLA 3TSOA 4UHEA 4EB6A 1KAGA 1MC5A 1Z0UA 1RKXA 2YCLA 3KS9A 3ND7A 4J94A 2H65A 3AUFA 4G9EA 3A4LA 3BORA 4P98A 3IALA 2FNAA 2C2MA 1X9GA 3NWEA 4CG0A 2GARA 3DUWA 3CHYA 4WHMA 4DBLE 2WIKA 4HX5A 1XPUA 5T6MA 3AR7A 3RF6A 4LJSA 1JW9B 3SC3A 1HNZB 4KIGA 2D4AA 1V3UA 3F8TA 3H65A 2EEPA 2MINA 3R0IA 1Y7LA 2GO1A 4IINA 4OGLA 4F4DA 1I3OA 1Y8CA 3Q3VA 4XVQA 1OBCA 4Q05A 3GNTA 1IJBA 3BILA 5F5XA 3TECE 4K6CA 3OM8A 2IEGA 1EP9A 3IEXA 3OPMA 4MUMA 4RBNA 4CM7A 2QSZA 3OLCX 5KDOA 1UK8A 5IS2A 4Z7OB 3O74A 2VDJA 2XMBA 5BRAA 4MRNA 2CLDX 4RZ3A 4RJIA 1IN6A 5F1PA 1Y3BE 1YJQA 5JXGA 4FGZA 4G4SP 2JLQA 5JSKA 2A92A 3OZDA 3JD2A 4NPCA 4V39A 2PN1A 4MW1A 2WT4A 1YTLA 1R8YA 2PMKA 3AB3A 1ZVMA 3QFFA 4KYIB 2J5QA 3CUVA 1FXUA 4MWTA 2ABWA 2P9CA 3RUDA 3VC3A 4AF7A 4D4HA 5AVSA 5DNYB 5JJKA 2IPLA 1YA8A 3O21A 1ICEA 1IN1A 2HQSA 5KYVA 1JMKC 4IDAA 3U4MA 1ZN2A 3DONA 3PS9A 1BIFA 3DGEC 5IEJA 1OVGA 2IYNA 1GY8A 2C2BA 1Q1ZA 3EY4A 4ZAYA 3TCNA 4C6HA 3FLMA 4HF7A 2IZZA 1W0JA 3N28A 4NCHA 4NS4A 3NHWA 2IX9A 2O9JA 1U3TA 3D8UA 3LCCA 1PQ4A 2GM3A 1DEOA 3KKZA 3NEJA 5ALOA 4ZVTA 3TIFA 3STUA 3I9MA 4KNWA 4Q9HA 3BMXA 5IP5A 5THQA 5A5DA 3EIHA 3G85A 2JLUA 4M9RA 1ORTA 3KQWA 3NHJA 4UATA 1SU6A 3PLNA 1XX6A 2H57A 3RRXA 4FWBA 2RG7A 5EXPA 2GF9A 2CLKB 3MWDB 1AQIA 3KOYA 1KJWA 1HT2E 2X0IA 3WP0A 5HZMA 1GWNA 1I3MA 2XVAA 4M1SA 3DEYX 1BG6A 2TECE 1IBCA 3ZD6A 2PZ8A 4CDGA 3U3OA 4JC4A 1JR2A 3DTNA 2WINI 4DLPA 5DTMA 1RM0A 3U6KA 2AOUA 3IT1A 5J59A 4WZ6A 3QTTA 1BJTA 2YIDA 1RIIA 1BEEA 1FE8A 1NVKA 1X19A 1QIFA 5K3SA 5J23A 3OM0A 4NJMB 1JA9A 1Z4IA 5DHSA 3SOZA 4DCPA 3J81k 2IPOA 3H4TA 3LXXA 2H7YA 5A4JA 2YZKA 4IFTA 5MGBA 1GIAA 3QFTA 4MQLA 1ORIA 5LA6A 1I3NA 3IP8A 3KM0A 1RFLA 1EUYA 1P77A 1QBKC 2P5UA 2ZUBA 3EK2A 4AYXA 2VXCA 4DAOA 5JAIA 5AW1A 1PNQA 4G0OA 3UK0A 4G25A 2JRCA 3SJCA 2BZ1A 2AUTA 3D3WA 1P45A 4PU0A 3NTQA 3FFBA 2OHGA 3ABQB 4OQNA 2FUNB 1LF5A 2HCBA 3REQA 4AP5A 2FUEA 4JQZA 3RWOA 1KU6A 1X39A 