5HBRA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
464
structure length
464
Chain Sequence
MNDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 170
structure length 464
sequence length 464
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hbrA01
4PZDA 2D0IA 1ZEMA 4MOWA 1VSUA 3QVOA 1MXHA 4DPLA 2ZCVA 2C07A 4XKJA 3C7AA 4WNIA 4WLEA 3H7AA 3ZNNA 5TF4A 3IL2A 1QYVA 4EW6A 1YS4A 1YJ8A 1ONPA 4QO8A 2VWQA 1DIBA 1JU9A 1TT5A 3RBZA 4BO5A 2NVUB 1A9YA 2WDZA 3GN2A 4F6LA 1EFKA 3H4VA 3UN1A 3WSWA 2X9VA 3H6KA 4ZU3A 2NTNA 5KJEA 5EJ2A 4PLZA 3VH4A 3RC9A 5KVQA 2YW9A 5TSDA 3FWNA 3JCZA 4J16A 3JV7A 3O8QA 1GV0A 4MVJH 4R51A 3UHAA 2JCVA 4NU5A 1DJNA 2O50A 2CDBA 3NTRA 1EQ2A 1GZ3A 5A5EA 4NK5A 1DAPA 5DP1A 3JSAA 3JQAB 2CF6A 1P44A 1XKQA 3VOSA 1WWKA 3BAZA 5GZ3A 4B4UA 2EXXA 4XYLA 3JQDA 1ZZEA 4ALKA 3RU9A 1U28A 2BFMA 3MJVA 4U6QA 2CNBA 4RF3A 5CEEA 1UDBA 4M49A 4Y9DA 3VPGA 1IB6A 2HRZA 3JQBA 2O3UA 3NKLA 3TNLA 4CMGA 5G4KB 1LDGA 5I7EA 1CERA 1VC2A 3CEAA 3G1UA 1NQAO 4Z0TA 4J6FA 4JJFA 4CMIA 3OIFA 2PGDA 4NNJA 4DIFA 5CG2A 1ZK2A 1GYQA 1LC3A 2CUKA 3RC7A 3B6ZA 1Z75A 4E2WA 4ZQFA 1NHWA 3JQFA 1JW9B 2X8LA 2OBYA 1KERA 4KQWA 5B4VA 4Y6PA 4IDCA 2R6JA 3DOJA 5JMWA 4J3FA 3W4KA 1O5IA 4CMEC 4FJ1A 3BMOB 1GZ4A 3HQ4O 4BNTA 1FDUA 1HLDA 4I9UA 3ZU4A 3ZZNA 1GFSA 4BS9A 3WQQA 1E6WA 4NZ9A 4FS3A 1PWXA 2WM3A 1KY4A 4R4JA 3AI2A 4IXTA 4WPGA 1DIAA 2G82A 2X5JO 2B4QA 1Y9AA 1UUFA 1D7OA 1PGJA 4HKTA 4J1TA 4XQCA 3PYLA 1BXGA 1YBAA 1T2FA 4YJGB 4J4BA 3WLEA 2F1KA 2DC1A 2NVBA 1T26A 2B37A 4LVCA 1HXHA 1X15A 4QFCA 2CDAA 4MVJE 4YJFB 3RBVA 4II3A 1U9JA 4IGFA 2FR0A 5BT9A 1DO8A 1NBOA 1RPNA 3GMDA 4Q3CA 4UAGA 3ZCXA 5C7OO 1LSUA 3DONA 4UVIA 4DRYA 3OECA 3PLNA 1U8FO 3FBGA 4FOOA 5IG2A 1U3WA 4J4TA 1SCUB 3MOIA 2EW8A 3JYPA 3INTA 3WGQA 2WYVA 2AQKA 4URFA 4CV0A 4W9NC 3NDRA 4CM5A 4YAJA 4HWKA 1HZZA 2OUIA 4BO2A 3FHLA 1HDRA 2ZTUA 5I7SA 2BF7A 3CTMA 2ILTA 1E5QA 4D0SA 1XEAA 4DTIA 4J1NA 3D4OA 1KEUA 1M76A 3JQ7A 4ALNA 2FY8A 3W6UA 1BSVA 3VH1A 2FOIA 3A28A 4YR9A 3F46A 1XSEA 4W7HA 4D45A 1BDBA 4ID9A 3L6OO 2HKIA 1BDMA 2QIOA 1ULUA 4N7RA 3KUXA 2JHFA 4O6VA 2GN9A 1UR5A 1T2AA 4BNKA 5JDIA 1DFHA 1F17A 2DM6A 2V6FA 3GA0A 3ZHXA 3JQ8B 4J49A 3SLGA 3DOCA 2PH3A 5ES3A 4PLWA 1UAGA 3A14A 1K3TA 1YE3A 2VHVA 4D3FA 1YQGA 1QMGA 2BI8A 2ZB3A 3FNGA 3W4IA 3VTZA 2NU7A 1BMDA 3BTSA 3INRA 1AXGA 2WD7B 3I5MA 2ZYGA 1U3VA 4TRMA 3AU8A 4PRLA 3JYQA 5IN5A 1HYHA 3C24A 3L4BC 4AJ1A 5C5IA 3VZRA 5L7TA 1A4IA 2VYVA 2OO5A 1LXCA 2Q46A 1C0PA 4IM7A 3UKOA 3WX0A 2F00A 1H6AA 5CEJA 3OH8A 1IHYA 2J3KA 5C37A 3M2TA 2W2LD 4IXWA 3ZU5A 3IMFA 1ZH8A 4XZ3A 1U5AA 4LRSB 1R12A 5EL0A 1HDCA 5GZ6A 1UXIA 1SOVA 1R4NA 1DHTA 4YJHB 5L53A 3E6AA 4Z6KA 1GEGA 1OFGA 4EZBA 3UFXA 2B4RO 3BMCB 1V8BA 3UCEA 4FPXA 4IJWA 3H9GA 3H3JA 5L9AA 1U3TA 4FN4A 5IXYA 3MJCA 3I6QA 3WGZA 1P45A 4FFNA 5K6AC 1DJQA 2FPIB 1FDTA 1MGOA 1V6AA 4TWRA 5KVSA 4MIYA 4BNJA 3HDHA 3T7CA 2A92A 3KV3O 5AQ1A 2DFDA 1T25A 3VTFA 3NDIA 1DC3A 5DOVA 2OZPA 5ITWA 4HNHA 4DUPA 1H2HA 2HJRA 4NFYA 4PG5A 2DBRA 5EINA 5FWNA 1DDOA 3W8DA 4WLOA 1SO8A 4IINA 1H2BA 3VDRA 1BW9A 3DO5A 2SCUA 1I24A 3AI1A 2CF5A 4RF5A 2ZB8A 3AU9A 3PHLA 2W2KB 3PTZA 4IQ8A 4CM8B 4E4YA 3I9MA 1X14A 1FJHA 4CLRA 4B7CA 4J7UA 4BO8A 1HSZA 3RQSA 4KWIA 2BFOA 3GZNA 1B15A 1K6XA 1W73A 3BHIA 3H2SA 1DPGA 3S2GA 5CHEA 4IBOA 1GZ6A 1CYDA 1TXGA 4ZHSA 1QYDA 3GAZA 5JNLA 1NAIA 3Q2KA 2AEMA 2EHDA 2NWQA 1J4AA 4YB8A 3QWBA 4BO4A 3DB2A 3UH1A 3GK3A 4HX5A 4E33A 1YOVB 4IMPA 3RUDA 2NNLD 4CPDA 2WE8A 3L77A 2AG8A 3ITKA 4Z3DA 4Q3EA 2B35A 3E03A 4IDFA 1IULA 3I9JA 4R41A 1XWFA 4N5LA 1FXSA 1KBZA 5CEFA 4GL4A 5TGDA 1U7HA 4B8WA 3TZHA 1PX0A 1DLIA 1VL6A 2DPHA 5JYEA 1Y8QA 2GPTA 1LI4A 3WGIA 3ANMA 5COQA 1E5LA 1BGVA 2NACA 3AI3A 4OJNA 4TKLA 2QZZA 1JKJB 5KCZA 3IP1A 4CM9A 4CQMD 5JY6A 2YHIB 1E92A 4YT8A 4YAIA 1DFIA 1QYXA 2NU8B 4B8ZA 1VLLA 3P5SA 3MTGA 3GR6A 2I5PO 4UUOA 4FFRA 4EEZA 1G0OA 1LLQA 1F0YA 3WJAA 2VOJA 4U8GA 4N54A 2AW5A 4MVJD 2WWRA 4TVOA 5JO0A 3RFTA 1P1RA 2IE0A 4AL4A 5IAAA 3VVCA 3UCFA 2GZ2A 1U2GA 2DKNA 4PLPA 1U1IA 2HDHA 4JQCA 3QVXA 1U4SA 3V1UA 1YKFA 2HLPA 2BI7A 4LVUA 2ZYDA 3ZWAA 3PRJA 5JS6A 1V3TA 2EIHA 5ICSA 4OL9A 4KZPA 1IUKA 3F4LA 1M66A 3ZHBA 5CDUA 5T57A 1UDCA 1OMOA 3DHNA 2HQ1A 1GQYA 1V3UA 5F1OA 4MDHA 4F6CA 4BNIA 3SX2A 1A4UA 3ONEA 4MO2A 1GCOA 2FRDA 2J6IA 1HYGA 2P91A 3OSUA 4YRDA 2SCUB 5THKA 1E3WB 1P1KA 1IYZA 1U7TA 4L8VA 4IZHA 1LLDA 3PQFA 4R3NA 4JGBA 4IDGA 3G79A 1D1SA 4BO9A 1I0ZA 1QXSA 1X7HA 1XQ1A 1CQIB 4MP6A 5TC4A 4J0FA 1DFGA 5GY7A 1SAYA 3PIIA 3RAJA 1NQOA 3EZLA 3ROKA 1UZNA 1DRUA 3GZ4A 3ZWYA 1H0KA 3AM3A 4MPDA 1D8AA 1EE2A 3TZKA 1O0SA 1EVYA 1P1JA 3D3WA 2DFVA 3I6IA 2OFPA 1H9AA 1ZSVA 4JXKA 2FP4B 3ZWCA 3UW3A 1JAXA 4NJMA 4Z0PA 1C1DB 1EUCB 4CLOA 3C8MA 1JWBB 3TPCA 2O2YA 5H81A 4O1MA 1NPTO 4DLLA 1Y5RA 2Y99A 3NEPX 4K6CA 1QYCA 1Q0HA 3BTOA 1UXJA 4OYRA 4ALLA 4P8RA 3MWEB 2TMDA 2GO1A 5BSFA 2I9PA 5J23A 3QVTA 1LDYA 1M75A 1IZ9A 2EWMA 3DHEA 4AJLA 1Y8QB 1NQTA 3FD8A 1UXKA 1PGNA 3ZH2A 3PZBA 3E18A 1I30A 4B3HA 5JYDA 3PDUA 2A4KA 4C7KA 3DL2A 2DLDA 5AOVA 1PJ2A 3HG7A 4E5PA 4IDAA 1PS9A 1C14A 4RGBA 4BUCA 1PTJA 2BRUA 1B26A 1PL7A 4J7XA 1H6CA 5EQDA 