5HBRA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
464
structure length
464
Chain Sequence
MNDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
total genus 170
structure length 464
sequence length 464
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hbrA01
4JGBA 1PGJA 3T7CA 3LU1A 1YBMA 3KHUA 4LSMA 3DZKA 3AU8A 1ENZA 3IIEA 1DIRA 3NDJA 3LF1A 4FFOA 5LDGA 2DTXA 4OJNA 2X0IA 1KVUA 1NVMB 4BV8A 2OBYA 1J5PA 1GY8A 4XKJA 3L07A 5F5NA 5C37A 1BXGA 1SMKA 3TQHA 3WYCA 4EJ0A 3F1LA 3ADOA 3P2YA 3NYWA 2PD4A 2Y99A 1VJ0A 3PWZA 2WDZA 1YL7A 3E18A 4AL4A 4BO1A 4DPLA 1YB1A 5A9TA 1GEEA 5I7FA 4CM8A 4EYEA 3EYWA 3DBRA 4QO8A 1VJ1A 3AUSA 3I23A 1AXGA 2BFAA 3MEQA 1GD1O 2UYYA 4J4TA 1L7EA 4RL6A 4Q3BA 4CR6A 1G0OA 1I30A 1NTOA 2HMTA 1YQGA 2P4HX 2Q1TA 1A27A 4NU6A 5A03A 1HE2A 4R1UA 4QTZA 4BNVA 5CFZA 3ETDA 4ZRNA 4J3FA 1Z45A 5FWNA 3B1JA 3UFXA 4R01A 5DCWA 2CF5A 3EW7A 3G1TA 1Y5RA 3OFSA 5AOVA 1O94A 1XKQA 2GRAA 4NFHA 5CHEA 4E21A 4WNIA 3HN7A 1R4NA 4CQMA 3QWBA 4CUKA 4W99A 3I3OA 3AM4A 4S3MA 3O38A 3D1LA 1E6WA 4CM9A 5ES3A 1PR3A 2EHDA 4EGFA 1XWFA 4J4HA 4BNYA 3NX4A 3TSCA 3MTGA 4FFPA 1H94A 2DFVA 3G0OA 3PGJA 2I99A 3INGA 2DM6A 3M6IA 3K31A 2SCUA 3GEGA 1YWGO 2IYPA 1GYRA 3DHNA 4ND4A 5F1PA 4LCJA 2D1YA 3N58A 3VVCA 3L9XA 3U49A 3DR3A 3ROMA 1E3IA 4D0RA 2W2LD 1U3UA 1FDWA 3X2EA 5JY1A 1K6JA 1RYEA 3OA0A 3QVTA 4NJMA 4J43A 3WGQA 5IDQA 4TROA 4TMFA 3EDMA 2FZWA 3DAGA 3ZWBA 4E2YA 2IEDA 5B12A 2FMUA 1AHHA 3PIIA 3K6JA 3C8MA 1QG6A 2P5YA 3PLNA 4JBIA 1YJ8A 3IKTA 2LDBA 5IZ4A 3OQBA 3JQDA 5L95A 3WBFA 3SLKA 1D1SA 5BR7A 4CV0A 2DT5A 4UREA 2H5LA 3PJEA 3JQCA 4YT5A 3CEAA 2GCGA 4XR4A 2FN7A 1BMDA 2W98A 1X15A 1LDGA 4L75A 1DIBA 3RC7A 4RDIA 5LC1A 3V5NA 2HMWA 4ZU3A 5L7YA 3WX0A 2B0JA 1GU7A 5JE8A 4PLPA 4XQ9A 1C0KA 4IQ8A 3LT1A 3RUFA 3PYXA 4BO9A 2QZZA 2W4QA 3H65A 3DFUA 1RJWA 1T1RA 1XU9A 2Z5LA 4XYBA 2X4GA 1NQTA 4K1LA 4CQMD 1DIAA 4R51A 5T57A 1NP3A 3CZRA 5KWEA 2X7HA 5TX7A 4CMKA 3KYBA 2P5UA 4GQAA 3TZ6A 2OBNA 4IIVA 4IGFA 4PLCA 3RC9A 1U7HA 4M54A 3IP1A 3WG9A 3VH3A 1KIFA 4W4TA 2GERA 3KXDA 4ZN6A 5C7IO 4CM4B 1NR7A 4L4SA 5H82A 3ONDA 5KJEA 4R9RA 1ULUA 1UDBA 4CLEA 3TWOA 4B8WA 3C7AA 4OH1A 4HX5A 5TT1A 4PG6A 2X23A 2EJWA 1B2LA 2WJPA 1LDYA 2C5AA 2ZCVA 4CR8A 4JCOA 5JC1A 3L4BC 4GKVA 4B3JA 3CXRA 2F1KA 1I24A 1ZJZA 2PFGA 3WB9A 1LRKA 3AUTA 4BNNA 5F5LA 2EF1A 4M8SA 1TVEA 1NFRA 1U1IA 1HYHA 4GGPA 4F45A 3WGTA 5JDCC 2W8ZA 2G1UA 4NMHA 4BO8A 1OI7A 1DRWA 4BO7A 4RVDA 4OOEA 3GUYA 2IZZA 3IDSA 3BMOA 1NWHA 4NZ9A 4W7HA 1V3UA 4TVOA 1OC2A 4QUKA 4D0SA 1HDXA 3KUXA 4Q3AA 3DZGA 1LLUA 5CP8A 2UDPA 3W4IA 3RC1A 1DBVO 2EGGA 1O5IA 2AEFA 3CE6A 2C2YA 2EV9A 1MC4A 1XQ6A 5H83A 1EE9A 3ADPA 4FJ0A 1YDWA 2EGHA 1LRJA 1ENPA 2B83A 2X0RA 3GUCA 1PGQA 3HDJA 3GOHA 3GVPA 4M86A 1J4AA 4UULA 4AJ2A 1ONPA 5DZSA 1FDUA 3NTOA 2HRBA 3V1UA 1DFHA 9LDTA 1ISJA 5CEJA 4J7UA 5JMWA 2Q2WA 1OBFO 4ROSA 1ADBA 3KRTA 3PVZA 1PJLA 5JAIA 1HKUA 3I1JA 1ARZA 1H2BA 1I3LA 4AJNA 2J8ZA 4PRLA 4RORA 3BMOB 3KM0A 4D7AA 1YXMA 3ROKA 4PIVA 5G0SA 3NEPX 1NPTO 2WYWA 3GZ4A 4IJVA 2PZJA 2YFHA 3SLGA 4BNMA 3C1TA 1C0IA 1P1IA 5BSFA 2B4TO 4JN6B 1B7GO 1HRDA 1M6WA 4DBZA 3WWZA 2C07A 4NFSA 3R3SA 4BMVA 1HDCA 1B15A 2Q1UA 3DXFA 3E8XA 4CM3A 4GLOA 1NVGA 2FZEA 5IDYA 4DREA 4RPGA 4Z9YA 3H2SA 2DQ4A 1ZK0A 4LMRA 4DLBA 4YT4A 3WJAA 1M76A 3AY3A 2IXBA 2QRJA 4YJGB 4DC0A 4R1NA 1BVUA 4XJTA 4E32A 3EY4A 4GBJA 4HFMA 5JCXA 5K9ZA 5FF9A 2V7PA 2NU7B 2HU2A 5A05A 1XHLA 1UJMA 3Q11A 1I3MA 2Z1MA 2J3HA 3X2FA 3H8VA 4PZCA 3LT4A 4QEDA 3ZW8A 7MDHA 4F6LA 2Q50A 3H5NA 1UP7A 3I4FA 3ZHXA 3GHYA 4MVJF 1E3LA 1T25A 2FP4B 4HWKA 4N7RA 4GX5A 4QXMA 4HY3A 4BUCA 3FR7A 4KP7A 4IJUA 1C1DB 2YFQA 4RVHA 4BOYA 4PFJA 2PK3A 5IJZA 3KSDO 4QQRA 5A4DA 3AY6A 4OYRA 4HBGA 3ZW9A 4BL5A 3OMLA 2VRBA 3FRJA 3V2GA 4YRDA 1IULA 3DTTA 5L9AA 1O95A 4J2HA 4TKLA 1TEHA 1BXGB 1IE3A 3ONFA 5F21A 1QV6A 2Q46A 2D8AA 2DLDA 4IPTA 1AE1A 5B4VA 4U5QA 4AJ4A 4FFLA 1R15A 4IDGA 4U0KA 1QLHA 3MTJA 5TRTA 4IGEA 4BNZA 1P1KA 3OEYA 4CM9D 3L0DA 3FR8A 4P8RA 3FI9A 2DFDA 3PQFA 5TQVA 2FP4A 1EZ4A 4B7UA 3NGLA 3PJDA 3TZCA 3UW3A 1ZUD1 3I9LA 3U4IA 5JC8A 2E82A 2C20A 1QLJA 1P33A 2FY8A 3PFWO 4IS3A 1XQ1A 1SZJG 4NK5A 3W8DA 2DKNA 4TRJA 2HSDA 2WD7B 1PS8A 3B70A 4MKRA 4RGBA 1A4UA 2X22A 4WLNA 1X0VA 2BGLA 4ZA2A 2Z95A 4AJOA 3T4XA 1NNUA 3GVXA 4AVYA 4I5FA 4I5EA 4G5HA 3RU7A 4MVJI 1UP4A 3TL2A 2Y66A 2O3SA 1HSOA 1E7QA 5TGDA 2A92A 1Q0QA 5BSHA 5CDSA 4YWJA 1F17A 1KERA 3I6QA 3PHGA 3KTDA 1Y7TA 1PQUA 2ZTUA 4LSWA 5T67A 4ZQEA 2XF8A 3VPFA 1BXZA 4BGEA 5HTOA 4B7CA 1N9GA 2O3UA 4IDCA 5EERA 3FTPA 1MUUA 3CUKA 1G0NA 3KOUA 3VPGA 3A06A 1Z7EA 3QQPA 2TMDA 5KVCA 5KIAA 2JFFA 3H9UA 1LX6A 3A14A 3PDUA 5JMPA 3C24A 4N18A 8ADHA 3PWSA 2GGSA 2VWGA 2B4RO 2VOJA 2GN8A 5DBGA 3WQRA 3RBVA 1GZ6A 2PLAA 4DUPA 4EJMA 4XX0B 2DAPA 2PH5A 2CUKA 3A1NA 3RUHA 2DPGA 3PWKA 4NBWA 4KWIA 5JAZA 3C7CB 1GQYA 2JCYA 3DQPA 3AOEC 5ADHA 2OOSA 3WGIA 2NU9A 2WM3A 3D7LA 5C3MA 1T2CA 2EKQA 2ZJ1A 4BO5A 2NUAB 3L6DA 3PJFA 3AU9A 4A5OA 4S1VA 1C1XA 2OGUA 1H6AA 5DN9A 1NVTA 4B79A 2V6FA 2IZ0A 2IODA 2RBEA 3OQ1A 3ZWPA 3VKUA 4BVAA 1TT5A 2BRUA 5EN4A 3GZNA 2CDAA 5HM8A 4Q9NA 1J6UA 1T26A 1ZW1A 3I9KA 