4NARA 1N8KA 1N5KA 4RPCA 3J7AC 3QPWA 4G0QA 1QUEA 1UF9A 3FSGD 4GOMD 3OHPA 4Z4IA 2NSYA 1GDTA 4OB7A 1PZMA 3LV8A 1LJUA 1Y7HA 3LKZA 3WK4A 2FPRA 1P33A 3WGNA 3BMCA 1HNXB 5LIRA 1V9LA 1OXSC 4JB0A 1MQAA 4IV0A 3H8VA 4ZI7F 1BCSA 3JYQA 3R4CA 1SIUA 5LQUA 3QVTA 2OC9A 4WGFA 4BS9A 1JSCA 3C7KA 2I4RA 4KO3S 3CUWA 1FNCA 2EZTA 2MIIA 2NN3C 1CULC 3L7KA 1JU4A 4RK6A 5AHKA 4LQLA 3KQNA 2K5UA 4LRYA 4R1TA 1Q7TA 3I5AA 1B41A 3WIDA 3IE1A 2H7CA 5FUMA 1KH2A 3K0CC 3USES 1FRZA 2QM8A 4PYOA 4K9LA 1H23A 3CIOA 3DWIA 2UYHA 2KYRA 3VV2A 5C1IA 1GA1A 3GL9A 2YUTA 1QOQB 4UTVA 2LIPA 3WMWA 5A7FA 4X44A 2GCEA 3RUIA 4JGBA 2COEA 2FEPA 5HF9A 3PWZA 2WD8A 4OHUA 3UWOA 4OYLA 4KSCA 1N2EA 1WNFA 4OXIA 1T91A 1WZIA 4JLMA 3RRJA 4YWJA 1L4UA 4S0ZA 3ZIAD 1HRKA 2NV0A 3UAYA 2OMKA 3BGVA 3DZBA 3VA7A 3U9SA 4MR8B 3QKRB 2XT0A 3MAJA 1ZUWA 2JBHA 5LQRA 2IEAA 1I4WA 1DO8A 2NTJA 1VFPA 1XQYA 4OYYA 1QKJA 3ER6A 5FNZA 5H1YA 1L4BA 3AFNA 1PQPA 4BJ6A 5KYGA 5HGJA 3E8SA 2JB9A 3OQPA 4P7FA 4UBMA 3ANXA 4AXBA 1YL5A 3TZEA 4CCAA 5AESA 5BWLA 1PK9A 1T8TA 5HIKA 3TGPA 5AICA 2R48A 1P2BA 3PC2A 3HA5A 1FTYA 2ZUEA 1QG6A 4Z1OA 2UXDB 4NX2A 1SGWA 1C9MA 2AS0A 2PSHA 1MX1A 3DDNA 3KYIB 1IXKA 2OCGA 4R2MA 1Z18A 4UUAA 4QLOA 3GLRA 1X0VA 2X6QA 3RBXA 5CB6A 1AH2A 4BL5A 1ZUHA 3KJNA 5L53A 2IS2A 1AK9A 4NYMR 2XOKD 4MUYA 2FW0A 3UOAB 2I6QA 4R2XA 4MOWA 1IPEA 1K4YA 1RDFA 1X13A 1XP8A 1XWFA 4OQEA 5J5VA 2Q6LA 4WV3A 2HU2A 3FZEA 3UHJA 5BP7A 2J9FB 1Z6ZA 3G2QA 1OWMA 1AK1A 2H29A 4G41A 4B3XA 4MTCA 2MSLA 1E0SA 3O93A 4LJAA 3N6RA 1ST2A 4JT2A 3C8ZA 4PLVA 2QG6A 3WGKA 3FZNA 3JWGA 2FPMA 3C8HA 3F0TA 1KVQA 1SCUB 3O7WA 4M9SA 4R69A 4BN0A 1VL1A 2Z1NA 4FE3A 2R4QA 3LIPA 1VDMA 2BDEA 2G07A 3Q8WA 1KJYA 3T9DA 3HVJA 3PFNA 3BHIA 2VHQA 1SN7A 3TLKA 2O14A 3FVTA 3R3YA 1E9SA 3ADOA 4JZYA 4YJ2A 3P2KA 2C84A 1O8CA 3IXQA 3RI3A 4LFAB 1PEYA 1E0AA 1JDVA 1M1YE 5BQFA 1WHTA 3GLQA 1HTBA 4JYMA 3GAZA 3EEFA 4LKOA 1BQEA 2HRQA 3QMMA 4UD6A 3PQ7A 