5HBRA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
464
structure length
464
Chain Sequence
MNDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
total genus 170
structure length 464
sequence length 464
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5hbrA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hbrA01
5DBGA 3JQFA 3PLRA 1ZKMA 2I5PO 1T4BA 3GK3A 3PHLA 3NT4A 1F14A 4P4LA 1ENZA 2J5RA 3GEDA 2VZ9A 4J1NA 1DHRA 3RWBA 1R0SA 2Q1SA 5AXCA 1H2BA 4CLOA 2P2SA 3E1KA 3K5PA 1IZ0A 3GC6A 4WGGA 2AXQA 1LRKA 1X13A 1NP3A 3H9JA 4AG3A 5U1PA 4J43A 5A1TA 4TSKA 4BS9A 2BRUA 4GMFA 4EDFA 4K6FA 1E7MA 3F3SA 5JDCC 3MJ4A 5I7EA 3LT0A 1ZK1A 4KTVE 4XB2A 3GA0A 1B16A 3T7EA 1YL5A 4HFNA 1N7HA 5KJFA 2EGGA 2VHYA 2DTXA 4A5OA 1SCUA 1IY8A 2GYYA 1K6JA 1ZK4A 5CPFA 3OIDA 1LSJA 2EKQA 1BXGB 1EMDA 3RC9A 4D3DA 2PTGA 3CXRA 3DBHB 4A26A 1LLUA 5IN4A 3L07A 1I3NA 3GVPA 1C1DB 4XQGA 5EPOA 3PEFA 2X4GA 3D5QA 4FDAA 3QA9A 4B3JA 4LCEA 1SMKA 4BO9A 2FPGA 2WD7B 2NTNA 1TVEA 3HUDA 2JKVA 4RGBA 4CQLB 3WJAA 4DIFA 1E1MA 2YV2A 5CPBA 3DXFA 4GPD1 1NR7A 4Y9DA 3RSHA 4J3FA 1H9AA 3U4IA 5TJHA 1MFZA 2IODA 4OIMA 4R68A 3DEYX 4YWJA 5IDWA 4TVBA 1PX0A 4RPJA 1U4SA 4CMEC 3B20A 1U2GA 1XHLA 1ZK3A 4YXFA 1DRVA 4C7JA 2VZ0A 4H16A 3F47A 3FRJA 2NVWA 1XU7A 5TIIA 5KWEA 2NU8A 4IS3A 3G79A 2EXXA 2Q50A 4OSOA 1PJ2A 3OJ0A 2IZ1A 3DZFA 2HU2A 1B8UA 2IYOA 4EJ6A 5G0TA 4H3VA 3ONFA 4YA6A 1BVRA 4PG4A 5IZ4A 2PR2A 3JYPA 3DHYA 4BGVA 2IXBA 4GL4A 4BNMA 4XWYA 5FWNA 4BV9A 3GN2A 4EGFA 1Q0LA 3FPLA 3BMOB 1KC1A 3BMNA 1EQ2A 3ZNOA 1WWKA 4ND1A 2SCUA 3MWDB 4P8RA 2HUNA 2PFGA 2ZTVA 3COSA 3QLJA 2HDHA 4MKXA 1WMAA 3H7AA 1BTOA 4E30A 3VH3A 1HKUA 1KEUA 2HLPA 1LSUA 1PS8A 4NFYA 4QX6A 1ZK0A 3JQ9C 2NQ8A 5DOVA 4E12A 4G65A 4NJMA 2Y0EA 5L7YA 3NAQA 2VHXA 1YXMA 5TRTA 1PJCA 3JQFC 1AN9A 1ZFNA 3NDRA 3RU7A 3WLEA 3WGQA 4P4GA 3H3JA 1UZNA 2B4RO 3QQPA 4IUYA 2WYUA 3DBLA 4Q3DA 3JD0A 4CV3A 3TFQA 2I6TA 2JCVA 4RQTA 2Y99A 4RORA 4ND2A 3K31A 3W6UA 2WJPA 5EIOA 4W7HA 1FF9A 4EEXA 2NTJA 3LZ6A 3ZWOA 5KOIA 1GYRA 2YZ7A 4YAGA 4UUMA 1P31A 2XPCA 1PJBA 4JBHA 4QFDA 1PZFA 8ADHA 1UXIA 1RM4A 1UXKA 1LI4A 3GAFA 4NHEA 2NU9B 5AQ1A 2LDXA 3WSVA 3NTRA 1LSSA 1I3KA 5HWSA 1A9YA 4CMHA 2BF7A 1ENYA 3GFGA 1XLTA 2ZB8A 3HG7A 1N92A 1SEPA 4BB5A 3JQCA 1F17A 2VTEA 2GPTA 4J9UE 3ZNNA 1J5PA 1E3WA 4J7XA 3HQ4O 3PHJA 3NX4A 4JQCA 3DO5A 1FDWA 3H8VA 4WCFA 4DMMA 1X7HA 1W4ZA 4MIOA 5BNIA 1C0KA 5JBIA 4NBTA 1HDOA 4RVUA 3H4VA 3UVEA 4YRDA 2DUWA 2QZ9A 3HADA 4WK6A 3GMDA 2CUKA 5B4VA 2RHRA 4Y67A 1FK8A 1GYQA 2FR8A 3GRPA 3H9QA 4MVJM 3DHNA 2WYWA 3E18A 2JL1A 2F1KA 4RVSA 4B8WA 5I7SA 3TL2A 2CVOA 2D5CA 1KY4A 1M66A 3GGPA 4G5HA 1O8CA 4Q3EA 3RASA 2EV9A 1UR5A 3H3FA 4R1NA 3FCOA 4NNJA 3H2ZA 1ISHA 1E0DA 1V3UA 4U5QA 1U3WA 2GASA 2OFPA 1WDKA 1GL3A 4IJWA 3T4XA 4YYZA 1IUKA 3PWKA 3WGHA 2GDZA 5ICMA 1GU7A 1E7RA 4IS2A 1Q7CA 3OIGA 7MDHA 4PN3A 1Q2XA 1MGOA 3IDSA 1G0OA 3K96A 2OO5A 4NFHA 4R16A 4BNYA 4NJOA 1F8FA 4D0SA 4YRBA 4R41A 4PLYA 5BR7A 5ENVA 4DA9A 1E7WA 4LMPA 5DCYA 4ZRNA 3ETEA 4CLXA 1KVUA 1IB6A 5KJ1A 5DULA 2PZLA 1O6ZA 2F00A 3DMTC 2WSBA 1X0VA 3RUAA 3F5SA 3E82A 4CQMD 2VHVA 1UAGA 3M1AA 4D3FA 3IKTA 3VKVA 2CMDA 1VSUA 2DKNA 1UZLA 3KETA 5IDXA 4BO1A 1FJHA 4YCAA 3WYBA 4XRGA 4ALKA 1QYVA 4AJHA 1T26A 1HE4A 1KY5A 4CM4A 1SB8A 3ANNA 1U7TA 3LYLA 3R6DA 3HFSA 4FFRA 2OZPA 2JHGA 3GEMA 4KUGA 2PD4A 2YQ4A 5TNXA 2J3IA 5T64A 2FN7A 3JQ8B 5IDYA 4CLHA 7ADHA 4ZJUA 5TGDA 1QYCA 1GQQA 1U3VA 3C1OA 4AJOA 4XZ3A 1EUCB 2FZEA 3FSRA 4L4RA 4E2ZA 4EITA 4W9NC 4U6SA 3NTOA 1UDBA 5KJ6A 2AA3A 4LVCA 1D3AA 1HDGO 2PGDA 1NQAO 4JIGA 3K9QO 3PGXA 4P38A 1QV6A 3EW7A 1ZW1A 1P33A 4J49A 4CJXA 2X0JA 4BNFA 4TZKA 4RF4A 2A9FA 2O2YA 1PGPA 3TL3A 2JD1A 3GDOA 3JV7A 4KTTE 3IL2A 2QHXA 1GQYA 1LDEA 1ONPA 2CDCA 1LTHR 2EHDA 3DAGA 1WDLA 5DP1A 2HQ1A 4FJ0A 4HNGA 4M86A 1HZJA 2VYND 3GGOA 5F1OA 5JLAA 2VQ3A 3ZHYA 4IQ0A 3I6QA 1T2DA 5JE8A 3GZNA 1VL6A 4BNNA 4YJFA 3LVFO 4ZGWA 1BDBA 4GLLA 2Y93A 3VZSA 4B7XA 3K73O 4FC6A 2FSSA 4WCFC 3NJ4A 4I5EA 2C5AA 3IIEA 3PZRA 5HTOA 3OF2A 1A72A 1ZK2A 2NM0A 3OEWA 3BMQA 2ZK7A 5AXAA 3WBBA 1KC3A 1CQJA 5A3JA 3HDYA 2ZYDA 4TKLA 4JP2A 2GF2A 4I5GA 5THKA 4KDEA 2E49A 1QYWA 1D7OA 3O4RA 4MKRA 1LU9A 1ISFA 2OL4A 3SXPA 1DIGA 1EBFA 4CMIA 1P74A 1JLLB 1J0XO 3D3EA 1B8VA 3OQ6A 3KLMX 2NVUA 2CDAA 5DCWA 1R4MA 3U4DA 2Y1GA 3VOSA 1EE9A 1PJQA 2VHZA 3DFZA 1GZ6A 2ZIZA 1PWXA 3AI2A 3R3JA 3ROPA 5L4LA 3E9MA 2YUTA 1R66A 4E5NA 1NNUA 2EEZA 2OBYA 3I9KA 4QECA 4E0BA 1XIVA 4PZCA 2W98A 2HMSA 3ZHBA 4Y6PA 1EBUA 4IDGA 4DIBA 4BKQA 1XGKA 2O3UA 1K5HA 5KIAA 1V0JA 3EY4A 3ICCA 4HFMA 4E5PA 2I3GA 1H6DA 2QRKA 2PZMA 3MEQA 4ZD6A 3WWZA 4RQUA 3CINA 5L4SA 1Z74A 3B6ZA 2FPIA 2B4TO 4XYBA 3DC2A 5ICSA 1X14A 3MZ0A 4CQMA 2UUPA 1NPYA 3RUIA 3OFSA 1YL6A 4BQRA 3AJRA 1U2DA 4JN6B 4ILKA 4JX8A 4PG8A 1DFHA 1DRWA 4AICA 3ZWAA 4BO5A 1QRRA 4UUPA 2B36A 4K1LA 4MIEA 5EQDA 1XEAA 3RC7A 3WDSA 1Y8QA 4KZPA 5COAA 1O0SA 2QYTA 3AUSA 3VC7A 4IGEA 4PVCA 4R3WA 3PPIA 5B12A 1P0CA 3RUCA 1ISIA 3H5NA 2RHCA 5JMWA 4J1TA 3S55A 2D2IA 4AL4A 3H2SA 4NU5A 4BHTA 2QX7A 3JYNA 3DOJA 4CM8B 5F3RA 2YQ5A 4CODB 5I9LA 1E3EA 3OHSX 4NZ9A 4IJVA 2PGLA 3CE6A 3SVTA 1PGOA 4L73A 