1LNQA 2UUOA 3LLSA 1YWGO 1H6BA 3TN7A 3TRIA 1Y8RB 1HE2A 3LC2O 2J5QA 1EUDB 4NBVA 2GN4A 3W6ZA 2XOXA 5BNFA 5A05A 1IE3A 1SEVA 3GDFA 1ISJA 3NUGA 2IZ0A 4XGIA 1EDOA 4ALIA 4E30A 5C7LO 4BKPA 4GBJA 3QHAA 5KVVA 3ZU2A 3FWZA 2ZTMA 4EUFA 2X23A 1UZLA 1YONA 3MJ4A 3PHHA 4RF4A 4NH4A 4NI5A 3ZGYA 1VJTA 3PJFA 4BNWA 1MB4A 3OIGA 1M2WA 4XD2A 3DEYX 1TA4A 1B8UA 4UEOA 1C3VA 3ANNA 3P7MA 2WE7A 4AJJA 2H6EA 4J9UE 1P9LA 2ZCUA 4L76A 1GDHA 5A9RA 4RVDA 2DUUA 4XJSA 3V1YA 3TDKA 3HN7A 3QY9A 1EDZA 1LA2A 3GGPA 4H7PA 3RWBA 1ZJYA 3ICPA 5I9NA 3LF2A 1H93A 1U3UA 2DBZA 5BNTA 3WGOA 1R0KA 3OQ1A 2O3RA 4NU6A 3OEYA 4GX2A 4WEQA 1JN0A 3HE3A 3KHUA 1YRLA 2D5CA 4Z9YA 3GRKA 3FNFA 3OJ0A 3JQAD 1N1EA 2I6TA 4CM4A 3OETA 3Q2IA 4D0RA 3U4HA 5TX7A 1ADBA 2X9GA 2Q4BA 1KS9A 2YDYA 3DMTA 4YT2A 3UUWA 3BMQB 3EDMA 5HWSA 1MFZA 2HMSA 1VJ1A 3UGKA 2NUAB 1KEWA 3GGGA 3HADA 4FC7A 4CM1A 3LF1A 3PYXA 4IY1A 2PKQP 3KSDO 4CUKA 1YGYA 1ZK1A 3AUSA 5LDHA 4XWYA 3E48A 3PWSA 2I3GA 4PVCA 3C7CB 4WASA 3C7DB 2GN6A 1CWUA 5JXWA 1RM3A 3F4BA 2QX7A 3JQ9C 4O0LA 1E1LA 4L73A 3G49A 2UYYA 4XIJA 2DTXA 3ZNPA 4XGNA 4KDFA 4L4RA 3H5AA 4JX8A 1OI7A 4Z9XA 1PL6A 3RUEA 4FR5A 1VL8A 2YQ4A 4Q39A 4DA9A 1AUPA 1PQWA 1ZBQA 2Q1WA 3CH6A 4BO0A 4Q3DA 5HBRA 2C54A 4RF2A 4QUKA 2I66A 2YY7A 3R6DA 3QV1A 3U49A 3U4CA 1O9BA 3OP4A 3CINA 4AJ4A 4E31A 5JPIA 4GMFA 2YQ5A 3DXFA 1EBUA 1ZUD1 2PV7A 2G0TA 3RUHA 2ZJ0A 4XYEA 5FFFA 4J91A 3HB4X 2Y1GA 3SJUA 3F6YA 4KUGA 4M1QA 3E5RA 2P5UA 5AXAA 5G0WA 4O63O 3ETDA 3F47A 2E37A 3QWAA 3WIEA 1BVUA 1N7HA 1DAOA 3ANLA 3HUDA 2GD1O 4E2XA 2FMUA 3QVSA 2Q1TA 3KLPX 4I5EA 5G0VA 4PG6A 4DQXA 1ZFNA 4GKBA 2QQ5A 2YV2A 1FK8A 1PZGA 4GI2A 4ZICA 3JYOA 2D3TA 3CUKA 4OGWA 1IL0A 1B3RA 3LC7O 4WUVA 4GH5A 3RU7A 3UOGA 1QLHA 2Q50A 3BXXA 4CV3A 4E32A 4ZQBA 3T7EA 1R4MA 1PGOA 1O94A 1S6YA 3FNEA 1QSGA 3ZI0A 1WNTA 2FPPB 4RDIA 1MX3A 4ZQGA 1X1EA 5DOZA 1ONOA 3B70A 4R16A 4DVJA 4RQTA 4CL8A 1DBVO 6ADHA 3QE3A 1YBVA 5ENDA 1P1IA 4A0SA 1GPJA 5CDTA 3H65A 3R0IA 5JAIA 3C1OA 2IODA 4J1SA 2W8ZA 4JIGA 3QP9A 4AG3A 1P3DA 2VUUA 5BSHA 1EK5A 3AY3A 1VKOA 4ND2A 4P4GA 4OMUA 2NQ8A 4RLSA 3S2FA 3S55A 2O23A 4NMHA 1Z7EA 3GC6A 4E5KA 1ISHA 5HA5A 1XHLA 4MKXA 1HTBA 5EPOA 1HETA 2XF8A 2ZTLA 3MJSA 1F8GA 1F8FA 3Q3CA 3DBLA 3EK2A 4CLXA 4CMAA 2VRCA 4P4LA 4QO7A 5IXSA 3KEOA 1ENZA 1GD1O 2EG9A 3BMNA 4OOEA 1CEQA 4HADA 5JAMA 1LTHR 1HKUA 3KM0A 5HS4A 3WNVA 1T2DA 4OXYA 2D59A 3ZNQA 2Y1EA 4JJIA 3DMYA 2VHYA 2POQX 2O3TA 4BQPA 2FSSA 2Y67A 3WGTA 1LQUA 2HMUA 3DTYA 3GPIA 2IEDA 3GLQA 3UAGA 1I10A 4BKRA 4RCVA 2OP1A 3FF4A 3Q9NA 2JCXA 5JCXA 2R00A 3HHPA 1SZJG 4KTVE 1XG5A 4Z3KA 2AEFA 1NP3A 1KETA 2WJPA 4GSKA 2QYSA 1J49A 2O3QA 4EBFA 4IS3A 3WXBA 1KEPA 1ENYA 2BKAA 2DU8A 1MFPA 3ROPA 2NU9B 4JP2A 3V5NA 4FIZA 1NPYA 2IXBA 4PFJA 1B2LA 4BNLA 1RM0A 3KRTA 4LSMA 1YO6A 4J43A 3GRPA 4PG8A 3DZBA 3ZN2A 3COSA 2X4GA 3KSUA 1E6UA 1LU9A 5TRTA 5KKAA 4A03A 4CM7A 4FBGA 5JY1A 1WMAA 1IHXA 1LDEA 3DBVO 4GAEA 4HP8A 2ZQZA 5DP2A 3I3OA 2UVDA 4XA8A 3OFSA 3ROQA 4LISA 3W4JA 2EGGA 4BMNA 5EQFA 3TFOA 3T4XA 3RASA 1L7EA 2EJWA 2VHZA 4NR0A 4E5YA 1LRLA 4L9RA 1DHRA 1PJCA 5TJHA 2YFHA 2XAAA 4DBVO 1HL3A 3LLVA 3AW9A 2NADA 3C3XA 4AJOA 5CDGA 2FZEA 3FBTA 3IQDB 1RYDA 4IDEA 5IZCA 2PWZA 4L4SA 1GPDG 4QSMA 3VPFA 2VZ0A 3D5TA 1Z82A 3E8XA 2Y1OA 3DBRB 1I01A 1CRWG 2CFCA 3IKVA 3L4SO 1MP0A 3FRJA 1QR6A 1H6DA 3NGLA 1M6WA 2PZKA 2IYOA 1ISMA 1YBMA 5T64A 4FC6A 3NT2A 4YXFA 4E12A 5CAEB 5CG1A 2D2IA 2V6MA 1R15A 1ZK4A 1K5HA 4DC0A 2D5AA 3O26A 3HFSA 4UVDA 1U2DA 4J9VA 2QRJA 3L9XA 1ONNA 4MKRA 1I3KA 3LU1A 3CMCO 4BV8A 2Z1NA 4KUEA 3ZV3A 2BFPA 2PH5A 1YDWA 1H94A 2Q1SA 4R69A 1XELA 5DT9A 4AICA 1LSOA 1OOEA 5DF1A 4Y8VA 2CDCA 4DGSA 3I1JA 4QTZA 4BHTA 1P0CA 1TT5B 4NG5A 3H9EO 3NRCA 4RPGA 1NFQA 5T8KA 3PFFA 4IJKA 4BIIA 1MC4A 3I83A 1R37A 5JO9A 3DZIA 3TZQA 2E49A 4YAEA 5A4DA 4JROA 1I3MA 4Y67A 4GVLA 4OAQA 4UUNA 3ZW9A 1UP7A 4RZIA 4IS2A 4JK3A 3O8QB 4YT5A 4WGGA 3MWDA 1CQJA 2I3AA 4K28A 5I9LA 3JQGA 4AJPA 4XR9A 1W4ZA 4I8XA 1WDKA 5IZ4A 2RIRA 3VZPA 5HM8A 2OP0A 1JLLA 1UP4A 1I3LA 2IZZA 1X1TA 4RL6A 4LMPA 4IDBA 1X7GA 5CFZA 3WGHA 2LDXA 4IMRA 5BSEA 1I2ZA 2QYTA 3PEFA 2ZB7A 4Q3AA 1N1GA 4A2CA 4W6ZA 5ADHA 1N7GA 2NSDA 4OKIA 4B79A 4PN3A 4RVFA 1ML3A 4BO3A 3F9IA 1WVGA 2Z5LA 3I9NA 3DAFA 1Y81A 2HSDA 3GN1A 4XRGA 3LQFA 1QV6A 4TKMA 1X7DA 2Q4EA 5A03A 1E7MA 1TEHA 4CQLA 3RIHA 3I9LA 4BGIA 4CMIB 1X13A 4FFLA 4G2NA 3SXPA 5KVCA 3TZ6A 1AN9A 2PZJA 3VHRA 2P4HX 4GWGA 5ILGA 4FFOA 4U6SA 5LC1A 2PKQO 5JLAA 4YDRA 4H16A 1UH5A 5JAZA 1IY8A 3OQBA 1Q7BA 1HF3A 3JQEA 3H3FA 3I9OA 5G2OA 1Z74A 3DHYA 3K96A 5JDCA 2VYND 2UAGA 3GNTA 2X0NA 4UULA 2LDBA 1N5DA 4GX5A 3FN4A 4NFHA 1P33A 4UVHA 5L51A 1Q7CA 5ER6A 4NBRA 4OXKA 3ZNOA 5T67A 2BGKA 1JQBA 5HRUA 3GDOA 2DT5A 1ARZA 4QXMA 1QKIA 2GRAA 4PIVA 3B1KA 4HY3A 2PGJA 5KNLA 3ON5A 2P9GA 3DBHA 3BA1A 4W4TA 4M54A 5EMHA 5U4QA 1Z73A 4NBUA 5COBA 3WTBA 5U1PA 4DC1A 7ADHA 3H5RA 1BXGB 2JD2A 3EGOA 3KYDA 4BKQA 2H5LA 4XYGA 4XQ9A 4A5OA 1M67A 1N8KA 2NM0A 4FGSA 3TSCA 3S8MA 3GY0A 3RI3A 5A3JA 3TL3A 1H5QA 2B4TO 2W98A 2X1HA 1ZK3A 4WLUA 3JQBC 3ZHZA 3LYLA 4ZN6A 4HXYA 1ZEJA 3JD1A 2JCYA 1E6EA 4GSLA 1UXHA 2NU6A 4OSOA 3GNSA 2Y66A 5A1TA 3WG9A 