1NG9A 4AIRA 5AVQA 2C1EA 4RFSB 2F1HA 3JALA 1E6MA 1TZBA 2HH9A 4KW7A 4XFKA 1O94A 3IDZA 5REQA 3VR5H 3ZX5A 5I51A 5LA6F 5I5EA 1Z45A 2QDXA 1K08A 5IMBA 1KC3A 3V2GA 1J1UA 2O0LA 2PZLA 3H4VA 1T5OA 4KR9A 4KQEA 4OXNA 1F1BA 3ID6C 4JQSA 2NAFA 5LJLA 3SQLA 4ZARA 3NVAA 4ZIRA 5DHUA 4DAEA 5LR6A 4P3XA 3DA8A 4EVSA 3GLHA 1TMKA 2CLFB 5HM8A 5JU6A 3IJEB 3PUZA 2NZYA 3BTOA 3ICCA 3GRCA 1Q0ZA 4WLUA 1CIVA 4NONA 4MYSA 2YN2A 2CHFA 1L5FA 3SPXA 4AJLA 3FE2A 2WE7A 4C3ZA 5BOSB 5K03A 2J6IA 3QFRA 4XIGS 3ZQ4A 1WXWA 1VGRA 3LHFA 3L1HA 5KNBA 1F0YA 1OYYA 1PZFA 3GGCA 3GEIA 2FK7A 4LSGA 1HL7A 1W88A 5E95A 4AP6A 5A6VA 3ILXA 5E3JA 2WY2D 1GXSA 3GPCA 5BMOA 1Z7BA 3ZV3A 1PFYA 5TMPA 1LC3A 3IHWA 2YV5A 2RK3A 1N2CB 5EQFA 3AVUA 2ZQ5A 3I2YX 1N8NA 2WYVA 2OFWA 4IHAA 4O4IB 4WI1A 4LS3A 1VSQA 2EATA 3IPLA 4TLMB 1VBMA 3I2IA 1AKTA 4ZODA 4IZHA 2H4ZA 3T3EA 1NIJA 4IRXA 1YDGA 2XVYA 4F9FA 3R7AA 4URZR 2Q46A 4LX8A 3RIXA 3UBMA 3SBOA 1NN5A 2P6UA 3ZV7A 2WI8A 1M2NA 3E84A 2RK4A 1ZD2P 4D79A 1ZL2A 4M0CA 2VQFB 3CVVA 3T7CA 2QBYA 2Q1XA 4MUKA 4PAGA 4IIYA 4RHYA 4DR3B 3T9BA 4DBVO 3OLYA 4QYTA 4OI2A 1KY4A 1KE1A 1GGVA 5IT0A 4BVLA 4P58A 3CRZA 2PX3A 2ZSBA 3A31A 3DZJA 3BB1A 3EXEA 3HGTA 4YJGA 2YXPX 3PFIA 3FGNA 1UJCA 3OX1A 1UM9B 4KQHA 5IDQA 3FLAA 2ZTUA 2JAUA 2R2AA 5FA8A 3PDIA 1YS7A 3WIBA 4B48A 3LUKA 1M2OA 1HE8B 4FR0A 1GT91 3K8QA 1KMHA 4BYMA 4J0IA 3K70C 3IDAA 1OT5A 2V65A 1WZUA 4ML3A 5KINB 1YR1A 4PYRA 4XFDA 6AT1A 3QUTA 2B25A 2F00A 3OJEA 2AIRA 1YB6A 2H16A 1UPXA 4EYQA 2F59A 3QPBA 1JXMA 3F98A 2QD2A 4Y2SA 3LIIA 2LNDA 2Q49A 3QUQA 5JI3E 4UM9D 1A1VA 1AV7A 1ZCZA 4FI3C 1QQ5A 1H9AA 4OIFA 5FL3A 4KOEC 3BWVA 2NZJA 4RQAA 4J2HA 1YE8A 3OQNA 4TYWA 1CRLA 3SIRA 5EE3A 4S0XA 1IHPA 3EDQA 3PITA 1R2QA 4HDNA 1HYHA 1N7JA 1OH8A 2CCKA 1PR5A 4X94A 4EMUA 5JD5A 1D0IA 3ACCA 1KBQA 2BONA 3OTHA 3PUWA 3ENNA 3ZVMA 5ANRB 1R0RE 2OAP1 4GMGA 4URFA 4EZBA 2F1KA 1Q20A 1E1MA 4EG5A 1BMQA 2JF0A 4I6EA 4P81A 