1W8DA 2Q1WA 2Z5LA 3LT1A 2PKQO 4RV9A 4TROA 2HK9A 1PS9A 1Y5MA 3IOYA 4DPKA 4TRNA 4ITUA 1VL0A 2O48X 2GZ3A 5LDHA 4HX5A 4WUVA 4DPMA 2X8LA 1ONOA 1H94A 4PLVA 2EP7A 5HS4A 3L9WA 3PK0A 2VYNA 2BKAA 4ALJA 1DXYA 2FZWA 3PFWO 2DTEA 1PJLA 2JAPA 4P22A 3ZZNA 3DFUA 3BTOA 3GNQA 3RQSA 4N5NA 3JQAD 4JJFA 5A06A 2IDZA 5TX7A 4BO4A 5KJEA 3ULKA 3DZBA 5BQFA 1D1TA 3F1KA 1PR9A 4L4XA 1QSGA 1YVEI 1C14A 4RZIA 5G4KA 4ZHSA 2NUAA 3WGGA 2AQ8A 1Y81A 4IJUA 2O3SA 3H5AA 3HWRA 1NHGA 2TMDA 1MC4A 4B7UA 2X5KO 1GR0A 2Y67A 3RCBA 4CV2A 1OMOA 4PLPA 3RKUA 1EVIA 4M8SA 3OA0A 1HYEA 1IZ9A 1T25A 2H9IA 4JK3A 1I2ZA 5ER9A 4HNHA 1U5AA 1CWUA 5L45A 3UFXA 4CM6A 1LDBA 3DHEA 2HSDA 4BGEA 1WLYA 2AE1A 2CF5A 2C82A 3O03A 3O9ZA 3DBVO 1ZBQA 4B7CA 1ONNA 1BSVA 4R01A 2CD9A 3V2GA 4J2HA 3ANLA 1EZ4A 3PQDA 3IKVA 4D44A 2QRJA 4NBWA 1E3SA 1FMCA 1BW9A 3AUTA 4D46A 5BSEA 2A92A 3I9OA 3SLGA 3WWYA 2O3RA 4ZICA 1DSSG 3EZLA 3WGYA 1Z7BA 1UZMA 4MVJH 3ASVA 2JFGA 3BMCA 4Q3AA 3RBZA 4XB1A 1GTMA 2ILTA 5JCJD 1HDZA 3ZWVA 1U28A 2VUUA 4FPXA 1CJCA 3ANMA 2Y1EA 1V3VA 4R3NA 5BSHA 3U5TA 4IIVA 1SZJG 1JKJA 3JTMA 2P91A 1Y9EA 3INRA 2NU6A 2QQ5A 2P68A 3E03A 4AJLA 2CZCA 4Z6KA 4YTEA 2PNFA 4BOYA 4GWKA 5JMPA 1RPNA 4RL6A 1ZUD1 4XD2A 4JBGA 5C5IA 4XQCA 5B1YA 1SC6A 1PL8A 3I9LA 2I3AA 5L53A 3GEGA 3D3WB 2DBVO 2UYYA 4WECA 1YKFA 3A4VA 4F46A 3PDUA 3GN1A 4DLAA 2J5QA 4CMEA 2GLXA 4J7UA 4YJHA 4II3A 1YWGO 1H6AA 1A4IA 4MVJE 4WEQA 1VE9A 3LT4A 4IGFA 4MO2A 4Z3DA 2GGSA 3N74A 5FFFA 3ZWBA 4PFJA 1DJNA 1XA0A 1J6UA 4OXNA 5CDUA 4UEOA 1DC4A 1U8FO 4IBOA 1E1LA 3QVWA 2AG5A 3A9WA 2HJRA 4NR0A 1HE3A 4OMUA 2PLAA 3V5NA 5FYDA 1I30A 4L76A 4NU6A 3VPFA 4WNIA 1GZ3A 3VPGA 3HNPA 4A03A 3ZWCA 3ZW8A 3K30A 2O3QA 3H9EO 3KEOA 2UUOA 4RPKA 3JD2A 1BGVA 2DU8A 3GPIA 2NADA 2V6FA 3JQAA 1HE5A 3WB9A 1ADGA 5CG1A 1PS0A 1W0CA 1U7HA 3PVZA 4Z9YA 1NQOA 4NI5A 1N5DA 4RVDA 4DQUA 3FNGA 4I5DA 1AGNA 4UVEA 1MP0A 1HE2A 1YRLA 3G1TA 2OGUA 3Q0EA 2FP4B 4PZDA 5DF1A 3WTCA 2YJZA 2POQX 3E5MA 3JQ9A 1YBMA 2X23A 3TZKA 3EZYA 4MVJG 4Z0HO 2B0JA 1YQDA 5JS6A 4YACA 1KOLA 3ADPA 2EGHA 1E6EA 2TMGA 4KUHA 4YAIA 1T2CA 3FHLA 3JQ7B 4YJGB 4AJ4A 4DWVA 4XX0A 3VZRA 4R1SA 1BRMA 2PH5A 4OH1A 3OP4A 2X9NA 9LDBA 1P1HA 1BXZA 5EL0A 1MC5A 1Q1NA 2AW5A 1M76A 1RM5A 1TXGA 2VUTA 3DZJA 3PLNA 1OZAA 1P9LA 4GVLA 5CEJA 5BNFA 4ZU3A 4D0RA 4L9RA 4HWKA 3AWDA 3HSKA 5IZCA 2HK8A 2GNAA 3DBRA 4OHUA 2HJSA 4DYDA 3C85A 4S3MA 1DIAA 2HRZA 4ZQHA 4NH4A 4LSWA 2B5VA 1TT5B 3FTPA 1I2CA 5A5FA 5MGBA 3NEPX 4L75A 3R1IA 4Q39A 2GERA 5I7VA 4MIYA 2B35A 4CUJA 1U3TA 2WWRA 1R4NB 1RYDA 2EW8A 3FR8A 3MCVA 5JCJA 4MP8A 1XG5A 2C7VA 2BGKA 3QSGA 1GFSA 3JQDA 1ZSYA 2FPPB 2QYSA 3GH3A 3UGKA 2GZ1A 3F1LA 3TDKA 4G2NA 4ESOA 1K0UA 4I8XA 1TA4A 5L40A 4GQAA 2OBNA 3V1TC 4OM8A 1PQWA 4KUEA 2H6EA 1B15A 1NBOA 4FJ1A 3H65A 4D41A 3ADOA 4BKUA 2DQ4A 3KZVA 3GMSA 1BXGA 1I5RA 4M49A 3DBHA 4IZIA 4LSMA 4R5MA 1DIHA 4PRKA 1K2WA 4CR8A 4NBRA 3SX2A 1ZJZA 4D45A 1C1DA 4DC0A 3E8XA 2BMAA 1L7DA 2B83A 2FRDA 3D4OA 3KSDO 3G0OA 4BB6A 4WLFA 5KVVA 2WD7A 4BV8A 4LISA 1CRWG 4XGNA 4CV1A 2WD8A 4WASA 3K2EA 2CDBA 4KP7A 3OJOA 4N7RA 1I2BA 1DLIA 3PFFA 4M1QA 3GDFA 2FWMX 4CM3A 2Q2VA 3VTZA 4DVJA 2GR9A 3ETGA 3MJSA 3G17A 1P45A 4GWGA 3VH1A 2NU7B 2C07A 2E48A 1LLQA 1HZZA 4WE3A 2A4KA 4I5FA 2OHXA 4QFCA 2YW9A 3HB4X 4M54A 1EEHA 1I3MA 1YOVB 1ARZA 1FDSA 1JW9B 4BNGA 1T1SA 2NU8B 4N5LA 1QORA 2AEFA 2HRBA 4GI2A 2X22A 4XJTA 3H9UA 3ZU5A 4RZHA 1XDWA 2OUIA 3IQDB 4UUNA 4CUZA 1U9JA 1CYDA 3QWHA 3ZU2A 3DR3A 4DUPA 1DC3A 5L95A 3UOGA 1SO8A 4OL9A 3DB2A 4J91A 4WJZA 1ZEMA 1UP6A 1GV1A 3L77A 3L9XA 2R6JA 3DMTA 4J7CA 1GCUA 3BMOA 1OI7A 2J8ZA 1MG5A 3MWDA 1ZCJA 2BFOA 4K26A 1N7GA 2CY0A 3JQ6A 3GVIA 3TOZA 1NQTA 3S8MA 5CEEA 1BXKA 2D8AA 2PGJA 5B37A 4J2OA 1VJ1A 3D5TA 1EVYA 3ZGYA 3ZU3A 3PJGA 4Z0PA 4AJEA 4E13A 3P2OA 4C4OA 1H0KA 4IXWA 1KYQA 5L3ZA 4BL5A 2X9GA 4N18A 3MOGA 2EIHA 1F0YA 5AOVA 1TB4A 4FFLA 1YE3A 5A9SA 4XA8A 1IHYA 3P7MA 1WNTA 3DZKA 3KM0A 2Q3EA 4FD3A 3W8EA 1YDWA 5IZCC 2C7GA 3E9NA 4K9DA 3V1YA 1M2WA 4W9NA 5DBIA 1NVTA 4XEHA 1M75A 3SLKA 1JVSA 1LA2A 4FBGA 2IRWA 5GZ1A 2YY7A 1RYEA 3IP3A 4LRTB 2UAGA 5F1KA 4EEZA 3VVBA 5C7LO 3V2HA 4URFA 2Y1OA 3FPCA 4YPOA 4AFNA 3R3SA 1TT7A 3GDGA 3WNVA 2NWQA 1AXEA 2C20A 3AUUA 4XR4A 2X5JO 2HMVA 3WTBA 3NJ8A 1QV7A 4PLFA 4L0QA 4KWHA 3WICA 4CLEA 4JGBA 3N58A 3OMLA 1W6UA 2CNBA 3DTTA 2QG4A 1ZIDA 1ZXBA 1YQGA 3P19A 4XGKA 3RVDA 4PLWA 5JYEA 2DPGA 3ROQA 2WYVA 2X1HA 4AJIA 3K6JA 1D1SA 2DBZA 3WYCA 3L4BA 2Q1TA 2VTDA 1GUZA 3KSZO 2NNLD 4LCJA 3DWFA 3OIFA 3AM5A 1DEHA 5I9NA 1FDVA 1DC5A 2EJWA 1XSEA 1UUFA 4XYEA 4AJ1A 4E3ZA 3IS3A 4TQGA 2DLDA 1A9ZA 1NHWA 2EF1A 1EFLA 1LDYA 1PJ3A 4KOAA 2GZ2A 1Y8RB 3CEAA 4WKGA 1K6XA 3TOXA 2PA3A 5G2OA 1P1FA 2A35A 1LJ8A 4YT5A 4MVJF 1A27A 4Y98A 1UH5A 3SC4A 4IXTA 1C0PA 3KLPX 1CERA 3JYQA 3DOOA 2YV1A 2AEJA 4E5MA 3WS7A 1E92A 3DAFA 1ISJA 1ZVMA 4WPGA 3B70A 2PZJA 1ADBA 3TSCA 3U9LA 3D7LA 3ETDA 2C29D 2BLLA 4AVYA 5GMOA 2Q4BA 3RFTA 4QO8A 2WMDA 4ALIA 3Q6IA 4KQXA 4O5OA 1H2HA 2G1UA 1M67A 2RAFA 2Q1UA 1PL6A 1VM6A 1B8PA 4O59O 1JAYA 4CM1A 5JPIA 1S6YA 4OO3A 4QQRA 3VTFA 4FSHA 3TZQA 5JDIA 2X0RA 2WE7A 3BTSA 4E2WA 1A4UA 1YO6A 3WGOA 3WXBA 1V3TA 2OP1A 8LDHA 