2BMAA 4W7IA 1QYWA 4WCDA 1JKJA 1KC3A 3FNGA 4WPGA 3IMFA 4CMEA 5ITVA 3OIDA 4Y6SA 1LDNA 2CVQA 2G17A 1BVRA 4UVHA 3ZNQA 3IQDB 2AA3A 4NBRA 1ZH8A 3ITDA 1YQXA 1PJTA 4E2XA 1CDOA 3ZV5A 3INRA 4AICA 3TZKA 3PQDA 1F06A 1GTMA 3SC4A 1MFPA 3W1VA 2FPPA 1GPJA 4QSMA 5KJ6A 4MDHA 4RF3A 1U3TA 3O9ZA 3UVEA 4A03A 1VM6A 3HWRA 2Q49A 3HADA 2Q3EA 2X8LA 4KMSA 1LQUA 2NNLD 3BTVA 1DC3A 1EQUA 4L8VA 1L7DA 1ZIDA 4L73A 5T6BA 4PGFA 4YEDA 5ENDA 5KJCA 1IZ0A 2GN4A 5AYVA 7ADHA 1MB4A 2FRDA 3M2PA 3VKVA 1C3VA 2A9FA 5CEFA 2GN6A 1LNQA 2WEKA 1Z74A 3HDQA 3VZQA 1LDMA 4DRYA 5EMHA 4NBUA 4IMPA 1XSEA 2VUSA 1LC0A 1ZXBA 4X54A 3WR5A 3I9OA 1SCUA 4RPJA 3OJFA 2VUUA 4ITUA 2OUIA 5JAMA 2P2SA 3FPLA 3PEFA 3RUCA 5CEEA 3ZV4A 5G0TA 3H5RA 1U4SA 3MJVA 1HE4A 2Q1SA 3DZFA 2CMDA 2UV8A 3HFSA 1HDZA 4NJMB 2Y05A 1PWXA 3UCFA 4XQEA 1LI4A 5FI5A 3RUDA 1QKIA 1JKFA 1PL8A 4NI5A 2OXIA 1GCUA 3H4VA 3U3XA 4IMRA 3NT4A 2C54A 4TWRA 3ABIA 5H81A 4H15A 3U0BA 4Y8VA 1A4IA 2I3AA 1JAXA 4IQ0A 3PFFA 1HWYA 1P44A 1Z75A 1DRUA 4GI2A 4XQCA 2HCTA 3A28A 4AJJA 2Y93A 3M1AA 1K89A 4D42A 1IYZA 2FPGB 1ONNA 1ZJYA 1B0AA 1P1JA 2XPCA 1NHWA 4BMSA 2VTEA 4YAGA 3V1TC 3GA0A 1E6UA 1LSUA 1Y81A 4YPOA 4HNHA 3BHMA 1KY5A 1YL5A 2CSUA 2EERA 3JQFC 1DFIA 2AXQA 1I3NA 1DAPA 1M67A 4R9SA 4KUGA 2O4CA 1WZIA 3VH4A 1ADFA 1H9AA 1K0UA 2X86A 1E5LA 3NJ4A 4M89A 4TRMA 1W73A 4OL9A 5KOIA 4CLOB 3RUIA 2D5CA 1EE2A 1UXKA 1HE5A 3TRIA 3UICA 4Z0HO 4A10A 2AG5A 4D45A 2HMVA 4MP3A 4YDRA 3VAZA 2I5PO 3JQGB 4XJSA 1IPEA 1EUDB 3H9JA 4IDDA 3BYZA 3RJ5A 1LC3A 2VRCD 2FPGA 2VQ3A 5TT0A 2VYVA 4IQGA 3ICPA 3ZWVA 4XIYA 1H6DA 1AUPA 4OSPA 3W4JA 4E12A 5K6AA 3DC2A 4XZ3A 4UVDA 2EW8A 3QV1A 1LDBA 1QXSA 1P45A 1KY4A 1SB8A 1YGYA 3LLVA 3QY9A 4KUEA 1I2BA 2ZTLA 3SBOA 3ST7A 2O50A 2BGKA 3TN7A 1EUCA 2G5CA 3ZU2A 2IEBA 1B26A 1WVGA 2PGLA 4UVGA 2CDBA 4Y6RA 2Y1EA 2PR2A 1HL3A 1Y5MA 2GDZA 4YAKA 1YBAA 2G0TA 3E5MA 3ZH2A 3RWBA 4UVEA 1BG6A 2Y1GA 5GMOA 2JFHA 4CMIA 3GT0A 4ZQBA 1W0CA 2OL4A 3ZHBA 3F46A 2DBZA 1Y9EA 1KVTA 5C7OO 1EK5A 1X7GA 4D3DA 4G2NA 2YZ7A 1MG5A 3OSUA 1N5DA 3QJ5A 4O59O 1TLTA 4PLHA 1N92A 4OOFA 4CLHA 4OXYA 4KOAA 1S6YA 1OZAA 5BSGA 4CLRA 2JKVA 2HJRA 1BW9B 3LYLA 4OO3A 4WOKA 4Z9XA 4UUOA 3NAQA 4C7JA 3KO8A 1OFGA 3UN1A 2IYOA 3MWEB 2C82A 2J5RA 3UF0A 5HBRA 1IHXA 2F00A 2O23A 4YRAA 5IAAA 3R0IA 4NFYA 4E5PA 1ADCA 3QVWA 4PLFA 3RUAA 2O3TA 2XOXA 2W2LA 2AG8A 3HHPA 4WE3A 3JQ7B 1EUDA 2X0NA 3BXXA 2I9PA 2E49A 4NH4A 1JWAB 1P1FA 1U28A 1AHIA 3P2OA 1B3BA 4IXTA 2GO1A 3IC5A 4AJEA 4BNUA 4FS3A 3O4RA 1X0XA 3U4DA 4WKGA 1XR3A 3NDRA 2YV2A 3O03A 2LDXA 1PQWA 1Y6JA 2TMGA 3WGGA 1M75A 1Z6ZA 4DIBA 4YACA 4Y9DA 3G17A 1LLQA 2PKQO 2O3RA 3ZNNA 5BNIA 2Z1NA 3WOHA 4DMLA 3AUAA 3OJEA 2JD2A 1EVYA 1ZSYA 2BI8A 1SEPA 2QQ5A 1Q7CA 3QWIA 2Y68A 4GGOA 4UUPA 4FFMA 2QYTA 3K92A 1ZXLA 2GR9A 1P1RA 3L4BA 2VZ9A 3QIVA 4CM7A 3JQ9C 1YL6A 5L51A 1UZLA 2PD6A 3CZMA 4UUNA 4CMGA 5KJ1A 1MV8A 2PZMA 2V6GA 1NFFA 3KSZO 3FWZA 5GY7A 4K28A 1E3WA 2NQ8A 3VHRA 5IDXA 1VL6A 4UUMA 4HFRA 4JBGA 4DPMA 1WMBA 5BSEA 3GEDA 3JCZA 4BNGA 1GPDG 4GX2A 3E1KA 4RV9A 2B35A 2O2SA 1LDEA 1I0ZA 3K5PA 4EBFA 3E9NA 2O3JA 3HDYA 1VKOA 2CY0A 1ZMTA 4OQZA 6LDHA 1EMDA 1PGPA 1BSVA 3FN4A 2R00A 3W6UA 3H3JA 3WQSB 3WIEA 5ILGA 1TT7A 3SX2A 4LVUA 3TF5A 2I76A 3ZU3A 3GG9A 1ZK3A 3E9MA 2Y0DA 1E92A 5JDIA 2QRLA 3BHJA 2BELA 2DU8A 1GV0A 4NG5A 3BMNB 3JD0A 4JNKA 1ZZEA 2CD9A 4TRNA 4R5MA 2OP1A 3BAZA 1H5QA 1AN9A 3CPSA 4ALKA 4AJLA 1T2AA 1YONA 1KOLA 1JA9A 1EUZA 3JQ6A 1MLDA 2VOEA 4I9NA 4UAGA 1VSUA 1VJTA 2HK9A 4YB8A 4BNXA 1D4FA 1LSJA 1U8XX 1ZMOA 4JROA 3DTYA 3I52A 1ZEMA 3E6AA 4P4NA 4TVBA 4PZEA 4QFCA 3FPCA 1A72A 4FPXA 2NM0A 2J5KA 3FSRA 3JQFA 4BNTA 1QORA 2VZ0A 4ZQGA 1GYQA 3TZQA 4E5MA 1PZEA 1GQQA 4Y98A 3BZUA 1IUKA 1EVJA 1I32A 1KS9A 3IUPA 4MINA 1U8FO 4BO2A 1XEAA 1WMAA 2NVUA 1ADGA 3DBHB 3GK3A 1KC1A 1UH5A 3E82A 4J9VA 1UXHA 3B20A 3WGYA 3DBRB 3CH6A 3BTSA 2V6MA 5L4SA 1H2HA 1LJ8A 3DONA 3DZIA 4ZGWA 3OECA 4F46A 2O48X 1WDLA 1PS9A 4XQGA 4E5NA 2NVWA 1BWSA 3UOGA 3ZV3A 3KYDB 1ISHA 1PTJA 3WFIA 2E37A 1E7SA 1V6AA 3GAFA 4DPKA 4EUHA 1DIGA 1DC4A 2VYNA 4OAQA 4GWGA 4ZHSA 2IXAA 2I65A 3MWDB 4MVJG 4R3WA 2HJSA 2Q2QA 2RH4A 3KVOA 1B3RA 1ENOA 1YDEA 4D79A 4PN3A 2SCUB 2FR8A 4YJHA 2NTJA 1RYDA 3CIFA 4JIGA 1D8AA 1H0KA 1JVBA 2BH9A 4J7CA 5A04A 1I36A 3AOGA 3A4VA 4FD3A 4WLOA 2BF7A 4AG3A 1K2WA 2B4QA 5K6AC 3RFTA 5IFLA 1U9JA 2X9VA 1TXGA 3G49A 3H9GA 1V8BA 2XAAA 4FJ1A 1VL0A 3PHJA 2P68A 4DC1A 4P22A 4N5NA 3E5RA 4AJIA 3D4PA 4BO4A 3ZU5A 2VYVD 3ETGA 4FJ2A 3FNHA 1PJBA 3QWHA 1NQ5A 1SBYA 4K6CA 5CDGA 2D3TA 1YB4A 5KVVA 4U8GA 2YHIA 1YQDA 1VLLA 1EDOA 2CF6A 3OBBA 2C5EA 1L1FA 5ICMA 2ZB3A 4KTTE 4L74A 2NWQA 3KB6A 3Q6IA 4ONEA 1A5ZA 2C59A 4EI2A 2O2YA 2V65A 1CEQA 2VWQA 3PP8A 4WCFC 2HDHA 3SC6A 2FSSA 4WCFB 4BQPA 1CQIA 2CNBA 4II3A 4LGVA 4NBVA 5JAQA 3UKOA 4DQXA 3QVXA 1UR5A 3ULKA 2AHRA 5KCZA 3OF2A 3W6ZA 2OP0A 4W9NA 3JD3A 5THQA 2RHRA 2JD1A 1E5QA 3QVSA 4PLVA 4WJZA 3WQQA 4B4OA 3DHEA 4R3NA 4PRKA 4OKNA 4Q3CA 4W6ZA 3EAGA 4D44A 3HSKA 2HRZA 3QRWA 4BNHA 2Y1CA 2FOIA 4G81A 5IZCC 4N5LA 3RCBA 1DEHA 3DFZA 1WW8A 4GVLA 3RSHA 1E3JA 5A5EA 2H63A 3V1YA 4CL8A 3PYMA 4J0EA 1MGOA 4GPD1 5HRUA 1LRLA 1ISMA 3U4CA 