4F2WA 3DO8A 1PJAA 4K9PA 3O31A 2QMEA 4MLZA 4YJ2F 2YVUA 3M4NA 2BMEA 3IB3A 4FFBB 1G19A 1KMCA 1WQ1R 1X1BA 2D3TA 1T24A 1U3WA 3IUEA 1TOAA 1UPUA 1VLQA 5ARDA 1JQ3A 3Q9UA 5TQJA 2XYRA 3A1SA 3NHFA 1XMVA 4UKDA 4BX3A 1M0SA 5CA0F 3IPCA 2R8EA 1XHFA 4H1VA 1I8TA 1TXGA 3FPSA 4FFWA 3AEUA 3LC0A 2ET6A 4QG3A 3ON5A 1O54A 4RK0A 1VI6A 4KQJA 3IHLA 4BNVA 4EITA 1CQWA 1WF3A 1W34A 5DM0A 3JAKA 5G4KB 4CLXA 4CMEC 4DQ0A 3C1AA 4FTWA 3E3OA 2PX0A 5AO9A 4K3VA 1Z8DA 3QPCA 2QJFA 3NT4A 3K8ZA 4NAHA 5ALSA 3BGSA 2FXVA 3UFBA 3EA5A 3THSA 5KKNB 4TWAA 2VDQB 2CHVA 2J9RA 2BYTA 2BRUC 5TE9A 1B4DA 1FPQA 2E7ZA 3L93A 4D9KA 1TVEA 4BFYA 1UAAA 1VG8A 1RC1A 2GEJA 3CN9A 4D8YA 3PWSA 5IVDA 1FP6A 2MT9A 3QWHA 5KTYA 3GCWA 3JVIA 1CUUA 4V0QA 4QHSA 2PLRA 1N0IA 1L7AA 2I2XB 3RBZA 2FMHA 3T34A 2JFBA 2QD1A 4ZYZA 2C57A 4O2AB 3H0EA 4R83A 1SWVA 3KUDA 3EC7A 1R18A 5TJ9A 4MUHA 3GB9A 1Z06A 3LT0A 4J7CA 3WL8A 2ZBDA 1JFVA 4OGGA 3V8EA 1XB2A 2WAXA 4YV1A 1M7HA 2C0QA 3VDMA 3RC2A 4H0NA 3U13A 1N3IA 4WMLA 3T1QA 1URPA 5DGXA 3I58A 1V3TA 4B32A 1JNYA 1PWHA 3N8NA 4NFLA 3HZZA 2PRYA 1TF2A 4W1PA 2HAEA 3R5JA 1WEHA 4BNNA 4CT0A 2GHIA 2P9YA 5SZJA 1DADA 1VECA 1GUDA 2EJTA 3DMGA 2EZ8A 1ZN8A 2PLNA 3HRIA 4M3NA 5D00A 1LKZA 4IKEA 1SKAA 5JV5A 4MW2A 1IQPA 2JARA 3BFVA 4KNVA 3K35A 3CF4G 4Q34A 3ZU6A 3OWHA 3DL2A 2ZRHA 2FHPA 5A62A 3DGFC 4L9SA 1ZJ4A 1IQUA 4NOMA 3IV9A 3LFTA 3Q7QA 1IOVA 3D0QA 2GEVA 2HZBA 3MN1A 5FPSA 4MKZA 4N8SA 4ZTZB 4FSDA 3UK2A 4GPBA 4I9HA 4Q18A 3RRBA 3UUWA 1R8QA 3PGLA 3DZFA 2PA3A 1GV0A 1P8AA 4PINA 1CYDA 4Z2AA 4Q4LA 3QFSA 4H7IA 4EJMA 4OBXA 3GUHA 1FTNA 1QS0A 1YZNA 2B4RO 5DCWA 2RI6A 5DYGA 1YQXA 3KHUA 4D9EA 1OX4B 4NMXB 4RV4A 3D6AA 1CJUC 4W9MC 1E1CB 1PT6A 2GO7A 4F4CA 1W19A 2CYAA 2PWBA 3B78A 4TTTS 3NOXA 5WRFA 2F3RA 3AKEA 3MWYW 2P0EA 3O2QB 2RE8A 2FKAA 3HO6A 4DG9A 4YRPA 1NKVA 3IVXA 3V4PB 3WRXC 1A9XB 3PFBA 3FMOB 1FTQA 3PNPA 4DFDA 1KGSA 5KYTA 1BFKA 3SQXA 4A0SA 4Z0TA 2H63A 3RHSA 