1T2CA 2JD0A 2Q3EA 4EI2A 1LUAA 2EEZA 3L6DA 3U62A 3O9ZA 1HWYA 3VPSA 4WK6A 3WBBA 4IIVA 4TRRA 3C1TA 3HNPA 4A27A 3NT5A 1SPXA 1P77A 4D43A 1HSOA 4X54A 3JQ7B 3JQFC 2PLAA 1E3JA 4JJGA 1XDWA 3F1KA 4HFRA 2I76A 1WDLA 4NJOA 4XQEA 4Y6SA 1W0CA 3AJRA 3CIFA 4I08A 4IIUA 1TB4A 3DZGA 3OJEA 2W4QA 2Y0DA 1DIGA 2Z1MA 1NWCA 3AM4A 3IKTA 1T24A 1WPQA 1AHHA 2GZ3A 2VZ8A 3KBOA 5IDXA 3CKYA 1DRWA 4O5OA 3OQ6A 4D46A 3K6JA 1ID1A 3PLRA 5B4TA 1Q2XA 2BFAA 3PJDA 4E0BA 3N58A 2V6BA 4D44A 2QZ9A 3OJFA 4EGFA 1B3BA 4DLAA 1JVBA 1QLJA 3KETA 4FB5A 4FFPA 5L3ZA 1SC6A 4BO7A 5JCJD 3U4IA 2NU7B 3CXRA 3TOZA 4P22A 4K26A 4RVSA 2IRWA 3OIDA 3R1IA 3BIOA 5EN4A 3M6IA 4W82A 5MDHA 2NLOA 3BHJA 3H8VA 4ILKA 4PG4A 4XR4A 1Y5MA 2UDPA 4N5NA 1ISIA 2Q2QA 1W8DA 2VOEA 3JTMA 2W2LA 1D4FA 5IFLA 3PYMA 3FI9A 1WAMA 2P5YA 4R3WA 5CPFA 3AOEA 5DBGA 1NR7A 5EESA 1XQ6A 4XYMA 3NTOA 3WFJA 4EUHA 4BNUA 3A06A 4W99A 5JFOA 3K30A 1GUYA 2YYYA 4DYVA 4XRRA 1R4NB 4BNVA 4GKVA 1S7CA 1A7AA 3MZ0A 4ZVVA 3UFXB 2E48A 4U0KA 2PD3A 3AFNA 3ZDFA 1DC4A 2O7QA 3EYWA 3AUUA 2GDZA 5FEUA 4EJ6A 1G0NA 1N9GA 2R2GA 1WLYA 2X7HA 4CLEA 2BD0A 4JP3A 4BGUA 1E7RA 1E7YA 4WNCA 3V2HA 3PHJA 2PFGA 1LQTA 1JKFA 4ALMA 4FOSA 3TWOA 2WYUA 4Q3NA 4RQUA 1I33A 5JDIC 1E1KA 1VJ0A 2B83A 4II2A 4TSKA 2GGSA 3PJEA 2Y1FA 2YV3A 3F5QA 2JD1A 1HE5A 5BR7A 4NHEA 4BNNA 2P4QA 2EV9A 3DR3A 4RLHA 2JFHA 1BW9B 2Q2WA 2V65A 3O38A 4E2ZA 4ITUA 2FSVA 4HFJA 3SC6A 5G4LA 4CLRB 5LCXA 2AG5A 2DVMA 1H9BA 5F1KA 4EUEA 1HT0A 1BWSA 3GZNB 1DIRA 4EEXA 3BHMA 1GUFA 3HDYA 3D4PA 4NIMA 4BNFA 3QIVA 2YJZA 3G1TA 1A27A 4AJEA 2P9CA 1V0JA 5TJ9A 3LC1O 1NM5A 1ZJZA 3DAGA 4G65A 2YUTA 4NQZA 2Y0CA 4DXHA 3VH2A 2P2SA 5A9SA 5L4NA 2JHGA 5T6BA 3ONFA 1ZXBA 3DZJA 4MVJP 3IJRA 4UVGA 4ALJA 1C1XA 2UV8A 1LEHA 4Y98A 3FTPA 1A9ZA 4XEHA 3WB9A 1LDNA 3GG9A 3NX4A 1NQ5A 3OF2A 2RCYA 1OC4A 4ZQHA 4J1QA 5DNAA 1UXGA 4YQZA 3FPLA 2BGMA 2E82A 1QP8A 4CQMA 1O95A 2RAFA 3AY6A 5IDYA 4FW8A 3ZV5A 3V2GA 1EVZA 3ROMA 4YAKA 3KXDA 3PIDA 2AE2A 4TVBA 3OJOA 4CV2A 1DEHA 5IJZA 1YB4A 3F3SA 3CZRA 2UUPA 1VM6A 1PJ4A 4MVJA 4DIBA 3E9NA 2A94A 3E5MA 3GUYA 4ND1A 2AHRA 1V3VA 4YYZA 1GYRA 2DUWA 1QYWA 4ZA2A 3E82A 5BSGA 3OA2A 1R0LA 1U8XX 4BB5A 3PWKA 4UREA 4L74A 3ZWOA 4YRAA 1DC6A 1K0UA 3KYCA 2Y68A 3W8FA 1BRMA 3RC1A 3G3EA 4L75A 4YJDA 4BNXA 3SVTA 5CPBA 3K9QO 2GYYA 2QW8A 3ITDA 4PZCA 3DQPA 2QG4A 1HDGO 1PR3A 5AYVA 1B0AA 3S2IA 3BZUA 1PJ3A 3RVDA 2IXAA 1CIVA 5CP8A 4KTTE 4K1LA 3GVCA 3VH3A 4B4WA 3I4CA 4RPKA 4WCFA 1EQUA 2PZMA 3Q11A 3ZWPA 2Q49A 4DMLA 1NX6A 1YQXA 3TQHA 4ZQEA 3R3JA 3RKUA 3VVBA 3NJ8A 1GCUA 1MC5A 2G1UA 3ENKA 4J2OA 4C7JA 2ZIZA 5KJFA 4PLVA 4ESOA 4D3DA 2W90A 1AXEA 2HMTA 2PZLA 3LT1A 4A7PA 4D41A 2HRBA 3DZHA 1ISFA 2B69A 5F21A 1TVEA 1ZVMA 4AJHA 2Y93A 3D3WB 4ND3A 4IZIA 4RV9A 5KJ1A 2J3JA 4GPD1 3EHEA 4NJMB 5A9SB 3DZKA 2ZKLA 4CLOB 2C5EA 4J0EA 2X9NA 3K2BA 2NTJA 2WYWA 1P74A 1P31A 3NV9A 5GZ1A 3SJ7A 3NDJA 3WDSA 4CMKA 3ABIA 4OHUA 1AHIA 2VNAA 3N7UA 4UEKA 1PGPA 3K73O 4M86A 2FPGA 5DCYA 5B37A 3PQDA 1WMBA 2V7PA 5TS3A 4H15A 3QJ5A 4KUHA 4BL5A 4XX0A 3MCVA 6LDHA 4W7IA 2O48X 3VAZA 5DCWA 1VI2A 4NBTA 2C0CA 4XJTA 3RUCA 1IZ0A 1UDAA 2Q45A 1Z45A 4WECA 1GQQA 3AUAA 4GLLA 3ZWMA 1N92A 4R1UA 2D1YA 2BGLA 4QX6A 3E1KA 3NAQA 3WGYA 3A1NA 3GVHA 3MEQA 4GGPA 3V2UA 1GR0A 1I32A 1LX6A 1RYEA 2VUSA 3NGXA 3VZQA 1HDYA 2C2YA 3C85A 4BO1A 1ZNQO 4NBWA 2PNFA 3TF5A 4ND5A 1PWZA 2P68A 3B1JA 3D1LA 2X5KO 3QW2A 5ITVA 1Q0LA 1KYQA 3O4RA 3JD2A 3KB6A 1PQUA 2X58A 3AY7A 4U7WA 5I8WA 1T4DA 4TROA 1WDMA 1BVRA 1F14A 1YQDA 4CMCA 4G5HA 5F1PA 2NVUA 3ZU3A 3QLJA 4QT0A 1PZHA 2EF1A 2CZCA 4XIYA 1OZAA 2XPCA 4Q9NA 4BO6A 4CMEA 5B1YA 5L95A 2BHLA 1J0XO 5TIIA 3DDNA 4I9NA 1V9LA 4YTEA 1ZMTA 4R1NA 4GQAA 1KEVA 4MINA 3RCBA 2O4UX 3FTNA 1OAAA 4LSWA 4OQZA 2OXIA 5B4UA 4I1IA 2HK8A 1I5RA 4I5FA 3VKUA 3WICA 4XCVA 3JQAA 2OHXA 4KMSA 2EP7A 3IP3A 4LCEA 2WEKA 5EIOA 1LRJA 3GHYA 2JAPA 2JFGA 3DZFA 2RBEA 2VQ3A 3QWIA 4LN1A 3A4VA 4CM4B 3STHA 1ZMOA 1FF9A 1ISGA 3F1LA 3LT4A 5JSFA 1Y9EA 5BNIA 1TI7A 4CV1A 3NJ4A 1YDEA 3ADOA 3AK4A 4PLYA 3PP8A 3ZHYA 5K9ZA 2YZ7A 4O59O 3DWFA 1ENOA 3WGGA 3I23A 1UAYA 3K92A 3CMMA 1WW8A 2FN7A 4MVJF 2HJSA 1YB1A 3PWZA 5G4KA 1EEHA 2FR1A 1TT7A 1Z7BA 4DPKA 1L1FA 4ZD6A 3PHGA 1E7WA 4TMFA 4UUMA 4W9NA 3TJRA 5KJ6A 4FSHA 3G17A 4LRTB 4E3ZA 2TMGA 3PPIA 4RZHA 4KDEA 3GT0A 4OM8A 5C7IO 3WJ7A 2O3JA 3ZWBA 2EKPA 1RWBA 3KLMX 1YJQA 3WNQA 1PJQA 2B5VA 5F3RA 4ROSA 4CLHA 5AXBA 3RROA 1XLTA 1E3IA 3P2OA 4PLHA 1WZEA 1GEEA 4RDHA 4AJ2A 1F06A 4L4XA 2GUGA 3IC5A 3FR7A 4CJXA 1K6JA 4ZRNA 1EVJA 3GUCA 3IS3A 2HCTA 2HMVA 4R5HA 1V35A 3QQPA 3U09A 4DPMA 5F5NA 2O2SA 3H5NA 3QVWA 4GX1A 4WCDA 1PL8A 2VRBA 5KJCA 2C5AA 1HE3A 1ZKMA 1W6UA 1KVTA 3MJEA 3MJTA 4YJGA 3P19A 3FR8A 3A9WA 5FYDA 2P9EA 5ILOA 3VZSA 3GEDA 2Q99A 3PHIA 4MJLA 1T1RA 3DMTC 4N18A 4PZEA 4YJFA 2JAHA 3L4BA 2JL1A 4DLBA 4JBGA 5A02A 5G0TA 3KO8A 3ZWWA 1HDZA 4DMMA 5DCUA 1HYEA 1NHGA 4MVJM 2PR2A 5L4LA 2QHXA 2CD9A 5TLSA 1EMDA 2HK9A 3IJPA 1SCUA 1PR9A 1PSDA 3JQ6A 3TL2A 4MP8A 1R4MB 3ZWXA 2BLLA 1U5CA 4P4NA 1NPDA 2NQTA 2JFFA 2HO5A 1QORA 4BNGA 4YCAA 1JDJA 1ZIDA 4WKGA 2DBQA 3OM9A 2HK7A 3HZZA 4NK4A 1HDOA 4RVGA 3GVXA 3N74A 4MIOA 1CF2O 3EVNA 