5HCDC

Ternary complex of human complement c5 with ornithodoros moubata omci and rhipicephalus microplus raci2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
148
structure length
148
Chain Sequence
b'ESDCTGSEPVDAFQAFSEGKEAYVLVRSTDPKARDCLKGEPAGEKQDNTLPVMMTFKQGTDWASTDWTFTLDGAKVTATLGQLTQNREVVYDSQSHHCHVDKVEKEVPDYEMWMLDAGGLEVEVECCRQKLEELASGRNQMYPHLKDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C5
publication title Structural basis for therapeutic inhibition of complement C5.
pubmed doi rcsb
source organism Ornithodoros moubata
molecule tags Immune system
total genus 41
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2016-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5hcdC00
1AVGI 2R74A 1YWCA 1OBQA 1SY1A 1X71A 4Y0SA 1JJJA 3WJGA 1ADLA 1U0XA 5F58A 3CBSA 4A1HA 3NR3A 2HMBA 3BDRA 4ZHCA 1QY0A 5HCDC 3U0DA 4I9RA 4HPCA 4XMCA 4GNWA 1BRQA 1MX8A 3B2IA 1SY2A 5L8IA 5LJGA 3RZYA 5FFHA 4TQ2A 3C76X 5IO7A 4NYQA 1ERXA 1E00A 2ALLX 2GJ5A 4TNNA 5EDBA 5HZ9A 3ELXA 5F6BA 3VG7A 1X89A 5F6ZA 2Q39A 2FR2A 2E4JA 1GGLA 5EPQA 3BSZE 1JYJA 2CM4A 5HTDA 1FELA 2MJIA 1B4MA 1DFVA 1YWAA 2AT0X 2HYSA 2HZRA 5F7GA 2KTDA 5K06A 2HZQA 4AZMA 5LKEA 2Q4NA 4AZQA 1CJ5A 3BX8A 2CBSA 1S44A 2WWPA 2AMMX 4AZNA 3FW5A 5DG4A 4ZJ0A 2RCTA 1MVGA 3WJDA 4OS8A 5FAZA 4IB9A 4YGZA 5HZ8A 1QY2A 3VG6A 1H91A 1I4UA 5H9KA 3FR4A 3UEXA 2Q2MA 1HQPA 5EZ2A 1BM5A 3PP6A 1PBOA 4UU3A 1MUPA 3KQ0A 4OMXA 1GT4A 1GKAA 2K62A 1ERBA 1EALA 1KT5A 3U9PC 1L6MA 2XKLA 3FA8A 5LJKA 3VG2A 1RLBE 4GRJA 4YBUA 1HN2A 1B0OA 1KT6A 3WJFA 5LKFA 1X8PA 3P6DA 1VYGA 1B8EA 2W2AA 3JS1A 1TVQA 4ES7A 3F9DA 4A60A 4GH7A 3FIQA 4BOEA 3WJBA 4ORRA 4D6BA 1KXOA 3KFHA 1QABE 1QFVA 3ZUIA 1G5WA 1E02A 4I3BA 3FA6A 1S2PA 1E06A 4WFUA 1LIFA 2AT8X 5HZ5A 3KFFA 4HPBA 3EM0A 4XMFA 3O19A 2FT9A 4A8ZA 3CR6A 2EU7X 1IFCA 5KHPA 4QGWA 3NQ9A 3P6CA 1HBPA 1JYDA 3HWDA 3FLLA 5HWZA 4ORWA 1O8VA 3PH5A 4QGVA 1AQBA 4IMOA 1E5PA 1GT3A 1NGLA 5EEDA 5IO5A 1CBQA 1TOWA 1DZMA 2OVDA 4ORUA 2R56A 2K23A 2RQ0A 4RUNA 3IFBA 1TW4A 3HK1A 1JJXA 4OS3A 3STMX 1KOIA 1SY0A 3DTQA 4RUUA 4LKPA 4NP1A 3NX1A 4AZOA 1N0SA 1KT3A 1UREA 1QG5A 3B2LA 3BRNA 4IAWA 1SXUA 4D6AA 2X45A 2O62A 4LZUA 5L8OA 3P6HA 1BSOA 4TKJA 1ZRYA 5H9AA 3PPTA 2POAA 4ZH6A 5LJHA 2NNEA 1ZNDA 3ELZA 2PY1A 1SA8A 3OJYC 5HAEA 1ZNGA 3PEDA 4GNYA 1FTPA 2R73A 4NLIA 1DC9A 4HPAA 3UEWA 1QWDA 3VG4A 2A13A 3P6FA 5DPQA 4A1YA 2A2UA 4YKOA 3TZSA 3NP1A 2P8GA 3Q6LA 1EUOA 1GT1A 4WFVA 4XMDA 1JZUA 3PH6A 4I3DA 4M6SA 4DQ3A 4YKMA 3FA7A 3WVMA 5AQ6A 3CMPA 1XKIA 1T68X 4I3CA 1BWYA 1EPBA 5C0NA 1GX8A 1BEBA 4TKHA 3KFGA 2FWVA 3K3LA 1GT5A 2QO6A 4YGGA 1O1UA 4QAEA 2JN3A 4UU2A 3FENA 1ZNKA 4ODDA 2KT4B 2ASNX 4K19A 2A2GA 3WXQA 5L8NA 3APVA 4HFOA 1T0VA 4LKTA 3AKNA 4ZR2A 3L4RA 2BLGA 3CQRA 5EDCA 4AZRA 1CBSA 3MBTA 3FMZA 3BU9A 5FENA 2FS7A 4QYNA 1A2DA 1YWDA 3HWFA 2LBAA 3EBKA 3VG5A 1KZXA 1S7DA 1X8QA 3C77X 4AW8A 2MO5A 3HWEA 1P6PA 2CM9A 1DZJA 2NNDA 1YIVA 1BSQA 1EXSA 4WBKA 3FW4A 3BS2A 2G78A 2F73A 1IIUA 1CRBA 1TOUA 3TGAA 4ZFXA 2WEWA 3PECA 1OEKA 1MDCA 2QOSC 2RCQA 5LJEA 4YH0A 3RSWA 3EMMA 1YP6A 2WUTA 2ANSA 2FS6A 2L68A 2OZQA 3NPOA 1PMPA 1Z24A 1VYFA 1G74A 5JR8A 1PM1X 1DF3A 4QGXA 2AKQA 3G7XA 1ALBA 4ALBA 1EPAA 1HMSA 1KGLA 4ORYA 3I0AA 3O2YA 2CBRA 1X8OA 1FE3A 2W2BA 4AZPA 3U03A 1R0UA 1HMRA 1QQSA 4PSQA 4ZHDA 1FENA 2WEXA 1U18A 1DZPA 1O1VA 4ZCBA 2JOZA 2L5PA 2FRSA 1IFBA 1I04A 2RA6A 3WJCA 5LJDA 5LJCA 3FA9A 3D97A 1CBIA 2A3FX 1EQDA 1BBPA 3FEKA 4YMYA 3FEPA 2Q9SA 4ZHHA 3APXA 1G7NA 4Y0RA 1BRPA 3QKGA 4KIIA 2LKKA 4GE1A 1LNMA 3UEVA 4XMEA 4ORXA 3BLGA 1GX9A 5BVQA 4EEJA 1KQXA 2AT3X 1IKEA 2RD7C 3F8AA 4M7MA 5HA1A 1ML7A 4Y0PA 3STKA 1YUPA 3CBCA 5HCCC 2AH7X 4ZGUA 4YGHA 2W2FA 4TLJA 2N93A 3WBGA 3NADA 3ZQ3A 1EIOA 1I06A 1LF7A 4GETA 4MVKA 4BVMA 4QZUA 1GM6A 3GAQA 4YBPA 1CBRA 5D8JA 2LBVA 1ZNEA 1DV9A 5HZ6A 1A57A 1ICMA 2AT5X 2XSTA 3CWKA 4I9SA 5D4AA 3ZUOA 5HCEC 1JBHA 4IB7A 4YCEA 4GKCA 2IFBA 2MM3A 1OBPA 1X8UA 2JU8A 1ZNLA 3DSZA 3TGCA 1IKJA 2NNQA 2WQ9A 3CQNA 4XMHA 4IMNA 1YWBA 1G85A 5HA0A 1D3SA 4CK4A 4YDBA 4TJZA 2JU7A 4MVIA 3O22A 2Q2PA 3P6EA 1FDQA 5CE4A 2CZTA 4IAXA 1VPRA 4ALOA 2AT6X 1LIEA 1KT4A 1XCAA 1LIBA 3I17A 2WQAE 4ZHFA 2FTBA 1EW3A 1LIDA 1OBUA 2NP1A 1BLRA 1TXLA 5D45A 4EXZA 1KQWA 3S26A 3EYCA 1PEEA 1DZKA 5HBSA 4ZH9A 4LZVA 1NP4A 3JSQA 5B29A 3TGBA 1T8VA 3NX2A 1LKEA 1HBQA 3C78X 4R0BA 4DQ4A 4YFPA 2JU3A 1UZ2X 5H9NA 1B56A 1LICA 3FR5A 2LFOA 4O9SA 1HMTA 1SXXA 3NQ3A 4NNTA 4OMWA 3IA8A 2QO5A 4NLJA 1OEJA 2FR3A 1LFOA 3HWGA 1IW2A 1QY1A 3UEUA 1OPAA 1A3YA 1JV4A 3WJEA 4IB6A 1YP7A 2DM5A 3SAOA 5KICA 3AKMA 5H8TA 3MVFA 4N7DA 1I05A 1SXYA 3BX7A 5IO6A 4XMGA 2G7BA 4YDAA 2WR6A 5HTEA 1AB0A 1ACDA 2WSJA 4ARHA 1BJ7A 2ACOA 4OS0A 5HZQA 1D2UA 1LPJA 1KT7A 2OFRX 4YFQA 1OPBA 2CZUA 3FELA 1QFTA 4IBAA 1EIIA 4IB8A 1ZNHA 4YCHA 1GXAA 3APUA 2HNXA 3BU1A 4ORSA 4NYRA 3B2JA 2HLVA 2L9CA 1SY3A 2GC9A 5B27A 1RBPA 4Y0QA 2X46A 4EFGA 3KZAA 4YFRA 1X8NA 1AELA 3STNA 2G79A 5F1EA 1KZWA 1BSYA 3VG3A 4QZTA 5LJBA 2LB6A 2OVAA 4AYHA 1U17A 3EBWA 1MX7A 3P6GA 4NNSA 3BY0A 1FEMA 3B2HA 2FLJA 1SXWA 4ZHGA 2L67A 2OVEA 3T1DA 1NP1A 4HPDA 2OFMX 4QYPA 4BQUA 4TKBA 2GTFX 3B2KA 2QO4A 2QM9A 3D96A 5D47A 2ACPX 2A0AA 4EDEA 3KFIA 4MVLA 1OEEA 5H9LA 5D48A 3D95A 3FR2A 1A18A 3TF6A 1ICNA 5BVSA 1GKAB 2AL0X 5EEEA 4N7CA 5BVTA 5KIDA 3APWA 2YG2A
chains in the Genus database with same CATH superfamily