1WPQA 1JDJA 1I24A 3AI1A 1PIWA 5IN5A 4IMRA 4JP3A 1EUDB 1AHIA 4NDNE 3Q2IA 1ZXLA 3DTYA 1ISMA 3OQ1A 2BI8A 2VUSA 4R5HA 3X2EA 4DRYA 1E6WA 1NTOA 3WJ7A 3HB5X 2Z95A 3V1UA 3ZV6A 4OKIA 3C8MA 5MDHA 4J90A 3DZIA 4E5KA 4QXMA 5A5EA 4PZEA 4PG6A 3U09A 1Q7BA 4GAEA 3GUYA 2DFDA 2VWPA 3WIDA 2ZJ0A 4CM4B 1DLJA 1RWBA 4CMKA 2YYYA 3QRWA 2X6TA 1IPEA 2AG8A 2H63A 2X86A 1EDZA 3JQ8A 4ZRMA 1UDAA 1EUCA 4O1MA 1HT0A 1B26A 4BO6A 1OAAA 4DIOA 3KB6A 3ZWYA 2H5LA 2JHFA 3INTA 4TRMA 1DPGA 1R0KA 4DGSA 5H81A 4WNCA 4MKZA 1QR6A 4PG5A 1DB3A 3I9JA 4FR5A 1AHHA 1O94A 2YDXA 4UVIA 5L9AA 5GZ6A 2C2YA 1J49A 4E31A 1Z6ZA 1YJ8A 2XOXA 3W6ZA 5DN9A 2G0TA 1DIBA 3BTUA 3D0OA 4RVHA 5A4DA 3GQVA 5F5LA 4PGFA 3ZI0A 2Y1DA 1E7QA 3LLVA 2D4AA 4XIJA 1XWFA 1YB1A 2ZQYA 1QLHA 3C7AA 4KMSA 4MVJI 3L4BC 1JN0A 4RVFA 4Y6SA 5C7OO 1YDEA 2WEKA 2AQHA 4IZHA 3QVSA 2X0IA 4NBUA 4J4BA 4R1UA 1LSOA 1HXHA 1MB4A 1E7SA 1H9BA 1RKXA 3WOHA 2FOIA 2P4QA 3BMQB 1P1JA 3O8QB 2ET6A 3OECA 1SBYA 5IAAA 5G0WA 1HTBA 2AMFA 4TWRA 2XF8A 3WGZA 4DTIA 2BFMA 5JO0A 4GX1A 5HS6A 2FMUA 1G0NA 1MA0A 1PJ4A 5F21A 3R0IA 4NQZA 1YB4A 1JWBB 3ROKA 4LVUA 3UXYA 3VPXA 5K9ZA 2Z1MA 1JLLA 4WEOA 4RDHA 2W2LD 5T8KA 5JXWA 5C37A 4RPHA 3MJTA 1V9LA 2NV6A 4IPTA 2FR1A 1PZHA 4OXKA 3KYDB 5EERA 1WMBA 4BKRA 3U62A 4E5YA 1WW8A 2GN4A 4J6FA 3KVOA 3PYXA 1XKQA 4EZBA 3X2FA 3RFVA 5DOZA 2XAAA 3WMXA 5TT0A 5A9RA 3UH1A 2V65A 1WVGA 5JC1A 3JQBA 4Z9FA 1Z73A 3ZWMA 5JDIC 3GOHA 1JTVA 3U49A 3WMWA 2OP0A 4AJJA 3DAPA 4YBZA 4IDCA 4YT2A 4EUEA 2DBRA 4WOJA 4YQZA 4CLRB 3UN1A 4BQPA 4MPDA 1KETA 4S1VA 1IE3A 3KTDA 4XDYA 4Z9XA 3KYCB 1GEEA 2Q2QA 2ZTUA 1Y7TA 5A04A 4U7WA 4CL8A 3RROA 1PR3A 3JD3A 3C7DB 1ADFA 2HKIA 1QYXA 3D1LA 3KOUA 1P3DA 4M55A 4O0LA 1ZMOA 5BSFA 1PGNA 2X5OA 1VKNA 2DPHA 1N9GB 1YS4A 5DDIP 5I8WA 3NGXA 3PHIA 4Z3KA 3HFGA 3U4CA 1SPXA 3ON5A 4JLWA 5KKAA 4BNHA 4OJNA 2IZ0A 1KVTA 3EAGA 3LF2A 4R4JA 3ZU4A 1MXFA 2YHIB 3GHYA 4LGVA 4XR9A 5EMHA 5TT1A 2V7PA 3W4JA 4PLZA 4E2XA 2JD2A 1GAEO 1B0AA 2IEBA 3PRJA 3RI3A 1E5QA 1LLCA 3VH2A 3OJEA 3ZH2A 4HFJA 3O38A 2W8ZA 4IDBA 1JKFA 1K89A 4ALLA 3ORFA 4M87A 2Z1NA 3AY6A 5HA5A 5KTKA 1PU2A 4XQ9A 3W4IA 1QMGA 5ILOA 3QE3A 4ONEA 5KCZA 1ZEJA 1WZEA 4MVJD 3O26A 1X7GA 1C0IA 3DOCA 3EMKA 1Z75A 1O5IA 3HDHA 1T2AA 3WIEA 4FIZA 2Q4EA 2CFCA 4IMPA 3KUXA 3LT2A 1VLLA 4BVAA 3RD5A 4TRRA 4GVXA 4A2CA 3RFXA 1I0ZA 1LRLA 1AE1A 4CMJA 1X7DA 2LDBA 1LEHA 1CQIB 3OJFA 1HSZA 2I65A 3A14A 3FD8A 4WLEA 4GX0A 1GD1O 2CF6A 3GVXA 3ASUA 2QRLA 1KBZA 3RUFA 2DC1A 5ES3A 4R69A 4DXHA 2IE0A 3I52A 4IQGA 3KO8A 3JQGB 3UCXA 1A7KA 1GZ4A 3S1LA 3T7CA 5I7FA 4NK4A 5A9TA 1NVGA 2YHUA 3I1JA 3QVTA 3IUSA 1SOWA 3BAZA 1RM0A 1KVSA 4F6CA 1LDNA 3WR5A 3BXXA 4I08A 1XU9A 3Q2KA 3WFIA 3BHJA 1C0LA 2DAPA 3RC2A 4B4OA 4OXYA 1T2EA 2W2LA 1NM5A 2EJVA 3KXDA 5KVQA 3RJ5A 5T8KC 1GY8A 2VZ8A 1UXHA 2RCYA 1TI7A 4WLUA 5DBFA 3PYMA 1ZSNA 4ZVVA 3UCEA 1E77A 1V35A 4B3HA 1T2FA 3CKYA 2PK3A 1JU9A 3PIIA 3PJEA 3QWBA 4IIUA 5AVOA 4YVFA 1KS9A 1ISGA 3GY0A 1IOLA 3ZWNA 2W90A 3LC1O 2W2KA 3CUKA 3JQBC 1HLPA 4GLOA 4J0EA 4BO8A 5JY6A 1EVJA 4BNTA 3UUWA 1ZH8A 1I33A 1ZMTA 1EFKA 2DTDA 3RUHA 3BMCB 4YAEA 1MX3A 1Z7EA 4XDZA 4DREA 4E21A 2BH9A 3B1FA 3JQEA 4FOSA 4BIIA 3I9NA 3EVTA 9LDTA 4NFSA 3M2TA 1DFGA 2ZTMA 4GH5A 1PL7A 4UVHA 4B3IA 2VWHA 4JBIA 4PVDA 3WLFA 1R16A 5T6BA 4G81A 1JKIA 1DC6A 2AEMA 4RDIA 2O7SA 4FFOA 1NQ5A 1ADCA 3OICA 3TZHA 1UAYA 2ZB4A 1E1KA 3Q3CA 3MWEB 3U3XA 1T24A 3D3WA 4B4UA 2VN8A 2NSDA 5EESA 3IC5A 4E4YA 2ZATA 1HWYA 4YQYA 4MDHA 3NGLA 1M6WA 1ENPA 3FBGA 3PYLA 3GVCA 5I9MA 3VPSA 3C3XA 1N8KA 1V8BA 3CZRA 3LQFA 3AU8A 3CIFA 4RLHA 3ZW9A 5HM8A 4QSMA 4FQ8A 5IFLA 3HHPA 3VDRA 3OBBA 4OYRA 4MVJA 1WZIA 2W4QA 2ZCUA 3WYEA 2IZZA 4DPLA 1XQ6A 4H15A 3LLSA 4MOWA 4ND5A 1KEWA 4KQWA 2EERA 1DOHA 4L74A 1KVQA 2H1SA 1H6BA 1U8XX 1AUPA 2VHWA 5DT9A 1QXSA 4GSKA 3W8DA 2QZZA 5CAEA 4UVGA 4LN1A 5KJCA 2E4AA 1C1XB 1NAHA 3TWOA 4XCVA 5JAIA 1EQUA 1UJMA 1Z82A 3DQPA 4MP3A 2C54A 2R2GA 2GN8A 1NPTO 4X54A 1NPDA 4GBJA 4Y8VA 4IDEA 1JAXA 2UV8A 3I9MA 4HKTA 3KEQA 4TVOA 1DO8A 4LK3A 2D0IA 3AK4A 2G5CA 4CPDA 4UAGA 4E2YA 4PRLA 3FNEA 5JC8A 2FR0A 2JAHA 4DLLA 3JQ7A 4KDFA 3WGIA 3EK2A 3F5QA 5CDSA 4W7IA 3RUDA 2OOSA 1AXGA 3D64A 1OC2A 1SNYA 5K6AC 2P5YA 3D4NA 1IYZA 1UP4A 4KWIA 4NBVA 5KKCA 4ROSA 5G0SA 2AQIA 3GF4A 1Y1PA 4CLOB 5I8ZA 2WM3A 1GV0A 3DBRB 3PZBA 5JFOA 1P1RA 4BNXA 3G3EA 1GYPA 2RBEA 1VJ0A 4FJ2A 1T1RA 4A27A 2CVZA 3NTQA 3A1NA 3K92A 4UEJA 4W6ZA 4XYLA 1TT5A 2ZJ1A 4YDRA 5L7TA 1JA9A 3G49A 3ICPA 1B7GO 3VDQA 4MP6A 3VZPA 3ZV5A 1SEVA 1GPJA 1JWAB 1R4NA 2NTVA 4B4WA 4BO3A 1NR1A 5TQVA 3I6IA 3B1JA 4J1QA 4TZTA 5KNLA 4ZQBA 2J3KA 2FPPA 1SCUB 1GPDG 2A94A 3LF1A 2NLOA 1N1GA 3ROMA 2Y1FA 2BGLA 3L0DA 1VC2A 2WE8A 3L6OO 3HJAA 2WDZA 2UVDA 3TZCA 2PZKA 2Y0CA 3LDHA 1UXJA 3HN2A 1LXCA 2DUUA 4JROA 1O95A 5ER6A 5H82A 3SC6A 1PTJA 1NXQA 2BI7A 2FPGB 2WTBA 3IJPA 4J0FA 5EN4A 5JY1A 4CMGA 2X0NA 4CQLA 3E6AA 3M2PA 4Z0TA 3TJRA 2PD3A 5CFZA 3BA1A 3ITKA 1DHTA 4CR6A 3CPSA 3H9GA 5BSGA 1I8TA 3CMMA 1HEUA 1QLJA 1VPDA 4YEDA 5DZSA 3FF4A 1EVZA 3A28A 4FS3A 4HADA 5KVCA 3S2EA 3S2IA 3QVXA 4RLSA 4HFRA 2HO5A 1GCOA 3C1AA 5DP2A 2CVQA 4BNJA 4BNIA 1LUAA 3IUPA 2RH8A 3W8FA 2P9CA 3KHUA 