1E77A 1E7SA 5IF3A 4S3MA 3EY4A 4E13A 4ZJUA 3L6EA 1SEPA 1PEDA 4IJVA 4A73A 1C0LA 2AQIA 4CMBA 3DBLB 3HJAA 5K6AA 2B36A 3KOUA 4F45A 1E1MA 3AM5A 3IDSA 3WBFA 3BMNB 1PJSA 4HBGA 3HWRA 1ORRA 4TZKA 2HAEA 3ICCA 4KWHA 1LSSA 1R16A 2ET6A 5FI3A 4LW8A 3JQ8A 4RO0A 4AVYA 1A72A 1ZXLA 1DC5A 3D4NA 4DBZA 1LC0A 1LRKA 4MIEA 1QRRA 2DTEA 4CR8A 1MXFA 1N2SA 3OHSX 3RC2A 2GCGA 2WD7A 4DWVA 1KY5A 3U3XA 1KC3A 1XR3A 1QV7A 5JC8A 1I2CA 3GFGA 5L4SA 2EJVA 3WYCA 4YT4A 2CVZA 2RHRA 1F12A 2DAPA 2YV1A 4BOYA 4QEDA 4LMRA 3HB5X 3WLFA 4Y6RA 4B3JA 2VYVD 1LLCA 1VL0A 2VN8A 3S1LA 4HFMA 2RH4A 3E9MA 5HTOA 2CVOA 3W1VA 4F46A 4CMHA 4I5GA 4YJHA 2C7GA 4CUJA 2CMDA 2X0JA 3BMCA 2A35A 2PD4A 1LLUA 4H3VA 3UXYA 4DQUA 1I2BA 5FI5A 8ADHA 1RJWA 2O4CA 1EE9A 1YB5A 3RBXA 3KZVA 4J7CA 1O89A 5JW6A 1CJCA 5FF9A 5KOIA 2FPIA 3T4EA 1R66A 4EJMA 3AWDA 4OO3A 3EMKA 3BYZA 3VPXA 5A04A 4R9SA 4Q3BA 3D64A 4HUJA 3S2EA 4BGEA 3ASUA 3U9LA 3TFQA 3ULKA 3ORFA 4RJTA 1WZIA 4HV4A 3EVTA 3PFWO 4B7UA 4RVUA 2DBVO 4D79A 2GLXA 2GF2A 3LSYA 5BQFA 3W8EA 2O3SA 3VDQA 2G5CA 3D0OA 3EZYA 1JA9A 2R00C 4FD3A 5IDWA 3PQEA 2W2KA 4CM8A 2JJYA 5COAA 3VPHA 1UP6A 3V1TC 3QWFA 4FDAA 4E6PA 4JCOA 3PVZA 4BV9A 1KVQA 1Q0QA 4IDDA 2IDZA 3FSRA 4TRNA 3NT4A 1KIFA 4TZTA 4E5NA 3JD4A 1GL3A 1NAHA 1NVGA 2BMAA 1XA0A 3HN2A 3K5PA 3CE6A 4NDNE 5A9TA 2AXQA 3I52A 1X0XA 2VWPA 2J3IA 2A9FA 3LT0A 4IGEA 1LDMA 1GU7A 3Q0EA 4RPLA 3B1FA 2IZ1A 1HE4A 4CUZA 1YOVA 2VT3A 1NNUA 3CPSA 4ZGWA 4LCJA 2I99A 1BXZA 2YFQA 5A5FA 5JC1A 4R1SA 2C59A 2PGLA 5THQA 3ST7A 2OOSA 3FNHA 2GERA 4K6FA 1BG6A 3PI7A 3WQRA 5C3MA 2FZWA 2PK3A 2EW2A 3KYBA 1E3LA 2WSBA 4MVJG 9LDBA 3I9KA 4J90A 4RPJA 5L7WA 1NASA 3M1LA 1JKJA 2VTDA 4DQVA 3MWDB 1CQJB 2YDXA 4IQGA 1NFRA 3H9JA 3JQGB 1VKNA 2YHIA 1YH3A 1J5PA 2OBNA 2NU8A 3GHHA 3RUFA 1JLLB 1EUZA 1PZFA 2HU2A 4IJUA 4GWKA 4CM9D 3GPDG 2PY6A 4EJ0A 1NVTA 4WLFA 1NWHA 4OIMA 1AE1A 4I5DA 5EERA 4YPOA 1TLTA 3IUSA 4FGWA 1B16A 3JYLA 5I7FA 3ETEA 2D4AA 4F3YA 2IYPA 5TT1A 1G1AA 3PXXA 1ZSNA 5IDQA 1JWAB 4OOFA 4TRJA 3P2YA 5H83A 1K6IA 4ND4A 1FMCA 5MGBA 1ZK0A 4D7AA 1SB8A 4CQLB 1Y6JA 3DTTA 3ZWVA 3H2ZA 3ADPA 3DAPA 1ZCJA 4YRBA 2VZ9A 1DIHA 3OBBA 4DL9A 3K31A 4DREA 3GAFA 1O6ZA 4P38A 2I67A 3L9WA 3JYNA 4XB1A 3BTVA 2VYNA 2ZYAA 1GUZA 1E3WA 2OL4A 1GADO 3QSGA 5ER9A 2NV6A 4DIOA 1EFLA 2ZB4A 5GMOA 5IZCC 4PCVA 1CETA 1NR1A 2I65A 4JBHA 5T8KC 4YQYA 1ADGA 4MP3A 4UUPA 4OSPA 1CQIA 3HDQA 5JE8A 4PVDA 1YL5A 3PDJA 1P1FA 2EGHA 1Z6ZA 2BH9A 4YWJA 2GZ1A 3G0OA 3JD0A 4CMJA 1DXYA 4QFDA 4HNGA 3EW7A 4LK3A 4YEDA 2C29D 2CY0A 3LZ6A 3X2FA 4PRKA 2FP4A 3OA0A 3OEWA 1JKIA 1B7GO 1O8CA 4NFSA 3DBHB 1C1DA 1EUCA 2CSUA 1BHSA 4G81A 4M8SA 1T1SA 1VRWA 3DC2A 1SMKA 4E2YA 5AXCA 1NYTA 5TQVA 4A26A 2YHUA 2Z95A 2C82A 4J2HA 5KIAA 3UVEA 3KYDB 3SBOA 3MWEA 2Q2VA 3OICA 3R3SA 1UZMA 4JLWA 4GMGA 3EC7A 2V6GA 4R01A 1MG5A 3CZMA 1X0VA 5CDYA 3DFZA 3KTDA 4RORA 1B8VA 5DBIA 3IUPA 4D42A 2CVQA 4OQYA 1HDXA 2J5KA 2NU6B 1FDVA 1A7KA 1LBEA 1MV8A 1HEUA 4WJZA 2B0JA 3NYWA 2Y1CA 4FJ2A 2FR8A 4JN6B 1BXKA 4WLVA 1GTMA 1E0DA 1PJTA 3D3EA 1DOHA 1I8TA 4R68A 2DTDA 3GDGA 3GH3A 2Q1UA 1I3NA 1Y8RA 3Q9UA 4WLNA 3GVIA 3GF4A 2GNAA 1JAYA 2IEBA 1P0FA 1EUDA 5JDCC 3WIDA 3JQ9A 2C7VA 1OBFO 1ZSYA 5I8ZA 3OMLA 4HFNA 4RVHA 3ZV6A 4PGFA 4BNZA 5I7VA 1PJBA 2X86A 3D7LA 1XIVA 4MVJI 4XQGA 2H9IA 4BMSA 3WYEA 1LJ8A 1PZEA 4BVAA 2ZJ1A 3DOOA 5T5QA 5DZSA 3U5TA 3LDHA 3PK0A 1ZO8A 1T2EA 5JCJA 5G0SA 1MG0A 3WMXA 1PGQA 1Q7GA 3M1AA 4FJ0A 5I9MA 5IN4A 3CSDA 3HFGA 1Q1NA 4B7XA 1HLPA 1XGKA 2RH8A 4AJNA 4I9HA 4IUYA 4INAA 2WTBA 2QRLA 2GR9A 4M89A 5TNXA 4A10A 1MLDA 4AFNA 4CODB 4FQ8A 3HDJA 1LSJA 1KOLA 1NVMB 3KSZO 4BNMA 4E5MA 3DFUA 3INGA 4PLTA 1DLJA 4R1TA 3WSVA 5U9CA 5KWEA 4KP7A 1E3SA 4KOAA 5JMPA 1KVRA 2BELA 3ETGA 4QQRA 4WEOA 2AE1A 5CDSA 3QWHA 1K89A 3EAGA 4OH1A 4B4OA 3U4DA 4QECA 1Y1PA 1U4OA 1SBYA 3BMQA 4WE3A 1KVSA 2ZTVA 1EVIA 5L40A 2C2XA 2NUAA 3M2PA 3OJLA 5DBFA 3RUIA 1WP4A 2D8AA 3GG2A 3HSKA 3RD5A 5LDGA 3GVPA 3GOHA 3K2EA 1BTOA 3WMWA 1VE9A 1YL7A 1XCBA 3EUWA 2VT2A 3L0DA 4BGVA 1N9GB 3QRWA 4L0QA 3WWZA 1C0IA 1HRDA 1M6HA 1YXMA 1ENPA 1RM5A 2Y0EA 5DDIP 5F5LA 4C4OA 7MDHA 1PJLA 4M87A 2VNSA 4PG7A 5H82A 2NTVA 5AXDA 3UCXA 3ZV4A 3X2EA 3WR5A 4BB6A 1PU2A 1GQ2A 4N5MA 4BKOA 1B8PA 1UJMA 2NVWA 4GVXA 3RFXA 1A71A 1VSVA 4M55A 1LDBA 2VHXA 2X0IA 4PLFA 2EKLA 2X5OA 1K2WA 1NTOA 1D1TA 4YVFA 3C1AA 3Q6IA 2DPGA 4J4HA 4GLOA 3H9UA 4KQXA 1E1NA 5HS6A 3TOXA 3RKRA 5DULA 1YVEI 3PGXA 3UF0A 3TZCA 1XU7A 4E21A 2XXBA 4GGOA 4DYDA 2Y05A 2JKVA 1GYPA 4CR7A 4XDZA 2XXJA 3V8BA 3AOEC 3Q1LA 9LDTA 3WFIA 3LT2A 4XGKA 3GMSA 2PA3A 5A3VA 4EITA 1B14A 3GQVA 3LK7A 4BKUA 4YAGA 2VTEA 1GV1A 4YACA 3L07A 2J5RA 4XB2A 3AUTA 2PD6A 2X0RA 4IPTA 1C1XB 1ZW1A 1YL6A 3PZRA 5JBIA 2HUNA 2PTGA 4XDYA 3I4FA 5AVOA 4AJKA 1NXQA 3NTQA 4CL3A 1L7DA 4PLGA 2C20A 1R6DA 1PS8A 5L45A 4FFMA 4YBZA 1DSSG 1FDSA 4JNKA 2FPPA 1EZ4A 3RSHA 4B4VA 4CM3A 4CQMB 1IPEA 2VUTA 2X6TA 2GN8A 3B20A 1C0KA 1SOWA 2HMWA 5A06A 3AFMA 4WOJA 1KVUA 2H63A 3GGOA 4CLDA 2GASA 4U5QA 4RPHA 2AMFA 4TQGA 1ULSA 1R0SA 2RHCA 2B5WA 4UEJA 1MA0A 3AOGA 3ONDA 3GFBA 1P1HA 4IQ0A 5DN9A 5ICMA 5ENVA 2AQ8A 1PQPA 4XYBA 1FDWA 1IOLA 2VHWA 5G0UA 5L7YA 