1AVGI 2R74A 1YWCA 1OBQA 5B10O 5CHKA 1X71A 1SY1A 4Y0SA 1JJJA 3WJGA 2OY1O 2OF8A 1ADLA 1U0XA 1SWCA 3FW4A 2RTFB 1RXHA 2VFBA 5F58A 3CBSA 1N9YA 4U8UN 4A1HA 3NR3A 2HMBA 3BDRA 4O4UA 1RXJA 4QNIA 1QY0A 4ZHCA 3CKFA 4WHIA 4CV7A 2QMIA 1SRFA 3V8UA 5HCDC 3U0DA 4I9RA 4HPCA 4XMCA 3OD9A 1BRQA 4GNWA 1MX8A 3X00A 4EKVA 3B2IA 1SY2A 5L8IA 5LJGA 3RZYA 1KL5A 5FFHA 3C76X 4TQ2A 5IO7A 4NYQA 1ERXA 1E00A 2ALLX 2GJ5A 4ID2A 4GJSA 4NV8A 3ELXA 4O3WA 2ZAGA 5EDBA 5F6BA 2OY5O 1N43A 5B2AO 3VG7A 1X89A 5F6ZA 3RE6A 1AVDA 2Q39A 1SWDA 2FR2A 2E4JA 3S5VA 1GGLA 2FKGA 2FGSA 3BSZE 5EPQA 1JYJA 2CM4A 5HTDA 1FELA 2MJIA 1B4MA 1DFVA 1YWAA 2AT0X 2HYSA 2HZRA 4GZVA 2KTDA 5F7GA 5K06A 1LDOA 2HZQA 2RTLA 4AZMA 5LKEA 3VPJE 2Q4NA 4AZQA 1CJ5A 2C4IA 5L3YA 3BX8A 2CBSA 1S44A 3RKGA 1SWBA 2WWPA 2AMMX 3PDFA 4ON1A 4AZNA 3FW5A 5DG4A 4ZJ0A 1SWPA 2RCTA 1JQPA 1MVGA 3WJDA 4OS8A 5FAZA 4IB9A 4YGZA 5HZ8A 1QY2A 3VG6A 1H91A 1I4UA 5H9KA 3RDQA 3FR4A 3EW2A 4Z2PA 3UEXA 2Q2MA 1SWEA 1HQPA 2BT9A 3JQOA 5EZ2A 1BM5A 3PP6A 1PBOA 2MF6A 4UU3A 1MUPA 3KQ0A 4OMXA 1GT4A 1GKAA 3WYQA 4Z2OA 2K62A 4FBVA 5CSEA 4O4XA 1ERBA 1EALA 5IRWA 1KT5A 3U9PC 2GTLM 1L6MA 2XKLA 3FA8A 5LJKA 4LQZA 4DCBA 4DNEA 3FDCA 1RLBE 1UYNX 4GRJA 1HN2A 1B0OA 1KT6A 3HOEA 4YBUA 5LKFA 2X8SA 3SLTA 3WJFA 1X8PA 3P6DA 4MEEA 1VYGA 1B8EA 2W2AA 3JS1A 5B3MO 1TVQA 2AVIA 3SZIA 4BBOA 4ES7A 4Z27A 4Z6JA 1SWJA 3F9DA 3SLJA 4GH7A 4A60A 4Z28A 3FIQA 3VG2A 4BOEA 3WJBA 2UYWA 4ORRA 1VWCB 3ZWEA 1Y52X 4D6BA 1KXOA 1SWTA 1QABE 1QFVA 3KFHA 3FYFA 3ZUIA 1G5WA 1E02A 3ZW0B 4I3BA 4CPEA 3FA6A 1S2PA 1E06A 1LCZA 4WFUA 2RTRB 1LIFA 1VWOB 2AT8X 4L3RA 3UAQA 3EW1A 3WOVA 3KFFA 5HZ5A 4HPBA 3EM0A 4XMFA 3O19A 1DF8A 2FT9A 2KTSA 1VWFB 4A8ZA 2RTBB 1STPA 3CR6A 4O4OA 3E3CA 3QQ2A 2EU7X 1IFCA 5KHPA 4QGWA 1RSUB 1AVEA 3NQ9A 3P6CA 1JJUA 1HBPA 1JYDA 3HWDA 1JIWI 1HQQA 3FLLA 3SOTA 1HXLA 5HWZA 4ORWA 1SWGA 1O8VA 2RTNB 3PH5A 4QGVA 1AQBA 4IMOA 1E5PA 1GT3A 1NGLA 1SWLA 2OFAA 4IRWA 5EEDA 5IO5A 1CBQA 1TOWA 1DZMA 2OVDA 5AJCA 3H3IA 4ORUA 2R56A 3NQKA 1LUQA 2K23A 3AEHA 2RQ0A 4RUNA 3VGWA 3IFBA 5IRAA 1TW4A 3HK1A 2BS5A 1JJXA 2X34A 4OS3A 1MK5A 1SWHA 3STMX 1KOIA 1SY0A 3DTQA 4RUUA 1WUBA 4LKPA 1VWNB 4NP1A 3NX1A 2VDFA 4AZOA 2RTJA 4TNNA 1VWLB 1W5RA 1N0SA 3RDUA 1KT3A 3D9WA 1NDJA 1UREA 1K3BA 1QG5A 3B2LA 1HY2A 1SXUA 3BRNA 4GU8A 1PBYA 2X45A 4IAWA 3S60A 3WYPA 5FQ8E 2O62A 4LZUA 4FGIB 3NBXX 3P6HA 5L8OA 4KC8A 3ZI8A 1MOYA 1BSOA 3VHIA 3SZJA 4TKJA 1ZRYA 1N4JA 4GD9A 5H9AA 1E2TA 3PPTA 2POAA 1Y0GA 4ZH6A 3LHNA 2Z4IA 1FJ1E 2NNEA 3T6LA 1SWRA 1ZNDA 2PY1A 1SA8A 3AUMO 3ELZA 3OJYC 5HAEA 1ZNGA 3PEDA 4GNYA 1FTPA 2R73A 4NLIA 1DC9A 4HPAA 3UEWA 1QWDA 3VG4A 2A13A 3P6FA 1SLEB 2QCBA 5DPQA 4CDFA 4A1YA 2A2UA 4BJ8A 4YKOA 3TZSA 3VHMA 3NP1A 2P8GA 3Q6LA 1EUOA 1GT1A 2IZFB 2KW1A 4WFVA 1SRHA 4XMDA 4EQAC 5BYPA 1KL3A 3PH6A 1JZUA 4I3DA 4M6SA 1RAVA 4DQ3A 4YKMA 1Y53X 2RTKA 3FA7A 1UYOX 3WVMA 4CPHA 5AQ6A 4KCAA 3CMPA 1VWJB 1T68X 1XKIA 2IZDB 2BC3A 4I3CA 1BWYA 1EPBA 2FHLA 5C0NA 1GX8A 1BEBA 4TKHA 4INNA 3KFGA 2FWVA 3K3LA 1GT5A 4NW4A 2QO6A 4YGGA 1N7YA 1O1UA 2OL8O 4QAEA 2JN3A 2QOMA 2X32A 4B55A 4UU2A 3FENA 1ZNKA 4MVEA 4ODDA 2JGSA 2KT4B 2ASNX 4K19A 2RTHB 3RBYA 2A2GA 3WXQA 2Y3EA 5L8NA 3APVA 4HFOA 1SLDB 1T0VA 4LKTA 3AKNA 3RE5A 4ZR2A 1JMZA 3L4RA 2UZ2A 2BLGA 3CQRA 5EDCA 4AZRA 1CBSA 3MBTA 2IZIA 3FMZA 1SREA 2MHDA 2ZAIA 5K68A 3BU9A 5FENA 1NC9A 2FS7A 4QYNA 1A2DA 5AJBA 1YWDA 4GGRA 3HWFA 3CKGA 4D6AA 2LBAA 2IZLB 3EBKA 3VG5A 2C1QA 1VWMB 1KZXA 1S7DA 1X8QA 2ZSCA 3C77X 4GGZA 4GGTA 4AW8A 4BX7B 4CDCA 2MO5A 3HWEA 4O4SA 2VFCA 1P6PA 2CM9A 4O3XB 1RXKA 1DZJA 2NNDA 3EC5A 1YIVA 1BSQA 2A5BA 1EXSA 2X4MA 1VWBB 2IZHB 2G78A 2F73A 1IIUA 1CRBA 1PTSA 1TOUA 2RTPB 3BS2A 4I95A 3TGAA 3FIDA 2WEWA 3PECA 3WZOA 1OEKA 1MDCA 2DJFA 2QOSC 4FQBB 2RCQA 2FKJA 5JD2A 5LJEA 4YH0A 1VWIB 3RSWA 2G5LA 3EMMA 1YP6A 2X55A 3PK2A 2WUTA 4U9CA 2ANSA 2FS6A 2L68A 2OZQA 3NPOA 1PMPA 1Z24A 2OF9A 3RDXA 1VYFA 1G74A 4U8UM 5JR8A 1PM1X 1DF3A 4QGXA 2AKQA 1VWPB 2OL6O 4FBRA 3G7XA 3LTWA 1ALBA 4ALBA 1EPAA 1HMSA 1KGLA 4ORYA 2RTMA 2C1SA 3D4RA 3I0AA 4CPHB 4CDEA 3O2YA 2CBRA 1X8OA 5B5FA 1FE3A 2W2BA 4AZPA 2A5CA 4BX6B 3U03A 1R0UA 1HMRA 1QQSA 4PSQA 4ZHDA 1FENA 4WBKA 2WEXA 1U18A 1DZPA 1SLFB 1O1VA 2BS6A 2RTDB 2JOZA 2L5PA 4ZCBA 2FRSA 1IFBA 1I04A 2RA6A 3GE2A 4PJ2A 3WJCA 4CDDA 5LJDA 5LJCA 4ZFXA 1Y9TA 1VWDB 4CSBA 3P24A 4O3ZA 2RTIB 5FQ6E 3FA9A 3D97A 5B11O 1CBIA 3RDOA 2A3FX 1EQDA 2CAMA 1BBPA 2Y3FA 3FEKA 2I5VO 2KD2A 3MM0A 3FEPA 2Q9SA 4MIRA 3SLOA 3APXA 4ZHHA 1KL4A 1SLGB 1G7NA 4O3YA 1I9HA 4Y0RA 3RWXA 1RSTB 1SMPI 4JGLA 1BRPA 3QKGA 2M4LA 2RN4A 4KIIA 3LV4A 2LKKA 4GE1A 1WBIA 1LNMA 3UEVA 4XMEA 2FHNX 4ZGFA 4ORXA 2G8CO 1GX9A 3BLGA 5IRUA 5BVQA 4EEJA 1KQXA 1NQMA 1SWAA 1IKEA 2AT3X 2X56A 3N91A 4L1NA 4BX7A 5AEOA 2RD7C 3F8AA 1SWOA 4M7MA 5HA1A 1VWGB 3ZW2A 1ML7A 4Y0PA 3T2WA 3STKA 1YUPA 3CBCA 4NV7A 1GX3A 2AH7X 4ZGUA 5HCCC 3ZW0A 1VWAB 4YGHA 1Y55X 2W2FA 2X8FA 4TLJA 2N93A 1SWSA 3NADA 3WBGA 1SRJA 3ZQ3A 1EIOA 1I06A 1LF7A 1LDQA 1SWFA 2Y32A 4GETA 4MVKA 1GM6A 3GAQA 4QZUA 3F6ZB 3RY2A 1CBRA 1OSPO 2BSZA 4YBPA 4YVBA 5D8JA 2LBVA 2OY7A 1ZNEA 1DV9A 5HZ6A 2BHVA 1A57A 1ICMA 2AT5X 2WPUA 2XSTA 3CWKA 3HOLA 4I9SA 5D4AA 3WZNA 4GDAA 3ZUOA 5HCEC 4GDZA 2GH7A 1JBHA 4IB7A 1VYOA 4YCEA 4GKCA 2IFBA 2MM3A 4ML7B 1SWNA 3HPEA 1OBPA 1X8UA 2JU8A 1ZNLA 2GTLO 3DSZA 2IZJA 3MX7A 4I6SA 3TGCA 1IKJA 2RTCB 2NNQA 2WQ9A 3CQNA 4XMHA 5LJHA 3VU1A 5IXGA 2RTEB 1YWBA 4IMNA 1G85A 5HA0A 1STSB 1D3SA 1SWKA 1W6FA 2MWHA 4JO6A 4BX6A 4CK4A 2IZGB 4YDBA 4TJZA 2JU7A 3RY1A 1W4TA 1K24A 4MVIA 4O49A 2A8GA 3O22A 2Q2PA 3P6EA 1FDQA 3OBLA 5CE4A 2CZTA 4IAXA 3T6FA 5CYBA 1VPRA 3P02A 5B5GA 3WZQA 4ALOA 2AT6X 1SRGA 1LIEA 1KT4A 1XCAA 1LIBA 1VWRB 2F09A 3I17A 3WZPA 2WQAE 2OL7A 4HWMA 4U8UO 4BX5B 1VWEB 2FTBA 1EW3A 4ZHFA 1LIDA 4MISA 1OBUA 2NP1A 2IZAA 1TXLA 5D45A 4EXZA 1BLRA 1KQWA 3S26A 3EYCA 1PEEA 5K67A 1DZKA 1HXZA 