4ND4A 3ZWWA 3WQRA 5CEFA 4QTZA 2B69A 2ZCVA 2AE2A 5JNLA 3TFOA 1OBFO 4DYVA 1P1KA 4U6QA 5C7IO 2IXAA 2JFHA 2B4QA 4TKMA 2NU7A 2O4UX 3HDJA 3G1UA 4B4VA 2CSUA 1YOVA 5IF3A 1ORRA 3PDJA 1CETA 1HL3A 3BTVA 3F6YA 4ZN6A 3PXXA 2ZB7A 3RAJA 1W73A 4RO0A 3D4PA 1E6UA 1LLDA 2XXJA 1G6KA 3Q9UA 3UHAA 4ALNA 5IXSA 3BMNB 2VOJA 3M1LA 5COBA 5CHEA 2SCUB 2E6UX 1HDRA 2DVMA 4TRJA 4BKPA 3GNTA 5LDGA 4BNUA 4RF3A 3DZHA 5DCUA 5BNTA 3LSYA 2GD1O 3W1VA 4BNKA 4YRAA 4NJMB 2RIRA 3CH6A 3FR7A 5A3VA 2P9GA 4HXYA 1FXSA 2HMUA 4A10A 5F5NA 2G82A 3S2GA 3FWNA 3AOEA 1B2LA 2JCXA 3JD4A 1EE2A 2YV3A 1HLDA 2Q49A 3AY3A 3NT5A 5JO9A 3DBLB 5JAQA 5A9SB 4EBFA 3Q1LA 3UW3A 4D79A 3IP1A 1Y6JA 1F12A 5C3MA 4IM7A 3PJFA 2V6GA 4R54A 4JJIA 1K3TA 1OOEA 4N54A 1JVBA 1BHSA 1MV8A 1X1TA 4JCOA 2FY8A 3RUEA 1NFRA 4CM9D 2YDYA 3EYWA 5L7WA 3WFJA 3UICA 1HRDA 1R0LA 2JJYA 4YJDA 1ID1A 4QEDA 5J23A 1EK6A 2BFAA 4OGWA 1ULSA 5TS3A 2NU9A 1RJWA 4ALMA 4BO0A 1LNQA 4RJTA 2EW2A 3PQEA 2X9VA 2EP5A 4IINA 1K6IA 3DMYA 3E9QA 1A5ZA 4YB8A 1CF2O 3VAZA 3ABIA 4UULA 2G17A 3GFBA 1E3WB 5TF4A 1EUZA 2EG9A 4IQ8A 3TPCA 1HETA 2I76A 4WCFB 1HSOA 1Y9AA 2P5UA 3M6IA 4XYGA 5ITWA 1C3VA 2PWZA 3JD1A 4RPLA 3GLQA 4FCCA 1LBEA 4R51A 1RM3A 1CIVA 1YJQA 2HAEA 1A71A 4BGUA 3LC7O 3AI3A 4U0JA 5HRUA 4WLVA 3SEFA 3OM9A 1N1EA 4GSLA 3I3OA 1WP4A 4YT8A 5CDGA 1DAPA 1PGJA 1Y8RA 1MG0A 1P0FA 4ZQGA 3UKOA 3T4EA 5G0UA 1YB5A 1SAYA 3E5RA 1B3RA 3OA2A 3QIVA 3L4SO 4LMRA 4PLHA 2E37A 1BMDA 3FTNA 1DDOA 1PGQA 3Q9NA 4ZQFA 3AFMA 3UCFA 3ZHZA 2GSDA 3CTMA 4BNWA 3GT0A 4GX5A 1TEHA 2HCTA 3RJ9A 3Q11A 4I9HA 5AYVA 1T4DA 3BYZA 3GNSA 4CL3A 3BHIA 4B79A 4EUFA 3PHHA 4HY3A 3MOIA 3FN4A 3ZCXA 1XCBA 4FGSA 1LDGA 5GZ3A 4YT4A 1B3BA 4UUOA 4AJPA 1R15A 4D3SA 3DDNA 4U8GA 5LCXA 5CG2A 1QKIA 5TJ9A 1IL0A 2DM6A 1VSVA 1EDOA 4II2A 4DL9A 1E3IA 1R12A 2R00A 2VCYA 1MUUA 4H7PA 2O4CA 4B8ZA 3RC1A 2DFVA 2UDPA 4D7AA 2VT2A 1VI2A 2JCYA 3N7UA 3OETA 5TC4A 3ZV4A 4WLNA 4Q9NA 2IYPA 2I66A 4XRRA 3DONA 3A06A 1EUDA 4DQXA 4HUJA 2O23A 2DT5A 4FFPA 3F9IA 4GKVA 5T5QA 4BMVA 3AOEC 3WQSB 5CDTA 3L6DA 2VNSA 1IPFA 4CLDA 3ST7A 2QW8A 2YFHA 3RU9A 1OC4A 4FOOA 3H5RA 3AFNA 4FGWA 1LQTA 2EKPA 2O2SA 5EJ2A 4CM7A 4JJGA 1E1NA 4XQEA 4DLBA 1VJTA 2JD0A 4MJLA 3UF0A 4ZA2A 2Q2WA 6ADHA 3WG9A 3JYOA 4WLOA 1D8AA 1F06A 2VYVD 3EHEA 4CM9A 1NVMB 4BMSA 3FI9A 1H5QA 2BGMA 1PQUA 1O9BA 3NDIA 3JYLA 3KSUA 1QP8A 2X58A 3I4FA 4U0KA 2J6IA 3PP8A 3VZQA 1V6AA 5IJZA 1U3UA 1TLTA 2O3JA 1X1EA 4IY1A 3C7CB 2E82A 2NVBA 3BZUA 1GDHA 3EC7A 1NFFA 5IG2A 1Y5RA 2Y05A 1L1FA 1L7EA 1WDMA 4IDDA 4TMFA 3IMFA 3OH8A 5B4UA 4DBZA 3GZNB 2GN9A 1E5LA 2PH3A 4J4TA 2J5KA 3ONDA 4YJFB 1LQUA 3ZWXA 3OEYA 3RKRA 1GADO 3GZ4A 5FI3A 3F46A 1PZEA 4A73A 1XYGA 3LU1A 5GY7A 1DRUA 1H6CA 1OFGA 2ZKLA 2OXIA 1KVRA 2RH4A 2V6MA 3AY7A 4M89A 3F4LA 1CQJB 4EJMA 1I10A 5CP8A 3WNQA 3I23A 3VHRA 3TF5A 1NAIA 2G76A 3MTGA 4CMBA 4BGIA 2I67A 3FBTA 4HP8A 4K6CA 3O8QA 2Y1CA 4CMIB 3STHA 4CMAA 3E48A 2P9EA 3MJEA 4P4NA 4PLGA 1J4AA 2NVUB 1R4MB 3WBFA 4EI2A 2Y66A 2VRCD 2Y0DA 4D43A 1S7CA 2B37A 4D42A 1KERA 1PQPA 1P77A 3BIOA 5BT9A 1YBAA 3PHGA 4FW8A 3WGTA 3WQQA 1DFIA 4Q3NA 4FFNA 2ZQZA 2Q45A 5A03A 3H6KA 4OQZA 3OSUA 2PV7A 3RIHA 5THQA 1GUYA 5FEUA 4XYMA 2HMWA 2GUGA 1PEDA 1U5CA 1UXGA 3KYDA 3ZNPA 2O50A 1HYHA 5ENDA 4WCDA 2GO1A 4ID9A 5T57A 4NPCA 3GRKA 5AXBA 3INGA 4FB5A 1DAOA 1BDMA 2HK7A 1KEPA 2R00C 3UAGA 3GGGA 2FPIB 4CQMB 1NX6A 1PZGA 4IDAA 2QIOA 3TRIA 1QG6A 1HF3A 3C1TA 5FI5A 4NMHA 4AJNA 2EKLA 2OORA 2C0CA 3NV9A 1LRJA 2D3TA 2PKRA 3QP9A 4UREA 3FNFA 5G4LA 4CUKA 2VOEA 5EINA 3ZDFA 2DBQA 4CLRA 4L4SA 4GMGA 4GGOA 1Q0HA 4IDFA 1BG6A 1BWSA 1Y8QB 2NACA 3I83A 4F45A 3KYCA 3AM3A 1IHXA 4IJKA 4MINA 2OMEA 4BO2A 1PWZA 1R6DA 2BFPA 3GVHA 1Q0QA 4DC1A 2VWGA 4QUKA 5F1PA 1M6HA 4WOKA 3SJ7A 5COQA 3NUGA 4BNLA 2GCGA 3EGOA 1SOVA 4O6VA 3HDQA 4Q3CA 3VPHA 4BNVA 1I32A 3QWAA 4GKBA 2C59A 4RPGA 5JSFA 5JW6A 2Q99A 3GAZA 4ND3A 5K0ZA 4CM8A 4F6LA 1VRWA 2HMTA 4J4HA 4E6PA 4HV4A 3WSWA 1DBVO 1N9GA 4R1TA 4F3YA 2VYVA 3ZNQA 5JAMA 1YH3A 1P44A 1SB9A 1PJTA 4UEKA 4DQVA 4L8VA 3I5MA 3ZN2A 1HYGA 4QO7A 2P4HX 4RVGA 3SBOA 2YHIA 3PGJA 4OOFA 2O7QA 1P1IA 4R9SA 3PTZA 4HBGA 1E3JA 2O3TA 1GQ2A 2I99A 4PIVA 5ADHA 3DZGA 4XIYA 1G1AA 3C24A 3ITDA 5FF9A 3NYWA 1A7AA 2BHLA 2Y68A 3QWIA 3KV3O 3ZHXA 1YONA 4ZQEA 4BNZA 1GUFA 3EDMA 2B5WA 1E3LA 4YAJA 3PWZA 2VWQA 4I9UA 1X15A 1WAMA 4Q3BA 1R37A 2PY6A 3IAHA 5HBRA 1ZO8A 5EQFA 5TLSA 4A0SA 3AU9A 2YFQA 1HDCA 1I3LA 2C2XA 2I9PA 2JFFA 1VKOA 3QHAA 5G4KB 1CQIA 3NKLA 3PQFA 1LDMA 2NUAB 1PSDA 3K2BA 1NASA 3NDJA 1IULA 3GG2A 3I4CA 4NK5A 3KBOA 3FWZA 1YL7A 3HN7A 1LC0A 4DBVO 3V2UA 4FN4A 1LX6A 1VL8A 2PD6A 3JQGA 2GRAA 2BELA 5TSDA 3LK7A 3GG9A 3KYBA 1CDOA 1I01A 2C5EA 3GHHA 2AQKA 3QY9A 2D5AA 2FHSA 4K28A 5U9CA 4NG5A 4CMCA 5K6AA 2VRCA 1H93A 1BVUA 3ENKA 4W82A 1ZSVA 3UFXB 1B14A 3AUAA 4I1IA 5DNAA 3SJUA 1YQXA 1JQBA 3EVNA 4JNKA 4FC7A 1HDYA 3TNLA 3OJLA 2NQTA 4BUCA 5JCXA 4W4TA 1EK5A 3U0BA 4EUHA 1I36A 2J3HA 4OSPA 5T67A 1YBVA 1DJQA 3S2FA 4Y6RA 2VNAA 3ZWPA 3HZZA 3CZMA 3PI7A 1BW9B 4XGIA 1ZJYA 4XJSA 3CSDA 3PIDA 5A02A 3TZ6A 1DIRA 3AW9A 4EW6A 4AJKA 5A05A 1ULUA 3ZV3A 1FDTA 1ML3A 2W2KB 1UDCA 2GN6A 4NIMA 2EWMA 5JDCA 3PWSA 