2G17A 4BNYA 3WS7A 2AQHA 1XU9A 3ZW8A 3KYCB 1XYGA 2FHSA 2WD8A 3WQSB 4BMVA 4U0JA 2VRCD 4GX0A 1KC1A 2O7SA 2FWMX 2Y1DA 1Y7TA 4YA6A 3SLKA 4Z9FA 2E4AA 3MTJA 2WMDA 1SNYA 3WWYA 4BNHA 3LVFO 4PLCA 2EERA 3MOGA 1D3AA 1EBFA 1GY8A 4D3SA 4Z0HO 4K9DA 2EP5A 1DB3A 2ZK7A 3K8ZA 4R9RA 4WCFB 8LDHA 2E6UX 3PGJA 2NU9A 1CDOA 1ADFA 4FCCA 3JD3A 4NPCA 3U0BA 2VWHA 3RJ9A 2VCYA 1G6KA 3H9QA 2PKRA 1E3EA 2OORA 1NFFA 2X22A 3ENNA 3GEGA 3VC7A 1JTVA 5TT0A 3WTCA 3WOHA 1EK6A 3SC4A 1ADCA 4CR6A 1A5ZA 4MKZA 3ASVA 2QRKA 4ONEA 3VKVA 4EDFA 3O03A 5KKCA 4B3IA 3UICA 4LGVA 2ZQYA 4EYEA 3FPCA 2OGUA 3KVOA 1GAEO 1PIWA 3RUAA 1MUUA 4AJIA 4R5MA 5JAQA 3BTUA 5K0ZA 4S1VA 4OXNA 3IOYA 1OC2A 3RJ5A 2ZATA 3FCOA 2H1SA 1IPFA 4WOKA 3SEFA 2FPGB 3PJGA 3QA9A 2AA3A 1DRVA 2J3HA 3IAHA 1J6UA 4BQRA 2G76A 4XX0B 3F5SA 3DBRA 1SB9A 1PS0A 4JBIA 2AEJA 3GNQA 4R54A 1RM4A 3E9QA 2DQ4A 4ZRMA 5KTKA 3WYBA 1E7QA 2OMEA 2VWGA 2EKQA 4WCFC 3KEQA 3JQCA 1WXDA 3ZWNA 3GEMA 3IIEA 1HZJA 3BMOA 5CAEA 1AGNA 3D5QA 4OKNA 1QG6A 1I36A 1RKXA 2GSDA 1VPDA 4CM6A 5B12A 4UVEA 1T4BA 3RFVA 2J8ZA 1JVSA
chains in the Genus database with same CATH superfamily
4PZDA 2D0IA 4RSGA 4IVPA 3DV0A 2QP4A 1VSUA 5K3SA 3U13A 2B25A 1XRRA 1KSHA 1N5LA 4KBFA 4XKJA 1R9GA 3SHWA 1J1ZA 1AO3A 1JJFA 3TM4A 1KU6A 1IN7A 1HURA 1QYVA 3RAFC 4EW6A 4KGDA 4KPEC 1YS4A 1Y4UA 5TQJA 5B6JA 1ONPA 3GJRA 2FQQA 4AZTA 4EJSB 1JLMA 1JU9A 2XE8A 3LECA 4YO8A 3H1EA 5HX7A 4PY2A 5H1YA 1R7RA 2B99A 3ZWDA 4N41A 2P1DA 3TX6A 4F6LA 1EFKA 3H4VA 2VBCA 4DIDA 1YDFA 2X9VA 3H6KA 5KJEA 1XZLA 3CUYA 3RC9A 2YW9A 2MTBA 3WRXA 1H1DA 1PKXA 3CJTA 2GN0A 4MVJH 3FTEA 2IP1A 4EMBA 2O50A 2CDBA 4JP8A 1LD3A 1OGYA 5A5EA 3NM4A 4NK5A 2PUBA 3A11A 2WUEA 3IR7A 3JSAA 3JQAB 1OGIA 5DP1A 1FZTA 3ZYCA 3IPRA 4REMA 4LI0A 3VOSA 5B58C 4G8CA 1RWQA 5FUMA 1M1NB 3JQDA 4XYLA 1KFKB 1UWVA 2XDWA 3RU9A 3HDTA 4DLYA 5KOJA 1BXRB 3ANSA 4U6QA 2V6IA 2FPWA 2M9MA 4G1MB 4P92A 3G2IA 5JECA 2R47A 4M49A 1DKNA 3QITA 4TT8A 1A2BA 2XTZA 1M0EA 3UWPA 3W5IA 4J0HA 4N8EA 5JJIA 2MR6A 3NKLA 2YC4C 1MRZA 3NI2A 2ZZNA 2CDRA 3KUKA 5KTYA 2DKFA 4MCIA 3CEAA 1PV2A 1JP7A 2A9PA 3G1UA 4IQ4A 2ODNA 3EF3A 4JT2A 2I2XB 4XM2A 5AOBA 4Z0TA 2QD4A 7ABPA 1YGPA 2GO7A 2ORYA 2P9HA 4RKRA 4C1BA 1ETUA 1I0IA 4DIFA 5BUCA 2CE7A 3DHWC 3OWXA 5CG2A 4MRMA 5M2QA 1U2EA 3HP7A 1Z88A 1ZQ9A 5CGQB 5HBGA 5H80A 3UJ3X 2XZTA 1W30A 3QTTA 3MUNA 5LXTA 3FETA 4UPEA 3CX4A 2FB9A 2FUG1 3EWAA 4G5SA 2R25B 1G3RA 4ZQFA 1N6KA 1VMEA 3JQFA 2C78A 1RXUA 2IIPA 2X8LA 1L5VA 3O4GA 2XMGA 3HUFA 3SIWA 5B4VA 3EPPA 1BVYF 3LRPA 4Y6PA 2R6JA 3Q3VA 5JMWA 5JVDF 4JU9A 4Q9DA 4EPTA 1U0JA 1A4XA 3L1JA 3MJRA 5IF9A 3OQNA 2WM9B 3K4QA 1G4UR 4AQDA 4EFDA 3BRCA 2QTBA 2VK8A 2XUKA 4HDNB 5GP1A 3ZU4A 1TLFA 4FS3A 4L5YA 1PWXA 4IH9A 3A2LA 3WLKX 1VGQA 4HG2A 4R4JA 5CFLA 1NF8A 5CD1A 3AI2A 1SHZA 4IXTA 4BLPA 3DLBA 1HFEL 4KPUA 1P4HA 1GZHB 2B4QA 4KE7A 2EBUA 1GLVA 5C46F 3N39C 1S01A 5I4BA 4OX9B 1HKHA 2MSWA 1BXGA 1WSBA 2PUWA 3AQIA 5HXAA 1MH9A 2XODA 2VEOA 3ZDDA 1NMQA 4JQSA 3AVWA 2B37A 4S1WA 4GFDA 3V34A 4BTLA 5IT5A 4QFCA 2CDAA 1RLJA 1VGVA 2JCBA 2YYSA 1FC0A 3GMDA 4I81A 2G6TA 4UAGA 2VP5A 1HR0B 1LSUA 1CV2A 2Z04A 4HK4A 2A0FA 3KAJA 3KQMA 4DRYA 1U8FO 1NOJA 3FBGA 4MLCA 5BQPA 3UMYA 3KDSE 2XRZA 1DQRA 4J4TA 3ZH9B 3ZS9A 3JYPA 2CLDX 2X19A 1H23A 2JF0A 3O6VA 4KXVA 3WGQA 4ZI7B 3LBNA 1I3CA 3WK4A 1V25A 5IJ0B 1TO2E 3GGSA 3MCUA 4YAJA 3S44A 1E18A 1KFJB 3G9QA 4Q05A 4BO2A 3RYCB 3QBDA 3UAYA 4BFUA 3K0BA 2QD3A 2Z3ZA 3HYCA 4GYKA 4XGQA 1Z06A 5K3AA 1E5QA 4FUTA 4DTIA 1UANA 5KSPA 1SC9A 2ILVA 5T41A 2PKYX 2LCQA 4MROA 1ZGHA 2LP4Y 1IUNA 1SRQA 3L7AA 3WLNA 3W6UA 5BYAA 1BSVA 4QUEA 1ZMBA 3F46A 4L3WA 5CXXA 1KRXA 1EUQA 2B7LA 4Z4CA 4DQ0A 3VU0A 1C7QA 3B6KA 3UJ7A 2RJNA 2E55A 2Q41A 3K9GA 1BDMA 1QH1B 3DH0A 1Y6GA 1SBQA 2JHFA 4O6VA 3ELUA 2IYLD 1XPRA 1DFHA 2OKCA 4QIHA 2EBWA 1MORA 2ZYSA 3JQ8B 3H18A 4FT2A 4J49A 4E5DA 3AVYA 2QX9A 1QRSA 1IJBA 3VGJA 4EK9A 1KYWA 1ODKA 2PU7A 4B82A 4IKPA 1UAGA 2XJ9A 4N7MA 2GZSA 4F2WA 4D3FA 1YQGA 2BI8A 3EAQA 3ICWA 3W4IA 3VTZA 1LI7A 2NU7A 3W79A 1BMDA 5E2BA 3CBGA 4OMDA 1W1UA 4MMZB 1SHKA 3L7CA 3NAMA 4K9LA 2DF8A 4HLDA 2FFRA 3AU8A 4YMWA 1IRXA 3C24A 2CXQA 4GXQA 4O2LA 5C5IA 3EIOA 2VI5A 1KHHA 2AH5A 3D8UA 2MINA 5KNCH 2VYVA 3ICVA 4HTAA 5KYXB 3Q0TA 1KFCB 2IOQA 3B1XA 4EY7A 5E6RB 5IC5A 3WX0A 4MVCA 4EF4A 4EG6A 4RLQA 1H6AA 2Q3MA 1I1HA 1JDNA 3E9DA 4S35A 4D82A 4H0CA 2WA2A 4NDZA 3A4MA 1DDGA 1ZH8A 3E7WA 4NE9A 3UMMA 1HDCA 1E8MA 2FQWA 5GZ6A 1FLVA 4FLFA 4Q7QA 5L40A 1DHTA 1JIXA 2WG2A 4Q15A 1U28C 1UT5A 2F1JA 3KSBC 3R5JA 3UFXA 1PBNA 2CCKA 1USUA 2EZ4A 2J9YB 3OMWA 2ZIEA 2PZEA 1LBTA 4J0QA 3AVOA 5DXJA 2PIAA 1E5XA 5EXSA 4BWFB 3Q3JB 3P9YA 4OAOA 5SY9A 3EVZA 1RFGE 3I58A 3KJGA 5JH7A 2QUKA 1IXRC 2CXUA 3CLHA 2G80A 3W7VA 1V6AA 1MGOA 1XZHA 1VE3A 4TLDA 1EFDN 2C9DA 1OTXA 1UJ2A 5HQ3A 3QYAA 1T25A 5D5PA 4OVKA 5KZMB 3REOA 3FOFC 3OE7D 1Z0ZA 4RIGA 5DOVA 2LIPA 4ZO4A 4NFYA 2WF6A 1LH0A 2BAGA 3GUVA 3NOOA 3OI7A 4MQFB 5EINA 3UQZA 1W85B 1ZD3A 4GVPA 3SZRA 2I4IA 2OD2A 2PG3A 2NX2A 1SO8A 2QT9A 1A82A 3OSZA 3GEIA 3IPYA 3LNTA 4BZQA 5HCIA 3GU3A 4K5QA 5HDQA 1I24A 3AI1A 4OA5A 4JYMA 2JLUA 1TCVA 3JYHA 1KIAA 1U4NA 3PTZA 4KWEA 1Z38A 3T3DA 4LJ4A 4CM8B 4E4YA 1FJHA 1R3DA 2GAAA 3C4JA 1Q3HA 3FBWA 4Z9AA 2QIPA 3LZDA 4K2AA 4E94A 3GZNA 3H6HA 2F1HA 5DLPA 4H0FA 4K81B 1TOAA 1DPGA 4IFTA 5D3KA 2JI8A 3R7WA 2XUZA 3S2GA 4HWGA 1M7GA 4RGQA 1P2BA 5EE0A 3JWIA 1UMBB 4JGIA 2F48A 3I1IA 3IAM6 1IBMB 2DFTA 1CYDA 2HBQA 1TXGA 2OK7A 1QYDA 5K8UA 5D3QA 1NAIA 2NTYC 5JNLA 3EGCA 2EHDA 3HB9A 2NWQA 1W1WA 1J4AA 1Z4NA 1R8YA 2LKCA 2O1EA 3HPRA 4YB8A 4LE1A 3U37A 3GK3A 4MKFA 1F2VA 3AHFA 5IYZA 1ECCA 5GONF 1DAKA 2XUFA 3RNOA 4DN6A 3RADC 4I9FA 2EBFX 1DXHA 3RW9A 2X5NA 3W2IA 3PIRA 3A3NA 2PSSA 1QZZA 4GR9A 2J4CA 3ITKA 5EEHA 5I9TA 3W5UA 2FWPA 3L0YA 3TLYA 4EHHA 4Z1OA 4ZMBA 2ETXA 1MDFA 1NVVQ 2YJ4A 3E03A 3G8AA 3U17A 1SXQA 1N3YA 3EGXA 3MN1A 1FXSA 3BM5A 5CEFA 4QNMA 3F73A 4RA9B 4M7PA 1K8RA 1U7HA 4HGOA 2N9UA 3E22A 4BP3A 2DPHA 1WMEA 4I1UA 4LJYA 4RACA 5DVZA 3ANMA 3TG2A 1VCMA 4N7JA 821PA 2NACA 4D8UA 1JKJB 2EATA 3E61A 4Y2VA 2XUGA 1UM8A 3S70A 1AX9A 3IP1A 5DEIA 5JY6A 5LDDC 1I1OA 1O95D 2HJWA 5I4CA 4B9AA 3A1SA 4QHTA 5CW2A 4HN9A 4B8ZA 4EMSA 1VLLA 3P5SA 3ZQUA 1KRHA 1NBME 1CVIA 2I5PO 4PYMA 4FFRA 3NYIA 3T8YA 1G0OA 4NAUA 1JYSA 4EEZA 2E1PA 3FTFA 2QZSA 1JAIA 2VIIA 3PUIA 2PN1A 5PNTA 4DV7B 4JZYA 3UA3A 5IAAA 4QUIA 3KVNA 5AHWA 2EAUA 1U2GA 3W3AH 1N3LA 2P27A 3GEPA 3T1TA 1U1IA 4JQCA 1I4DD 3ETNA 1XEWY 2PMKA 4RL4A 5ALUA 5KYWA 4XWOA 1GNVA 5DB4A 1TJPB 4RK6A 3RS2A 2R7MA 5JS6A 3PRJA 1NI5A 5ICSA 4YPVA 2Q0XA 4KZPA 4B3GA 1IUKA 1M66A 3R6GA 1V6SA 4UM5A 3I73A 5ECDA 4C0LA 1WUTA 3AV3A 1D2EA 3BD8A 3TLJA 2I1VB 2CJXA 4F6CA 2PH7A 4UMVA 1UBCA 5F1OA 4BNIA 1I7PA 5A02A 1XVAA 4MO2A 3H2BA 2JLZA 2E5LB 1UBFA 2BDTA 3ELBA 5B1DA 3DQZA 1BCSA 2FRDA 1HYGA 2J6IA 3QMWA 1JQDA 2AFIB 1A7UA 3KAPA 4YRDA 1NN5A 4MQLA 3NVAA 3H1AA 4XM0A 3WRVA 1U7TA 1TZMA 4C7XA 4TV9F 2C9OA 2CLEB 3AR7A 4AX8A 3A6ZA 5F98A 3M1IA 2WBLC 4BO9A 4TT3D 4PC6A 1QXSA 1X7HA 1JGTA 2XMBA 4J0FA 3SR0A 2OO5C 1OR8A 2JJ8A 3LSTA 1MEOA 3EZLA 3H2YA 1UZNA 2COKA 2P62A 2QJFA 2X8AA 1RAIA 1D8AA 4TXMA 3AEYA 4DWWA 1Q7RA 4N9QA 1GXSB 1OFUA 3UBTA 2PFKA 1EM8B 1ZSVA 3JQPA 2WF7A 1JAXA 4Z0PA 1TUIA 2Y4NA 2AJBA 1EUCB 1GILA 3C8MA 5DHUA 1JQ3A 3B5EA 3M6WA 3UJPA 5KTRA 2O54A 1QHYA 3TZBA 2B3TA 4WY2A 1SCNE 2PLWA 2QM8A 2RK6A 3NEPX 1QYCA 4G24A 4WINA 1ZOIA 4MITA 3PGVA 1FW8A 1T0IA 2TMDA 1GAWA 4MUAA 1SOUA 2BMDA 2PBZA 2QTZA 5J23A 5GJBA 1NXOA 1V6CA 1BROA 3ANXA 2L82A 2O0HA 3MBOA 2EWMA 1CNFA 4AJLA 3GP5A 4MICA 2RGAA 4KLNA 4PN7A 3R0JA 2P8JA 4AWAA 1PGNA 4BGDA 3E18A 2VP4A 3RIXA 3JRNA 4HJXA 3MM4A 3PICA 2A86A 1NQWA 2P75A 1JALA 3L8HA 1AN0A 3B9RA 1UQRA 2AC7A 2Y3IA 2DCMA 3V46A 4UBNA 3MWLA 1X7ZA 1PJ2A 3HG7A 3M89A 2PMDA 4OUDA 4R2IA 4E5PA 2QY9A 1PS9A 4AI6A 1C14A 4KXFB 1Q20A 3PHCA 4FDMA 4PW0A 2YWXA 4F3RA 1PL7A 4J7XA 3MGKA 5EQDA 4JSYA 1JQEA 1RXWA 3LLSA 4CI9A 4C7VA 1YWGO 2IA5A 1LCIA 1J21A 2FRXA 4F4JA 1YKGA 5A3RA 2RHBA 3TN7A 1Y8RB 3CUWA 3JAWB 2A59A 1HE2A 2HWWA 1JR3D 5IJXA 4FZJA 1WQ1R 2HSZA 3THRA 3GI1A 1EUDB 3VR5D 2GN4A 3W6ZA 2TYSB 1TFRA 4MV1A 3OCXA 5K0TA 2FUKA 1KDRA 4II7A 3ZLBA 2IYVA 3G2LA 4XGIA 5ECYA 1EDOA 2DY0A 4ALIA 4E30A 1W5FA 1Y8CA 1TW3A 2ABWA 3IUYA 3QHAA 4GBJA 5F1YA 5FCDA 3QQ5A 1GZVA 1QE3A 3AFGA 5IJ9A 1BMFA 1QGUB 3RS3A 4D81A 2X23A 1UZLA 3PHHA 3ZGYA 1VJTA 1PNTA 3FMVA 5KC8A 1M2WA 2HXYA 4XD2A 4CTNA 1E1RA 2P6OA 2AX3A 2G3YA 3BB4A 3K8YA 3OCYA 4RJIA 3MSXA 1GSAA 5M34A 1KYTA 3ANNA 3Q7IA 3R3UA 3F8TA 5IT4A 5A3QA 2JGDB 3OO0A 3QVKA 1Y6QA 1Y1TA 3AJ8A 4RMHA 2PH1A 2FEOA 2NV2B 3KD3A 1SJ9A 2ZIVB 3TDKA 2R68A 3ZY2A 3HN7A 1JRLA 4PINA 3LF2A 1MPXA 2ECQA 1JYFA 1MX5A 1U3UA 2EVWX 2WKWA 5DASA 2DBZA 4YMSA 3A2MA 2Q6OA 5BNTA 1R0KA 3V4LA 3AJDA 4DV3B 2PLRA 3EDRA 4GX2A 1C29B 2O0LA 1MU0A 3WADA 2WU3A 1KO8A 2XNSA 1JN0A 4ES6A 1N75A 2B8EA 3HE3A 5IWAB 2D5CA 3O4FA 3ZV7A 1O94D 1CDDA 3IAAA 4CM4A 1FNMA 2NYRA 3OETA 3TM5A 3U4HA 3CUTA 5TX7A 2YDYA 2X9GA 1Z4IA 3KPUA 2HLNA 2EKZA 1PYOA 3BMQB 2I6XA 5FTLA 3ADBA 3UGKA 3OPMA 3WA7A 4FC7A 2QRUA 4NAHA 3T99A 1ZA2A 2XDYA 3I0MA 3OE5A 2PKQP 2YOGA 1LJLA 3WB2A 4CUKA 2B2NA 1YGYA 1BDJA 5LDHA 3EMVA 4XWYA 1B1AA 1T4CB 3F8SA 1XKXA 3D4LA 4OPMA 4JVSB 4ZI5A 4BWGA 2I3GA 4PVCA 2G6BA 5J4LA 5LU9A 4B6JA 1CULC 3NHJA 4YJ3A 5IX8A 4ZHQF 3S3TA 4BRUA 4I4TA 1JKMA 4UZEA 4DLXA 1JFVA 3KZNA 3ZNPA 5JJCA 4XGNA 4JB2A 4KACA 1NRWA 3HDVA 2AOWA 4L4RA 3BB3A 2P35A 3VYUB 1WXIA 3MMNA 4MV8A 4FR5A 3FIUA 4OHYA 3S1AB 3IEPA 3L5OA 4RUKA 4GKJB 3BXGA 4DA9A 2Q1WA 1W96A 3CH6A 3PNPA 1TQ8A 5FBVB 4Q3DA 5DHAA 9ABPA 4V0SA 3KB2A 1WSDA 4M0MA 4P5DA 1W46A 2GUWA 2RHWA 2B2XA 2BJHA 3DXYA 2R7LA 5I5GA 1V1MA 2P3LA 2X2EA 4OKSA 1W25A 3IB3A 2OKGA 3EVBA 3HMKA 4QJ4A 4WK2B 3HKDB 4LJRA 3CZPA 4DIMA 1AH2A 1KMHA 2PV7A 1ILEA 1NR5A 2I7XA 4AMGA 2Y1GA 4X61A 5IJ9B 3F6YA 2C84A 3P0JA 4OQMA 2P5UA 3CUVA 4BU0A 3GLKA 1JIIA 3HC7A 2IWRA 1FRVA 5AK5A 5ALYA 4PX2A 3ETDA 2ZYHA 2G04A 3KUDA 3QWAA 1N7HA 4IVNA 4BZZA 4B9EA 1LVHA 3OESA 2F43B 3R20A 1WZNA 3ZWQA 1US8A 2YNMD 3FSGD 1TU3A 1Y1RA 1C41A 2MYPA 2GD6A 4PG6A 1ZFNA 2H2HA 3MD0A 3T4UA 2H1FA 1GAJA 3AGQA 3P32A 3IR6A 2C83A 4IYRA 1PZGA 3FMFA 4LTDA 4ZICA 4FFBA 3RSLA 1ZU4A 4KHPB 1NQXA 3BXEA 2H85A 3H4IA 3ISJA 3LC7O 3HPQA 5ICEA 2BHNA 3FCCA 4KR2A 3NLLA 4QJBA 4CV3A 1IBRA 