2HKDA 5HBSA 4ZH9A 1Y9LA 3SZHA 4LZVA 4GK9A 1NP4A 3JSQA 5B29A 3TGBA 1T8VA 2OY8A 4FBOA 5FQ7E 1SWQA 3NX2A 1LKEA 3VE1A 4CPFA 1HBQA 3C78X 4R0BA 4DQ4A 3VE2A 4YFPA 2AF5A 1UZ2X 2JU3A 3ZW1B 4CPIA 5H9NA 1VWQB 4KH8A 1B56A 1LICA 3FR5A 2RTQB 4YMYA 2LFOA 4O9SA 1HMTA 1SXXA 3OE3A 2OFBA 1I78A 3NQ3A 4NNTA 4QQ1A 4OMWA 3HTYA 2IZEB 3IA8A 3KVNA 2QO5A 4NLJA 1OEJA 2FR3A 2DJGA 1LFOA 3HWGA 1IW2A 1QY1A 3UEUA 2JW1A 1OPAA 4U46A 1A3YA 1JV4A 2RTAA 4C5PA 2LA7A 4Y59A 4BCSA 4Y5DA 3WJEA 4OELA 4IB6A 1NBXA 1YP7A 1SWUA 2DM5A 2JMBA 2YMSA 3SAOA 5KICA 3AKMA 5H8TA 3MVFA 4IABA 2IZBA 4N7DA 1I05A 1SXYA 3BX7A 1LCVA 1VWHB 5IO6A 4XMGA 3RDMA 2F01A 2IZKA 1JMXA 3PQSA 2G7BA 4YDAA 2RTOB 2WR6A 5HTEA 1AB0A 3ZZVA 2RTGB 1ACDA 2WSJA 3Q34A 1BJ7A 4ARHA 3VHHA 2ACOA 2OVSA 4OS0A 5HZQA 1D2UA 1LPJA 2X8TA 1KT7A 2OFRX 4YFQA 3S5XA 1OPBA 2CZUA 3FELA 1QFTA 4IBAA 4JNJA 4IB8A 1EIIA 1EI5A 1MM9A 1ZNHA 1GXAA 3APUA 4KT5A 4YCHA 2HNXA 3BU1A 4ORSA 2PI3O 4NYRA 3B2JA 2HLVA 2L9CA 1SY3A 2GC9A 5B27A 1RBPA 4Y0QA 2X46A 4GJVA 3KZAA 4I60A 5F2BA 3MG5A 1X8NA 4BGFA 4EFGA 4YFRA 1VWKB 3STNA 2G79A 5F1EA 1AELA 1BSYA 3VG3A 1KZWA 4QZTA 1SRIA 4BX5A 5LJBA 2LB6A 2OVAA 4AYHA 4Z2VA 1U17A 3EBWA 1MX7A 3P6GA 4KC7A 4NNSA 3BY0A 1KFFA 1FEMA 3B2HA 2FLJA 1SXWA 2Z4HA 4ZHGA 2L67A 2OVEA 1N9MA 3T2XA 1NP1A 3T1DA 4HPDA 2OFMX 4QYPA 4BQUA 4OKAA 4TKBA 2GTFX 3B2KA 2GTLN 2QO4A 2OYBO 4BVMA 2QM9A 3D96A 5D47A 3ZW1A 2ACPX 4OEMA 4JHQA 2A0AA 1MEPA 4EDEA 1NQNA 4GUZA 3KFIA 1LCWA 4MVLA 4QRLA 4U3QA 1OEEA 5H9LA 1LELA 2I5ZO 1IJ8A 5D48A 3D95A 3PQUA 3RDSA 3FR2A 1A18A 2IZCB 3TF6A 1STRB 1ICNA 5BVSA 1GKAB 2AL0X 5EEEA 4N7CA 5BVTA 5KIDA 3APWA 5HZ9A 4COTA 2YG2A
chains in the Genus database with same CATH topology
1AVGI 2R74A 1YWCA 1OBQA 1SY1A 1X71A 4Y0SA 1JJJA 3WJGA 1ADLA 1U0XA 5F58A 3CBSA 4U8UN 4A1HA 3NR3A 2HMBA 3BDRA 4O4UA 4QNIA 4ZHCA 1QY0A 4CV7A 4WHIA 2QMIA 3V8UA 5HCDC 3U0DA 4I9RA 4HPCA 4XMCA 3OD9A 1BRQA 4GNWA 1MX8A 3B2IA 1SY2A 5L8IA 5LJGA 3RZYA 5FFHA 4TQ2A 3C76X 5IO7A 4NYQA 1ERXA 1E00A 2ALLX 2GJ5A 4ID2A 4TNNA 5EDBA 3ELXA 4O3WA 2ZAGA 5F6BA 3VG7A 1X89A 5F6ZA 2Q39A 2FR2A 2E4JA 3S5VA 1GGLA 5EPQA 3BSZE 1JYJA 2CM4A 5HTDA 1FELA 2MJIA 1B4MA 1DFVA 1YWAA 2AT0X 2HYSA 2HZRA 4GZVA 2KTDA 5F7GA 5K06A 2HZQA 4AZMA 5LKEA 3VPJE 2Q4NA 4AZQA 1CJ5A 3BX8A 2CBSA 1S44A 3RKGA 2WWPA 4ON1A 2AMMX 4AZNA 3FW5A 5DG4A 4ZJ0A 2RCTA 1MVGA 3WJDA 4OS8A 5FAZA 4IB9A 4YGZA 5HZ8A 1QY2A 3VG6A 1H91A 1I4UA 5H9KA 3FR4A 3UEXA 2Q2MA 1HQPA 2BT9A 3JQOA 5EZ2A 1BM5A 3PP6A 1PBOA 4UU3A 1MUPA 3KQ0A 4OMXA 1GT4A 1GKAA 2K62A 4FBVA 4O4XA 1ERBA 1EALA 1KT5A 3U9PC 2GTLM 1L6MA 2XKLA 3FA8A 5LJKA 4LQZA 3VG2A 1RLBE 4GRJA 4YBUA 1HN2A 1B0OA 1KT6A 3HOEA 5LKFA 3WJFA 2X8SA 1X8PA 3P6DA 1VYGA 1B8EA 2W2AA 3JS1A 1TVQA 4ES7A 3F9DA 4A60A 4GH7A 3FIQA 4BOEA 3WJBA 4ORRA 3ZWEA 4D6BA 1KXOA 3KFHA 1QABE 1QFVA 3FYFA 3ZUIA 1G5WA 1E02A 4I3BA 3FA6A 1S2PA 1E06A 4WFUA 1LIFA 2AT8X 4L3RA 3UAQA 3WOVA 5HZ5A 3KFFA 4HPBA 3EM0A 4XMFA 3O19A 2KTSA 2FT9A 4A8ZA 3CR6A 4O4OA 3E3CA 2EU7X 1IFCA 5KHPA 4QGWA 3NQ9A 3P6CA 1HBPA 1JYDA 3HWDA 1JIWI 3FLLA 3SOTA 5HWZA 4ORWA 1O8VA 3PH5A 4QGVA 1AQBA 4IMOA 1E5PA 1GT3A 1NGLA 5EEDA 5IO5A 1CBQA 1TOWA 1DZMA 2OVDA 5AJCA 3H3IA 4ORUA 2R56A 3NQKA 2K23A 2RQ0A 4RUNA 3IFBA 1TW4A 3HK1A 2BS5A 1JJXA 4OS3A 3STMX 1KOIA 1SY0A 3DTQA 4RUUA 4LKPA 4NP1A 4ZGFA 3NX1A 4AZOA 1N0SA 1KT3A 1UREA 1QG5A 3B2LA 3BRNA 4GU8A 1SXUA 4IAWA 4D6AA 2X45A 3S60A 5FQ8E 2O62A 4LZUA 4FGIB 3NBXX 3P6HA 5L8OA 4KC8A 3ZI8A 1BSOA 4TKJA 1ZRYA 5H9AA 3PPTA 2POAA 4ZH6A 3LHNA 2Z4IA 5LJHA 2NNEA 1ZNDA 3ELZA 2PY1A 1SA8A 3OJYC 5HAEA 1ZNGA 3PEDA 4GNYA 1FTPA 2R73A 4NLIA 1DC9A 4HPAA 3UEWA 1QWDA 3VG4A 2A13A 3P6FA 5DPQA 4A1YA 2A2UA 4YKOA 3TZSA 3NP1A 2P8GA 3Q6LA 1EUOA 1GT1A 2KW1A 4WFVA 4XMDA 4EQAC 1JZUA 5BYPA 3PH6A 4I3DA 4M6SA 4DQ3A 4YKMA 3FA7A 3WVMA 5AQ6A 4KCAA 3CMPA 1XKIA 1T68X 4I3CA 1BWYA 1EPBA 5C0NA 1GX8A 1BEBA 4TKHA 4INNA 3KFGA 2FWVA 3K3LA 1GT5A 4NW4A 2QO6A 4YGGA 1O1UA 4QAEA 2JN3A 4UU2A 3FENA 1ZNKA 4MVEA 4ODDA 2KT4B 2ASNX 4K19A 3RBYA 2A2GA 3WXQA 5L8NA 3APVA 4HFOA 1T0VA 4LKTA 3AKNA 4ZR2A 3L4RA 2BLGA 3CQRA 5EDCA 4AZRA 1CBSA 3MBTA 3FMZA 2MHDA 2ZAIA 3BU9A 5FENA 2FS7A 4QYNA 1A2DA 5AJBA 1YWDA 3HWFA 2LBAA 3EBKA 3VG5A 1KZXA 1S7DA 1X8QA 3C77X 4AW8A 2MO5A 3HWEA 4O4SA 1P6PA 2CM9A 4O3XB 1DZJA 2NNDA 1YIVA 1BSQA 2X8FA 1EXSA 4WBKA 3FW4A 3BS2A 2G78A 2F73A 1IIUA 1CRBA 1TOUA 4I95A 3TGAA 3ZW0B 4ZFXA 2WEWA 3PECA 1OEKA 1MDCA 2QOSC 4FQBB 2RCQA 5LJEA 4YH0A 3RSWA 3EMMA 1YP6A 2WUTA 4U9CA 2ANSA 2FS6A 2L68A 2OZQA 3NPOA 1PMPA 1Z24A 1VYFA 1G74A 4U8UM 5JR8A 1PM1X 1DF3A 4QGXA 2AKQA 4FBRA 3G7XA 1ALBA 4ALBA 1EPAA 1HMSA 1KGLA 4ORYA 3D4RA 3I0AA 3O2YA 2CBRA 1X8OA 1FE3A 2W2BA 4AZPA 3U03A 1R0UA 1HMRA 1QQSA 4PSQA 4ZHDA 1FENA 2WEXA 1U18A 1DZPA 1O1VA 2BS6A 4ZCBA 2JOZA 2L5PA 2FRSA 1IFBA 1I04A 2RA6A 3GE2A 4PJ2A 3WJCA 5LJDA 5LJCA 1Y9TA 4CSBA 3P24A 4O3ZA 5FQ6E 3FA9A 3D97A 1CBIA 2A3FX 1EQDA 1BBPA 3FEKA 4YMYA 2KD2A 4MIRA 3FEPA 2Q9SA 4ZHHA 3APXA 1G7NA 4O3YA 4Y0RA 3RWXA 1SMPI 4JGLA 1BRPA 3QKGA 2M4LA 2RN4A 4KIIA 3LV4A 2LKKA 4GE1A 1LNMA 3UEVA 4XMEA 4ORXA 3BLGA 1GX9A 5BVQA 4EEJA 1KQXA 2AT3X 3N91A 1IKEA 4L1NA 5AEOA 2RD7C 3F8AA 4M7MA 5HA1A 3ZW2A 1ML7A 4Y0PA 3STKA 1YUPA 3CBCA 5HCCC 2AH7X 4ZGUA 3ZW0A 4YGHA 2W2FA 4TLJA 2N93A 3WBGA 3NADA 3ZQ3A 1EIOA 1I06A 1LF7A 4GETA 4MVKA 4BVMA 4QZUA 1GM6A 3GAQA 4YBPA 3F6ZB 1CBRA 5D8JA 2LBVA 1ZNEA 1DV9A 5HZ6A 2BHVA 1A57A 1ICMA 2AT5X 2XSTA 3CWKA 3HOLA 4I9SA 5D4AA 3ZUOA 5HCEC 4GDZA 1JBHA 4IB7A 4YCEA 4GKCA 2IFBA 2MM3A 4ML7B 1OBPA 1X8UA 2JU8A 1ZNLA 2GTLO 3DSZA 3MX7A 4I6SA 3TGCA 1IKJA 2NNQA 2WQ9A 3CQNA 4XMHA 3VU1A 4IMNA 