1F8GA 2X7HA 5H83A 3K8ZA 5LC1A 5B4TA 3HE3A 1HDXA 4YAKA 4E33A 4RF2A 3QV1A 1JKJB 5U4QA 3AOGA 3MJVA 2NU6B 5IDQA 1XQ1A 4EJ0A 4PG7A 1U1IA 4BKOA 3V8BA 4LW8A 1N2SA 1NYTA 3QW2A 4INAA 4BO7A 2FSVA 4E32A 3JCZA 1PJSA 4YR9A 3MTJA 1KIFA 4AJ2A 1D4FA 4XKJA 2XXBA 6LDHA 2ZYAA 2Q46A 5G0VA 3GUCA 3QWFA 4DMLA 3VVCA 4YJHB 1Z45A 4JXKA 4J16A 1ZNQO 2ZB3A 3MWEA 4J9VA 4O63O 4CR7A 1XR3A 2D59A 4R9RA 4RF5A 5AXDA 3ENNA 3VH4A 3WX0A 3VKUA 1ZZEA 3NT2A 3NRCA 1NFQA 3P5SA 3PJDA 1GEGA 2ZTLA 2IEDA 4QT0A 3AM4A 3MJCA 3F4BA 5ILGA 4PCVA 3U4HA 4BMNA 1WXDA 2VT3A 4OAQA 2V6BA 3W4KA 4A7PA 3L6EA 3JQAB 3RBVA 3OQBA 4LRSB 1MXHA 4J1SA 1MFPA 4MVJP 4OQYA 4RCVA 1NWHA 3KRTA 4CM5A 4N5MA 3GR6A 4EYEA 1MLDA 4CV0A 1Q7GA 1ENOA 3RBXA 3GPDG 1O89A 1U4OA 4OOEA 2FP4A 2AHRA 1NWCA 1CEQA 5JYDA 4W99A 5CAEB 5JAZA 3TN7A 1YGYA 3FNHA 3LC2O 4GGPA 4FFMA 3DL2A 3JSAA 1C1XA 3QVOA 1LC3A 1QYDA 4UVDA 2ZYGA 3B1KA 2J3JA 2VRBA 3BHMA 4PLCA 4PLTA 3IJRA 5ITVA 1XELA 5IXYA 3ONEA 4YJGA 1X0XA 1FDUA 3P2YA 4XX0B 2PKQP 4OKNA 4GX2A 5CDYA 5KVSA 3TQHA 5L4NA 1UP7A 2D1YA 2BD0A 3CMCO 3EUWA 4C7KA 3QJ5A 5L51A 1KEVA 4I9NA 1E7YA
chains in the Genus database with same CATH superfamily
2F62A 3GMTA 3JQFA 5DBGA 2I5PO 1U65A 1DWUA 2ZXEA 4I9GA 3GK3A 3NHBA 1L1QA 3G0DA 5DGIA 3BD7A 1F14A 3E61A 1VQ1A 4P4LA 1NZJA 3W7VA 3P9CA 5HVNA 2F48A 4MV4A 1K7YA 1R0SA 2Q3LA 3FPGA 3Q5EA 3LBAA 1YD7A 1TEXA 4EUKA 2FFRA 4QLOA 4CLOA 1XDDA 4L3OA 3V8NA 1FBTA 3HCDA 3T1VA 1USKA 4B8YA 1IZ0A 2O8FB 3FPHA 1X13A 3U80A 3JZMA 1RP1A 1SCJA 5KNBH 5T4BA 1R6XA 4ESHA 5U1PA 5B2ZA 1ZJ4A 3A36A 2O8CA 4AWXA 3ESXA 4J43A 5KQRA 1W36D 2A57A 5TQ0A 2BRUA 1N6LA 5I7EA 3I01A 1TU3A 4YN3A 4AT1A 1GAWA 1X80A 4CDMA 3AR3A 4EYGA 3REQA 3EJWA 4JI2B 5G1NA 3ENWA 1B16A 3NATA 3VO8A 4RKYA 4JL6A 4NOKA 1N7HA 3GQBA 4H7DA 1S5PA 4C3OB 3PR2B 2PXXA 4FKMA 4IUCS 4EY7A 1KTIA 1K6JA 1ZK4A 4RTKA 2PIDA 2PL5A 4ZI7F 3TBFA 5HDQA 1RI5A 3RC9A 3WYAA 3NASA 1YR9A 1YC2A 3IBYA 2NYRA 3CXRA 2P62A 2WFZA 2IVZA 4HN4B 1ZYUA 1LLUA 3DPUA 1XTSA 2FYTA 3O1IC 4M0KA 4MV0A 4RHXA 1L5SA 2VQDA 5SY4A 4COKA 3PEFA 2X4GA 3D5QA 3BUSA 2I2XB 4MS4B 2CV2A 4LCEA 2QEQA 2GBLC 4YRMA 2FPGA 4CG0A 3CLSC 2NTNA 3K7EA 4V2IA 4KR9A 4EO4A 4CQLB 5J4KA 3CW8X 1W581 3CB2A 3MB8A 1E1MA 1VDMA 4HLUA 4BU0A 4DIFA 5DHRA 3B38A 2QG9A 4U9UA 3WL6A 2ZIVB 1ZH0A 4EO9A 4UTRA 4X5OA 5CUQA 2VATA 3ANSA 5TJHA 1LWNA 3SDZA 4OIMA 4YWJA 5IDWA 1YZQA 4C4XA 1PX0A 3ROZA 3FSEA 2E85A 1U4SA 2F6RA 3OUTA 3DE5X 3HXTA 1D1QA 5F7ZA 2QLFA 2IGBA 2FKNA 2DH5A 1PFUA 3IELA 2VZ0A 4YXFA 3TTWA 5GIPE 4Q48A 1NLZA 1X7XB 3ILVA 1E4VA 2E1PA 3B6JA 5KOJB 4XASA 2Q50A 3ETLA 3OJ0A 2JLUA 5CT6A 5LFAA 1XN1A 2DE0X 4KEAA 2NTYC 4ZVKA 1P72A 5JXHA 1NVAA 4MR9A 1B8UA 1ZH6A 1YQQA 2IXEA 1M2VB 1TUEA 1YT5A 2LKDA 4RD6A 4D1YA 2X4LA 4AD8A 3E53A 1CJTC 2C5BA 4IKOA 3V7FA 3AJDA 1MB3A 2PR2A 4W7SA 3HPQA 1QAMA 1WA5A 2O20A 1VIAA 5CLLA 4E08A 4M0LA 4GL4A 3VKFA 4Z7OB 2ACKA 3CYFA 4ZP1A 2CL0X 3WP0A 4EGFA 2W6JD 1Q0LA 1SQ6A 1R2QA 1U7XA 2IYYA 2ZUSA 4UBKA 1QTNA 4YV0A 5DM4A 3BGSA 1WWKA 2NUBA 4ND1A 2SCUA 4P8RA 3MHTA 4F4JA 4DCJA 1IEVA 4EG7A 3QYPA 4YMSA 3WMFA 2CDNA 4DV2B 1K92A 1L8QA 1EXDA 4E30A 3N9IA 4CQJA 3TD9A 2NVOA 2HYIC 1HT1E 3E2IA 1AGYA 1TO1E 1R00A 1JSZA 4QX6A 3JQ9C 2O2JA 3LVQE 1TM4E 2DKOA 2F8LA 2VHTA 3L0IB 4NJMA 1Q3TA 2XGOA 2Y0EA 4PYOA 3WLTA 4B83A 3SS7X 2PRKA 2VHXA 3QJGA 2HYDA 4QXPA 3WAKA 4BP1A 4C1NA 1JSRA 4UTZA 4WAUA 4WBNF 1FYXA 1PK8A 1TGYA 1UEJA 2AC7A 2C2ZA 3EC1A 3T9BA 1ZVVA 1JLRA 4LBZA 2OCBA 1QKKA 2VA9A 2GZHA 4GE3A 4PX3A 3NHYA 4O2AB 1UZNA 5MFZA 1F2DA 3ZLTA 7REQA 2DFPA 4Z1MA 3DBLA 4B6RA 5JAOA 5CBPB 4LDNA 3RWOA 4KHZA 3PF8A 1M73E 4Q3DA 3JD0A 5FWYA 4CV3A 3EA4A 2A0YA 1XCGB 3H1TA 3TFQA 4F7WA 1KNXA 3EFHA 1YACA 2ZBGA 4CKYA 3K31A 1U0RA 2WJPA 2OQRA 3SR4A 4LMAA 4PXAA 3LZ6A 1C4OA 1ESMA 2AZXA 4YMUA 2QTBA 4WL0A 1Z7GA 3GELA 1IBCA 3G0GA 3FPFA 2GI4A 1GYRA 1SJ9A 2WA1A 3DWGA 3E9RA 3QF7A 4NONA 4P3KA 1MABB 5K1ZA 4UUMA 4F5YA 3U7FB 2PBRA 1OF1A 1PBTA 3AVQA 4JBHA 3BD8A 3NBMA 4QFDA 4QPZA 4ZVLA 5IAGA 3GAFA 3SN6A 2NU9B 4OM7A 4V2UA 4XSVA 1RPAA 4WBSA 5CURA 1FLVA 1W2WB 1Y8CA 2DBYA 2LDXA 3NTRA 2A88A 4G86A 4YUVA 1W52X 2I6UA 1IUOA 1SFRA 2HJ9A 1Q1BA 4IHKA 3JARB 2JGFA 2P7IA 1E5VA 5DHFA 1N92A 3TM5A 1QO0A 4BB5A 1AF4A 121PA 3CM0A 2JI9A 3G2QA 3OJXA 1P7PA 4PSDA 1F17A 5KTOA 4LI0A 5EHQA 1R9GA 3AG5A 3R4VA 4RLQA 1I7NA 2IX3A 4L27A 2BTEA 1FNBA 1AO3A 3NX4A 3A6EA 1COWD 4FZ3A 4JQCA 3DO5A 4TYPA 4X6UA 1E2QA 4U3JA 1EFPB 3KJNA 4MIOA 5LMNB 3HJCA 2QDKA 1CNMA 1D2RA 2QZ9A 4HH1A 3RJTA 2ZJ2A 3A7DA 3GMDA 3A1UA 2X7JA 1UFOA 1HT3A 2CUKA 1GPKA 4Y67A 4MVJM 5F2EA 3BORA 3H9QA 4WXHA 1U2GC 1RI4A 3DHNA 5IT0A 4UMEA 1WTAA 3VAYA 2F1KA 2YJNA 4B8WA 4E88A 4LXXA 3UJDA 3ZGVA 3GGPA 4G5HA 2C61A 1JMKC 1UR5A 2NT4A 4DLUA 4X20B 5FOXA 5BUZA 4K2AA 3LY5A 4X64B 3H2ZA 1R9MA 1ISHA 3LRPA 5CLGA 5ALUA 1DTWA 3DKPA 3L7LA 2PGXA 4E5UA 1GL3A 3AUXA 2DQSA 1NYRA 5EP4A 1M10A 3WGVA 4MCIA 3GJ4A 1IUKA 3EZ9A 3PWKA 4FFWA 4R1LA 1P60A 1GU7A 1X92A 3WGHA 1Q7CA 3ZCUA 4RTNA 4PN3A 5LMZA 1K8YB 3WBJA 1SVLA 1G0OA 3A6JA 3TE7A 3VHXB 3PSAA 2OO5A 4MA0A 2IYSA 4NFHA 4IOKA 2YVKA 4NYMR 4PYMA 4R16A 4ENRA 1PDOA 4KO3S 4S24A 5G53C 4YRBA 4WQMA 1KAMA 1UWVA 