1YOVA 4RPKA 2PA3A 2HMSA 3PHLA 4E33A 3DZBA 1V3TA 4D3SA 1ZEJA 5EIOA 2OORA 4FC6A 4HV4A 3WNVA 4MVJP 4YJDA 1R4NB 4CQMB 1CJCA 4L0QA 3DOCA 4J49A 4K6FA 3RAJA 4ALJA 1EK6A 1GZ4A 1XIVA 2ZB8A 4BNIA 1LSOA 1ZNQO 3LC7O 5U4QA 4PCVA 1WWKA 4NDNE 3GRPA 3V2HA 4RLSA 2ZTMA 4ID9A 2O7SA 4P4GA 2PWZA 5DT9A 2VHZA 3DAFA 3PQEA 4L4RA 1U2DA 1ZSVA 1HLDA 1UXGA 3OETA 3DMYA 2ZQZA 3ZNOA 1Q0HA 2AE2A 4HADA 3FBTA 4WEOA 1P1HA 5A5FA 2EKPA 1OAAA 3GAZA 5A06A 3U62A 3NRCA 2B37A 4PLZA 4RVUA 4BNKA 3NGXA 4FFNA 4JBHA 3WGZA 5I7EA 1RWBA 1G6KA 3GFBA 4OM8A 4EUFA 3LVFO 3L77A 5JS6A 4FC7A 3HUDA 1KVSA 4DYDA 1XLTA 1H6CA 5GZ1A 5TIIA 1MXFA 1RM5A 3TJRA 3GDGA 3R1IA 3OQ6A 5G0VA 2X6TA 1NFQA 3GGOA 3WJ7A 1IPFA 1K3TA 2ET6A 1NPYA 4M49A 3ZWAA 2G76A 1HT0A 3VPHA 1E7RA 5TS3A 3ANLA 1NWCA 2D4AA 5DF1A 5JPIA 1R0LA 5COAA 1E77A 3DL2A 3LQFA 4I1IA 1WAMA 1E3WB 2BHLA 5CPFA 3STHA 2OMEA 3N7UA 3VPXA 3D4NA 4AJKA 1GL3A 3MOGA 3NT5A 3HB5X 1UUFA 5C7LO 3MWEA 4DA9A 3OIFA 1IZ9A 3RUEA 1QP8A 5EQDA 1KETA 3CKYA 3K2BA 1GCOA 3GH3A 3TFQA 4UEOA 1PGOA 4W9NC 1P0CA 1V3VA 6ADHA 1FDVA 1JKIA 4PLYA 2VT3A 2DPHA 4KUHA 2ZYAA 4LMPA 3WXBA 3GMDA 3C1AA 1DXYA 2H1SA 3LC1O 3S2GA 4JP3A 1DC5A 5JY6A 3DB2A 3ICCA 2B5WA 1O9BA 1UZMA 4DWVA 4IZIA 2GASA 3AW9A 4M87A 5A3VA 3E03A 4MKXA 1E0DA 2I67A 3K8ZA 1HEUA 2A4KA 3AY7A 2BFPA 4DXHA 4R4JA 1ZK1A 3DMTA 1X7DA 1ISIA 1QYVA 3QWAA 2ZTVA 4OKIA 1R6DA 1DJQA 3WGOA 2I66A 2P91A 3M1LA 1HF3A 4LRSB 1FDSA 3JQAD 2GD1O 2JCVA 3PGXA 4E2WA 3MCVA 4MOWA 3EZYA 3H3FA 4MVJA 4JP2A 5DCUA 3T7EA 3JD4A 5F1OA 4YJFB 3AWDA 4O6VA 1ZK2A 5DDIP 4DQVA 3WLEA 4M1QA 4CL3A 4HP8A 2FWMX 5KVSA 1F0YA 1LLCA 2DC1A 2JCXA 2YV3A 3LLSA 3HDHA 4P38A 3ANMA 4IDBA 4K26A 5JCJA 1UXJA 3RASA 3U5TA 2PTGA 3GN1A 4BO6A 3VZSA 2CFCA 4IY1A 5KTKA 4XYEA 4GX0A 5I9LA 5DOZA 3GZNB 2VNAA 3GG2A 2RAFA 3O8QA 1JAYA 5CG1A 3SVTA 1GZ3A 1WDMA 4RDHA 2VRCA 1TB4A 3AI3A 3BMQA 3GDFA 3I9MA 4BKPA 4J91A 2NV6A 4CLRB 4MVJM 1GV1A 3UCXA 4IXWA 5IF3A 1XELA 1NPDA 2Q45A 2C2XA 2XXJA 1FMCA 1BDBA 4YJFA 4ALMA 3WSWA 5L40A 1Z73A 2VT2A 4QO7A 4RJTA 4MVJD 3CMCO 3GHHA 3RD5A 2H6EA 1C14A 5T64A 4B4VA 4BKUA 4RVFA 1ZFNA 3I4CA 3NJ8A 4ILKA 4IJWA 1VSVA 3KETA 1ML3A 1CQJA 2VTDA 3KSUA 5G2OA 3K9QO 4TZKA 1C0LA 1F14A 1R0KA 3LF2A 5DULA 2C29D 2X0JA 1X1TA 4CMHA 3L9WA 2HK7A 4DTIA 1V9LA 3DOJA 4JLWA 4BNJA 2NTVA 2GPTA 4ALNA 2W90A 3FHLA 3VTZA 4ND5A 4DQUA 1E6EA 3NV9A 1O89A 2C0CA 2NU7A 1P74A 4YTEA 2AW5A 4CMCA 4RLHA 1ULSA 1YKFA 1NQOA 3OJLA 1ISFA 2VHWA 1R12A 5B37A 4RVSA 1MX3A 4MIOA 4YJGA 4RPLA 5G4KB 4J4BA 3BIOA 1SEVA 1SCUB 3QP9A 2X1HA 3G3EA 2NU9B 2HLPA 4CMBA 2GZ3A 1QMGA 3B1KA 1Z7BA 1ZBQA 4R1SA 3KYCA 3LK7A 1Y1PA 4Z3DA 3DZJA 4B4WA 4EEXA 2JL1A 1PSDA 1N2SA 3INTA 5JXWA 1V35A 2ZB4A 2DUUA 2ZYDA 3RJ9A 3H9QA 3MOIA 2UUOA 4XX0A 2ZJ0A 4CM8B 5B1YA 1NHGA 2NU8A 3MJTA 1A9YA 4E4YA 1VRWA 3Q3CA 2R6JA 4NNJA 1CETA 4AJHA 3K96A 1NAIA 3IS3A 3Q1LA 4BHTA 4TQGA 1U3VA 2HMUA 4XWYA 3L4SO 4NJOA 2PKQP 4J1SA 4YRBA 2YDXA 4K9DA 5FI3A 4YAIA 3ZU4A 3UFXB 4FGSA 3EUWA 1M66A 3FNFA 3WMWA 4BNWA 4CODB 2I3GA 4GL4A 1BRMA 4MO2A 4E31A 4FR5A 1ORRA 2VUTA 3S8MA 3HNPA 1MP0A 3ZWOA 5IG2A 3JD1A 1UDAA 2GUGA 2YQ5A 3W8FA 4BNLA 1FF9A 4R16A 5G0WA 3JSAA 4CV3A 5DCYA 2BKAA 3H5AA 4R54A 4ZICA 5EINA 4E6PA 1EFLA 1DPGA 2RH8A 4C7KA 2OFPA 4RZHA 3IOYA 1PJ4A 4XIJA 4CUJA 3VH1A 2WYUA 2QYSA 4GWKA 3ONEA 2D2IA 4NU5A 3RQSA 1XGKA 5L45A 2P9GA 3JYLA 4FQ8A 4YQYA 1LEHA 3JQEA 4J1QA 4XD2A 4E13A 3ZWMA 1TA4A 2PGDA 4I9UA 4E3ZA 3FTNA 3WFJA 1JU9A 2XXBA 3U4HA 3HFGA 1D1TA 1DB3A 2EG9A 1LBEA 1R16A 2BLLA 3GVCA 3GY0A 4O1MA 3WIDA 3SXPA 2ZYGA 1U7TA 3A9WA 4A7PA 3ZV6A 1B8UA 5FEUA 5G0UA 3WNQA 1DAOA 2WE7A 3ASUA 3ROQA 1CQIB 1HE3A 4XYLA 1PQPA 3MJ4A 1FK8A 1WXDA 1HXHA 2WMDA 4XEHA 4Y67A 1GYPA 2QZ9A 3IAHA 4E30A 3IUSA 3HG7A 3OH8A 2NU8B 1K5HA 3I6IA 3H6KA 4DGSA 3GN2A 5EQFA 4BGUA 4YT2A 1R4MB 3HZZA 3LT0A 4YXFA 3CSDA 4DLLA 1Q7GA 4EJ6A 2YW9A 2JD0A 3PRJA 4KZPA 3NTQA 3TZHA 2EW2A 2YQ4A 3B6ZA 4PG4A 3WS7A 4CM6A 1PZHA 5IN4A 4WLEA 5KKCA 1PZGA 3F3SA 2Y1FA 4FOOA 3ZWCA 3DZHA 1UZNA 1VI2A 4J16A 5L3ZA 2QHXA 3R6DA 1U5CA 4HUJA 3JTMA 4R69A 5JO9A 3DAPA 1VL8A 1YB5A 3ZDFA 1I01A 5I8WA 4L9RA 3RROA 1HDOA 5JYDA 3VZRA 4DVJA 3U09A 1T2DA 1YE3A 1QV7A 4DLAA 3Q9UA 3MJSA 3RKUA 4DMMA 1IL0A 4RCVA 9LDBA 3NDIA 1YRLA 1E7YA 1HSZA 3NUGA 2ZQYA 3DHYA 3RBXA 4WK6A 1DLIA 4CUZA 3UCEA 3MWDA 3DWFA 1G1AA 4RO0A 1JQBA 5A9SA 3VOSA 2JJYA 2AQIA 4H3VA 2EJVA 5I7SA 4FGWA 4MP8A 4H7PA 1MFZA 4GX1A 4YAEA 4OXNA 5COBA 3CTMA 4YVFA 3TFOA 1CF2O 5ITWA 1LUAA 4C4OA 4CM5A 1B14A 1HYEA 5F3RA 2NADA 1FJHA 4RF2A 1QYXA 2VHVA 2Y0CA 1E1MA 3K73O 3JQGA 1AXEA 2GYYA 3DBLB 2QW8A 3BMCA 5AVOA 1ENYA 4EW6A 4EITA 4CMAA 4WEQA 4BMNA 3JD2A 4OGWA 1CERA 2POQX 3FCOA 1U4OA 2E48A 3PPIA 3VDQA 5A1TA 4IDEA 2O3QA 4PLWA 2P9EA 3N74A 2DUWA 3FNEA 4R1TA 4PVDA 1ZVMA 2D0IA 2A94A 4I8XA 5BNFA 4EZBA 1A7AA 3C1OA 1TI7A 3G1UA 1FXSA 4E5KA 1PU2A 1K6XA 1E1LA 2EWMA 4IJKA 1V0JA 1U2GA 1KEPA 2W2KB 1SPXA 4QT0A 1R66A 2YV1A 3AI2A 3B1FA 3EZLA 3ZWXA 3PXXA 1J49A 3OHSX 4I9HA 2J5QA 3HN2A 2I6TA 4Y6PA 4BGIA 3AFNA 1CIVA 1PJCA 4XCVA 2W2KA 2AEJA 4OXKA 5GZ6A 1I10A 1MA0A 2AQ8A 4J0FA 1PZFA 2B69A 2ZATA 4ND2A 3JYOA 3ZWNA 4Z9FA 4E0BA 4U6SA 1I33A 