1YWBA 1G85A 5HA0A 1D3SA 2MWHA 4CK4A 4YDBA 4TJZA 2JU7A 4MVIA 4O49A 3O22A 2Q2PA 3P6EA 1FDQA 3OBLA 5CE4A 2CZTA 4IAXA 5CYBA 1VPRA 3P02A 4ALOA 2AT6X 1LIEA 1KT4A 1XCAA 1LIBA 2F09A 3I17A 2WQAE 4HWMA 4U8UO 4ZHFA 2FTBA 1EW3A 1LIDA 4MISA 1OBUA 2NP1A 1BLRA 1TXLA 5D45A 4EXZA 1KQWA 3S26A 3EYCA 1PEEA 1DZKA 5HBSA 4ZH9A 1Y9LA 4LZVA 4GK9A 1NP4A 3JSQA 5B29A 3TGBA 1T8VA 4FBOA 5FQ7E 3VE1A 3NX2A 1LKEA 1HBQA 3C78X 4R0BA 4DQ4A 3VE2A 4YFPA 2JU3A 1UZ2X 3ZW1B 5H9NA 4KH8A 1B56A 1LICA 3FR5A 2LFOA 4O9SA 1HMTA 1SXXA 3OE3A 3NQ3A 4NNTA 4QQ1A 4OMWA 3HTYA 3IA8A 2QO5A 4NLJA 1OEJA 2FR3A 1LFOA 3HWGA 1IW2A 1QY1A 3UEUA 2JW1A 1OPAA 1A3YA 1JV4A 2LA7A 3WJEA 4IB6A 1YP7A 2DM5A 2JMBA 2YMSA 3SAOA 5KICA 3AKMA 5H8TA 3MVFA 4IABA 4N7DA 1I05A 1SXYA 3BX7A 5IO6A 4XMGA 3PQSA 2G7BA 4YDAA 2WR6A 5HTEA 1AB0A 3ZZVA 1ACDA 2WSJA 4ARHA 1BJ7A 2ACOA 2OVSA 4OS0A 5HZQA 1D2UA 1LPJA 2X8TA 1KT7A 2OFRX 4YFQA 3S5XA 1OPBA 2CZUA 3FELA 1QFTA 4IBAA 1EIIA 4IB8A 1EI5A 1ZNHA 4KT5A 1GXAA 3APUA 4YCHA 2HNXA 3BU1A 4ORSA 4NYRA 3B2JA 2HLVA 2L9CA 1SY3A 2GC9A 5B27A 1RBPA 4Y0QA 2X46A 4EFGA 3KZAA 4YFRA 1X8NA 1AELA 3STNA 2G79A 5F1EA 1KZWA 1BSYA 3VG3A 4QZTA 5LJBA 2LB6A 2OVAA 4AYHA 1U17A 3EBWA 1MX7A 3P6GA 4KC7A 4NNSA 3BY0A 1FEMA 3B2HA 2FLJA 1SXWA 2Z4HA 4ZHGA 2L67A 2OVEA 3T1DA 1NP1A 4HPDA 2OFMX 4QYPA 4BQUA 4TKBA 2GTFX 3B2KA 2GTLN 2QO4A 2QM9A 3D96A 5D47A 3ZW1A 2ACPX 2A0AA 4EDEA 3KFIA 4MVLA 4QRLA 4U3QA 1OEEA 5H9LA 5D48A 3D95A 3PQUA 3FR2A 1A18A 3TF6A 1ICNA 5BVSA 1GKAB 2AL0X 5EEEA 4N7CA 5BVTA 5KIDA 3APWA 5HZ9A 4COTA 2YG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVG I;  2R74 A;  1YWC A;  1OBQ A;  1SY1 A;  1X71 A;  4Y0S A;  1JJJ A;  3WJG A;  1ADL A;  1U0X A;  5F58 A;  3CBS A;  4A1H A;  3NR3 A;  2HMB A;  3BDR A;  4ZHC A;  1QY0 A;  5HCD C;  3U0D A;  4I9R A;  4HPC A;  4XMC A;  4GNW A;  1BRQ A;  1MX8 A;  3B2I A;  1SY2 A;  5L8I A;  5LJG A;  3RZY A;  5FFH A;  4TQ2 A;  3C76 X;  5IO7 A;  4NYQ A;  1ERX A;  1E00 A;  2ALL X;  2GJ5 A;  4TNN A;  5EDB A;  5HZ9 A;  3ELX A;  5F6B A;  3VG7 A;  1X89 A;  5F6Z A;  2Q39 A;  2FR2 A;  2E4J A;  1GGL A;  5EPQ A;  3BSZ E;  1JYJ A;  2CM4 A;  5HTD A;  1FEL A;  2MJI A;  1B4M A;  1DFV A;  1YWA A;  2AT0 X;  2HYS A;  2HZR A;  5F7G A;  2KTD A;  5K06 A;  2HZQ A;  4AZM A;  5LKE A;  2Q4N A;  4AZQ A;  1CJ5 A;  3BX8 A;  2CBS A;  1S44 A;  2WWP A;  2AMM X;  4AZN A;  3FW5 A;  5DG4 A;  4ZJ0 A;  2RCT A;  1MVG A;  3WJD A;  4OS8 A;  5FAZ A;  4IB9 A;  4YGZ A;  5HZ8 A;  1QY2 A;  3VG6 A;  1H91 A;  1I4U A;  5H9K A;  3FR4 A;  3UEX A;  2Q2M A;  1HQP A;  5EZ2 A;  1BM5 A;  3PP6 A;  1PBO A;  4UU3 A;  1MUP A;  3KQ0 A;  4OMX A;  1GT4 A;  1GKA A;  2K62 A;  1ERB A;  1EAL A;  1KT5 A;  3U9P C;  1L6M A;  2XKL A;  3FA8 A;  5LJK A;  3VG2 A;  1RLB E;  4GRJ A;  4YBU A;  1HN2 A;  1B0O A;  1KT6 A;  3WJF A;  5LKF A;  1X8P A;  3P6D A;  1VYG A;  1B8E A;  2W2A A;  3JS1 A;  1TVQ A;  4ES7 A;  3F9D A;  4A60 A;  4GH7 A;  3FIQ A;  4BOE A;  3WJB A;  4ORR A;  4D6B A;  1KXO A;  3KFH A;  1QAB E;  1QFV A;  3ZUI A;  1G5W A;  1E02 A;  4I3B A;  3FA6 A;  1S2P A;  1E06 A;  4WFU A;  1LIF A;  2AT8 X;  5HZ5 A;  3KFF A;  4HPB A;  3EM0 A;  4XMF A;  3O19 A;  2FT9 A;  4A8Z A;  3CR6 A;  2EU7 X;  1IFC A;  5KHP A;  4QGW A;  3NQ9 A;  3P6C A;  1HBP A;  1JYD A;  3HWD A;  3FLL A;  5HWZ A;  4ORW A;  1O8V A;  3PH5 A;  4QGV A;  1AQB A;  4IMO A;  1E5P A;  1GT3 A;  1NGL A;  5EED A;  5IO5 A;  1CBQ A;  1TOW A;  1DZM A;  2OVD A;  4ORU A;  2R56 A;  2K23 A;  2RQ0 A;  4RUN A;  3IFB A;  1TW4 A;  3HK1 A;  1JJX A;  4OS3 A;  3STM X;  1KOI A;  1SY0 A;  3DTQ A;  4RUU A;  4LKP A;  4NP1 A;  3NX1 A;  4AZO A;  1N0S A;  1KT3 A;  1URE A;  1QG5 A;  3B2L A;  3BRN A;  4IAW A;  1SXU A;  4D6A A;  2X45 A;  2O62 A;  4LZU A;  5L8O A;  3P6H A;  1BSO A;  4TKJ A;  1ZRY A;  5H9A A;  3PPT A;  2POA A;  4ZH6 A;  5LJH A;  2NNE A;  1ZND A;  3ELZ A;  2PY1 A;  1SA8 A;  3OJY C;  5HAE A;  1ZNG A;  3PED A;  4GNY A;  1FTP A;  2R73 A;  4NLI A;  1DC9 A;  4HPA A;  3UEW A;  1QWD A;  3VG4 A;  2A13 A;  3P6F A;  5DPQ A;  4A1Y A;  2A2U A;  4YKO A;  3TZS A;  3NP1 A;  2P8G A;  3Q6L A;  1EUO A;  1GT1 A;  4WFV A;  4XMD A;  1JZU A;  3PH6 A;  4I3D A;  4M6S A;  4DQ3 A;  4YKM A;  3FA7 A;  3WVM A;  5AQ6 A;  3CMP A;  1XKI A;  1T68 X;  4I3C A;  1BWY A;  1EPB A;  5C0N A;  1GX8 A;  1BEB A;  4TKH A;  3KFG A;  2FWV A;  3K3L A;  1GT5 A;  2QO6 A;  4YGG A;  1O1U A;  4QAE A;  2JN3 A;  4UU2 A;  3FEN A;  1ZNK A;  4ODD A;  2KT4 B;  2ASN X;  4K19 A;  2A2G A;  3WXQ A;  5L8N A;  3APV A;  4HFO A;  1T0V A;  4LKT A;  3AKN A;  4ZR2 A;  3L4R A;  2BLG A;  3CQR A;  5EDC A;  4AZR A;  1CBS A;  3MBT A;  3FMZ A;  3BU9 A;  5FEN A;  2FS7 A;  4QYN A;  1A2D A;  1YWD A;  3HWF A;  2LBA A;  3EBK A;  3VG5 A;  1KZX A;  1S7D A;  1X8Q A;  3C77 X;  4AW8 A;  2MO5 A;  3HWE A;  1P6P A;  2CM9 A;  1DZJ A;  2NND A;  1YIV A;  1BSQ A;  1EXS A;  4WBK A;  3FW4 A;  3BS2 A;  2G78 A;  2F73 A;  1IIU A;  1CRB A;  1TOU A;  3TGA A;  4ZFX A;  2WEW A;  3PEC A;  1OEK A;  1MDC A;  2QOS C;  2RCQ A;  5LJE A;  4YH0 A;  3RSW A;  3EMM A;  1YP6 A;  2WUT A;  2ANS A;  2FS6 A;  2L68 A;  2OZQ A;  3NPO A;  1PMP A;  1Z24 A;  1VYF A;  1G74 A;  5JR8 A;  1PM1 X;  1DF3 A;  4QGX A;  2AKQ A;  3G7X A;  1ALB A;  4ALB A;  1EPA A;  1HMS A;  1KGL A;  4ORY A;  3I0A A;  3O2Y A;  2CBR A;  1X8O A;  1FE3 A;  2W2B A;  4AZP A;  3U03 A;  1R0U A;  1HMR A;  1QQS A;  4PSQ A;  4ZHD A;  1FEN A;  2WEX A;  1U18 A;  1DZP A;  1O1V A;  4ZCB A;  2JOZ A;  2L5P A;  2FRS A;  1IFB A;  1I04 A;  2RA6 A;  3WJC A;  5LJD A;  5LJC A;  3FA9 A;  