3U5ZB 2Z5GA 2YNMD 4R2WA 1KSGA 5ALQA 4OH7A 3NM6B 3F9IA 1UT8A 1DOAA 4DTCA 3ZH2A 1X80B 1AMOA 2AN3A 3H5NA 5CM9C 3DP7A 1GHTA 5ALDA 3VM6A 2W2VA 1ZH4A 4JKYA 5F5LA 2FW9A 3CNOA 4AIIA 2DERA 2C8VA 1FL9A 4KX5A 3NDRA 4UAVA 4KV9A 2GD0A 3K73O 1IXSB 1PNOA 1RADA 1X6VA 1CERA 221PA 2WHRA 1J0EA 1GRCA 2WU8A 3GFSA 1B3BA 3JR7A 3WHLA 2QN7A 4OXQA 3S2FA 4KKVA 2ZIXA 1BCRB 2RBKA 1YB5A 2CMKA 3EEOA 3AINA 4IIFA 5GV8A 4E33A 3MLBA 5EIEA 1HLDA 5EL0A 5AJVB 3UMJA 1ES9A 1X70A 5LMNB 4RQBA 1F0PA 1GPLA 1PP4A 1Q57A 2X58A 2NUAA 1WMEA 3C6ZA 4XPZA 4DLNA 3N0XA 4J4HA 1II8B 5CBPB 3PEYA 3C4VA 3AXSA 3FHLA 3GFVA 3L7OA 1DV1A 4QLBA 4PIVA 2OCKA 2DT8A 2ZUCA 4F6RA 4Y1GA 5BMVB 2A2ZA 1UC8A 4UDYX 3KKLA 1C3JA 1BDIA 1ZLXA 1C0KA 1OJLA 3K8OE 1ZK1A 2A9PA 4RO0A 1EDBA 2Q0QA 5CT6A 3QKRA 3UYKA 3WZLA 2YV1A 1JIKA 2ZB4A 1ZI6A 5IVKA 3CNQS 1UC5B 1QO7A 2COUA 3D1LA 2YJ4A 1V4NA 3Q1LA 4ZEWA 2JGKA 2XRYA 4NKRA 3A6PC 4BQIA 4XUCA 1LU9A 4AZVA 1K75A 4GR4A 2GETA 1LQTA 2PZAA 3B8HA 3NBFA 3X1WA 3ZV5A 4CG1A 4EAQA 1Y4SA 1Y6QA 5I7WA 2IUUA 1EB9A 1G8KA 2Q2NA 4MUJA 4P36A 5FTJA 4ALNA 5DT2A 4Y6QA 5AVOA 3BZUA 1SBTA 3BWXA 4F11A 3A4VA 1VSBA 3DC7A 3NVMB 3PGJA 3ZXYA 1DPGA 4Z4FA 4PO9A 4NRDA 4KFSA 4QM7A 3QPAA 3RVNA 2ZJ7A 3KEGA 4HMQA 3WLEA 3WX0A 3WWPA 2Q5IA 2ZRGA 2OORC 3CQ9A 3M70A 3K6RA 3QLUA 4GDMA 2G06A 2QTNA 4MS3B 2V7VA 3S99A 3TX2A 3RVRA 4UVDA 1QJCA 3ASVA 3FCXA 2J9FA 5JSFA 4KMOA 1HF3A 1Y3AA 1L1RA 3NBAA 2Q5CA 1LV8A 4JLOA 3PQFA 1NF8A 4F85A 3GLVA 1SCUA 1S7GA 2DQYA 2IYUA 3LCMA 2PYZA 4BO9A 4LMAA 3ENVA 5FUWA 3WFIA 1ESMA 2WBLC 4GYKA 4PLHA 3V1TC 3SIPA 1C4XA 2C5GA 2IXTA 4OBBA 4URUR 5EKUA 4NFSA 2XNJA 2FP4B 1MOPA 3TJMA 1MFZA 4OFXA 2WZCA 2OENG 3AOEA 3KT8A 5AW9A 4CV3A 3THRA 4ISCA 4G65A 1SC4A 2R5FA 3FVQA 3KWFA 3OZAA 2L18A 1QBGA 1T3SA 4P7BA 4W4TA 4KWTA 2WUFA 4INOA 4PBTA 4PX9A 4PF1A 2ZM5A 3OP1A 3QW2A 2OHIA 2QR3A 1N75A 2MYUA 1GZUA 3WJ2A 4EVIA 4OL0A 1OTHA 2EL9A 2G3YA 3JWIA 1V8OA 