4YT8A 1WZEA 4AFNA 3EVTA 1N7HA 2D59A 4GSKA 1EUCB 4A2CA 5AXDA 3JQAA 2OZPA 3UH1A 3M2TA 1H9BA 1SNYA 4BS9A 5MDHA 2X5JO 5I9NA 1GFSA 1KYQA 1P31A 3D5TA 1ISGA 3PHIA 1SB9A 4GH5A 4JQCA 4PG7A 3D5QA 4RZIA 4XYMA 4UVIA 3MJEA 1NX6A 3JQ7A 1DSSG 1SOVA 2WE8A 1BHSA 3C3XA 1A71A 5T8KC 3ETEA 3WBBA 4WNCA 2OO5A 5AXCA 4F3YA 3F4LA 1YJQA 1N8KA 2JFGA 4BV9A 1OOEA 1PJ3A 3PZBA 5L7WA 5JNLA 4FB5A 2CZCA 1PJ2A 1I5RA 4EDFA 5ILOA 4Q3DA 1LLDA 3DBLA 3P5SA 5TF4A 4JX8A 3JYPA 4FDAA 4FOSA 3GLQA 5ER9A 3UHAA 5F1KA 5T5QA 1N1GA 1EVIA 1E3SA 3AFMA 2B36A 4D46A 4CLOA 1HDYA 2PH3A 1BGVA 3V8BA 1Z82A 2EXXA 5I8ZA 4J6FA 4NQZA 4Q39A 4LN1A 3WMXA 3DMTC 4XB1A 3GPDG 5MGBA 1OC4A 4GSLA 3GNSA 3GRKA 4WECA 2V6BA 2VHYA 1QSGA 2O7QA 4PZDA 2GSDA 3ANNA 4F6CA 4TSKA 5THKA 4DBVO 4KWHA 3QLJA 1H93A 1EVZA 5IN5A 1C1DA 4Q3NA 3VC7A 5U1PA 2Y1OA 2J6IA 1D7OA 1F8GA 3PHHA 4IINA 4UEKA 2CVOA 1QYDA 2IRWA 4FIZA 2A35A 4CR7A 2YJZA 3F6YA 1RM0A 5U9CA 1JW9B 1AGNA 4R5HA 3O8QB 1FDTA 2PGJA 4TRRA 4URFA 2QG4A 1MC5A 1NYTA 1N9GB 2E4AA 2R00C 4RQTA 4D43A 3GVHA 2PKRA 1CQJB 5B4TA 1Y8RB 4ZQHA 4R68A 3Q2KA 3UAGA 3VDRA 5J23A 4OSOA 3WSVA 4QFDA 1YO6A 5CPBA 1NQAO 5IXYA 2YHUA 5HS4A 4HXYA 3GNTA 3MZ0A 2DTEA 2ZB7A 2DTDA 3I5MA 2YYYA 3ORFA 2PY6A 3GDOA 3R3JA 4Q3EA 1UAGA 2WD7A 2HUNA 2VN8A 5ICSA 5BNTA 1BW9A 2NACA 3KEQA 4YA6A 4IZHA 4O63O 4EEZA 4BO3A 2CVZA 2BI7A 4GKBA 1E3EA 2EIHA 4HKTA 2H9IA 4NR0A 3RFXA 2P9CA 3WDSA 5IDWA 4GMGA 3HJAA 5IZCA 3EC7A 4L4XA 2FPIA 2FSVA 4J1NA 3VH2A 4AJ1A 2ILTA 2JHFA 2NVBA 5KJFA 4ND3A 4RVGA 4U0JA 1Y9AA 1Y8QB 3EMKA 3KYCB 5CAEA 3BTUA 3GFGA 3VTFA 5TJ9A 2QIOA 4Z3KA 3HB4X 4B8ZA 5IXSA 2X9GA 1W6UA 2NVUB 1GDHA 4XR9A 4BKRA 3AUUA 5T8KA 2ZCUA 5G4KA 2AQKA 1BXKA 4WASA 2GN9A 5KNLA 3ITKA 1F12A 1UAYA 4GVXA 5C5IA 3PK0A 1C0PA 2YUTA 3GR6A 1F8FA 3OIGA 2VHXA 1NM5A 1PIWA 3ZZNA 2JHGA 4A73A 1B8PA 1HZJA 4NIMA 1W4ZA 3LC2O 1PS0A 3PTZA 3RVDA 1JN0A 4XB2A 5EPOA 1SO8A 4DIFA 2HAEA 3G79A 4QX6A 3JQ8B 3QWFA 3VVBA 2VWPA 1T4DA 4WLVA 2JAPA 5L4LA 4IM7A 4B3IA 1ZK4A 2WYVA 4IBOA 3EVNA 4CMJA 4BNFA 4LCEA 1TT5B 4NHEA 3ZN2A 3DOOA 3PLRA 4P4LA 3IP3A 1CWUA 1VC2A 3FWNA 4DYVA 3IL2A 3LSYA 1X7HA 1Q2XA 1WPQA 4XDZA 5JDCA 1GAEO 3H9EO 3AI1A 3UXYA 1IB6A 1P9LA 3HE3A 3U9LA 1ZSNA 4G65A 3EHEA 3AK4A 1PGNA 2J3JA 2NTNA 1GUYA 1GUZA 3NTRA 5LDHA 1EDZA 2X5OA 3BA1A 4N5MA 3P19A 2HQ1A 1A9ZA 3SJUA 5CDTA 1H6BA 2PV7A 4R41A 5JDIC 3K2EA 3L6OO 5EESA 1E7WA 2RHCA 5FFFA 3KLPX 1KVQA 3Q0EA 4LVCA 3UGKA 1HLPA 2CDCA 3RFVA 4WGGA 3ON5A 5DP2A 5HS6A 3GEMA 1MG0A 3BMCB 4ZD6A 3D64A 4LW8A 1GR0A 5TJHA 1QYCA 2GF2A 4B3HA 3ZI0A 2OHXA 1YVEI 3F1KA 2QRKA 2YHIB 1PL7A 1PL6A 5K0ZA 3ASVA 3WYEA 3KV3O 5A9RA 4QECA 2ZKLA 2FHSA 1HETA 3OEWA 2IE0A 1EFKA 2HO5A 3E48A 3KYDA 3D3EA 1RM3A 2EKLA 3D3WB 3PDJA 3TL3A 3GGGA 2O4UX 1IOLA 3QW2A 5BT9A 4II2A 4KDFA 1VPDA 3WLFA 2QX7A 3FD8A 1ZCJA 3AOEA 2WWRA 3E9QA 4WUVA 4CMEC 1IY8A 1JWBB 5LCXA 1GADO 3QHAA 4YQZA 4YJHB 1KBZA 4ESOA 4RQUA 2Y1DA 1UXIA 3DBVO 3ZNPA 4MIEA 2BGMA 4I08A 2PZLA 1OMOA 2BFOA 4MVJH 5A02A 2Q4BA 2FR0A 3S2IA 3WWYA 1JKJB 5TSDA 3W8EA 1CYDA 3D3WA 1U5AA 2DBVO 3PIDA 3CINA 3JQBA 4CM1A 4ALLA 4ALIA 3CMMA 3QSGA 4BQRA 3TDKA 2X58A 3IJPA 4O5OA 4CPDA 3KLMX 4MP6A 4WLFA 1WLYA 3OJOA 2Q2VA 4L76A 2VYND 3ENNA 2HK8A 5EJ2A 3AM5A 1YOVB 4JK3A 4A0SA 1Q0LA 4U7WA 1A7KA 3EGOA 3MJCA 1RM4A 1T1SA 2IDZA 4BGVA 3ZWYA 1HTBA 3RIHA 4XRGA 1P0FA 1DO8A 1VKNA 1DIHA 1NR1A 3S2FA 2UVDA 3VZPA 5L7TA 4YYZA 1EBFA 4Z6KA 3GMSA 4CMIB 1X14A 1R4MA 4PVCA 4I5GA 2YDYA 1QR6A 2IZ1A 5JW6A 4E5YA 1KEVA 4H16A 4IDAA 2PD3A 5JBIA 2NUAA 3BTOA 1DHTA 1K6IA 5I7VA 4YBZA 5FYDA 5JYEA 1ZO8A 1E1KA 3F9IA 3C85A 1C1XB 3GPIA 4MJLA 3I9JA 3ZGYA 3OICA 4WLUA 4U6QA 4PLTA 4WCFA 4DL9A 4CJXA 4CM4A 1LTHR 3SEFA 5EL0A 3F5QA 3OJ0A 4YR9A 1B8VA 1HDGO 4FN4A 4OQYA 1I3KA 4LRTB 4OMUA 5CDYA 4CV1A 4J9UE 4KQXA 2VWHA 3T4EA 4J7XA 3ROPA 4OHUA 4YAJA 4BIIA 5AXAA 1XYGA 4OIMA 4XGIA 3S2EA 4M55A 4MIYA 3WTCA 3EK2A 5AXBA 5G4LA 5HWSA 1LA2A 3JYQA 2JAHA 2PZKA 3F47A 3V2UA 3QVOA 4HNGA 2X9NA 4EUEA 4KDEA 1GQ2A 1IHYA 3ZWWA 3LDHA 1HZZA 2WD8A 4D3FA 1JDJA 1XCBA 3GGPA 3H2ZA 2AMFA 4XGNA 1X1EA 2AEMA 2D5AA 4CQLB 3RKRA 2J3KA 2UUPA 5A9SB 1JTVA 1N1EA 4CV2A 4ZVVA 4UEJA 1X13A 1O0SA 2FPIB 1EQ2A 3TOXA 1R0SA 1RPNA 1D3AA 2Q99A 4FCCA 5COQA 2Q1WA 2NSDA 1P3DA 2ZIZA 2Q4EA 3ENKA 3OP4A 4O0LA 1VE9A 3RI3A 1NASA 4DIOA 5BQFA 1GUFA 1PR9A 5I9MA 1MXHA 4NK4A 3I9NA 1ZKMA 5AQ1A 2NU6A 2GZ1A 1O8CA 1BDMA 3GC6A 4TKMA 1WP4A 3WYBA 3GQVA 5JO0A 1WDKA 3W4KA 3BMQB 4N54A 2C7VA 3KZVA 3UUWA 3TNLA 4MKZA 3GNQA 1DDOA 3ZHZA 5TC4A 1B16A 1DFGA 2WSBA 2Y67A 4GLLA 4JJIA 3QE3A 4JJGA 1Y8RA 4ZJUA 3P7MA 3O26A 1YS4A 4ZRMA 1GEGA 3OA2A 2ZK7A 1HDRA 4NBTA 2VCYA 1XDWA 4J2OA 4IUYA 5KKAA 4RF5A 4RPHA 1ONOA 2B5VA 5JSFA 2DBRA 2E6UX 2EP7A 2NU6B 1DC6A 2DBQA 4KQWA 4XDYA 1U3WA 3DO5A 3GVIA 1W8DA 3OM9A 4LK3A 3SJ7A 3WTBA 4Z0PA 4W82A 4PG5A 2HKIA 1I2CA 1PJQA 2NQTA 4FW8A 1SOWA 4BO0A 4BKQA 3JQAB 1DJNA 4D41A 1Q7BA 5JCJD 3F5SA 4XGKA 4MPDA 1R37A 2FR1A 3PI7A 1E7MA 1CRWG 2VNSA 1UDCA 3COSA 2RCYA 1I8TA 3WICA 1E1NA 4CQLA 4FSHA 1BTOA 3DEYX 1DRVA 4J90A 1KEUA 5DBIA 5CAEB 4INAA 2AE1A 1XG5A 5TNXA 2DVMA 1SC6A 3RC2A 1M6HA 4CLXA 1P77A 2GLXA 2P4QA 1J0XO 8LDHA 