3D97 A;  1CBI A;  2A3F X;  1EQD A;  1BBP A;  3FEK A;  4YMY A;  3FEP A;  2Q9S A;  4ZHH A;  3APX A;  1G7N A;  4Y0R A;  1BRP A;  3QKG A;  4KII A;  2LKK A;  4GE1 A;  1LNM A;  3UEV A;  4XME A;  4ORX A;  3BLG A;  1GX9 A;  5BVQ A;  4EEJ A;  1KQX A;  2AT3 X;  1IKE A;  2RD7 C;  3F8A A;  4M7M A;  5HA1 A;  1ML7 A;  4Y0P A;  3STK A;  1YUP A;  3CBC A;  5HCC C;  2AH7 X;  4ZGU A;  4YGH A;  2W2F A;  4TLJ A;  2N93 A;  3WBG A;  3NAD A;  3ZQ3 A;  1EIO A;  1I06 A;  1LF7 A;  4GET A;  4MVK A;  4BVM A;  4QZU A;  1GM6 A;  3GAQ A;  4YBP A;  1CBR A;  5D8J A;  2LBV A;  1ZNE A;  1DV9 A;  5HZ6 A;  1A57 A;  1ICM A;  2AT5 X;  2XST A;  3CWK A;  4I9S A;  5D4A A;  3ZUO A;  5HCE C;  1JBH A;  4IB7 A;  4YCE A;  4GKC A;  2IFB A;  2MM3 A;  1OBP A;  1X8U A;  2JU8 A;  1ZNL A;  3DSZ A;  3TGC A;  1IKJ A;  2NNQ A;  2WQ9 A;  3CQN A;  4XMH A;  4IMN A;  1YWB A;  1G85 A;  5HA0 A;  1D3S A;  4CK4 A;  4YDB A;  4TJZ A;  2JU7 A;  4MVI A;  3O22 A;  2Q2P A;  3P6E A;  1FDQ A;  5CE4 A;  2CZT A;  4IAX A;  1VPR A;  4ALO A;  2AT6 X;  1LIE A;  1KT4 A;  1XCA A;  1LIB A;  3I17 A;  2WQA E;  4ZHF A;  2FTB A;  1EW3 A;  1LID A;  1OBU A;  2NP1 A;  1BLR A;  1TXL A;  5D45 A;  4EXZ A;  1KQW A;  3S26 A;  3EYC A;  1PEE A;  1DZK A;  5HBS A;  4ZH9 A;  4LZV A;  1NP4 A;  3JSQ A;  5B29 A;  3TGB A;  1T8V A;  3NX2 A;  1LKE A;  1HBQ A;  3C78 X;  4R0B A;  4DQ4 A;  4YFP A;  2JU3 A;  1UZ2 X;  5H9N A;  1B56 A;  1LIC A;  3FR5 A;  2LFO A;  4O9S A;  1HMT A;  1SXX A;  3NQ3 A;  4NNT A;  4OMW A;  3IA8 A;  2QO5 A;  4NLJ A;  1OEJ A;  2FR3 A;  1LFO A;  3HWG A;  1IW2 A;  1QY1 A;  3UEU A;  1OPA A;  1A3Y A;  1JV4 A;  3WJE A;  4IB6 A;  1YP7 A;  2DM5 A;  3SAO A;  5KIC A;  3AKM A;  5H8T A;  3MVF A;  4N7D A;  1I05 A;  1SXY A;  3BX7 A;  5IO6 A;  4XMG A;  2G7B A;  4YDA A;  2WR6 A;  5HTE A;  1AB0 A;  1ACD A;  2WSJ A;  4ARH A;  1BJ7 A;  2ACO A;  4OS0 A;  5HZQ A;  1D2U A;  1LPJ A;  1KT7 A;  2OFR X;  4YFQ A;  1OPB A;  2CZU A;  3FEL A;  1QFT A;  4IBA A;  1EII A;  4IB8 A;  1ZNH A;  4YCH A;  1GXA A;  3APU A;  2HNX A;  3BU1 A;  4ORS A;  4NYR A;  3B2J A;  2HLV A;  2L9C A;  1SY3 A;  2GC9 A;  5B27 A;  1RBP A;  4Y0Q A;  2X46 A;  4EFG A;  3KZA A;  4YFR A;  1X8N A;  1AEL A;  3STN A;  2G79 A;  5F1E A;  1KZW A;  1BSY A;  3VG3 A;  4QZT A;  5LJB A;  2LB6 A;  2OVA A;  4AYH A;  1U17 A;  3EBW A;  1MX7 A;  3P6G A;  4NNS A;  3BY0 A;  1FEM A;  3B2H A;  2FLJ A;  1SXW A;  4ZHG A;  2L67 A;  2OVE A;  3T1D A;  1NP1 A;  4HPD A;  2OFM X;  4QYP A;  4BQU A;  4TKB A;  2GTF X;  3B2K A;  2QO4 A;  2QM9 A;  3D96 A;  5D47 A;  2ACP X;  2A0A A;  4EDE A;  3KFI A;  4MVL A;  1OEE A;  5H9L A;  5D48 A;  3D95 A;  3FR2 A;  1A18 A;  3TF6 A;  1ICN A;  5BVS A;  1GKA B;  2AL0 X;  5EEE A;  4N7C A;  5BVT A;  5KID A;  3APW A;  2YG2 A; 
#chains in the Genus database with same CATH topology
 1AVG I;  2R74 A;  1YWC A;  1OBQ A;  5B10 O;  5CHK A;  1X71 A;  1SY1 A;  4Y0S A;  1JJJ A;  3WJG A;  2OY1 O;  2OF8 A;  1ADL A;  1U0X A;  1SWC A;  3FW4 A;  2RTF B;  1RXH A;  2VFB A;  5F58 A;  3CBS A;  1N9Y A;  4U8U N;  4A1H A;  3NR3 A;  2HMB A;  3BDR A;  4O4U A;  1RXJ A;  4QNI A;  1QY0 A;  4ZHC A;  3CKF A;  4WHI A;  4CV7 A;  2QMI A;  1SRF A;  3V8U A;  5HCD C;  3U0D A;  4I9R A;  4HPC A;  4XMC A;  3OD9 A;  1BRQ A;  4GNW A;  1MX8 A;  3X00 A;  4EKV A;  3B2I A;  1SY2 A;  5L8I A;  5LJG A;  3RZY A;  1KL5 A;  5FFH A;  3C76 X;  4TQ2 A;  5IO7 A;  4NYQ A;  1ERX A;  1E00 A;  2ALL X;  2GJ5 A;  4ID2 A;  4GJS A;  4NV8 A;  3ELX A;  4O3W A;  2ZAG A;  5EDB A;  5F6B A;  2OY5 O;  1N43 A;  5B2A O;  3VG7 A;  1X89 A;  5F6Z A;  3RE6 A;  1AVD A;  2Q39 A;  1SWD A;  2FR2 A;  2E4J A;  3S5V A;  1GGL A;  2FKG A;  2FGS A;  3BSZ E;  5EPQ A;  1JYJ A;  2CM4 A;  5HTD A;  1FEL A;  2MJI A;  1B4M A;  1DFV A;  1YWA A;  2AT0 X;  2HYS A;  2HZR A;  4GZV A;  2KTD A;  5F7G A;  5K06 A;  1LDO A;  2HZQ A;  2RTL A;  4AZM A;  5LKE A;  3VPJ E;  2Q4N A;  4AZQ A;  1CJ5 A;  2C4I A;  5L3Y A;  3BX8 A;  2CBS A;  1S44 A;  3RKG A;  1SWB A;  2WWP A;  2AMM X;  3PDF A;  4ON1 A;  4AZN A;  3FW5 A;  5DG4 A;  4ZJ0 A;  1SWP A;  2RCT A;  1JQP A;  1MVG A;  3WJD A;  4OS8 A;  5FAZ A;  4IB9 A;  4YGZ A;  5HZ8 A;  1QY2 A;  3VG6 A;  1H91 A;  1I4U A;  5H9K A;  3RDQ A;  3FR4 A;  3EW2 A;  4Z2P A;  3UEX A;  2Q2M A;  1SWE A;  1HQP A;  2BT9 A;  3JQO A;  5EZ2 A;  1BM5 A;  3PP6 A;  1PBO A;  2MF6 A;  4UU3 A;  1MUP A;  3KQ0 A;  4OMX A;  1GT4 A;  1GKA A;  3WYQ A;  4Z2O A;  2K62 A;  4FBV A;  5CSE A;  4O4X A;  1ERB A;  1EAL A;  5IRW A;  1KT5 A;  3U9P C;  2GTL M;  1L6M A;  2XKL A;  3FA8 A;  5LJK A;  4LQZ A;  4DCB A;  4DNE A;  3FDC A;  1RLB E;  1UYN X;  4GRJ A;  1HN2 A;  1B0O A;  1KT6 A;  3HOE A;  4YBU A;  5LKF A;  2X8S A;  3SLT A;  3WJF A;  1X8P A;  3P6D A;  4MEE A;  1VYG A;  1B8E A;  2W2A A;  3JS1 A;  5B3M O;  1TVQ A;  2AVI A;  3SZI A;  4BBO A;  4ES7 A;  4Z27 A;  4Z6J A;  1SWJ A;  3F9D A;  3SLJ A;  4GH7 A;  4A60 A;  4Z28 A;  3FIQ A;  3VG2 A;  4BOE A;  3WJB A;  2UYW A;  4ORR A;  1VWC B;  3ZWE A;  1Y52 X;  4D6B A;  1KXO A;  1SWT A;  1QAB E;  1QFV A;  3KFH A;  3FYF A;  3ZUI A;  1G5W A;  1E02 A;  3ZW0 B;  4I3B A;  4CPE A;  3FA6 A;  1S2P A;  1E06 A;  1LCZ A;  4WFU A;  2RTR B;  1LIF A;  1VWO B;  2AT8 X;  4L3R A;  3UAQ A;  3EW1 A;  3WOV A;  3KFF A;  5HZ5 A;  4HPB A;  3EM0 A;  4XMF A;  3O19 A;  1DF8 A;  2FT9 A;  2KTS A;  1VWF B;  4A8Z A;  2RTB B;  1STP A;  3CR6 A;  4O4O A;  3E3C A;  3QQ2 A;  2EU7 X;  1IFC A;  5KHP A;  4QGW A;  1RSU B;  1AVE A;  3NQ9 A;  3P6C A;  1JJU A;  1HBP A;  1JYD A;  3HWD A;  