2EF0A 3E35A 4JMPA 1DARA 5CFRA 5JS1A 1A8PA 1Q50A 3C6QA 1IB6A 2G4LA 3KOYA 3CVOA 4JLMA 3E7XA 2O2ZA 3FYSA 4B3TB 1Z5GA 4PBRA 2O14A 3F5SA 1GJRA 2BPOA 3CNEA 4QUDA 1I2AA 3LWNA 2CMDA 2DKNA 4BLOA 4LF4B 3ROXA 1QG4A 1QIIA 3SHWA 3EZ7A 1RCTE 5CB4F 4S12A 1I7LA 1K75A 2P9JA 4TTJA 4J03A 1DKRA 2AFHA 1RHUA 1KY5A 4OFZA 2ASEA 3NI2A 5HIIA 3TDNA 4BAUA 4PR3A 1TQ2A 1SB8A 3ANNA 1VHQA 3ECCA 4HQNA 3LYLA 3PR1A 4RA6B 4FFRA 2JHGA 1SCNE 2WHXA 2XF2A 2PD4A 4TXNA 2YQ4A 4X85A 4GLJA 2ZBVA 3HKDA 5TNXA 5AM2A 1KWKA 4AO7A 4K9PA 3EMDA 1TIBA 2I8AA 5TGDA 4ZJUA 3L7KA 2G04A 2FZEA 2Y2VA 3FSRA 1KQNA 1K6EA 4EAAA 3QLTA 1WKCA 4UQPA 2XQIA 2C03A 2WU4A 2AA3A 4LVCA 4M1SA 1QOQB 2WJ6A 1NJFA 2PUVA 1JH9A 1SUCA 2P2NA 4G9BA 1XHEA 3DHWC 1C7QA 4P38A 4BVHA 4IWXA 4ECAA 1ZDMA 2CXTA 3U7EB 1J1ZA 1UIMA 3FGOA 2SHKA 2O6LA 2PX4A 2RC6A 3K0FB 2X0JA 4HI0E 4JT8A 3WRVA 3U0VA 1NJ6A 4D99A 3TL3A 1NVVQ 3P9XA 1N5JA 2JD1A 3GIDA 3GDOA 3IL2A 3O0TA 1GQYA 5DP1A 1LTHR 2CLIB 3DAGA 1TUBA 4MRMB 1Q7TA 2I9KA 4P7JA 2QJTA 3WE7A 1L7RA 4JT4A 4KQHA 3R7LA 5F1OA 2JFBA 3NO4A 5K3OA 2VQ3A 4KQGA 5A6SA 4P4SB 1T2DA 5M3BA 2NO4A 3I5AA 1ULHA 1V11A 3DDZX 5JE8A 4UM5A 4O2BA 2CXNA 2G5PA 1AN0A 1BDBA 1BDIA 2I4TA 4GLLA 4TV9B 4NXMB 1EK0A 1TTQB 2AUNA 3TNFA 2HNKA 5LZ9A 1ORWA 3ICOA 2BEVB 3WA6A 2Q29A 4WY8A 3NJ4A 4I5EA 4IX9A 1AA9A 2GBFA 2G07A 3EXFA 3IIEA 4MQFB 1NJ1A 1FLNA 2QAGB 3HZOA 3OF2A 4IYJA 3JPWA 1ZK2A 2J41A 3OEWA 2C83A 2DHEA 5IULC 3TCKA 4DB2A 3E9EA 4P0TA 5D6OA 3EPJA 1T5TA 2J9FA 2RJOA 2G36A 2GF2A 3SK0A 1Z6YA 5EFZA 3M70A 2Z8XA 5TGTA 5FOQA 4FMBB 3N8DA 5THKA 5DWQA 2D5BA 5FULA 4L6CA 3UAYA 1CUHA 1ISFA 1A96A 2IJGX 2IQ5A 3G9QA 4MO9A 4D57A 2BE9A 1P74A 1MORA 1ZNWA 1TKAA 5DCWA 5KSWB 2NW6A 3AEQA 4AXXA 2Y1GA 2Z2YA 1PJQA 5K4AA 1NOJA 1GZ6A 4H4CA 4EB6A 3E9MA 3UG7A 2B9EA 2IEZA 1NNUA 4L5CA 4E5NA 3WLSA 2QTRA 2XGGA 3I9KA 1QVZA 1VHJA 1FTNA 3CQ9A 4NP6A 2P69A 1EAMA 3OEHD 1TZCA 4PY2A 5KX5B 4DIBA 1GHTA 5FBVB 1KI2A 3IEVA 4XFKA 4FYMA 3UEOA 4YXWD 1HQDA 4S35A 3WRYA 1V0JA 4QAJA 1QS0A 4ZRDA 3CVYA 2QPAA 1QOPB 2NO1A 3IE1A 2I3GA 4ZANA 1VMEA 1E61A 5TARA 4OLFA 3OKPA 3MEQA 2UZ1A 1TJNA 2BDUA 2ZR9A 4KFSA 3HABA 1E8NA 5L4SA 1Z74A 2X76A 3G2JA 3HXLA 4OPMA 5IJ9A 2MYPA 2FPIA 4PYKA 1PLLA 4XYBA 1YVUA 4I8IA 3W05A 3OTHA 4CQMA 5KTNA 4PAGA 1WDWB 1NG1A 4BAGA 1EB9A 3NXSA 1YL6A 4DKJA 2WAMA 3IYLW 3AJRA 4PG8A 3IP8A 2HJVA 3L8HA 4ZV4A 4B71A 1IOWA 1MC1A 3LKVA 4K1LA 3WLLA 3FOZA 1XK7A 3Q8WA 4QOEA 3SEZA 2PLFA 4P7KA 1M2OB 2QYTA 1CUIA 3AUSA 3VDXA 4LZWA 1GM5A 4D8TA 4J2TA 3BDVA 3U60B 4Z4QA 1WHSA 3H5NA 2XA1A 5AHOA 1BA3A 4J1TA 5JMWA 1L1RA 2NZ2A 3W3AD 3H2SA 2R751 4NU5A 3V42A 4X7MA 5AR1A 2HR1A 5H7XA 1XXLA 4NENA 2O59A 4BHTA 4B2PA 1WB6A 4CM8B 5D51S 1JYSA 3UANA 3WGJA 4DJ5X 4UAJA 1ZJWA 1C4WA 2WWIA 3EIFA 4CODB 1NMQA 5F7JA 2G9UA 4NZ9A 2RD2A 2YNMC 3CE6A 4G84A 1E9RA 1RVDA 1L2TA 2HBYA 4X1YA 3LV8A 4ENSA 1RWWA 4RC9A 1IJEA 2Z5LA 4WACA 5JFOA 2AJBA 1ZD3A 2Z6UA 3GUZA 1PS9A 2QRNA 1YTUA 3LY8A 1GPLA 4FX2A 3LYHA 2O48X 3ZXIA 3CLVA 3P0HA 4DDUA 2H4ZA 2J4DA 4WUVA 4CT4B 5K3SA 3VR2A 1N1MA 1Y6ZA 3BA6A 5CFMA 2O8BB 5JSHA 2PGIA 3PNBA 4C2BA 3T5AA 2NO5A 4R2MA 3EQZA 3L6UA 3VR5D 1W0JD 4X0EA 1T4GA 5JD3A 1MEJA 1O9HA 1R7RA 2N47A 4LYDA 1ULTA 3RKSA 2WQ6A 4OMDA 1L4NA 2NYVA 3KKOA 1VE3A 2IDZA 4YDHB 3H1PA 5F64A 1QYRA 5E4YA 3R5JA 4PAOA 5JIBA 4K05A 1Z12A 4COOA 1VG9B 4C04A 1T4CB 2R6R1 1HX7A 4QGBA 3NBXX 3D6TB 4TTTS 4WXPA 2VHQA 4L4XA 4CHGA 3K09A 4ZHSA 4ZOLF 4LE0A 4KOEC 2IUFA 1Y33E 5C5EA 4XPIA 1QAQA 3H5AA 3LUAA 4D8UA 3QEMA 1MC4A 4GWLA 2Y67A 4YAUA 3O8LA 1IU9A 1Q0PA 3ZEAA 4PLPA 4BC0A 1EVEA 4GE0A 3RKUA 3FTFA 1TDJA 3ZTWA 4M8SA 4B17A 3KYIB 1IZ9A 1OYYA 2AOTB 1OI3A 3L8GA 5F76A 1DO0A 3C3PA 2FU5C 4TMZA 4XARA 2DX7A 1C1YA 5K99A 2WUWE 4LOKA 1XNGA 1V37A 2DKFA 3HM9A 1UPCA 3L04A 4C1BA 1H1LB 2WUGA 4ZPXA 3UWPA 1XPOA 2DR3A 4CM6A 1AZWA 4MLDA 1NR5A 2QW0X 1LDBA 1WXGA 4MHTA 1DTEA 3BWXA 3COPA 5CW1A 2HN9A 1J90A 1NF9A 2WKRA 1E2HA 4KBFA 4HVTA 1VIYA 2C82A 2ZYRA 1ZBQA 3ELBA 1U9YA 3C70A 1JVNA 3TLGA 4G5GA 5DTMA 3KWJA 2I6QA 4QUGA 1SBHA 1WHTB 5BSRA 2VHCA 3HC7A 3IR5A 2FUNB 3NWEA 4PYJA 3IKVA 2VP9A 2QRJA 4LZOA 4D46A 3AUTA 5BSEA 3SNKA 4Q19A 2VDWB 1BH6A 1I94B 2O1EA 1RR6A 3QF4A 3A6DA 3EZLA 1JECA 3IV9A 4P92A 4BNDB 3OT5A 1SCQA 2JFGA 3R24A 3AIOA 1D4AA 4ENWA 3KT6A 4XB1A 1GTMA 5JCJD 1QTQA 2DUJA 1HDZA 3ZWVA 1FY2A 2YXEA 4FPXA 5HKBA 3H2HA 4DCSA 1CUEA 2QVXX 2Y1EA 1OGJA 4M38A 3L0BA 2ALJA 4RJJA 4P5EA 3RRYA 1T3SA 1TQ8A 1JKJA 1K9VF 1U2DC 3I42A 3JTMA 4Y2RA 3INRA 5D1NA 1XD2A 1F0PA 4NZNA 2QQ5A 3ZY6A 4DTCA 2P68A 3Q0IA 4INOA 3E03A 5KYYA 4GDMA 4Z6KA 4YTEA 3K6SA 3GJYA 4RU1A 4XJVA 2NXCA 2EEPA 1RPNA 1LVUA 2CBZA 1MAVA 2J3MA 3FTDA 3F8WA 4JJ7A 5E95A 4XD2A 5I7RA 2GS9A 2C42A 3QNUA 3V4LA 1EXWA 2I7VA 5B1YA 4RJ2A 3AEUA 3NBUA 2X0FA 1NQUA 1CJBA 1VMIA 2QD1A 5FPKA 2G8LA 4C6TB 2DFNA 3BWYA 1L5KA 5FV7A 2PRJA 2B9VA 3CISA 3RG2A 3QYFA 1UANA 2GRUA 3SC3A 2A84A 2HL6A 3OM8A 2OV2A 5H3CA 1GFZA 3NC4A 4CMEA 1F1BA 4II3A 1YWGO 3R8XA 1H6AA 1YB7A 1A4IA 5FTWA 2IHUA 5EI5A 1B42A 1C2YA 1RRKA 4WK0B 2J46A 3RS0A 3E81A 1UPUA 4L8YA 1G5PA 4PRZA 5FFFA 4B3DA 2CYBA 4B6OA 1EFVA 1FYFA 3L8ZA 3SM9A 3QUBA 3VV3A 4XTCS 4OXNA 5CB6A 