2WTBA 1JVSA 4B7XA 4XRRA 4IDFA 5CG2A 1UP6A 2GNAA 2BFMA 2R2GA 4A26A 1JLLB 5GZ3A 5KVQA 4PG8A 1M2WA 2RIRA 1T2EA 4GAEA 4J1TA 3AJRA 3HQ4O 1PEDA 3PZRA 4GMFA 4RF4A 4FFRA 4TZTA 2C7GA 3BMNA 3JV7A 3RU9A 3GF4A 4CLDA 5JLAA 3LT2A 3PJGA 5DNAA 3LZ6A 1WNTA 3ZHYA 1S7CA 3H7AA 1N7GA 1YBVA 3D4OA 4FBGA 5ENVA 2UAGA 5A3JA 4BKOA 3ZCXA 4HFJA 2EEZA 1DLJA 1ID1A 1PJSA 3JQ9A 3D0OA 1T24A 1HYGA 1T4BA 2GZ2A 2AQHA 4IIUA 5DBFA 4Z0TA 1LSSA 5TLSA 2BD0A 3JYNA 3Q9NA 1Q1NA 4NPCA 3FBGA 5HA5A 4LISA 4JXKA 3KBOA 1PWZA 1NAHA 4E2ZA 3F4BA 5CDUA 3JQBC 5ER6A 3BHIA 4PLGA 2NLOA 1I2ZA 1QRRA 1PX0A 1LXCA 3TPCA 4B4UA 3QA9A 4BB5A 1RKXA 3NT2A 3DBHA 1YH3A 2G82A 2YY7A 3Q2IA 4AJPA 3PYLA 3KEOA 1KVRA 1LQTA 3NKLA 3IKVA 5L53A 1KEWA 1DHRA 2X5KO 3WGHA 2FPPB 2EP5A 3TOZA 3K30A 3RBZA 3DDNA 1T2FA 4MVJE 4ND1A 4YCAA 4I5DA 3VPSA 1LU9A 3S55A 1SAYA 5DP1A 3JQ8A 4A27A 3L6EA 4IS2A 3FF4A 4XA8A 4XYGA 1XA0A 3S1LA 4ZQFA 4JJFA 1NBOA 5DOVA 1EBUA 1Y8QA 1EEHA 4BB6A 2VZ8A 4WOJA 5B4UA 2PNFA 3AM3A 1DOHA 4HFNA 1JLLA 5JFOA 3C7DB 2J3IA 1XU7A 3I83A 4KTVE 2Y0EA 5L4NA 1O6ZA 3IJRA 1NXQA
chains in the Genus database with same CATH superfamily
2OCIA 1PDWA 3T7CA 3U6BA 1UBHS 1FPMA 2DWQA 2O0LA 4LSMA 1ENZA 3HRHA 1X86B 4QD3A 4M60A 2VP0A 1CZRA 1DIRA 3JU3A 4FFOA 1L5KA 4ERNA 5LDGA 5I9BA 4O29A 2RGBA 1FS5A 2YTZA 5F9MA 2X0IA 5KQMA 3I2IA 3GLVA 2F17A 1CUWA 2JI4A 2OBYA 1J25A 1J5PA 1GY8A 2CHGA 3L07A 5AHRA 5BXQC 1ZWLA 4BE9A 4DDTA 2A88A 5IAGA 621PA 1SQGA 3IMCA 2ZRLA 3WYCA 4B8YA 4M38A 5BW5A 2AWNA 2Y2VA 4R9NA 2PWPA 1R6TA 2Y99A 1EX1A 3PWZA 2X3FA 2GK4A 5E2AA 4BZZA 1YL7A 1AUVA 1ADJA 2H52A 2Q4OA 2WHRA 3AR7A 2VDPB 3P97A 4YRJA 5I7FA 2M6SA 1AK2A 3TCXB 2R3SA 3HYTA 1FA9A 3BIXA 3I23A 1AXGA 3D2LA 3QSYA 2C95A 4WOCA 4QT4A 4Z4HA 4JJ6A 1GD1O 2UYYA 4WKNA 3SHVA 3KE8A 3NHAA 3K32A 3QKTA 1Z08A 1X9GA 2Q0XA 4J4TA 4Q3BA 1JL3A 1KZYC 4CR6A 5KOHB 2JFNA 5BYBA 2O2EA 4KDRA 1WTAA 3GZJA 3HBAA 1M1NA 1ODLA 2NYRA 1EJ0A 2D1FA 5DEOA 5CFZA 1Z45A 3G5AA 3NC1C 4CT5A 3NHWA 4DIKA 1PJRA 2UVQA 2ONYA 1O94A 5CT8A 4Q3KA 1XKQA 2HMAA 4GOOD 2C7QA 4BLTA 3TGPA 1YR9A 2VKQA 3HN7A 1R4NA 1JG7A 4L9SA 1US8B 1UT8A 4IDHA 2KLHA 1ULZA 3AM4A 1U3CA 3KT3A 3O38A 3D1LA 3GWGA 4KIUA 1CDDA 4YS6A 3R5JA 4GPTA 5L3QB 2NZ2A 2J3DA 4N6GA 2DR2A 4HVAA 2Q5EA 4EGFA 1BNCA 2J3EA 5CM2Z 4JI4B 4R7TA 4TZ6A 2Q9AA 3NX4A 3TSCA 2P3QA 4DANA 3EQ8A 2NSHA 4M46A 3OURA 3PGJA 1BHO1 4OA8A 5BW6B 2WIBA 3WV4A 2ZSAA 2O05A 1D2CA 1WUHS 2BV3A 4Y3UA 3ZK9A 5JROA 1XMSA 2LV8A 4FSXA 1MRSA 4GMKA 2ZBPA 1JALA 1ELOA 3M5CA 4WLEA 1W29A 3RYCB 1T9HA 1DCFA 5F1PA 2QTAA 5FBKA 3MT8A 3LIPA 2D7CA 4R9VA 5CYFA 1XD9A 3U49A 4CCYB 3DR3A 3MN1A 4LMBA 1CB7A 1L5YA 2W2LD 1FDWA 4NZZA 1C7FA 4C4PA 2GEFA 3E22A 2J59A 1K6JA 2NZJA 3OA0A 1KH3A 3OJXA 1E2EA 1ONSA 4J43A 2EYUA 4Y2SA 4D5EA 2RHLA 3BWDD 2C61A 2H2IA 3EDMA 3VC2A 5A04A 2GQ0A 2H2DA 4JI6B 4KLRA 5B12A 3V34A 4LE2A 4NV3A 1NATA 4X7PA 3VR5A 3CLSD 3PLNA 1OGIA 1Y4UA 4XUGB 1PNRA 4Q02A 4Q03A 3O90A 4B3BA 4LY6A 3WBFA 4C2TA 4DZZA 1OGJA 5I51A 3DMFA 3H16A 1PVDA 3G7UA 4JMPA 4HNAB 2QVGA 5BR7A 1QFJA 4CV0A 4RK5A 1QHNA 5FADA 4UREA 3VR5D 3PJEA 2XX3A 2CUNA 2GCGA 2P2NA 3O4IA 3T5TA 1NV9A 1XMQB 3A6ZA 4M0KA 3RSFA 1KQFA 3SVLA 3HWX1 4RGQA 1W5BA 2GEUA 2RI0A 3L41A 2F62A 4L75A 1Z4JA 4AXBA 3VO2A 3OIUA 3DM9B 3HWSA 1ZRMA 3L2OB 4PLPA 1WXQA 3P8ZA 3FKQA 2H4JA 4IQ8A 3QKRA 4JC8A 1UXOA 5H4GA 3FMPB 1R6UA 1XN4A 5SYAA 3BULA 1Z7GA 2Z5LA 3V4OA 3PKZA 2X4GA 3LX4A 5EUQB 4FGUA 4KE6A 3CZRA 1MV5A 1EGHA 2X7HA 3I04A 5KWEA 3KU4A 4JI7B 3KYBA 3TZ6A 4I36A 3O3MB 1E1YA 3TLXA 2O8FB 3I1IA 4M54A 1MJGM 2QNIA 1MRNA 2GERA 3KXDA 3WMRA 1V1MB 4ZN6A 1IWOA 1PR0A 2CDNA 2KWIA 1UKYA 3U7FB 3DLHA 3OCXA 1TU3A 3CBGA 2CKDA 4B0PA 3ONDA 4R9RA 1ULUA 4UFOA 1VQ1A 2AN1A 5DJ5A 3T3DA 3TWOA 3H04A 4B8WA 5BQ3A 1S5PA 2X2PA 4QHTA 3NPAA 2AI3A 2WSSA 1Z88A 3KQNA 2JGIA 3EIUA 4X1IB 3VHXB 4KR9A 1C8LA 1F20A 3PFKA 3TM4A 2PWBA 3GRAA 2XXAA 3L4BC 3MWKA 3N7AA 3LWDA 5DLYA 2TMKA 4GKVA 1P4JA 4XQ0A 4ARBA 4PN7A 3P2JA 3ADDA 2OHJA 4XWTA 2VO1A 4ZOCA 1R0ZA 3NM6B 2WHEA 5DNWA 3RR2A 1UPAA 4EAAA 2GSWA 1GSOA 3AUTA 3I53A 3PXCX 5F5LA 1Y82A 4BX8A 5K0GA 1NFRA 2DWOA 3BE8A 3VISA 3IT0A 1UJCA 4F45A 5JYCA 4DG5A 3ZIDA 2AH5A 2CGEA 2W8ZA 5IUNC 1GUAA 4BO8A 4BO7A 1P4SA 3EQZA 4W7HA 1NWHA 1FTQA 1ZOIA 3KU1A 4GMXA 5F73A 3OY7A 3GRRA 4D0SA 3F6PA 3E4DA 3DZGA 4DEXA 2UDPA 3AXSA 1SBHA 3ROZA 4PANA 3BRQA 1DBVO 3R7FA 2QRHA 2A5JA 4GWLA 2FLVA 1D7AA 3M1YA 4G0OA 5ULLA 2EV9A 3U3JA 3D54D 3AL0C 1UM8A 5ABPA 5H83A 1EE9A 1K7YA 2W6MA 3ADPA 1YDWA 2EGHA 2H17A 4FJ0A 4FVTA 4MV6A 1ENPA 5FOTA 1FQJA 5C5DA 1PGQA 2G40A 3HDJA 3LW7A 2WAAA 1ONPA 5DZSA 1VLHA 4UMFA 4MS4B 1DFHA 2OG2A 3V8EA 3ENZA 2A86A 4J7UA 2BBWA 3DNMA 5IP5A 2Q2WA 3IELA 1K7CA 4TXLA 1OBFO 4J3JA 4ROSA 3KRTA 2E6KA 4ENVA 1FNNA 1ZINA 3DF7A 4H3KB 3G5UA 1PK7A 4V0NA 3WKDA 4Z4CA 3T1OA 4PM4A 3TEMA 3U61B 2O9JA 4H4CA 1HDIA 4RORA 1RBMA 1E2UA 4D7AA 4DMFA 4XIGS 1NBHA 3IKMB 4GI1A 3ZH2A 1N3YA 1NMQA 3ROKA 3WRVA 3R74A 5J59A 1NPTO 3GZ4A 2PZJA 2H9YA 4G37A 1RVDA 821PA 2VA9A 3C1TA 1A8IA 2OD2A 1MJNA 1J9GA 1UDRA 4MW2A 2GKGA 3UV7A 2B1GA 1ZD2P 3RS0A 1E9RA 2V6IA 4WN9B 2IT1A 4ZEXA 4KX3A 1KKLA 3FDZA 1M6WA 4K3UA 5BSMA 