1JIW I;  1HQQ A;  3FLL A;  3SOT A;  1HXL A;  5HWZ A;  4ORW A;  1SWG A;  1O8V A;  2RTN B;  3PH5 A;  4QGV A;  1AQB A;  4IMO A;  1E5P A;  1GT3 A;  1NGL A;  1SWL A;  2OFA A;  4IRW A;  5EED A;  5IO5 A;  1CBQ A;  1TOW A;  1DZM A;  2OVD A;  5AJC A;  3H3I A;  4ORU A;  2R56 A;  3NQK A;  1LUQ A;  2K23 A;  3AEH A;  2RQ0 A;  4RUN A;  3VGW A;  3IFB A;  5IRA A;  1TW4 A;  3HK1 A;  2BS5 A;  1JJX A;  2X34 A;  4OS3 A;  1MK5 A;  1SWH A;  3STM X;  1KOI A;  1SY0 A;  3DTQ A;  4RUU A;  1WUB A;  4LKP A;  1VWN B;  4NP1 A;  3NX1 A;  2VDF A;  4AZO A;  2RTJ A;  4TNN A;  1VWL B;  1W5R A;  1N0S A;  3RDU A;  1KT3 A;  3D9W A;  1NDJ A;  1URE A;  1K3B A;  1QG5 A;  3B2L A;  1HY2 A;  1SXU A;  3BRN A;  4GU8 A;  1PBY A;  2X45 A;  4IAW A;  3S60 A;  3WYP A;  5FQ8 E;  2O62 A;  4LZU A;  4FGI B;  3NBX X;  3P6H A;  5L8O A;  4KC8 A;  3ZI8 A;  1MOY A;  1BSO A;  3VHI A;  3SZJ A;  4TKJ A;  1ZRY A;  1N4J A;  4GD9 A;  5H9A A;  1E2T A;  3PPT A;  2POA A;  1Y0G A;  4ZH6 A;  3LHN A;  2Z4I A;  1FJ1 E;  2NNE A;  3T6L A;  1SWR A;  1ZND A;  2PY1 A;  1SA8 A;  3AUM O;  3ELZ A;  3OJY C;  5HAE A;  1ZNG A;  3PED A;  4GNY A;  1FTP A;  2R73 A;  4NLI A;  1DC9 A;  4HPA A;  3UEW A;  1QWD A;  3VG4 A;  2A13 A;  3P6F A;  1SLE B;  2QCB A;  5DPQ A;  4CDF A;  4A1Y A;  2A2U A;  4BJ8 A;  4YKO A;  3TZS A;  3VHM A;  3NP1 A;  2P8G A;  3Q6L A;  1EUO A;  1GT1 A;  2IZF B;  2KW1 A;  4WFV A;  1SRH A;  4XMD A;  4EQA C;  5BYP A;  1KL3 A;  3PH6 A;  1JZU A;  4I3D A;  4M6S A;  1RAV A;  4DQ3 A;  4YKM A;  1Y53 X;  2RTK A;  3FA7 A;  1UYO X;  3WVM A;  4CPH A;  5AQ6 A;  4KCA A;  3CMP A;  1VWJ B;  1T68 X;  1XKI A;  2IZD B;  2BC3 A;  4I3C A;  1BWY A;  1EPB A;  2FHL A;  5C0N A;  1GX8 A;  1BEB A;  4TKH A;  4INN A;  3KFG A;  2FWV A;  3K3L A;  1GT5 A;  4NW4 A;  2QO6 A;  4YGG A;  1N7Y A;  1O1U A;  2OL8 O;  4QAE A;  2JN3 A;  2QOM A;  2X32 A;  4B55 A;  4UU2 A;  3FEN A;  1ZNK A;  4MVE A;  4ODD A;  2JGS A;  2KT4 B;  2ASN X;  4K19 A;  2RTH B;  3RBY A;  2A2G A;  3WXQ A;  2Y3E A;  5L8N A;  3APV A;  4HFO A;  1SLD B;  1T0V A;  4LKT A;  3AKN A;  3RE5 A;  4ZR2 A;  1JMZ A;  3L4R A;  2UZ2 A;  2BLG A;  3CQR A;  5EDC A;  4AZR A;  1CBS A;  3MBT A;  2IZI A;  3FMZ A;  1SRE A;  2MHD A;  2ZAI A;  5K68 A;  3BU9 A;  5FEN A;  1NC9 A;  2FS7 A;  4QYN A;  1A2D A;  5AJB A;  1YWD A;  4GGR A;  3HWF A;  3CKG A;  4D6A A;  2LBA A;  2IZL B;  3EBK A;  3VG5 A;  2C1Q A;  1VWM B;  1KZX A;  1S7D A;  1X8Q A;  2ZSC A;  3C77 X;  4GGZ A;  4GGT A;  4AW8 A;  4BX7 B;  4CDC A;  2MO5 A;  3HWE A;  4O4S A;  2VFC A;  1P6P A;  2CM9 A;  4O3X B;  1RXK A;  1DZJ A;  2NND A;  3EC5 A;  1YIV A;  1BSQ A;  2A5B A;  1EXS A;  2X4M A;  1VWB B;  2IZH B;  2G78 A;  2F73 A;  1IIU A;  1CRB A;  1PTS A;  1TOU A;  2RTP B;  3BS2 A;  4I95 A;  3TGA A;  3FID A;  2WEW A;  3PEC A;  3WZO A;  1OEK A;  1MDC A;  2DJF A;  2QOS C;  4FQB B;  2RCQ A;  2FKJ A;  5JD2 A;  5LJE A;  4YH0 A;  1VWI B;  3RSW A;  2G5L A;  3EMM A;  1YP6 A;  2X55 A;  3PK2 A;  2WUT A;  4U9C A;  2ANS A;  2FS6 A;  2L68 A;  2OZQ A;  3NPO A;  1PMP A;  1Z24 A;  2OF9 A;  3RDX A;  1VYF A;  1G74 A;  4U8U M;  5JR8 A;  1PM1 X;  1DF3 A;  4QGX A;  2AKQ A;  1VWP B;  2OL6 O;  4FBR A;  3G7X A;  3LTW A;  1ALB A;  4ALB A;  1EPA A;  1HMS A;  1KGL A;  4ORY A;  2RTM A;  2C1S A;  3D4R A;  3I0A A;  4CPH B;  4CDE A;  3O2Y A;  2CBR A;  1X8O A;  5B5F A;  1FE3 A;  2W2B A;  4AZP A;  2A5C A;  4BX6 B;  3U03 A;  1R0U A;  1HMR A;  1QQS A;  4PSQ A;  4ZHD A;  1FEN A;  4WBK A;  2WEX A;  1U18 A;  1DZP A;  1SLF B;  1O1V A;  2BS6 A;  2RTD B;  2JOZ A;  2L5P A;  4ZCB A;  2FRS A;  1IFB A;  1I04 A;  2RA6 A;  3GE2 A;  4PJ2 A;  3WJC A;  4CDD A;  5LJD A;  5LJC A;  4ZFX A;  1Y9T A;  1VWD B;  4CSB A;  3P24 A;  4O3Z A;  2RTI B;  5FQ6 E;  3FA9 A;  3D97 A;  5B11 O;  1CBI A;  3RDO A;  2A3F X;  1EQD A;  2CAM A;  1BBP A;  2Y3F A;  3FEK A;  2I5V O;  2KD2 A;  3MM0 A;  3FEP A;  2Q9S A;  4MIR A;  3SLO A;  3APX A;  4ZHH A;  1KL4 A;  1SLG B;  1G7N A;  4O3Y A;  1I9H A;  4Y0R A;  3RWX A;  1RST B;  1SMP I;  4JGL A;  1BRP A;  3QKG A;  2M4L A;  2RN4 A;  4KII A;  3LV4 A;  2LKK A;  4GE1 A;  1WBI A;  1LNM A;  3UEV A;  4XME A;  2FHN X;  4ZGF A;  4ORX A;  2G8C O;  1GX9 A;  3BLG A;  5IRU A;  5BVQ A;  4EEJ A;  1KQX A;  1NQM A;  1SWA A;  1IKE A;  2AT3 X;  2X56 A;  3N91 A;  4L1N A;  4BX7 A;  5AEO A;  2RD7 C;  3F8A A;  1SWO A;  4M7M A;  5HA1 A;  1VWG B;  3ZW2 A;  1ML7 A;  4Y0P A;  3T2W A;  3STK A;  1YUP A;  3CBC A;  4NV7 A;  1GX3 A;  2AH7 X;  4ZGU A;  5HCC C;  3ZW0 A;  1VWA B;  4YGH A;  1Y55 X;  2W2F A;  2X8F A;  4TLJ A;  2N93 A;  1SWS A;  3NAD A;  3WBG A;  1SRJ A;  3ZQ3 A;  1EIO A;  1I06 A;  1LF7 A;  1LDQ A;  1SWF A;  2Y32 A;  4GET A;  4MVK A;  1GM6 A;  3GAQ A;  4QZU A;  3F6Z B;  3RY2 A;  1CBR A;  1OSP O;  2BSZ A;  4YBP A;  4YVB A;  5D8J A;  2LBV A;  2OY7 A;  1ZNE A;  1DV9 A;  5HZ6 A;  2BHV A;  1A57 A;  1ICM A;  2AT5 X;  2WPU A;  2XST A;  3CWK A;  3HOL A;  4I9S A;  5D4A A;  3WZN A;  4GDA A;  3ZUO A;  5HCE C;  4GDZ A;  2GH7 A;  1JBH A;  4IB7 A;  1VYO A;  4YCE A;  4GKC A;  2IFB A;  2MM3 A;  4ML7 B;  1SWN A;  3HPE A;  1OBP A;  1X8U A;  2JU8 A;  1ZNL A;  2GTL O;  3DSZ A;  2IZJ A;  3MX7 A;  4I6S A;  3TGC A;  1IKJ A;  2RTC B;  2NNQ A;  2WQ9 A;  3CQN A;  4XMH A;  5LJH A;  3VU1 A;  5IXG A;  2RTE B;  1YWB A;  4IMN A;  1G85 A;  5HA0 A;  1STS B;  1D3S A;  1SWK A;  1W6F A;  2MWH A;  4JO6 A;  4BX6 A;  4CK4 A;  2IZG B;  4YDB A;  4TJZ A;  2JU7 A;  3RY1 A;  1W4T A;  1K24 A;  4MVI A;  4O49 A;  2A8G A;  3O22 A;  2Q2P A;  3P6E A;  1FDQ A;  3OBL A;  5CE4 A;  2CZT A;  4IAX A;  3T6F A;  5CYB A;  1VPR A;  3P02 A;  5B5G A;  3WZQ A;  4ALO A;  2AT6 X;  1SRG A;  1LIE A;  1KT4 A;  1XCA A;  1LIB A;  1VWR B;  2F09 A;  3I17 A;  3WZP A;  2WQA E;  2OL7 A;  4HWM A;  4U8U O;  4BX5 B;  1VWE B;  2FTB A;  1EW3 A;  4ZHF A;  1LID A;  4MIS A;  1OBU A;  2NP1 A;  2IZA A;  1TXL A;  5D45 A;  4EXZ A;  1BLR A;  1KQW A;  3S26 A;  3EYC A;  1PEE A;  5K67 A;  1DZK A;  1HXZ A;  2HKD A;  5HBS A;  4ZH9 A;  1Y9L A;  3SZH A;  4LZV A;  4GK9 A;  1NP4 A;  3JSQ A;  5B29 A;  3TGB A;  1T8V A;  2OY8 A;  4FBO A;  5FQ7 E;  1SWQ A;  3NX2 A;  1LKE A;  3VE1 A;  4CPF A;  1HBQ A;  3C78 X;  4R0B A;  4DQ4 A;  3VE2 A;  4YFP A;  2AF5 A;  1UZ2 X;  2JU3 A;  3ZW1 B;  4CPI A;  5H9N A;  1VWQ B;  4KH8 A;  1B56 A;  1LIC A;  3FR5 A;  2RTQ B;  4YMY A;  2LFO A;  4O9S A;  1HMT A;  1SXX A;  3OE3 A;  2OFB A;  1I78 A;  3NQ3 A;  4NNT A;  4QQ1 A;  4OMW A;  3HTY A;  2IZE B;  3IA8 A;  3KVN A;  2QO5 A;  4NLJ A;  1OEJ A;  2FR3 A;  2DJG A;  1LFO A;  3HWG A;  1IW2 A;  1QY1 A;  3UEU A;  2JW1 A;  1OPA A;  4U46 A;  1A3Y A;  1JV4 A;  2RTA A;  4C5P A;  2LA7 A;  4Y59 A;  4BCS A;  4Y5D A;  3WJE A;  4OEL A;  4IB6 A;  1NBX A;  1YP7 A;  1SWU A;  2DM5 A;  2JMB A;  2YMS A;  3SAO A;  5KIC A;  3AKM A;  5H8T A;  3MVF A;  4IAB A;  2IZB A;  4N7D A;  1I05 A;  1SXY A;  3BX7 A;  1LCV A;  1VWH B;  5IO6 A;  4XMG A;  3RDM A;  2F01 A;  2IZK A;  1JMX A;  3PQS A;  2G7B A;  4YDA A;  2RTO B;  2WR6 A;  5HTE A;  1AB0 A;  3ZZV A;  2RTG B;  1ACD A;  2WSJ A;  3Q34 A;  1BJ7 A;  4ARH A;  3VHH A;  2ACO A;  2OVS A;  4OS0 A;  5HZQ A;  1D2U A;  1LPJ A;  2X8T A;  1KT7 A;  2OFR X;  4YFQ A;  3S5X A;  1OPB A;  2CZU A;  3FEL A;  1QFT A;  4IBA A;  4JNJ A;  4IB8 A;  1EII A;  1EI5 A;  1MM9 A;  1ZNH A;  1GXA A;  3APU A;  4KT5 A;  4YCH A;  2HNX A;  3BU1 A;  4ORS A;  2PI3 O;  4NYR A;  3B2J A;  2HLV A;  2L9C A;  1SY3 A;  2GC9 A;  5B27 A;  1RBP A;  4Y0Q A;  2X46 A;  4GJV A;  3KZA A;  4I60 A;  5F2B A;  3MG5 A;  1X8N A;  4BGF A;  4EFG A;  4YFR A;  1VWK B;  3STN A;  2G79 A;  5F1E A;  1AEL A;  1BSY A;  3VG3 A;  1KZW A;  4QZT A;  1SRI A;  4BX5 A;  5LJB A;  2LB6 A;  2OVA A;  4AYH A;  4Z2V A;  1U17 A;  3EBW A;  1MX7 A;  3P6G A;  4KC7 A;  4NNS A;  3BY0 A;  1KFF A;  1FEM A;  3B2H A;  2FLJ A;  1SXW A;  2Z4H A;  4ZHG A;  2L67 A;  2OVE A;  1N9M A;  3T2X A;  1NP1 A;  3T1D A;  4HPD A;  2OFM X;  4QYP A;  4BQU A;  4OKA A;  4TKB A;  2GTF X;  3B2K A;  2GTL N;  2QO4 A;  2OYB O;  4BVM A;  2QM9 A;  3D96 A;  5D47 A;  3ZW1 A;  2ACP X;  4OEM A;  4JHQ A;  2A0A A;  1MEP A;  4EDE A;  1NQN A;  4GUZ A;  3KFI A;  1LCW A;  4MVL A;  4QRL A;  4U3Q A;  1OEE A;  5H9L A;  1LEL A;  2I5Z O;  1IJ8 A;  5D48 A;  3D95 A;  3PQU A;  3RDS A;  3FR2 A;  1A18 A;  2IZC B;  3TF6 A;  1STR B;  1ICN A;  5BVS A;  1GKA B;  2AL0 X;  5EEE A;  4N7C A;  5BVT A;  5KID A;  3APW A;  5HZ9 A;  4COT A;  2YG2 A; 
#chains in the Genus database with same CATH homology
 1AVG I;  2R74 A;  1YWC A;  1OBQ A;  1SY1 A;  1X71 A;  4Y0S A;  1JJJ A;  3WJG A;  1ADL A;  1U0X A;  5F58 A;  3CBS A;  4U8U N;  4A1H A;  3NR3 A;  2HMB A;  3BDR A;  4O4U A;  4QNI A;  4ZHC A;  1QY0 A;  4CV7 A;  4WHI A;  2QMI A;  3V8U A;  5HCD C;  3U0D A;  4I9R A;  4HPC A;  4XMC A;  3OD9 A;  1BRQ A;  4GNW A;  1MX8 A;  3B2I A;  1SY2 A;  5L8I A;  5LJG A;  3RZY A;  5FFH A;  4TQ2 A;  3C76 X;  5IO7 A;  4NYQ A;  1ERX A;  1E00 A;  2ALL X;  2GJ5 A;  4ID2 A;  4TNN A;  5EDB A;  3ELX A;  4O3W A;  2ZAG A;  5F6B A;  3VG7 A;  1X89 A;  5F6Z A;  2Q39 A;  2FR2 A;  2E4J A;  3S5V A;  1GGL A;  5EPQ A;  3BSZ E;  1JYJ A;  2CM4 A;  5HTD A;  1FEL A;  2MJI A;  1B4M A;  1DFV A;  1YWA A;  2AT0 X;  2HYS A;  2HZR A;  4GZV A;  2KTD A;  5F7G A;  5K06 A;  2HZQ A;  4AZM A;  5LKE A;  3VPJ E;  2Q4N A;  4AZQ A;  1CJ5 A;  3BX8 A;  2CBS A;  1S44 A;  3RKG A;  2WWP A;  4ON1 A;  2AMM X;  4AZN A;  3FW5 A;  5DG4 A;  4ZJ0 A;  2RCT A;  1MVG A;  3WJD A;  4OS8 A;  5FAZ A;  4IB9 A;  4YGZ A;  5HZ8 A;  1QY2 A;  3VG6 A;  1H91 A;  1I4U A;  5H9K A;  3FR4 A;  3UEX A;  2Q2M A;  1HQP A;  2BT9 A;  3JQO A;  5EZ2 A;  1BM5 A;  3PP6 A;  1PBO A;  4UU3 A;  1MUP A;  3KQ0 A;  4OMX A;  1GT4 A;  1GKA A;  2K62 A;  4FBV A;  4O4X A;  1ERB A;  1EAL A;  1KT5 A;  3U9P C;  2GTL M;  1L6M A;  2XKL A;  3FA8 A;  5LJK A;  4LQZ A;  3VG2 A;  1RLB E;  4GRJ A;  4YBU A;  1HN2 A;  1B0O A;  1KT6 A;  3HOE A;  5LKF A;  3WJF A;  2X8S A;  1X8P A;  3P6D A;  1VYG A;  1B8E A;  2W2A A;  3JS1 A;  1TVQ A;  4ES7 A;  3F9D A;  4A60 A;  4GH7 A;  3FIQ A;  4BOE A;  3WJB A;  4ORR A;  3ZWE A;  4D6B A;  1KXO A;  3KFH A;  1QAB E;  1QFV A;  3FYF A;  3ZUI A;  1G5W A;  1E02 A;  4I3B A;  3FA6 A;  1S2P A;  1E06 A;  4WFU A;  1LIF A;  2AT8 X;  4L3R A;  3UAQ A;  3WOV A;  5HZ5 A;  3KFF A;  4HPB A;  3EM0 A;  4XMF A;  3O19 A;  2KTS A;  2FT9 A;  4A8Z A;  3CR6 A;  4O4O A;  3E3C A;  2EU7 X;  1IFC A;  5KHP A;  4QGW A;  3NQ9 A;  3P6C A;  1HBP A;  1JYD A;  3HWD A;  1JIW I;  3FLL A;  3SOT A;  5HWZ A;  4ORW A;  1O8V A;  3PH5 A;  4QGV A;  1AQB A;  4IMO A;  1E5P A;  1GT3 A;  1NGL A;  5EED A;  5IO5 A;  1CBQ A;  1TOW A;  1DZM A;  2OVD A;  5AJC A;  3H3I A;  4ORU A;  2R56 A;  3NQK A;  2K23 A;  2RQ0 A;  4RUN A;  3IFB A;  1TW4 A;  3HK1 A;  2BS5 A;  1JJX A;  4OS3 A;  3STM X;  1KOI A;  1SY0 A;  3DTQ A;  4RUU A;  4LKP A;  4NP1 A;  4ZGF A;  3NX1 A;  4AZO A;  1N0S A;  1KT3 A;  1URE A;  1QG5 A;  3B2L A;  3BRN A;  4GU8 A;  1SXU A;  4IAW A;  4D6A A;  2X45 A;  3S60 A;  5FQ8 E;  2O62 A;  4LZU A;  4FGI B;  3NBX X;  3P6H A;  5L8O A;  4KC8 A;  