5JSQA 1U3GA 1DC4A 1U8FO 2O5RA 1E1LA 1CKEA 2WSSA 3A9WA 2HJRA 3EGXB 1HE3A 3ENZA 4IBOA 3U56A 4TMWA 3T7DA 4C0XA 4M9ZA 5FYDA 1C9NA 1I30A 4L76A 1XKXA 1EVKA 3CNOA 3VPGA 2EBWA 4O02B 3HR8A 4V0OA 4ZDJA 3EW9A 4LECA 1CC1S 2B8TA 2GK7A 3NV7A 4RPKA 1E4OA 2HSEA 2J7KA 1B8OA 1O4VA 2UUOA 3NYIA 4G0QA 5E6UA 4LJ9A 2K5UA 1I6LA 4DA7A 5HK9A 2V6FA 3JQAA 1HE5A 4HGPA 2BMFA 2I71A 4JVMA 4OHMA 3WB9A 1HNZB 5JLJA 1FNSA 1W0CA 4A3SA 4NI5A 1QP4A 4TTVA 2R44A 4RD0A 3SBDA 4Y1EA 1W5AA 4DQUA 2BFCA 2XE8A 3CLTD 3CUWA 1WX1A 5AKLA 1BMTA 3EVZA 1HE2A 2GAIA 1JHRA 1OLSA 2ACWA 3LI2A 3Q0EA 1FFXA 4UEQA 5I3CA 5DF1A 3E5MA 3N86A 4NNPA 1YBMA 2BL4A 3SZRA 4DMUB 4OHBA 4OHVA 4PSAA 5LJLA 2RCNA 2WAXA 2JAUA 1EXMA 1MENA 2B0JA 4J8PA 4OA8A 4YACA 5BQOA 5AW1A 1K4YA 3W5SA 5LVAA 5K8VA 1M34E 1US8A 2OGWA 3FHLA 4U2FA 4DWVA 2IEAA 4TTPA 4XX0A 4TMTA 2PH5A 3P1JA 2CJFA 2VA8A 2X9NA 3AJEA 9LDBA 1BXZA 3O0DA 4WFIA 1W87A 3D8BA 3GT3A 5FWXB 3CLRC 1OX4B 3L1UA 4D6YA 1MZVA 1RM5A 2A1UB 2OCLA 4TT3A 3PLNA 2IUYA 3VZDA 4D3ZA 5I8PA 1VKJA 4C0WA 4D0RA 7YASA 3AWDA 3MW8A 3N2YA 4NMHA 5K0LA 4O4HF 4LGYA 1FJ2A 5FNVA 5K01A 1GAXA 3DBRA 4OHUA 3X43A 3UM9A 4U7PB 2QTLA 2HRZA 3Q8MA 2M32A 4ZQHA 2FFHA 2HT6A 1WSDA 3K0AA 4I1VA 4ZVOA 4N8SA 3TUJC 4ZYVA 2DWPA 3D2BA 2B5VA 2XQGA 4M1EA 3V1KA 4BZZA 3IQZA 4OQFA 3QXSA 5MGBA 5ECWA 1SKUA 3VYWA 3CRZA 5IARA 1QJ4A 1RBZA 5CLJA 5KNDD 3FGPA 3QLEA 3R1IA 3CSUA 1Y1KE 2GERA 1NRIA 1SUWA 4JA2A 4TUYF 4WWHA 2XWQA 4YONB 5I7VA 1GL6A 3A2NA 4MTCA 4ND8B 2I7TA 4PBTA 4FSXA 1F2TA 1XG5A 1RXSA 1TIKA 2BGKA 1W6RA 3QSGA 1U28C 2A5YB 1YZLA 3KYJB 6NULA 2IPAB 4XI9A 1ZN8A 2G3YA 5I4KA 1SHLA 1MR3F 1XJCA 4ER7A 4O8CA 3V1TC 2A5FA 4KR0A 1KMCA 1BEUB 1H1DA 2G0AA 2HA7A 4OM8A 1JIXA 1JIKA 2CXXA 4IO1A 5J5CA 4EB3A 5CDFE 1FJXA 2H6EA 2V7TA 1N5RA 4FJ1A 5LD2C 1P4HA 2WZBA 1QHYA 2NZYA 3EFOB 2XGSA 4MGHA 5DIFA 2W2XA 3TK1A 3KZVA 3ZU6A 1I5RA 5IYZF 2VP0A 2FEMA 3DBHA 2AJLI 1I6KA 1DIHA 4QPJC 4GECA 1BWQA 3ESCA 3FRHA 3B8HA 5ALYA 2CJPA 4IVPA 2AN3A 2Z4TA 4JYAB 3FMPB 3OCCA 3E8XA 3P94A 4X1OA 4HNAB 2B83A 3D4OA 3PU6A 4DN6A 5GAJA 3ZCQA 5KVVA 5INTA 1DKQA 3Q7IA 4NU8X 4CV1A 4N6NA 4BXOA 2C00A 4ED9A 2YJGA 2FPMA 4KP7A 4N7RA 3K05A 1FPQA 4EGCB 1I2BA 3KL4A 3GDFA 1Z83A 2QMUA 4YFYA 2WJHA 3Q3JB 4HLCA 1XCLA 2HLNA 4GWGA 4EJ6A 2C07A 1R0ZA 1HQYE 3QKTA 2VG8A 3VU0A 1FSZA 5KNBA 1ARZA 2BFDB 2AFIE 5ALFA 3N0XA 3DM5A 3OBIA 1UBGA 1LZLA 2HRBA 4P4TA 4XX1A 1Q0SA 4IKPA 1P7CA 1FX1A 2QUHA 4CFYA 3COJA 1L5OA 4RZHA 3AV3A 1XDWA 4MWCA 1XUOA 4Y2XA 1U9JA 2WP0A 5EE0A 1ZJ5A 5JZVA 1QUFA 3ZU2A 3E27A 4HWTA 4HDSA 1Y89A 2XKJE 4YFVA 1DC3A 4DUPA 4KPFC 2IEYA 1P19A 4EFNA 1VB3A 4K0RA 4KIUA 5ENZA 3FYCA 4N3NA 1OI4A 1VCHA 4C07A 4FOTA 1ZEMA 1UP6A 3ANTA 1VKRA 1YGPA 1RAIA 4DLVA 1GCUA 1OXBB 2PQ0A 3Q5DA 1H4TA 1OT5A 2IYXA 2WM8A 3F2IA 1XE3A 2YWXA 3KSAC 4GPEA 1IY9A 4QTUB 1ZCJA 2BFOA 3RRJA 3UOWA 3ZHTA 4IHQA 4B46A 4CKEB 2QF7A 3EQ7A 3GRZA 3JQ6A 3GVIA 4NCHA 4UPDA 1BYUA 3WYNA 1NQTA 3S8MA 1CY2A 2D8AA 4P1ZA 3TQOA 2WD9A 3WFZA 2QVGA 4C0JA 4MWDA 5AUPB 3GGDA 1WXIA 3II6X 4C4OA 2HIMA 2AD5A 2FG7C 1KYQA 2I55A 1OH6A 2JIZD 4ZDIA 1BD4A 1UBCA 1VZ3A 4N18A 3BXGA 5AOVA 1TB4A 4FFLA 3FMOB 4C87A 1LS1A 1WDTA 2OV3A 1JILA 2F3SA 1KJNA 1L7AA 3QUAA 4Q7QA 1PHPA 3HS3A 1NRJB 3PEYA 5LP6A 1YRBA 2YFYA 5BV2P 2P3LA 5DBIA 5C32A 4XEHA 4CKBB 3ZR4B 3MGKA 1JVSA 5JU6A 1FFAA 1LA2A 3JRXA 2KBFA 2IRWA 3L7MA 2UYHA 4B31A 2WG1A 3ZVRA 1Y5NA 3IP3A 4J76A 3SBEA 4LRTB 3DUWA 1NGSA 3ZGNA 1T6YA 4EEZA 2CFOA 3H0CA 5U4XA 1WO8A 3QVGB 5I48A 1CEXA 5LZ8A 3V2HA 3D4LA 3THXA 2Y1OA 4W5HA 1U0LA 4YPOA 3KWMA 4XLZA 1IBKB 1FB5A 2XUOA 1MQSA 2Q5LA 1L4EA 1GILA 1QF7A 3UMBA 2X5JO 4MPRA 5BT8A 3NJ8A 3FPEA 1PWYE 3OOJA 2XHZA 4QODA 4H6WA 4L0QA 4DY6A 1OAOA 1EVQA 3HUFA 3DTTA 2QG4A 3V46A 1ZXBA 3DFKA 4Q82A 1N75A 1IIRA 1FTYA 3RVDA 3EXEA 3FUCA 4IIGA 2BBOA 3ROQA 1QP7A 4AJIA 1QIJA 2AJDA 4DRZA 1D1SA 3KR2A 1FFYA 5CX4A 4N3CA 5FXMA 1C4XA 4UASA 5IJXA 2A59A 5AJXA 1DEHA 5I9NA 1Y3BE 2XWJI 1XSEA 1UUFA 5JUWA 3DFMA 1XZGA 5BP7A 5IM4F 1JJ7A 1KWGA 1L7NA 4K9MA 4TQGA 2D0PB 4JBNA 5JNWA 4CCWA 1A9ZA 3OQJA 1EFLA 1PJ3A 5JTTA 1VBKA 2GZ2A 1Y8RB 1PQYA 3MD9A 4L2IA 1DKOA 2QK4A 1KXZA 1UZUA 3TOXA 3B2EA 4BBZA 1X7ZA 3KSMA 1ORHA 1Y9ZA 2HY7A 4YT5A 3LO5A 3LHDA 2OQVA 3ZBPA 4EX7A 5CCXA 3TKLA 1SZDA 3HCOA 4JLNA 2P4EA 1ZHOA 5K20A 1H3NA 1O87A 2IIQA 2QR3A 3KLPX 3MSXA 2YXPX 5JZSA 1CERA 2Y4NA 2YZKA 1G41A 4QASA 3SMVA 4HVCA 1H2XA 1WMEA 4IOLA 2BEUB 3WIVA 5BR1A 3Q7TA 1AXRA 3LVBA 4Z1OA 4UNQA 3ZX5A 3OZDA 1ADBA 5G40A 2ODBA 1PZNA 2OCAA 3QUSA 2TRSB 1Q91A 4TS3A 3TQTA 4HC4A 4AVYA 4ALIA 1HH4A 4QO8A 4O5OA 3LT5A 1A5AB 3NR2A 1DCFA 1P1BA 1GPBA 3AEYA 5K8UA 3IUQA 2I34A 3OSZA 1GQSA 2Z9DA 3DYVA 4P98A 3K70C 4O59O 3LP8A 5IX8A 2ONYA 4UD6A 1VP3A 4DV3B 1KI6B 5D7BA 3DO6A 1G20B 1OTXA 3M82A 3WGKA 2E5FA 1JQDA 4JSYA 5AVJA 1TVKA 2IUEA 4YPVA 1KDRA 3LHFA 3L93A 4BASA 4R2LA 2A0WA 1AA6A 3ZCRA 16PKA 8LDHA 1A9SA 2EWWA 3FCCA 3LOQA 5FBHA 4EBBA 1GITA 4QBFA 3AF2A 4KV9A 5AVTA 4U9IS 4ZT2A 4MRPA 1NN0A 1AHIA 1CDZA 2NYUA 4NDNE 4HT3B 1DEAA 2V7XA 2IEIA 1ISMA 2VUSA 2XLBA 3HB5X 5AK4A 5E4TA 2ZJZA 5KHAA 2A9OA 2WJWA 4RVOA 4MV8A 4AMUA 1NQVA 2CNWD 3DE2X 3JY6A 4G5FA 3HV2A 1XBTA 