3UYKA 2GD6A 1BYUA 2FX3A 3OQIB 1ZJ6A 1B15A 4L2IA 3TNYA 4YMWA 2HJVA 3H2HA 1EDEA 3VC3A 4DREA 4LMRA 2DQ4A 4FHFA 2A3NA 4DC0A 3AY3A 2H4HA 3RTGA 1N78A 2R1TA 4R1NA 2DHCA 3W05A 4U9UA 1BC5A 4UTZA 5BN4B 1PG5A 5JCXA 5K9ZA 5K6TA 5A05A 1DQSA 3CE9A 3T3NA 2QLJA 1MW9X 3BA6A 1FYXA 2G4LA 1ZCFA 2BOVA 2ZROA 1UBOS 3ANTA 3QK7A 4URUR 4XAQA 3SMQA 1ORDA 2HYDA 2J5BA 3TB4A 2ACWA 2RGWA 1ZG3A 7MDHA 2Q50A 2WU8A 4TMWA 3C43A 2E2WA 3GLHB 3ZHXA 3GHYA 4H1TA 2JFVA 1T25A 2FP4B 2FEPA 3G2NA 4HWKA 3DWEX 1M0EA 3OTHA 1E32A 3AH8A 3KC2A 1ECBA 4RMGA 2GM9A 2GAAA 4E07A 2VK1A 1H2YA 1NYRA 2JGMA 2WG2A 3KSDO 3L8GA 3NP7A 3E3AA 4OB6A 4Q12A 4QQRA 4ZTUB 5F98A 4ZI5A 3M6FA 2FCRA 2BGIA 1T6YA 2AZDA 2X2EA 3A10A 4GOJA 4YRDA 3HJCA 1IULA 4Q18A 2BJVA 4J2HA 4TKLA 2XV1A 4B33A 4R2IA 4RHUA 1VDZA 3ONFA 4LC0A 4RPIA 9ATCA 1SWVA 5M34A 4IPTA 2DLDA 5DTJA 3A1VA 5JS2A 5B4VA 2V3WA 2ZAOA 4I0WB 1GKUB 4FFLA 2QE6A 3QLVA 1PFVA 1PV4A 1V2HE 5CCBA 1E59A 1T9KA 5E1DA 2HT1A 4TMTA 4LZLA 1O4WA 3LC0A 5H7XA 3IBFA 4AB1A 4CM9D 2GTIA 3EFOA 3FR8A 3PGVA 4WERA 2FN3A 4B2IA 1XZAA 4LF9B 2O8CB 1VMEA 3NGLA 4HN9A 1I4OA 4RCZA 2P9TA 3UW3A 3I9LA 1N34B 3U4IA 3TI9A 1TA9A 3DC7A 3PUHA 5DN6D 3WB2A 5AW6A 2C20A 4TYMA 4PZZA 4WACA 1P33A 4ETMA 4B3GA 3R9WA 5HF6A 4GZMA 4NK5A 3OOEA 3VHQA 4G5GA 4PO1A 3IKLA 1PS8A 3AO0B 2OB2A 3B70A 3EGDB 4K03A 4R7GA 4HGPA 4E1AA 4TWJA 2GBIA 2ZGVA 2QRMA 4AVYA 3L7JA 2D3WA 4I5FA 4Z49A 1P2FA 5EJ6A 1WCWA 2QAGA 1OPXA 3RU7A 3V97A 3I9V6 2HR1A 1DGQA 1R8XA 1QCDA 1CY4A 4IRUB 2YIVX 3L46A 4KKVA 2Y66A 4OXQA 3U7EB 3T06B 2A59A 3IAFA 2O3SA 3RVNA 1HSOA 3ZVKA 1U0FA 2I8LA 2A92A 1Q0QA 2XQIA 4JEHA 2OO3A 1F17A 3DL4A 1KERA 2BCEA 3PICA 3PHGA 5CDSA 3KTDA 1UMDA 1PQUA 4LSWA 4BWGA 1N8NA 5T67A 4AUMA 1BXZA 1UBTS 1COZA 4B7CA 2GI4A 3BUSA 5L3QA 1Z34A 1UWCA 4MPTA 4MI1A 4ZP1A 4LJ9A 5E4TA 1N2JA 1ZOSA 2DF8A 3A06A 1Z7EA 1SC4A 2VYQA 4HX9A 4C7VA 4F5ZA 4HNVA 2Q5HA 5F7XA 5KIAA 2VPQA 1Q11A 3RO7A 3P9KA 3B9RA 1RTTA 4YDHB 1M2HA 2FETA 2X76A 4RHXA 1EFTA 2VOJA 4NYMR 5CD1A 3DHWC 1FFEA 2R84A 1LGYA 3PGA1 4LWOA 4Z2YA 4DUPA 1QGUB 2JAWA 1GPWB 3BC1A 4XX0B 4QDZA 4UOEA 3J80A 5KVSA 4INZA 4MW9A 1W2HA 1WXEA 2O0HA 4PCAA 4DEYA 1IZZA 3KQUA 4MRNA 4JLJA 3F96A 1GQYA 2IJGX 2CHQA 1NW8A 2E1PA 3DEIA 1TKBA 2HQSA 3DNPA 1Y5IA 1S3SA 1JR3A 2HIMA 2OOSA 2WM3A 4IEFB 3WKEA 5BMOA 2WJGA 5JWHA 5EIBC 4EECA 4KPUB 1E62A 3PJFA 3AU9A 1EIWA 1OU4A 5AI0A 4YCBA 4YI5A 1ZN8A 2JJ8A 3P9QA 1DJLA 1H6AA 1TKRA 4B79A 3MFQA 2ZJFA 4CN8A 1XXHA 1KDOA 4NNOA 4H0CA 3CB4A 1SK8A 3VKUA 1TZ2A 1GITA 2E85A 2QYOA 2XITA 5BQXA 1SG6A 1UFQA 2X8JB 1TT5A 3KUCA 2BTOA 3JATB 1QGOA 3NM5A 4JLUA 2FQQA 4NPAA 2HC9A 2IA5A 5HM8A 4XTCS 1J6UA 3C8DA 4I19A 4JP1A 1P2UA 4G1VA 1JKJA 4GRDA 4Q47A 5LVAA 4JGIA 1Z62A 3EXAA 3M0EA 3SZMA 1C7ZA 4FK8A 4Z3OA 2YV4A 2FW0A 5ITVA 1ZX1A 1CQZA 1GL7A 4Y6SA 5EOVA 3S7ZA 2AV6A 1B8NA 3FPEA 3NTLA 1LDNA 2CVQA 3GMTA 1QQBA 1FFSA 3LL7A 5D7BA 4UVHA 3A6PC 2WTAA 3QKSB 4P5PA 6NULA 2IF2A 4MWGA 4DAEA 4E2XA 2GAOA 2I2DA 1T15A 3IDAA 2BLNA 1JSXA 4HATA 4TZ0A 1VJDA 4FUQA 4H6XA 4EB3A 1WUTA 1IG0A 4AZSA 5KNCH 3PGMA 3SC4A 1FRVA 3ECCA 4CKCB 3O8NA 3EARA 5AVTA 3NVMB 3D0KA 3B1YA 4IH9A 3O9ZA 3UVEA 2UZ3A 2W37A 1ILWA 1V7CA 2Q3EA 4GPBA 5J47A 5HIKA 3S8EA 3CJRA 3D5EA 1MH1A 3H3XA 4AP5A 5ESWA 5AIBA 3QPDA 5KBYA 4JI0B 2BF4A 2FSHA 5BORA 3C6ZA 5ENDA 3ZBTA 5KJCA 6CHYA 5LNK6 2QR5A 3WK5A 4OK5A 5AW2A 4DUGD 5ED4A 4OJQA 3C39A 1QZZA 3O8OB 3DPUA 3F78A 3O74A 4UMVA 1C3VA 2RAUA 5EG5A 1SU4A 5F2KA 1CVRA 2GN6A 3DDSA 4X5OA 1NU6A 2CWWA 1LNQA 2I2BA 1JBKA 3KR9A 3LRTA 4PAGA 1UBCA 4DRYA 2E4YA 1G42A 1OXMA 1ZXBA 3LSTA 3AR2A 3WR5A 3BRWA 4H18A 1ZI8A 2REQA 2PZAA 4IVRA 4LDRA 2H4XA 4RPJA 2OT3B 2D00A 2OZLB 1B6RA 3AKDA 2P2SA 3U7JA 3ZTTA 3CF0A 4I1SA 5FTMA 4MHTA 1E5XA 5CEEA 1JZQA 1ZRSA 3DV0B 5A0VA 1JIIA 1I4EB 1WQ3A 2FZVA 3OCJA 3KTFA 4FNOA 3QX7A 3N1UA 1G20B 4N0EA 1LK0A 3NHFA 4JSRA 4X1OA 3RS4A 4YR7A 1NXPA 4TQAA 3DZFA 1NLUA 1DEKA 2UV8A 5I7OA 1EUYA 1UBNA 3OESA 2HW8A 1HDZA 4NJMB 2Y05A 4EMBA 3FMOB 1I1QB 1M5UA 4XQEA 3RS8A 3T7KA 4UDOA 5J2UF 2BWJA 4EWLA 3K05A 4N5DA 1JKFA 3NHUA 5CGQB 4ENRA 1A8SA 4KXMA 4V1CI 4LXHA 1RYBA 2YIMA 2EX0A 4IOJA 3TBFA 2B34A 3ABIA 1XZQA 1Q50A 1YS7A 4MUBA 4NEHB 3IIJA 1WM1A 2NV0A 4L8YA 2I4LA 4Y8VA 1M8JA 4RBNA 1PFQA 4M9UA 5CCEA 3S2SA 1D5CA 1F8UA 1LWNA 4NE2A 2FUNB 1P44A 4Y2JA 4U4AA 5G1NA 3RYTC 1W0JA 5AD1A 2HCTA 1E8NA 1K89A 4HSEA 3K8QA 2V96A 3HBMA 2FPGB 3A27A 4O4LA 1ZJYA 1B0AA 2BGUA 2OQVA 2FH5B 1X8LA 3V7YA 2EZ4A 3I76A 4OMCA 4KBGA 2IOFK 3S2UA 1YL5A 2Z9DA 2CSUA 4QULA 5HP4A 1FEZA 3FH0A 1ACJA 3JQFC 3L92A 2AXQA 2YVQA 5CR9A 1DAPA 1M67A 2LCFA 4OHWA 4CCYA 4HR7A 1NSYA 4YH1A 3ZHVA 4U7DA 1NUPA 4HMQA 3BK1A 3ZCRA 1KO5A 1U7WA 3ZJ5A 2ECFA 1BWQA 2I2AA 2NZWA 2D74A 1ZGBA 4JYMA 7AT1A 4LI3X 2FSIA 2VNKA 4I4TB 3G0IA 5K6AC 2OHIA 1HE5A 1WUIS 2AVNA 3AF0A 1J0AA 2V7GA 3GLUA 3QEKA 1WQ4A 3B1ZA 3TXYA 3HR7A 3ROEA 4F6RB 1LZLA 1CS0B 3B5IA 2UKDA 1SG0A 3IUYA 4IDDA 4OYHA 4UQPA 4B87A 4EBBA 1VDMA 3DE7X 3O95A 5HIAA 1TEVA 2ZRHA 1SVNA 1YU6A 4WT7A 2VYVA 5TT0A 2GVNA 4P54A 2JF0A 1NL3A 5SICE 5H02A 4XJVA 1MO3A 2UU9B 2RG7A 4XZ3A 5K51A 5EPEA 3LA8A 4OB8A 4N47A 5IMBA 1YNSA 5EJ9A 4J7AA 1LDBA 