5CT8A 1V6CA 1SR8A 5KS2A 2CL6X 4MGZR 5EFOA 2UKDA 5CDGA 1TC2A 1AHNA 1HTWA 4UE6A 5JCJA 1AUPA 2BJWA 1AD2A 4QPCA 2NUTA 2WUDA 3CVWA 2PNFA 3D8TA 3HL0A 3KRTA 2NZ8A 1NLZA 3FB1A 1GQ2A 2HXGA 1SIOA 2G1KA 5HILA 4AO8A 2V0CA 4ID3A 1ONNA 2C8LA 4MVJP 4A0FA 2UVPB 1F2TB 1G6HA 3LDHA 3RS5A 3P9QA 1GZ3A 1JKXA 1N9ZA 2ECOA 3HWSA 4DSTA 3TQCA 4BLSA 3JAMA 1JR6A 3HP7A 3BH6A 4KDEA 4FOLA 2E4XA 3FNBA 3N6VA 4JJ8A 1QKKA 2OHFA 3HJUA 3O3CA 1E18A 2WTXA 2Z3ZA 4GQBA 1SUPA 4N9QA 3C8MA 4NV0A 3G2HA 4X3CA 3EAFA 1X8JA 3D6TB 1Q6YA 2O1SA 2VT6A 3W0LB 4KAXA 3LX4A 1YJCA 1SUAA 3DWGA 3LUBA 4CQMA 5LOVB 4DR4B 2IS1A 1GEEA 1HE1C 3EF1A 3L4KA 1C9EA 3QKSB 2D1YA 2QL7A 2CUTA 4LVCA 1Z62A 3U7RA 2ZRPA 4DUPA 1NW6A 1K6MA 2BF4A 2YCBA 1QFYA 2R85A 4UHJA 1Y5NA 2KBFA 3QE9Y 4TYYA 2Z2ZA 2P2GA 1OGYA 3ZY5A 4D41A 5FPYA 2Q9CA 1GM5A 1AO0A 3JVDA 1P4JA 1U65A 3SG0A 2Z4RA 5M7EA 4Q1FA 4FHDA 5IJ0B 4N0EA 4OFBA 2B9EA 2I8LA 1XRMA 1E2NA 1UJ5A 2FPSA 2I8AA 5JHHB 3IUSA 1A9ZA 1H6DA 2BEUB 4ZV9A 5CT4A 3OIGA 1ZC3A 3W5VA 1T5LA 1ZPDA 2X4GA 3L2OB 3N9IA 1OXKB 5HKKD 3ES9A 2RAUA 2YWEA 4RE6A 4I99A 1EZ4A 3DO6A 2Z43A 5EMKA 1FLNA 1C8LA 3OZVA 2VTBB 5DYIA 3TW8A 4B83A 1GA6A 2QPLA 4YS6A 5ALUA 1E2KA 4R68A 5FQNA 1EFKA 2R6DA 3IBGA 1NXVA 1SQ5A 2ZUVA 1Q50A 1YC5A 2VN8A 3HR4A 4PTLA 5TPZA 3RT1A 4YTEA 2B3TA 2RKBA 1MDFA 3QJGA 5E9QA 5FPHA 4HDSB 2YS7A 1AT1A 1VCIA 2OECA 2WM3A 3GLHE 1GGKA 4LGYA 3FN4A 3H3JA 5AYVA 3I9LA 2AK3A 2MJLA 2IQIA 5ARCA 3WZ2A 4CV1A 4DMGA 4FU0A 3TVYA 1CJTC 4HEHA 5JD3A 1Z6GA 1O08A 4YQYA 3GLUA 4L3WA 2FPWA 5L95A 1WSDA 3NUQA 1E5VA 2D5LA 3QF4A 2G4CA 4RVNA 5KNDH 1GL9B 3B20A 4F84A 4C4OA 3C3XA 4QQ8A 2F17A 4UC0A 1H2FA 2HD4A 4PO1A 4TT3D 1KEVA 1UBEA 2GB4A 4E12A 4Z86A 4PR0A 4I1YA 4IDPA 2UUOA 4EHLA 2JAOA 5AR1A 3ZLVA 3V4FA 2X76A 1OI2A 1RWVA 3OO0A 2BSXA 1ZJZA 1WMBA 3ELDA 4B3MB 3SF8B 4K6HA 3AIKA 4DC0A 3I2GA 1E64A 5MN4A 1VKHA 3OQMA 3VZPA 4I1RA 4D9NA 1CUSA 3N53A 2EP8A 1FTGA 1ICIA 2I71A 