3WB1A 4BDTA 4MLPA 1EFRD 3GNLA 3WIDA 3P97A 3C1UA 5ILQA 1V41E 2APJA 3U9SA 1N3BA 1DLJA 3ESDA 1Q77A 3QE4A 5JQGB 2YYYA 1UZAA 2PG3A 1GPNA 1IPEA 1PHRA 2AG8A 3IBFA 3C15C 1U0GA 5AM5A 1Q22A 4NYMQ 3A9UA 2IDKA 4XB6B 3JQ8A 2W6NA 4ZRMA 4D4JA 1UCFA 3MGBA 1K97A 1AQLA 3L8EA 2AWOA 2XCUA 1HT0A 4DIOA 5TMBA 3VYSB 1FXWF 5EIBC 2OHJA 3FZNA 4HDKB 5BW8A 3TLKA 4EA8A 1R0KA 1U8CB 4C9BA 5H81A 4WNCA 1OKKD 2C88A 3LSTA 4Y3UA 4PG5A 4TVSA 1GRRA 1O94A 2YDXA 3M0EA 5L9AA 2TS1A 1CK4A 2WFLB 2C2YA 1J49A 1TLLA 1ZUNA 4ISBA 1SOMA 3PUZA 5ETJA 5H59A 5IAKA 3TRFA 5DN9A 2G0TA 4I36A 3TZEA 2CHQA 1DIBA 3DTVA 3WNDA 4FNOA 1Z0AA 3QA3E 5F5LA 1R0BA 2DFLA 4LUCA 2PSSA 3OQHA 3RWMB 3WHIA 1XDSA 2Y1DA 3CUUA 4CCYA 3EH1A 3CE9A 3M3DA 1XWFA 5HJ7A 5JBQA 3G6WA 2JEYA 2ZQYA 3RC8A 3CWQA 1QLHA 3SSMA 1LBIA 1W5FA 4U39A 5WRFA 4KMSA 1CR1A 4MVJI 1E3TA 2I1QA 1I5EA 4RVFA 2O1XA 3HCAA 3STVA 2WEKA 1U3DA 1U90A 2AQHA 4IZHA 3EA0A 3GZTB 4P84A 5IK2D 1JQLB 3O4VA 4R1UA 3IVXA 2VTBA 4P3OA 4FDUA 3HBAA 1HXHA 1FFDA 3LW7A 1E2MA 4QHYA 1H9BA 4A6EA 3B3FA 4Z51A 1WTCA 3P9KA 4LV8B 3G2HA 1EHYA 3OECA 1ND5A 4LX0A 4NE7A 4R3UC 5CTJA 3VPBA 5IJWA 1MEEA 3RYCB 3O94A 1M2HA 2BFMA 5JO0A 4MGEA 3HY4A 1M2JA 2RGCA 2FMUA 3H1EA 2GWHA 3ESQA 1MA0A 1GXSA 1PJ4A 3MYRA 5DGCA 3TR0A 1S4QA 3M9XA 4YYEA 2OOKA 1YB4A 2LCQA 3S1SA 3LKZA 2J0UB 2ZGVA 3SJAA 1W2HA 3B53X 4HNQA 2Z1MA 3VPXA 4RS4A 2W2LD 5EEHA 1D4ZA 1R6BX 3UK1A 1KYWA 3MJTA 1V9LA 2NV6A 2EG5A 1HORA 2PR7A 3OPYB 4S1WA 5DO9A 1JA1A 2A0FA 2INGX 3F3KA 1G63A 4UFOA 2YBDA 4E5YA 2R5FA 1VCMA 2ATXA 2OD7A 3PYXA 1XKQA 1W4AA 2WB2A 1DZ3A 1FFWA 3H1GA 1NIJA 3IAEA 4FT2A 4QU8A 1Z4JA 1NMSA 4ASUD 1E1CB 4FHFA 5A9RA 2V65A 2VK1A 4KN6A 4KPGA 4QGGA 4Z9FA 4DCNA 1Z73A 3VYVA 5DHUA 3FYUB 3LXUX 3CSSA 3NHRA 5JCOA 4C5BA 2D1QA 1DKMA 5EJ9A 1TJ3A 1D9XA 1N5OX 2MMGA 3TIGA 4CTOA 4BX9A 4EB0A 3RREA 4EUEA 4YQZA 2NXWA 1PWEA 4MS1A 4TXLA 1BQ3A 3C98A 3HJUA 3AR6A 3RYHB 4BQPA 1S8NA 1USGA 2LTAA 4S1VA 1IE3A 3T0FA 2HT1A 2HLHA 5FOSA 3KYCB 2Q2QA 2ZSUA 4OKSA 4JB3A 4QVGA 4UZEA 1XNJA 1IXYA 4DWWA 3OPXA 4OXQA 2BEWB 2XDQA 1E9CA 1XQXA 1XDGA 3VU9B 1JEJA 4PS0A 3RROA 2EBHX 5BV8A 1PR3A 3JD3A 1M2GA 4W5JA 2I80A 3OY2A 2V7VA 4MYUA 2M6KA 1UOEA 2PMKA 1U31A 3T3MB 3EEQA 5I51A 3OEEA 1I4TD 2DWOA 1G21E 5I6DA 4DDWA 1P61B 2AOVA 2HFKA 4P4UA 4PEVA 5F3WB 3PICA 2ZZMA 3WGNA 2I4OA 1VKNA 5AUQA 4OUDA 3ZDXB 1J8YF 3HRIA 4WCVA 4BX8A 2I2BA 4G8BA 4HLQB 3PHIA 1FMTA 4M4SA 3V8QA 1SPXA 4GR9A 1W30A 4JLWA 1AQUA 4MUMA 2E5WA 3QOXA 4OHWA 3VOBA 3QEAZ 5TDHA 2IZ0A 3A6ZA 4R4JA 1D5CA 1FQWA 3OLVA 5CVDA 4DILA 1AQNA 4QYIB 1P0PA 1MXFA 2I29A 2YHIB 2ZRJA 3GHYA 4L9WA 1SIOA 2Q3DA 1GQRA 2W48A 4Q1FA 2B8EA 1TJYA 1V2GA 5FPHA 3TR6A 5IKPA 4BX3A 1CZUA 2LCIA 4LI3X 5F23A 2VDKB 4N41A 3ZH2A 5IP5A 1N2EA 2REXB 2R8OA 3P2JA 2W8ZA 4IDBA 4TWAA 1ECCA 2XOEA 1T3LA 1KAHA 1YZNA 3ORFA 4A0RA 5FHQA 3ZCSA 4M87A 5LNK1 4DCPA 5JHGB 3AY6A 5AKXA 4LXGA 3LUCA 4QXOA 2WJZB 4C2UA 4IZOA 3EWAA 4XQ9A 1Q0UA 2X5NA 2WW8A 4HXGA 4ZQIA 1DKUA 4ONEA 3R76A 5IANA 3SJCA 2J3EA 3GFOA 3OKCA 3O26A 1X7GA 3DOCA 3ITEA 3UGQA 2RH9B 2RGAA 3PGA1 4G5OA 4YCMA 1E4EB 3WIEA 1F1JA 2Q4EA 2C0PA 1RWMA 5EJ4A 1U1EA 3KUXA 1F60A 1VLLA 3LKDA 1L7PA 2GEUA 4GVXA 4TRRA 4UJ5A 3RD5A 3SSNA 3VA7A 4R8SA 1T5SA 3EQ8A 1LRLA 4ZMBA 1TVCA 1AE1A 3OX2A 4CMJA 1TAHA 1LEHA 3PKJA 2PMDA 3OZGA 1ICEA 4DE5A 4GX0A 3WGUA 5CA1B 1GD1O 2CF6A 2X2FA 1XRQA 5J58A 2DC1A 4JI7B 1C1HA 4BN4A 5ES3A 1KDVA 4RJIA 4OQNA 1ORVA 2ONKA 2YOFA 3KO8A 3K53A 2ZBEA 1TAGA 4L07A 5FPSA 3IJEB 5TQ2A 1A7KA 4ZKDA 4OQDA 5IKEA 1VCIA 2VJNA 2FZ5A 5KDLA 4EB8A 5A9TA 3H2YA 4C7OA 1NVGA 3QVTA 1D2HA 3V33A 1RWPA 1SOWA 3BAZA 1QVVA 4YRQA 3TTYA 3UV3A 2BZ0A 1DX4A 4PAMA 4UMVA 3WR5A 1CD5A 5F1YA 3ZGOA 5CX1A 4NU0A 1WY5A 5HTKA 1P5FA 1SVOA 3BHJA 4GR4A 3RS8A 5LQSA 4B4OA 3T3GA 5KHOC 2WZQA 2V8BA 1NVFA 4EHAA 1ILEA 3KXDA 2EJVA 2QVLA 2ATVA 1RAEA 3VO1A 1ODCA 1O7JA 4RHCA 4OK5A 5BW4A 1D2NA 2FE1A 2HXGA 3NVMB 4EL5A 2UZ4A 3PYMA 5EJGA 1ZSNA 3BGVA 4ZVVA 4M7PA 4UJ3A 1P9OA 4B3HA 1H4QA 1QH1B 4Y0AA 2ZI6A 3VDNB 4EKGA 2PK3A 2OFXA 1T8TA 4AQYB 2P6PA 3MWGA 1K08A 3COVA 2FUG1 2W90A 3LC1O 2BGTA 1JFTA 3KOWA 3I9V1 3O9MA 3ZDDA 3PG5A 1HYQA 4GLOA 4TT8A 4FWBA 4C22A 4L50A 2HCBA 3GT4A 3K0SA 1YDHA 1SK8A 2H8GA 3ZE8A 1QE5A 3E8SA 4Q93A 1KYTA 4WRRA 4YRLA 3PXCX 5AKGA 4EY8A 1I6WA 3IAXA 4AG5A 2BJHA 2G7ZA 5HS6A 3RUHA 4KQFA 1ZN2A 2DTDA 3AIMA 3ZE7A 3QXCA 4C5AA 4PFQA 5LOVA 1KZ9A 1MNAA 2BH9A 1SELA 4UW9A 3JQEA 1GA6A 3EVTA 4D97A 2GARA 1YR6A 3UATA 3IP6A 1ZOOA 1M1UA 3HU2A 2OORC 4GH5A 2XCIA 4UVHA 2VP2A 3C3BA 1DELA 2R4QA 4MUGA 2FMKA 4F12A 4DV7B 5IUKC 3D7KA 1R16A 6YASA 3GCZA 3LG2A 3NB0A 4Q4HB 1JQ5A 2NPFA 3PUWA 4YMHA 1XJQA 2XHEA 1X2EA 3MBKA 4RDIA 2O7SA 4CVNA 1I2MA 5ALEA 4FOLA 1ST2A 3A04A 1QIDA 2NN3C 5IAJA 3U6KA 2DQZA 3OICA 4LNAA 4GLBA 5K3CA 3TZHA 4MQ5A 1GGEA 1SGWA 3C97A 3MWEB 3JWIA 2IY7A 4K0KB 2QV7A 3NTLA 1HV8A 3DE7X 1T3TA 2NSDA 4HQLA 2J3QA 3P9IA 4QYMA 1HWYA 4FHEA 4TVKA 2R11A 1L3BA 3G1WA 3NGLA 2F1JA 3TL6A 2CSXA 1M6WA 1PTKA 3PYLA 5I9MA 3GVCA 3PUVA 4X7BA 5AH0A 5JSKA 4FW9A 3VPSA 3AF0A 2FN9A 4ATNA 3BICA 2ODQA 2YIVX 5FBQB 1N8KA 2ZYWX 5AVVA 2EJUA 4YIKA 3RTCA 1KXJA 5HM8A 3W5JA 4QSMA 4FQ8A 3UMVA