2FFBA 3S81A 3Q40A 2NSYA 1QZ3A 2CXOA 4O08A 4KUEA 2IUYA 1HC7A 4LE0A 1GTJ1 2JAQA 2VSXA 2BGKA 1U0HC 3ZU2A 2BFFB 1EWVA 1YCHA 2R6R1 2CDBA 1PG0A 1ETHA 3DB1A 4FINA 4HDOB 1Y5MA 1BAPA 4KPFC 2GDZA 4EVSA 2KM1A 1P4HA 3X1DA 1KJ9A 2OAGA 1VSQA 3S29A 4JJEA 3G8CA 5D6OA 5EZYF 5DPMA 1BG6A 4LRUA 5TVKA 2A67A 3R0ZA 2ZXEA 4X1KA 3X0DA 3TSAA 5GJBA 5HKOA 1BO6A 2LNDA 3KJZA 4U3JB 4MUXA 6ABPA 3R7AA 5BVHB 3FI0A 3RB8A 2AC7A 1HMYA 2DUMA 3GEEA 2HCFA 3V7UA 2X1VA 4LJ4A 2YZ7A 1JEQB 1SQSA 1N5DA 1G17A 2NUTB 2WINI 3G2JA 3KL2A 3U3DA 1Y3HA 2MSEB 2V1XA 3RM3A 5FV4A 2BR5A 3IP6A 1HFWA 4YO8A 5G53C 4GIBA 1GRCA 1KYZA 1OZAA 2G6TA 2IDKA 3HNOA 1X8KA 2VI5A 1RPJA 1H2FA 1KMIY 3E81A 4RY0A 3LYLA 3AB8A 4PQRA 3DV2A 4E5VA 2QMYA 2UYHA 3JALA 1OFGA 4NE9A 5FLKA 3ZI4A 2C82A 4O1HA 2IKQA 3UF0A 4GI7A 3EDYA 1UODA 2BDUA 3VSDA 4NFYA 4LOKA 5D51S 1G3RA 3QVWA 4IUCS 4MS3A 5B2ZA 2WT9A 3R8FA 3AESB 1L5WA 3RUAA 3RVQA 2XMDA 2W2LA 4WE3A 3AHFA 3K6SA 4HC4A 4JUFA 3DFMA 4BFYA 2P75A 3UOAB 3E9YA 4NH4A 3D8NA 3QEOA 2YJ4A 3NHBA 1YUMA 3ICWA 4CXMA 3P2OA 3X3HA 1IY0A 2O1WA 1CY0A 3VR3D 1XUOA 4BNUA 2GX6A 1LBTA 2W4IA 3QFHA 3C2QA 5AHWA 4WKGA 1II8B 2NIPA 2LDXA 1UPUA 2PLRA 4W5WA 4RLQA 5J2TA 2X2FA 3L7OA 2C57A 2IVZA 1T9BA 3I5YA 3EOAI 1OBVA 2ZRAA 4BJHB 3ZNNA 4Z7QB 5KWIA 3W2TA 5JNUA 3B6IA 3AHIA 4QTYA 4R2JA 3OJEA 3MF4A 2IPOA 2BI8A 4ENWA 4EG1A 3EC1A 1OB5A 3NU1A 4GGOA 1PX2A 1K63A 1ZVJA 2CNOA 2Y68A 3UGQA 1GPH1 2QYTA 1IY2A 3AV0B 4FKMA 4FYWA 2XWPA 2GR9A 1N1DA 2VZ9A 1OX4A 3JQ9C 1YL6A 1YR1A 3CIOA 3EPPA 4LHZA 2G0NA 4HS9A 1UZLA 2SBTA 3CZMA 4EHKA 3GLFB 1BKDR 1G2QA 4Q21A 4AD8A 2VVTA 4LXGA 2PZMA 3P71T 4UM9D 2HSJA 1NFFA 2O5EA 5KEIA 4ZK2A 4GNRA 1B1AA 4K28A 1IQ0A 3OQJA 4EKDA 1ICIA 2IBSA 3PGKA 2XZLA 2NQ8A 8AT1A 1UBSB 1GKYA 2ZYRA 1UBMS 4IV8A 4IJ6A 2G8LA 1NR5A 3CX4A 5TMDA 5LQDA 4MS1B 3OIYA 1YA4A 4AYTA 1Z0UA 2DFNA 2C7PA 2B25A 4P3OA 4FP9A 4G0WA 1KZGB 1Q17A 3LGSA 5KAMA 1VL2A 3I5AA 4MRSA 2AFIA 1P75A 3DOEA 3EOZA 3F74A 3IBTA 3OD5A 1KMNA 4G0XA 4X20B 5TARA 4Y0AA 1PR1A 1LDEA 3K5PA 2Q28A 4P93A 3VU0A 2Q6KA 4LZWA 2X6RA 4YV7A 2ZU6A 5JSKA 1V5WA 1TO6A 1ZMTA 4OQZA 2ATVA 4ZZ0A 3EXFB 6LDHA 2GWRA 4X63A 1TU4A 1EMDA 1PGPA 1BSVA 1I2MA 2CJWB 3LXRA 3NHJA 1P5HA 1RYYA 2R00A 3P52A 3WQSB 3UWPA 1L7AA 1OI2A 5DGIA 3HLKA 3OFKA 2J7KA 4Q9NA 4EOGA 3HL0A 1JR4A 2C4VA 3E9MA 5BUQA 2VTBA 4YCLA 1OY1A 2PGAA 2QRLA 3BHJA 3L7YA 2GCIA 1GV0A 4NG5A 5ICFA 4CTNA 3PEYA 2CD9A 1E9CA 2G4CA 3QYJA 4GT1A 1UQUA 5ALWA 1V71A 4JVNA 4F4HA 1AN9A 3QW4B 4NCHA 4ALKA 3AERA 1OLOA 4AJLA 3TW8A 4RAQA 3AYXB 3BH0A 3UFBA 2DQKA 2ENUA 2REBA 3MUFA 3RFFA 4DABA 2VYFA 2B61A 3F7NA 2G5TA 4MGHA 1TJYA 1LSJA 1ZMOA 4JROA 3NBZC 4DYHA 5IT5A 5CXUA 4FR0A 2Y76A 3EF0A 2C5SA 2XWSA 4FZ3A 1T9GR 2XYQA 4IW3B 4XCXA 3UMGA 2ANCA 5E7IA 5BN1A 1A72A 1LFAA 2MCFA 1NE7A 3GLHE 4BNTA 3M9WA 5L3SB 1W36D 1K6EA 4ZQGA 3TZQA 3LKDA 4IKOA 5I7WA 5DNEA 2J0QA 1GQQA 2AX4A 3IUPA 5K3EA 3K71B 1RVV1 3LUFA 2NVUA 3SZRA 4FEEA 2CSXA 2CUTA 3A6EA 3BL6A 2XI4A 2HUPA 1JDPA 4MKGA 3DYIA 4K8OA 2WR8A 3DBRB 4JDUA 3RSGA 2QJFA 1AGRA 3QKRB 4JR0A 3ROGA 2NUPA 2WW8A 1WY7A 3DZIA 1KJZA 4OV6B 3R8XA 2DJIA 2GFIA 3OECA 3QF4B 4L8GA 4F46A 4F72A 2QL5A 3IDQA 2NVWA 3ZV3A 4KQ2A 3LKVA 3CF4A 4TUYF 3AQ4A 1E7SA 4IDNA 1MAAA 1LY1A 3MILA 4FE4A 4HQNA 1DIGA 3N53A 4DPKA 4JBWA 4MWDA 1ZISA 2VYNA 3ELWA 4KAXA 1XLUA 4CHGA 1OILA 2QT9A 5J5AA 1FOEB 2I65A 4RUKA 2YCBA 4WX2B 4BVJA 1RAHA 4F3CA 1YS2X 4M7PA 2IUFA 4ECEA 3BF7A 1KEEB 3KVOA 2YZKA 1GAJA 1YDEA 2IPLA 3AHEA 1EXVA 4C7BA 2Y92A 1BQEA 3T0GA 1OH6A 3ITEA 5E0KB 3IP8A 4F8EA 5JXJA 2XMCA 4YJHA 3NVAA 1ODTC 5K8CA 4WNAA 1D8AA 5K3BA 5LFAA 4KGVA 3I34X 3MINB 3E0XA 1IQPA 2R25B 3O84A 3CCBA 3IVRA 4PFQA 3V8QA 3AOGA 3MA0A 4DLTA 4H6VA 1KTIA 4AG3A 1R2QA 5JSZA 1R6AA 2GBGA 1M73E 2B4QA 3MAJA 4GZ3A 1PW5A 1U9JA 2O1SA 2X9VA 3QNMA 1F9AA 3G49A 4GHWA 3H9GA 4IIJF 1ZUNA 2WKRA 3INNA 1XAHA 4GR9A 2B8WA 4F2DA 1QQTA 1N6IA 3IQHX 3L05A 3P0EA 3ESCA 4O4JA 5CJJA 4DQKA 1YCDA 3PHJA 2I4IA 4YV1A 2GOYA 3HJBA 3NCTA 4P22A 4UC0A 3TLBA 4DC1A 3N8DA 4H27A 2I34A 4Q9DA 3PL5A 1ZOOA 2OE2A 1YC2A 2Q8PA 4AJIA 4BO4A 5LR6A 3FNHA 1DELA 1NQ5A 4YV2A 5CDGA 1XPOA 4MUKA 2V9CA 2NYVA 3K6RA 4D3XA 2VPTA 3IEPA 1ZH2A 1ZGCA 2YHIA 1L1FA 1L5RA 4KTTE 2Z9BA 2P0EA 3KB6A 2O2IA 4KXXA 3ZGOA 2ZWVA 3OT4A 4Q7KA 4EI2A 1KQGA 3NUQA 4WCFC 4V3BA 1MIHA 3IMGA 4LVOA 5FIUA 4KFTA 3SC6A 4YI3A 4G9GA 5CBPB 4MQMA 4DLVA 2PX0A 3SSMA 2GXQA 1G38A 2XUQA 1AUXA 1QVWA 3TG8A 3WRYC 4DQXA 2XB8A 4P84A 3RVOA 1UR5A 1GRVA 3JZDA 3S2ZA 3GYGA 3OF2A 4AY6A 2OP0A 4LRYA 4E51A 2BSAA 1BWPA 2CK3A 1MC8A 2JD1A 4PHCA 4PLVA 2FCAA 3R7DA 1DE0A 1JQLB 1Z2CA 3DHEA 2HCRA 2P2ZA 3KOXA 4PRKA 4OKNA 3FCCA 4P1ZA 1XZBA 3B36A 1HR0B 2YH2A 5BSWA 3QKIA 3LV8A 4L07A 4PNHA 2V7EA 2IX3A 1QKKA 4G81A 3B7WA 4YCCA 3AQIA 2GEVA 3HYNA 5A5EA 1NNEA 3R3YA 1LPSA 4BFZA 2YS7A 2LIVA 4I50B 2PZEA 3PYMA 2LCQA 4N01A 4FXPA 4J0EA 4U9HS 3HN6A 5AVYA 5IM4F 4RPCA 1V5EA 3IIIA 5CB4F 4RPKA 1UKBA 4YDSA 3V1LA 3NGMA 4E33A 4GFDA 4D3SA 3G88A 4KPGA 4ZVPA 4B6SA 1JIVA 3WNVA 3TB6A 2HF8A 4YJDA 2EFGA 4KQIA 2XWJI 4CQMB 1ULTA 2WAYA 4L0QA 2PVCA 5HZKA 2B8JA 1A0OA 4HEQA 1S9DA 1EK6A 2C7BA 5BR4A 1VKHA 1V11A 5GOTA 2VJOA 