2HMAA 2X2FA 3PFGA 3VYSB 5K4HA 1R4MA 4EQ6B 1PGOA 1O94A 1S6YA 3FNEA 2JFUA 3ZJTA 5EZYF 2RI0A 3TI9A 2FJPA 1I51A 1A2KC 1UQTA 4HB4A 3B70A 1L8AA 6ADHA 1DBVO 4EGCB 3QE3A 3T5DA 2E18A 3CLTD 3DMHA 2RGNA 3E58A 5ENDA 4A0SA 1X1BA 3GXOA 4MV4A 1U8AA 2IODA 2Z0MA 1R18A 3BH6A 5DWVA 1VJ5A 3AM1A 2W8ZA 2ARKA 2YN2A 1NJ2A 2A5LA 3AR9A 3DP7A 4AG3A 1GUAA 3U5TA 4DCJA 3VRHA 1T9BA 4LXIA 1SUWA 2G1PA 3S2FA 2P6PA 3AO0B 3E9RA 1L3BA 4E5KA 1ISHA 5BR1A 1XHLA 2BGUA 2QUBA 3CEJA 1E32A 2ZTLA 1XVUA 1F8GA 1F8FA 1M0TA 3MJSA 1H69A 4JLBA 4TZ0A 2XYHA 2UZ0A 4P33A 4RHCA 1UEXC 3KEOA 5I51A 3BMNA 1I7SB 5K3CA 4ESEA 1K7SN 4HADA 2G88A 1CY7A 5JAMA 3KZXA 1B76A 1HKUA 2PZGA 1OYOA 3MBKA 4O2RA 3VOAA 5BW5A 2DUJA 3LHSA 5EJ8A 2C5FA 2D59A 2P2ZA 3GWGA 4JL6A 3GPLA 1AKQA 2FSSA 4ZAYA 3M7IA 4ZO8A 3WGTA 3H42B 1PZXA 3GPIA 1RBQA 3C97A 2M98A 3GJ5A 4G01B 3OZAA 4OHBA 4YRNA 3AHEA 3BK7A 2OP1A 3FF4A 2BW0A 5JVDB 2JCXA 5JCXA 2CLKB 2R00A 2ZCJA 3TTVA 4KTVE 1XG5A 4X3OA 1U1CA 3AX6A 1JQLB 1TQHA 3K05A 4BFTA 1J49A 2O3QA 4HGQA 3U6KA 1F4LA 1Y48E 3LUGA 3RWOA 2NO0A 1KEPA 4ACAA 3QVGA 1JMKC 3GXBA 3ROPA 1LPPA 1T0BA 2G71A 3JVUA 2NU9B 2ID9A 1PFGA 4MQ4A 1NPYA 3F74A 3OLQA 5E2IA 3IDFA 3M1YA 2C5SA 3C87A 1QH8A 1YO6A 1DCTA 4M9UA 2II6A 3N0VA 3NP7A 3LP5A 3DZBA 3IQHX 3QW4B 4DSUA 4EFKA 2E1RA 3CPEA 3WLHA 4XJVA 1WSAA 1FTWA 1Y0BA 2FUEA 2X4GA 3COSA 3B36A 3PB3A 4QDTA 4PX9A 4W8GA 4ZCRA 4WNAA 1FRNA 1N6HA 1UF9A 1BOFA 3MGGA 1C3JA 3Q40A 3R0ZA 5G40A 4CM7A 2WJ4A 1WMAA 1CVLA 4RIFA 3W6OA 3RPEA 1S1CA 2HJ9A 3P9ZA 1EP9A 1JPVA 4FFBB 1QZUA 4K03A 3SK0A 3OFSA 1CY2A 4N5DA 2JJ2A 2R8RA 2JGAA 3ROQA 5B7PA 1LVGA 5IFKA 1YIDA 5HUQA 1EB8A 4R98A 3O73A 3IPAA 5EQFA 3JALA 5BN5B 3EXHA 5DNWA 5HR5A 1FZQA 3NANA 3D7RA 5FUBA 2XCRB 3CRW1 3I1FA 1PI3A 1PJCA 4IH4A 3QUTA 4OHPA 2YFHA 4PTYA 5CH8A 4DBVO 4F3CA 1ZR2A 4FXPA 4B35A 2A0WA 3ZCVA 3C3XA 5EUCA 4MB0A 2RHJA 3OQOA 1O2DA 3AY0A 5C1PA 3UZUA 5CDGA 3L8CA 1XXHE 4LCBA 5B1SA 3JR7A 1W1IA 3IQDB 3T7KA 1RYDA 3TLXA 2ZIAA 2PWZA 3GBVA 2ENUA 3MS4A 4MO9A 4OCZA 1LV7A 4QSMA 4YBRA 5EFOA 5TS2A 3VPFA 3HJGA 1U0FA 3C3BA 1UK9A 5F2EA 1QVRA 2CFCA 1P0PA 3IKVA 3L4SO 4G1FA 3OQIA 1MP0A 1T8WA 3AXSA 5JASA 1TA0A 3UV7A 1F7UA 3NGLA 1ZWLA 2PZKA 2D5IA 1FUIA 2WUGA 5BW6B 5C3UA 5JADA 1ISMA 3KU1A 3KOYA 4JBWA 2HPVA 2BKXA 2CJWB 2QRGA 4EO9A 1G16A 5CAEB 2CXTA 2D2IA 3UT5A 4KFRA 1R15A 4MUFA 4DFDA 2QS9A 1BU5A 1K5HA 5C51B 4DXAA 4HVAA 3JPWA 3SQLA 2D5AA 4GIBA 2OORC 3CF6R 3MT8A 2QRJA 5ENZA 2IBSA 2OV6A 4HAYA 3WIOA 4DJDC 3VJMA 3R41A 4KR0A 4WKOA 1KMNA 2PUTA 2BFPA 2PH5A 4ZZ3A 2OR3A 3BFPA 3VTKA 3K0CC 2H52A 2ZJAA 2JVJA 1P73A 1BJTA 5AM0A 3MA0A 5DF1A 4GPZA 1ZA1A 2VDLB 3KUUA 1TT5B 4BHTA 2GHIA 5A6SA 3G88A 4M6WA 3X1ZA 1N5JA 3OX3A 4ZYWA 1NLMA 3BXZA 1JDSA 2IQIA 1KH1A 4WKBA 1X39A 1MAVA 5JO9A 4YAEA 3OPNA 1EX9A 1P91A 1NIPA 3OEHA 4Y67A 4OAQA 4YS6A 4UUNA 3ZW9A 1UP7A 1FJGB 2AOUB 3BVPA 2P5TB 4AY3A 5DN6D 3D6JA 4IS2A 2F3QA 2GF0A 3TD6A 3MWDA 2I3AA 4EVRA 2PUCA 3NWBA 4AC9A 2NYVA 3UQYS 3VZPA 1KQOA 3OD5A 1JLLA 4JUBA 1UP4A 1T36A 3D1VA 4BQIA 2ZRJA 3R40A 2YMPA 2WVHA 4MGYR 1BE1A 1X7GA 5B3KA 4MVXA 4ZT5A 2IGBA 5BSEA 4CF3A 4GU5A 1OFHA 3ZX4A 3B78A 1GAQA 1CR1A 3AT1A 3CPHA 4F4UA 1FYEA 1S8OA 1KI6B 4RETA 1ZI8A 5CVCA 1N4AA 2FTKE 1NMSA 5YASA 3U3MA 4BZWA 3IDQA 2J3QA 1SCBA 3DOIA 4W6ZA 4EX6A 2VJLA 3G5LA 4OKIA 3WWDA 3DE6X 2C88A 3AILA 1A97A 1SBIA 2WHRA 4KREA 1SELA 1N2EA 1WVGA 4EG7A 1JSLA 3GN1A 1H2FA 1TZBA 2C2OA 3LQFA 2UZ1A 2IHNA 1X7DA 3AFHA 4O4HF 5CYPA 3WJ1A 3QKSB 1N2XA 1ZJJA 2GHQA 3FUUA 1X13A 3WDKA 5K0GA 4FFLA 3ICEA 4YCJA 4DWOA 3D8NA 4EI8A 5DO9A 1JDBB 2PZJA 1J06A 1XRPA 2IYWA 2P4HX 2QD2A 3O2SB 3ZEAA 3TKLA 2CW5A 4DCTA 4OUKX 2PKQO 2YCBA 1W5AA 2WVJA 1UEIA 4H16A 4MV0A 1QFSA 1GA6A 3UW1A 4K9NA 3UWKA 1IWOA 1Q7BA 1J2TA 1FCJA 3C3CA 3H3FA 3I9OA 4G86A 3K96A 5G2OA 1WMFA 2CL0X 3IXQA 3CU5A 3FYDA 4REQA 1MDBA 4OLHA 1YQTA 1OUMA 2XCSB 3RC8A 3EGDA 4R2JA 4MGHA 1JQAA 3VO1A 1QZXA 1N5DA 2C4WA 2B2CA 6REQB 4CNBA 4FILA 1Q7CA 5E9AA 1XMVA 4ZODA 4RTQA 3WRXC 3ZNOA 3LUKA 5T67A 5F9MA 5GONB 1V4NA 3U81A 3GDOA 1XFDA 2DT5A 4QXMA 2OAGA 4X8HA 2F8LA 1CLEA 1D1PA 2GRAA 4HY3A 3HBNA 1DMSA 1MPTA 1BX0A 4B85A 4QAQA 2ZFUA 3IA2A 5EMHA 1JPJA 3WTBA 1H4QA 3AG6A 3HTXA 3AFOA 3MELA 4FEYA 4JEHA 5HK8A 3U3KA 2IU4A 1HX7A 2ZIUB 1B6SA 1O7JA 2JD2A 1XZGA 2XD9A 3MRXA 4U6NA 1VCOA 2Q3FA 4BKQA 4GBMA 1IU9A 1R9MA 4OGKA 4XYGA 4A5OA 1N8KA 1RYNA 2NM0A 4OQ4A 1NW3A 3S8MA 4YRJA 5A3JA 2VTKA 1C8VB 2TRSB 2WI8A 3JATB 2VHQA 1V7ZA 3AZQA 3LX6A 1QYRA 4ZN6A 4IOKA 4WK0B 4B2IA 5K3OA 2OAQ1 3ER6A 1UXHA 3OO1A 2J07A 4GOMD 3TBKA 3CNEA 4TKVA 2G70A 2GYWA 3PKIA 3GO4A 4RCYA 3VYWA 3A6HA 3WG9A 2FN3A 1PYGA 1N0WA 1RXIA 3O3OB 3L6DA 3CNLA 3QF7A 1JG6A 1VL2A 3TK1A 2RG7A 3WY9A 4GD3Q 4WK6A 5JFTA 3C1TA 2HRQA 4UDNA 2AN1A 2WJJA 2V9ZA 4XPIA 3JQ7B 1VL5A 2HF9A 3JQFC 5FPKA 3TRDA 1E3JA 2PBRA 3KCNA 1WUJS 3DC7A 2I76A 4Y6SA 1VRVA 5D1HA 1P19A 4DQDA 4LG1A 2BCJQ 2W4QA 3OJEA 1FYVA 3T7TA 4G1EB 4AD8A 5BMOA 1MKYA 4DSTA 3VBCA 4MR8B 4UOEA 4F85A 1AHHA 3LX8A 1T1JA 4JH0A 4O5OA 1GPBA 2E3JA 1ID1A 1PT9A 3TFWA 3A3KA 3NHFA 1T1EA 4QTXA 4TWIA 4DMKA 4DJFC 2BFAA 3PJDA 2IUTA 3DTVD 1O96B 5DX1A 3C5VA 1DJOA 4OHKA 1V47A 