1DIBA 2OB2A 5HIAA 2W2PA 1PSDA 3AM4A 3BTSA 1E4EA 3U7JA 4D3XA 1W4ZA 4II2A 5BV2P 4IX9A 1M54A 1YQTA 3OQIB 1GNQA 2NVOA 2ZE5A 3R5TA 4Y2JA 4DA0A 2CJYA 1U7ZA 1QB7A 2WNHA 2J3DA 3DXYA 3OPYI 1UBUS 3RYTC 4D9HA 2C59A 3OSUA 4OIMA 4CETA 3KVYA 3P71T 2FJ0A 5IJ9A 2GYWA 2ZIEA 3WXMA 2BFBA 1K6XA 1E8NA 1ZG3A 2BLLA 2P9BA 4FFMA 4P0TA 4RF2A 4E13A 2R3SA 3FDXA 3NHAA 2I4NA 4Y2VA 4R7TA 2QAGA 1K98A 2IHNA 3INNA 4HH3C 4V2UA 1LBIA 3GXOA 3C7AA 4DA7A 1Q2XA 1NAIA 4QDXA 5B3JC 1SQ6A 5H83A 5BSEA 2M9MA 3TNLA 1LDBA 1LWOA 2WUEA 1DLJA 4Q03A 1R6XA 2X4DA 1D07A 2OGSA 4QYSA 4C78A 2ISSD 2J8ZA 3ROFA 3H19A 3KL2A 1WCWA 3M1LA 4M38A 4UARA 5G3YA 1BROA 3PPWA 3T9AA 3DTVB 3ENKA 3BXZA 3X0DA 4ZJYA 5CDTA 4L7QA 5EEGA 3R5HA 5CJJA 3M2PA 1MOZA 2JIOA 1A2KC 4JLVA 5BURA 1PUXA 1Q0UA 2LXNA 4DN6A 1Z2CA 2NG1A 4EY6A 3A9TA 2GHRA 1QV7A 3IAFA 3ZJ4A 3ONWA 2GHTA 3P9CA 1CVRA 3KPVA 4TL7A 3DMNA 3JX9A 4WY5A 3UOWA 1RWPA 4CT5A 4LJ6A 5I3ZA 5ICSA 3U44A 3TRDA 4KI0A 1A72A 1QCCA 3MCUA 4ITRC 2VL7A 1LFDB 4NG4A 2HK8A 5LLDA 1GZDA 4L27A 3U09A 1IULA 1P74A 3ROMA 3BQMB 3HCAA 2W6NA 3IQFA 5BV7A 3NBMA 2O2ZA 4BV2A 1YTUA 1LK0A 1PK8A 1A9QA 4UBNA 5JH7F 3KKMA 2NZ2A 5F52A 2ID9A 4PSDA 4BMNA 4KR6A 1CZKA 4D3ZA 2W2MA 3EE6A 3AFMA 1GEGA 1P60A 2CFOA 4EJ2A 5KVAA 2HMYB 3K5HA 2CE7A 4OBEA 1ITZA 1GLVA 2GBLA 2I2AA 1OPRA 4WZBA 2XB2A 721PA 1HLGA 2L17A 1UP6A 2IJGX 3HRKA 5TS3A 2VNHA 1NXXA 4IQ4A 4DWVA 2HMWA 1QWOA 3UMBA 1F4PA 4IIDA 1UDBA 1ZGCA 2ALJA 1FP4A 1CEQA 3BEOA 1ZGGA 4ITVA 3S2SA 4E5KA 4G0VA 4B8WA 1Q95A 2ERYA 2Y0PA 4UTOA 3WY9A 3VMMA 2W2KB 4EPWA 4HT3B 1U6JA 2ZOSA 1HOXA 4QQKA 1G6KA 2A5GA 4FW8A 4YJFA 1XZHA 4C7MA 2XXAA 1MDBA 1CCWA 1OX4A 1TT5A 2GPYA 3VKGA 1QHSA 3D0KA 1RI4A 5KDLA 3K5PA 4ROSA 1RWQA 1Z2DA 3RJTA 3WDKA 4RA9B 3HVKA 4IHJB 5F9FA 1JDSA 1P18A 5MN5A 4LHYA 2N1MA 4IFBA 4ZYYA 1QFZA 1QH9A 3QV1A 1JEDA 1NURA 4JVNA 5C32A 4FFVA 4V0OA 4C89A 3DE2X 5GOTA 3LC2O 1ORDA 3NHBA 2NSJA 3OTWA 4QJ3A 