3ZI8 A;  1BSO A;  4TKJ A;  1ZRY A;  5H9A A;  3PPT A;  2POA A;  4ZH6 A;  3LHN A;  2Z4I A;  5LJH A;  2NNE A;  1ZND A;  3ELZ A;  2PY1 A;  1SA8 A;  3OJY C;  5HAE A;  1ZNG A;  3PED A;  4GNY A;  1FTP A;  2R73 A;  4NLI A;  1DC9 A;  4HPA A;  3UEW A;  1QWD A;  3VG4 A;  2A13 A;  3P6F A;  5DPQ A;  4A1Y A;  2A2U A;  4YKO A;  3TZS A;  3NP1 A;  2P8G A;  3Q6L A;  1EUO A;  1GT1 A;  2KW1 A;  4WFV A;  4XMD A;  4EQA C;  1JZU A;  5BYP A;  3PH6 A;  4I3D A;  4M6S A;  4DQ3 A;  4YKM A;  3FA7 A;  3WVM A;  5AQ6 A;  4KCA A;  3CMP A;  1XKI A;  1T68 X;  4I3C A;  1BWY A;  1EPB A;  5C0N A;  1GX8 A;  1BEB A;  4TKH A;  4INN A;  3KFG A;  2FWV A;  3K3L A;  1GT5 A;  4NW4 A;  2QO6 A;  4YGG A;  1O1U A;  4QAE A;  2JN3 A;  4UU2 A;  3FEN A;  1ZNK A;  4MVE A;  4ODD A;  2KT4 B;  2ASN X;  4K19 A;  3RBY A;  2A2G A;  3WXQ A;  5L8N A;  3APV A;  4HFO A;  1T0V A;  4LKT A;  3AKN A;  4ZR2 A;  3L4R A;  2BLG A;  3CQR A;  5EDC A;  4AZR A;  1CBS A;  3MBT A;  3FMZ A;  2MHD A;  2ZAI A;  3BU9 A;  5FEN A;  2FS7 A;  4QYN A;  1A2D A;  5AJB A;  1YWD A;  3HWF A;  2LBA A;  3EBK A;  3VG5 A;  1KZX A;  1S7D A;  1X8Q A;  3C77 X;  4AW8 A;  2MO5 A;  3HWE A;  4O4S A;  1P6P A;  2CM9 A;  4O3X B;  1DZJ A;  2NND A;  1YIV A;  1BSQ A;  2X8F A;  1EXS A;  4WBK A;  3FW4 A;  3BS2 A;  2G78 A;  2F73 A;  1IIU A;  1CRB A;  1TOU A;  4I95 A;  3TGA A;  3ZW0 B;  4ZFX A;  2WEW A;  3PEC A;  1OEK A;  1MDC A;  2QOS C;  4FQB B;  2RCQ A;  5LJE A;  4YH0 A;  3RSW A;  3EMM A;  1YP6 A;  2WUT A;  4U9C A;  2ANS A;  2FS6 A;  2L68 A;  2OZQ A;  3NPO A;  1PMP A;  1Z24 A;  1VYF A;  1G74 A;  4U8U M;  5JR8 A;  1PM1 X;  1DF3 A;  4QGX A;  2AKQ A;  4FBR A;  3G7X A;  1ALB A;  4ALB A;  1EPA A;  1HMS A;  1KGL A;  4ORY A;  3D4R A;  3I0A A;  3O2Y A;  2CBR A;  1X8O A;  1FE3 A;  2W2B A;  4AZP A;  3U03 A;  1R0U A;  1HMR A;  1QQS A;  4PSQ A;  4ZHD A;  1FEN A;  2WEX A;  1U18 A;  1DZP A;  1O1V A;  2BS6 A;  4ZCB A;  2JOZ A;  2L5P A;  2FRS A;  1IFB A;  1I04 A;  2RA6 A;  3GE2 A;  4PJ2 A;  3WJC A;  5LJD A;  5LJC A;  1Y9T A;  4CSB A;  3P24 A;  4O3Z A;  5FQ6 E;  3FA9 A;  3D97 A;  1CBI A;  2A3F X;  1EQD A;  1BBP A;  3FEK A;  4YMY A;  2KD2 A;  4MIR A;  3FEP A;  2Q9S A;  4ZHH A;  3APX A;  1G7N A;  4O3Y A;  4Y0R A;  3RWX A;  1SMP I;  4JGL A;  1BRP A;  3QKG A;  2M4L A;  2RN4 A;  4KII A;  3LV4 A;  2LKK A;  4GE1 A;  1LNM A;  3UEV A;  4XME A;  4ORX A;  3BLG A;  1GX9 A;  5BVQ A;  4EEJ A;  1KQX A;  2AT3 X;  3N91 A;  1IKE A;  4L1N A;  5AEO A;  2RD7 C;  3F8A A;  4M7M A;  5HA1 A;  3ZW2 A;  1ML7 A;  4Y0P A;  3STK A;  1YUP A;  3CBC A;  5HCC C;  2AH7 X;  4ZGU A;  3ZW0 A;  4YGH A;  2W2F A;  4TLJ A;  2N93 A;  3WBG A;  3NAD A;  3ZQ3 A;  1EIO A;  1I06 A;  1LF7 A;  4GET A;  4MVK A;  4BVM A;  4QZU A;  1GM6 A;  3GAQ A;  4YBP A;  3F6Z B;  1CBR A;  5D8J A;  2LBV A;  1ZNE A;  1DV9 A;  5HZ6 A;  2BHV A;  1A57 A;  1ICM A;  2AT5 X;  2XST A;  3CWK A;  3HOL A;  4I9S A;  5D4A A;  3ZUO A;  5HCE C;  4GDZ A;  1JBH A;  4IB7 A;  4YCE A;  4GKC A;  2IFB A;  2MM3 A;  4ML7 B;  1OBP A;  1X8U A;  2JU8 A;  1ZNL A;  2GTL O;  3DSZ A;  3MX7 A;  4I6S A;  3TGC A;  1IKJ A;  2NNQ A;  2WQ9 A;  3CQN A;  4XMH A;  3VU1 A;  4IMN A;  1YWB A;  1G85 A;  5HA0 A;  1D3S A;  2MWH A;  4CK4 A;  4YDB A;  4TJZ A;  2JU7 A;  4MVI A;  4O49 A;  3O22 A;  2Q2P A;  3P6E A;  1FDQ A;  3OBL A;  5CE4 A;  2CZT A;  4IAX A;  5CYB A;  1VPR A;  3P02 A;  4ALO A;  2AT6 X;  1LIE A;  1KT4 A;  1XCA A;  1LIB A;  2F09 A;  3I17 A;  2WQA E;  4HWM A;  4U8U O;  4ZHF A;  2FTB A;  1EW3 A;  1LID A;  4MIS A;  1OBU A;  2NP1 A;  1BLR A;  1TXL A;  5D45 A;  4EXZ A;  1KQW A;  3S26 A;  3EYC A;  1PEE A;  1DZK A;  5HBS A;  4ZH9 A;  1Y9L A;  4LZV A;  4GK9 A;  1NP4 A;  3JSQ A;  5B29 A;  3TGB A;  1T8V A;  4FBO A;  5FQ7 E;  3VE1 A;  3NX2 A;  1LKE A;  1HBQ A;  3C78 X;  4R0B A;  4DQ4 A;  3VE2 A;  4YFP A;  2JU3 A;  1UZ2 X;  3ZW1 B;  5H9N A;  4KH8 A;  1B56 A;  1LIC A;  3FR5 A;  2LFO A;  4O9S A;  1HMT A;  1SXX A;  3OE3 A;  3NQ3 A;  4NNT A;  4QQ1 A;  4OMW A;  3HTY A;  3IA8 A;  2QO5 A;  4NLJ A;  1OEJ A;  2FR3 A;  1LFO A;  3HWG A;  1IW2 A;  1QY1 A;  3UEU A;  2JW1 A;  1OPA A;  1A3Y A;  1JV4 A;  2LA7 A;  3WJE A;  4IB6 A;  1YP7 A;  2DM5 A;  2JMB A;  2YMS A;  3SAO A;  5KIC A;  3AKM A;  5H8T A;  3MVF A;  4IAB A;  4N7D A;  1I05 A;  1SXY A;  3BX7 A;  5IO6 A;  4XMG A;  3PQS A;  2G7B A;  4YDA A;  2WR6 A;  5HTE A;  1AB0 A;  3ZZV A;  1ACD A;  2WSJ A;  4ARH A;  1BJ7 A;  2ACO A;  2OVS A;  4OS0 A;  5HZQ A;  1D2U A;  1LPJ A;  2X8T A;  1KT7 A;  2OFR X;  4YFQ A;  3S5X A;  1OPB A;  2CZU A;  3FEL A;  1QFT A;  4IBA A;  1EII A;  4IB8 A;  1EI5 A;  1ZNH A;  4KT5 A;  1GXA A;  3APU A;  4YCH A;  2HNX A;  3BU1 A;  4ORS A;  4NYR A;  3B2J A;  2HLV A;  2L9C A;  1SY3 A;  2GC9 A;  5B27 A;  1RBP A;  4Y0Q A;  2X46 A;  4EFG A;  3KZA A;  4YFR A;  1X8N A;  1AEL A;  3STN A;  2G79 A;  5F1E A;  1KZW A;  1BSY A;  3VG3 A;  4QZT A;  5LJB A;  2LB6 A;  2OVA A;  4AYH A;  1U17 A;  3EBW A;  1MX7 A;  3P6G A;  4KC7 A;  4NNS A;  3BY0 A;  1FEM A;  3B2H A;  2FLJ A;  1SXW A;  2Z4H A;  4ZHG A;  2L67 A;  2OVE A;  3T1D A;  1NP1 A;  4HPD A;  2OFM X;  4QYP A;  4BQU A;  4TKB A;  2GTF X;  3B2K A;  2GTL N;  2QO4 A;  2QM9 A;  3D96 A;  5D47 A;  3ZW1 A;  2ACP X;  2A0A A;  4EDE A;  3KFI A;  4MVL A;  4QRL A;  4U3Q A;  1OEE A;  5H9L A;  5D48 A;  3D95 A;  3PQU A;  3FR2 A;  1A18 A;  3TF6 A;  1ICN A;  5BVS A;  1GKA B;  2AL0 X;  5EEE A;  4N7C A;  5BVT A;  5KID A;  3APW A;  5HZ9 A;  4COT A;  2YG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...