1NULA 1REQA 3GJZA 2P0YA 4PCVA 4EA6A 3BQ9A 3R20A 4OATA 5EJ8A 1G5HA 4NDNE 3V7WA 3Q3JB 4RS4A 1YJCA 1QO0A 1RJFA 2QJWA 5JANA 2XTJA 3S3TA 4BAZA 2O7SA 4BC1A 3GUHA 1JIQA 1T43A 3AZPA 2ESRA 3BJIC 1E1CA 2HXYA 4YJ2B 3H5IA 3TDNA 1IWBB 2MHCA 2IUTA 2PN1A 2I6QA 3DDHA 3DE1X 4FD2A 3UWDA 2ZQZA 5E1MA 3STYA 4D0NA 2FK7A 1X3LA 2OD9A 2IW3A 5E1BA 2HIGA 2J7PD 3OMXA 3QMWA 4OQFA 1JDBB 1KY3A 4WEOA 3GAZA 1J8FA 1VHTA 4NABA 3NRCA 2B37A 4HLCA 4MQBA 1VB5A 1P0QA 2COKA 3X44A 5BXYA 4FYMA 4JGGA 2V58A 3VO8A 3G2LA 3RTDA 1XN1A 2XVZA 1UFKA 1GL6A 3GFBA 2VNIA 2YV5A 4PR0A 4BTVA 5JQGF 3OLVA 4KVAA 2UYGA 4KO2S 1XZFA 1YZLA 5GZ1A 2CD7A 1XLTA 1A1SA 3DLBA 1Y5NA 4GE3A 3TJRA 5IKOA 5HRCA 3R1IA 4LYYA 3OQ6A 5C7YA 4PO9A 1NFQA 1CK4A 3AONB 1HT0A 2WWIA 3DTVD 5EC8A 1WZCA 4BJ6A 1NZJA 5G3YA 1KP2A 5JPIA 3TNJA 4EZEA 2NSLA 4Q9JA 1A95A 3LQFA 2OA0A 4ME6A 4NZMA 1T0JB 1FRNA 1GL3A 2EZUA 3MOGA 1E3QA 3RT9A 3HB5X 3LZCA 3RHSA 5C7LO 4Y1EA 4DF3A 2AFHA 1IZ9A 4W5QA 4C2UA 4C4AA 2R0QC 1KETA 2XBLA 2JJ1A 2JGFA 3GH3A 4JLDA 4W9NC 5EWLB 5BVHA 2GD2A 3D2CA 4F8JA 1D2AA 2H2AA 4PZ0A 3B7GA 1FDVA 3KD2A 1RABA 2VT3A 4B6FA 1Z0DA 2EDCA 2Q6OA 2X41A 1BX1A 4UUBA 2ZYAA 4O2RA 4LMPA 4URVR 4JVLA 5IAOA 3ER8A 4EHLA 3FTFA 1J22A 2BBTA 3A31A 1S2LA 3GMDA 3MJFA 4K9NA 2ATCA 4QICA 2H1SA 3LC1O 4QATA 1VHJA 2P2LA 4QFMA 1U2RA 1HPLA 3EXFA 4IEEA 4JP3A 3D4LA 1XALA 4JQYA 5J5VA 3TTWA 3RVPA 4MJ3A 5LBUA 4YUYA 5JCPA 1UZMA 2C99A 3FA2A 3GLKA 5EZYB 5TDHA 2VP4A 2WB4A 2F6RA 1OXBB 4KQ6A 4TL8A 4MQEB 3IXLA 4FEYA 3H1PA 2I67A 2C5GA 1CLEA 4RCYA 5C8DA 3MHTA 4BNDB 1MJGA 1RXUA 2BFPA 3A3KA 4R4JA 1EVLA 3V9AA 1X7DA 5IULC 3DQZA 4LC1A 2YW2A 2Z2ZA 1Q0TA 3H97A 5IJWA 1OZFA 2WUFA 4OKIA 9MHTA 1RBYA 4A8JA 4LHSA 4TYWA 2I66A 2IBMA 3M1LA 4IAOA 4D97A 4Z0NA 2GD1O 2P1RA 2I0FA 5CH5A 2FPMA 3V1NA 3H3FA 4MVJA 1JRLA 3LQQA 2G1JA 1CS0A 3T7EA 3LPDA 4CTKA 1DBPA 3CZAA 2DGDA 4YJFB 4C14A 3A6FA 4JXXA 2WJVA 2RFLA 2XR1A 4DQVA 1TW2A 2IELA 1IVNA 2GCEA 1IN4A 2FWMX 3A05A 3L0IB 3N2IA 4QDXA 3O2QB 1LLCA 2OO7A 1U80A 3DDUA 4WKBA 2EBWA 4DG8A 5KYGA 5AM5A 5B3AA 4QXOA 4C3OB 5C32A 3ZX4A 3H13A 1FJXA 5KINB 1N8TA 1ODIA 3BDVA 1UXJA 3GN1A 2OK8A 4IY1A 4XYEA 2HDNB 3AT1A 3ZDBA 5I9LA 5DOZA 2AT1A 3O8QA 2G08A 3JARA 3DEHA 1MOPA 1T5TA 3OVMA 5FO0A 1SU6A 4GOXA 2NZUG 4RDHA 3EUFA 4LYDA 3RJZA 1U2GC 3KDSE 5AW8A 1VE6A 4BKPA 3GDFA 2DE0X 1SC9A 1QGAA 4MV8A 1OWOA 1SD5A 3V8VA 4CLRB 3KHTA 4DNXA 5IF3A 1NUAA 1IM2A 1XFDA 2XCOA 1RZVA 3CH7A 3SICE 4LKRA 1PHRA 3Q2OA 2Q45A 1CUHA 1AA9A 4QBHA 3V33A 4BE4A 5BN3A 4HAVA 2K2WA 2FEAA 3OLWA 2MSKA 5C81A 1CUCA 2J09A 4L0DA 4V24A 4CFYA 2P2CA 2JKZA 4QWWA 4U3JA 2HFKA 2PU5A 2R2AA 1EI9A 3QU5A 4DG9A 4FM9A 4D80A 1DXQA 3PA6A 2UUAB 1H4SA 4B82A 1AB5A 2VTDA 3KSUA 3CG4A 3QH4A 4X6UA 2VCEA 3UMBA 3TTUA 4OLAA 3UMRA 1ZAYA 1EG7A 3F5FA 3HU2A 1USWA 2GVZC 3K9QO 4D1YA 1H1LB 3LF2A 2H08A 1UMBA 2C29D 2X0JA 4Q6WA 1STOA 3L9WA 4RZ2A 1CF9A 4IIBA 1IWPB 4ASUD 5AUQA 4QQKA 4BNJA 3A4TA 1JHAA 5BQ5A 3AEYA 4C08A 4XASA 1RLOA 4ALNA 3NV9A 2ORYA 1O89A 2R6DA 4KO8A 4ZGGA 1P5RA 1WSDA 5DHRA 2RGNA 4EENA 2V1UA 1AB6A 4YTEA 1XP8A 1XVTA 1L5SA 1G9XA 4CMCA 4QGAA 3IV9A 5ERGB 5JI3E 5GINE 2QA5A 3KALA 4CKZA 4QPZA 2WHPA 3KJEA 4UBJA 2Q5CA 1CNMA 2VHWA 4IJ5A 3CXUA 3K6SB 4RVSA 3S28A 3U40A 3S6JA 2R8PA 5EHGA 2NXNA 3N70A 1O94D 1K7SN 4J4BA 3IAUA 4YRRA 1CJBA 3O4FA 4HGZA 2HMYB 2ORIA 3LWZA 4YIKA 1ZBQA 3PTLA 3E2IA 4R1SA 5EIEA 3KYCA 4JEMA 1I1OA 1RFGE 2FV8A 2YJ3A 1U90A 3RRJA 1W5EA 2ONKA 2JL1A 1TQ2A 3EYAA 1PYGA 1N2OA 2JG3A 1M8KA 4QQFA 3UTDA 3OQVA 4QNRA 3PFCA 3RGWS 3EX7C 1JV2B 1UINA 1XTJA 1VYVA 1A69A 2KMLA 2A2ZA 2ZJ0A 3OEHD 3R3WA 5FL7A 1E20A 2NU8A 4LKOA 3PUZA 3DOUA 5CA1B 2YC4C 3X2SA 1A7UA 3EG9A 2J9FA 4GZ5A 3MD9A 2OLKA 4ZYUA 3K96A 3I8XA 1UK9A 1U3VA 2ZJ8A 4XWYA 1K4MA 1RC0A 1QQ5A 2D2VA 4J1SA 3BSYA 1UMKA 3UFXB 3WMWA 2OCGA 5CRIA 4CODB 3LHDA 3A9SA 4DZTA 3FHOA 3NS7A 1Z4LA 4URZR 1G3QA 2ZOSA 3R6GA 3FMGA 4DNPA 3PD1A 2WFMA 3JD1A 5ALPA 2YQ5A 4U2KA 3ZLBA 4BNLA 1H4QA 2DHQA 1WDTA 5G0WA 1X74A 1NIJA 3DKRA 4U2EA 4RK1A 4LHVA 4G1FA 1GGMA 4I1VA 3M5DA 1EVKA 5A6VA 5G41A 2GPAA 3H5AA 2PUGA 4R54A 1NXSA 3A0UA 1WKBA 2QAGB 4ZICA 1TLLA 3T3HA 4E6PA 1OLXB 3G0HA 2HCJB 3KQWA 3R7WB 5MF6A 4P0PB 3CF6R 5CVJA 4MRPA 3WL6A 1NQWA 1H3FA 1FUIA 1IPHA 1T4CB 2XE8A 4ZDIA 1JFTA 3B52X 3K8OE 1XBTA 4LDPA 5AM1A 3QPUA 1BIFA 1C50A 4GWKA 4CKEA 4NU5A 3IP9A 3RQSA 3TR6A 1XXHE 5JALA 4J0KA 2P9GA 2TYSB 4FQ8A 3FYHA 4BZXA 4XD2A 1XTIA 3NQ41 2IY9A 4MA5A 3WLHA 1TA4A 1GFZA 2PZ8A 1PEKE 3NHSA 3SLRA 3BD7A 4JFRA 1O5TA 2HZ7A 3WK9A 4U7PB 1U2QA 2Q9BA 3EGXB 4RIFA 1P2BA 3U4HA 1GPLA 1MB9A 2WUEA 1JR3E 3CGGA 4A36A 1R16A 2BLLA 1QZTA 2QRVB 2E21A 1M7HA 3BBPA 5G3ZA 1KYYA 1W4BA 3B9BA 5CT5A 3STTA 3BREA 3SXPA 4OQ4A 3ZOKA 3ZVRA 3LH5A 3IKJA 4TXNA 5HKAA 1TTTA 2DEUA 1B8UA 2BEWA 3CG0A 3KAQA 4QJ4A 4UDXX 3E27A 3SZ3A 3ROQA 1W6RA 1ND5A 3VR2A 1EP3B 1PQPA 3GLIE 1U9CA 4DV4B 2CHEA 1FK8A 1OBHA 1VFPA 2WMDA 3GNLA 1G8FA 2NQ2C 2QZ9A 3S4YA 1ZIXA 3IAHA 3UATA 3HG7A 1J1IA 2H57A 2LWIA 2NU8B 4EJFA 5FH9A 2HQRA 1C7QA 5F4ZA 3DEKA 2W2TA 1QMPA 1RQ7A 6AT1A 2QJRA 4DGSA 2ODNA 3D1JA 1QHHB 3HZZA 2V7UA 3LT0A 3QF4A 4DLLA 2XMQA 3HZOA 1M1XB 1CY6A 2GAIA 3W5DA