2I78A 5IT5A 3VJLA 1DQRA 4KITB 1ACMA 4MWCA 1IM5A 3R76A 1SA0B 3WKCA 4N82A 4LZLA 1JU9A 2OWEA 4Y6GB 1EK0A 1KI9A 3V4LA 4J90A 4JHXA 2J30A 2ZU6A 2X42A 4UQPA 4AMBA 4IGAA 4H4CA 4LNHA 1DAKA 3MZ0A 2OBFA 1QGUA 1P81A 1L4GA 3E9NA 3EZ6A 3O92A 4NQRA 3UEOA 4DYDA 3C6KA 1KIFA 3CPHA 3FTCA 4UUMA 3U4QB 3N2KB 2XITA 4L51A 3TSYA 1R0LA 1G4UR 1IRIA 1TQDA 2HBZA 3PCTA 5EHZA 4CQLB 3CX3A 4EW1A 1QTRA 1PUIA 3GGJA 2IHBA 4EFKA 1OH6A 1EEHA 5AXAA 1TAUA 5KQLA 1IZYA 1MTOA 4DABA 1VE7A 3AR6A 4ZJZA 3HFSA 4GR9A 3CNNA 4O0LA 4KE9A 3IOCA 4LE2A 1HXHA 5LUBA 3HP1A 3SE7A 4Y2GA 3SHFA 3ZI4A 5JJBA 1II8A 1KZGB 3UJAA 5CBPA 1M7BA 1PSWA 5DN6D 4Z3OA 3ZDFA 3ZQKA 1OLOA 4PM4A 3H5TA 4M37A 1D2MA 4L75A 2HSJA 5JDCA 3VZCA 1CUEA 2RCYA 1XE3A 2DBRA 5LBTA 2UVDA 4ED9A 1ZH8A 2IZ0A 5EMLA 1WSAA 3A2NA 3AH8A 3KTAB 3T99A 1JSXA 1R88A 4YYZA 4TZ0A 1Y1LA 1UIMA 1JDTA 4RFVA 2G76A 4LRSB 2DEUA 4GDFA 5AXCA 5JQGB 4UBJA 3Q15C 3UCEA 2VT3A 3LYLA 4FMDF 5B4VA 3HK2A 2ZRKA 1UKZA 3P97A 4E94A 4WKNA 1M67A 4B6RA 4ZVOA 1KK0A 3DSRA 2Z1DA 5C1DA 5AK4A 1I80A 5SICE 2AG8A 3ORQA 2J7PA 2VEDA 4YRJA 3TD9A 3WLOA 3WWCA 1B6SA 3T35A 4POAA 3I9JA 1TKRA 3HXLA 1ETUA 5ENZA 3WYEA 3BB3A 3M82A 5EERA 3ZBTA 2JS7A 2PVPA 3WLPA 1R12A 3ICQB 3A9WA 1VHJA 3EVAA 1N8SA 1ZSVA 1T6YA 3IEPA 2I9PA 4QEZA 3BGOS 3IUYA 3JQAD 3M1YA 1T26A 5BV8A 3ACDA 5DEOA 2VJMB 3THXB 1W94A 2VJOA 4BYGA 3IR5A 2PL1A 1F9AA 1UXKA 3E5MA 3JD3A 1P5FA 4BMXA 3DDSA 4N4AA 1ACJA 1OZAA 3E18A 2AVNA 1R15A 2ONCA 5A5VA 3UENA 2RC5A 2ZB2A 1Y1QA 1GNLA 1UPAA 1WDKA 1IU9A 3I52A 2AW3A 3GRVA 3NBKA 1V9SA 4HVAA 1N5OX 4GNRA 4NCXA 3GARA 5CDUA 2AUNA 3ANMA 2QD4A 4BU0A 5IRCD 5DM1A 1UIRA 5IEBA 1TD1A 6GPBA 4Y98A 4DT1B 2WM9B 1K7XB 2DCUA 3Q0TA 3FBWA 5AJWA 3DVRX 4COKA 1CC1S 3LHKA 1G0OA 4EY8A 3WNBA 2ORYA 1WCIB 1M2HA 3NJRA 1T8UA 3LX6A 2YXLA 4UBLA 3FJYA 3ADBA 4IQFA 3IP7A 2AFHE 3HKEB 1RZRA 3OX2A 2PSDA 3THWB 4P8RA 3D8NA 3F73A 1Y1KE 2FN3A 4RZHA 4V1CA 1F8XA 4DHEA 4EFNA