2HWUA 2I4MA 1KI8A 4TV9B 2XXAA 5E3IA 1NVUQ 2ZT8A 3KETA 1J1IA 4IX1A 3KOOA 4M9CA 4RD4A 2Z2XA 1LBQA 1FFXA 3U4IA 4OX9Y 5I7RA 5HF6A 2HEIA 4C76A 3LO8A 4MW6A 5IEBA 3W3ZB 1ST2A 2A5DA 4LE0A 4ZAGA 3ER8A 3WGLA 4Z1MA 3H8VA 4EQZA 4PG4A 2UDPA 1OZGA 3ESQA 5D3ZA 1QX3A 4B5LA 2Q2QA 1F38A 4QLOA 1MAAA 5B6IA 1F3OA 2W2LA 3OIWA 3SBXA 1MOSA 3FI9A 1TZCA 2P5YA 4OHMA 1Z15A 1W88B 3REFA 3AOEA 3K71B 1TM3E 3V55A 2H2WA 3GLFE 4XWKA 1DZIA 2RKWA 1XQ6A 4H77A 3WFJA 1OXVA 5ICFA 1ZC4A 3LAWA 5BSRA 4EUHA 4W99A 2ZSAA 5JFOA 1Z83A 1ZGCA 3HXMA 4XRRA 4YRZA 4ZCPA 2ORWA 3ZX5A 4Q4AA 4BNVA 4GKVA 4WBNF 1VPWA 3D2BA 3N59A 4LDPA 1FU4A 5AVJA 4YRCA 3IAXA 1KK3A 2YWFA 3I9V6 3O1HB 4IICA 3KP1A 1FOEB 4Q19A 2WJAA 3OZRA 4JUDX 1P29A 3IJEB 3K94A 1SA0B 5EWJA 1TE2A 1RIFA 1XZQA 3NPMA 4HDKA 2R2GA 2WILA 2XYQA 1AUQA 5G3YA 3ZBUA 1QGED 2PEYA 3KT3A 4AW9A 2UVPB 2X7HA 3CW9A 3N2EA 4EW3A 2FZLA 2NO4A 3M6VA 1NU6A 4CT0A 5D7NA 5BW8A 2XOKA 1JKFA 5LP6A 4Q3NA 1FNDA 3VR2A 3HXOA 5DWDA 2B83A 4LC9A 2JARA 2WMYA 4II2A 1NLFA 5EHQA 1QIHA 3WK7A 8GPBA 4RULA 3L7OA 3PJEA 4GZ5A 2Y1FA 4Q3LA 5GM2A 4IIYA 1HE5A 3Q12A 4NHEA 5BR7A 3CLUD 4P0TA 2XTJA 2EV9A 2YZKA 1EDDA 2Z5GA 4XIFA 4RGYA 1KTVA 4EVIA 2V65A 3O38A 4PO9A 1J99A 5A4JA 5L3QB 3L8MA 1UFVA 1U9ZA 5IW8A 1OT3A 1OVMA 2D2VA 1KMMA 3DD1A 4HX2A 3ZIAD 1N2ZA 1QF9A 4CLRB 2F7SA 4CKXA 1B93A 5I9IA 3UFBA 3TW8B 1HH4A 2WMOB 4AWBA 1GUFA 3G0DA 3HWX1 3C98A 2AD5A 3BJZA 3NKVA 3D4PA 2CEKA 5BSKA 2JLWA 3IAFA 3LA6A 3QIVA 3W9YA 3G1TA 2WK1A 1VB5A 3B6EA 1V11A 5AVKA 1DARA 1CFJA 3B9BA 5TJ9A 5EI5A 2QOEA 2XXAB 4AO6A 3VH2A 1XL1A 3P0EA 3AV0B 3ZJVA 4QM6A 3TGWA 4AMVA 2KWIA 3HY6A 3NCHA 4K0RA 5A9SA 4R31A 3UK2A 5FIUA 4BFVA 4MVJP 4UVGA 4KXNA 3M6XA 1C1XA 3Q0IA 3DUFB 2QAIA 1E79A 1A9ZA 1IJEA 2ZSEA 3LBHA 1HV8A 3KDPA 4MR7A 2AI3A 3NATA 4QJIA 3TOSA 1XCPA 1LQ2A 2ORED 3WB9A 3A6JA 1Q7EA 2VP2A 5B3JA 1NQ5A 2JI4A 4GRDA 3B8HA 1UFRA 4R8RA 5EJIA 3KJFA 1G8SA 2E82A 2VSXA 3N2ZB 3Q7QA 2H29A 5AK4A 1GZ5A 4CQMA 3LT5A 3GEBA 1XNQB 1SXGA 5DEOA 4CIBA 1QG2A 2CBZA 2QMQA 3EQ9A 3I2KA 4EB0A 1VRCA 1YIOA 2H16A 2QVCA 3HXKA 2HIGA 4QOEA 4YRKA 3FNRA 2G1JA 3D81A 3FDZB 5BP7A 1S0UA 4XVHA 4CV2A 2VZEA 2JFOA 1DEHA 3F3SA 2PS0A 1KEEB 4EAAA 1VM6A 2A94A 4WW0A 1T4MA 3L7JA 4IV8A 4W1RA 3ND9A 2P0AA 3WIVA 1V3VA 1DTWA 4DCSA 2B1IA 3LPLA 1R0LA 2H06A 4P5EA 3PWKA 2WT9A 5DI3A 4BB5A 5CFOA 1EDEA 2B9EA 4L74A 4F5WA 3SG0A 2Y1LA 1BOOA 1UT6A 3FCSB 4UPDA 3RC1A 5F33A 4RZ2A 1QWOA 3KKLA 4UBIA 4BNXA 5KWIA 4U5XA 4GR4A 1C3LA 1Z2AA 2EFDB 2HSGA 2I2BA 3A10A 2LUOA 2WU4A 1I4EB 3ITDA 4LDNA 2QG4A 4PZCA 3CURA 4R8KA 1N6RA 1PR3A 4C6RA 4D4IA 4ENPA 4Q48A 5G1NA 4N9WA 4JKYA 2H4ZA 2PKWA 4ED9A 1NKVA 2MT9A 4KQEA 4PZ9A 3SM9A 1A8UA 1TTQB 1UC5B 2LE0A 3QPCA 2PUDA 3AKCA 2JI9A 2M1ZA 2FQ1A 4E2FA 2E21A 4HWTA 1L6RA 4WCFA 2AOTB 2O8DB 3THXB 5FPTA 4YCDA 3CTPA 1GL6A 5FBHA 1NX6A 1YQXA 3M6LA 5AVYA 1K7CA 2GYVA 3LXRA 5E8JA 2Q7XA 3C4VA 3CF4G 4ND6A 5DSXA 3FCYA 4DIEA 2XY4A 5BSUA 2CXRA 2G1UA 3ENKA 5KJFA 3DMFA 4PLVA 1R00A 4ESOA 2W70A 1XF9A 2XIJA 2AJTA 3BXFA 4Y2TA 1M34E 3QX9A 2DR2A 4OFXA 4F4HA 4JR1A 4PONA 5K3FA 2PZLA 1C1HA 1P18A 3AW8A 3K6SA 1FS4A 2BZSA 1IPHA 3DZHA 3PDCA 1KJ8A 1ISFA 2B69A 2O8VA 4X95A 3H3XA 1TVEA 1ZVMA 3KZOA 5DSZA 5F21A 3TTSA 4IDOA 3ILSA 4I1SA 4IZIA 4ND3A 4OYYA 4L7VA 4UXIA 4RNDB 4RV9A 5A0FA 3RAPR 5KJ1A 2J3JA 4K6HA 3MXTA 2IDKA 2Q4RA 5A9SB 3K0EA 1H8EA 4E5UA 3TXYA 3DZKA 1NC1A 3LQ4A 4J0EA 1WW3A 2X9NA 3K2BA 1TUBA 2BEUA 3NIFB 3OLWA 1GNPA 3EVEA 2C5BA 4HXGA 4V0OA 1P0MA 3CWCA 5EZYB 1AZWA 1IY1A 1ML4A 4C89A 2XZDA 2FETA 1AKEA 2RARA 4BX0A 3Q3EA 1JEAA 1X38A 1JHQA 4G07A 2KE5A 4NV3A 4KI7A 3TMAA 1PV1A 3M4NA 2G1AA 2FZCA 1W5TA 1VKRA 4TTPA 3V9PA 1XRJA 3CRQA 3LV8A 3N7UA 1JLKA 2CK3A 1U1DA 1WABA 2A9OA 3K73O 3R9WA 1S2MA 5AKYA 4C0XA 3KT8A 1USVA 4XFJA 4BL5A 1I7LA 3VKWA 1W76A 2NUBA 4KQFA 2IP4A 3G89A 4M38A 3MCVA 3KQUA 1DAHA 3U7QA 3EVGA 5A4MS 1R2QA 5LD2B 2OZVA 2G77B 1DINA 3RUCA 1P7PA 2H4FA 2CFTA 5FYQA 1CUEA 1G63A 1L6IA 2BZ0A 4AWXA 1PK8A 2FRDC 4UMDA 4C0WA 3H9BA 5K03A 4R1UA 2D1YA 2BGLA 5E7IA 5T4EA 4OQLA 3BIFA 4G97A 4ZGGA 1JSCA 2R6CA 1MB3A 4O02B 5J58A 2DPLA 3MEQA 3GVHA 1JJBA 3KL4A 3T3EA 4G4SO 3V2UA 1VP3A 2M6LA 1I32A 5DLEA 5B2ZA 1Y6RA 3E7PA 3NGXA 5CXSA 5DIZA 3VZQA 4Z7QB 3V4PB 5BYKA 3MFQA 4FI3C 5G41A 3EEOA 4A15A 3ZQ6A 2R6R1 2BIFA 5LB4A 3TKAA 3C7KA 4NBWA 2W6OA 4MI9A 1USIA 3TF5A 2W2MA 4ND5A 2O8FB 3UMVA 1PWZA 2ODQA 5JTUA 1KYQA 1YAJA 6GPBA 1XCGB 3JD2A 3KZ1E 1UL1X 1PQUA 4ISCA 3KK0A 2XTNA 4TROA 2DPMA 4DBLE 3KR2A 4CMCA 3SSAA 1IY2A 2NVUA 4BJHB 3QLJA 1W34A 4KXMA 4ZMRA 2KSQA 4QT0A 5M29A 4ITRC 4YRPA 4BO6A 4MPPA 4CMEA 3A9TA 2MSEB 1ST3A 3KHTA 1J0XO 4U7GA 2A1IA 2ZSIA 2UZIR 5REQB 1WBDA 3I39X 4R1NA 1SVWA 4GDFA 4N76A 1UMDB 1N0IA 4L0CA 1DCFA 4OQZA 2RHGB 1Z4LA 4IO1A 5B4UA 2M6SA 1VE5A 1VB3A 5K3FB 4U3JA 3MWJA 3BC1A 5K99A 3H0KA 2G5TA 4NQRA 1ODSA 3E0QA 3WICA 1M6NA 4TL6A 2OHXA 5EIOA 5GM1A 2XCQA 3HV2A 4OREX 4PCLA 4RM2A 3GHYA 3C6KA 1YFLA 1WZ2A 4XQ0A 2OB2A 2WP8J 2J0SA 1M1YB 1XTQA 2VXYA 3N0TA 3STHA 3B12A 5FL7D 1ISGA 1YVRA 4IEEA 1FSZA 4BQSA 1Y9EA 2BEUB 1ZUIA 4GR5A 1TI7A 2AFVA 2WF5A 3L82B 1IMJA 3ADOA 3ZHYA 1DOZA 2PQ6A 3D7KA 4PFQA 5D5HA