5HCHA

X-ray structure of a lectin-bound dna duplex containing an unnatural phenanthrenyl pair
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a lectin-bound DNA duplex containing an unnatural phenanthrenyl pair.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
molecule keywords Fucose-binding lectin
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5hchA00
2JDKA 2CHHA 3DCQA 1W8HA 1OVSA 2JDYA 2VUCA 4AOCA 2JDNA 4CE8A 3ZDVA 2VNVA 1W8FA 5A6XA 1UQXA 5A3OA 5D2AA 2BV4A 5HCHA 5A6ZA 2BP6A 5A6YA 5A70A 2JDPA 1OURA 5A6QA 1OVPA 2BOIA 2BOJA 1GZTA 1OUXA 1UZVA 2WRAA 1OUSA 2VUDA 2JDHA 4UT5A 2XR4A 1OXCA 2JDUA 2JDMA 2WR9A
chains in the Genus database with same CATH superfamily
5AC91 1LU2A 3VBFA 1UYXA 2J7MA 4QMAA 5K7PA 1LOBA 4HKLA 4MGTA 3WNXA 2D5HA 3PHMA 1UCXA 4JKMA 3RYKA 5C33A 2Q8DA 2WZ8A 5A7WA 5E88A 4AG4A 2DUOA 4NROA 1TMF1 4N53C 2VW1A 3NJVA 2ZMNA 1RUE3 4CU7A 5FPUA 3T09A 3JZVA 1NZIA 3DPRB 4NN0A 3ZFFB 1HRI1 2WINB 3R05A 3PURA 4MHUA 3WQ0A 2DBIA 1QH7A 1GFF2 2RJ2A 5JIAA 1UY3A 1PO11 2IXJA 1EV13 4K1YA 1QXRA 2X05A 3SCGA 3OYWA 3SEPA 3MDPA 4NWWA 1QOOA 1WKYA 4E4HA 2X10A 1AR72 2YPDA 1C8NA 1BHGA 4NOTA 1I6XA 1XU1A 4GH4A 2YB7A 1LOEA 5FZHA 2R071 1F4HA 1W6QA 5DZEA 1VBD3 5K0UA 1VBC1 1OVSA 3LIHA 4IE5A 2DTYA 4LOSA 2Y6GA 2W91A 3SCHA 4EN6B 5FPAA 4UBHA 4YM2A 4IV1B 4AVCA 3WF3A 4AF9A 3N7LA 2NP0A 2ADEA 3OY8B 5BUVA 3BPZA 4AVVA 3IDEA 2A7AA 3T2PA 1POQA 1UKRA 3NV1A 1C8M1 2EIGA 3L2YA 4KGQA 1XBFA 2QDNA 2WZPP 4CSWA 2VGDA 5HXVA 3UKTA 1JU3A 2CDPA 2VVEA 5K0UB 2W39A 2ZEZA 4XUOA 1XYPA 3MPBA 3MW4A 3SITA 3I2KA 4GMP0 2JDUA 2BEOA 5HXMA 5EIYB 4JKKA 1TZOA 3OY8A 2JB4A 3KV6A 1R083 1RTVA 1UKGA 5GZFA 4CCNA 1QIQA 4LOTA 4AZZA 3POFA 3BPSA 3KCCA 2RS53 3C3VA 2W52A 3WNOA 2ZMLA 4A7YA 5FP9A 3N4MA 4MGYE 4O7XA 4UW4A 4CCCA 4R4XA 1O4ZA 1YEWA 3GZEA 3ASIA 3IBMA 5KHJA 3M4FA 2B7YA 3ECQA 2XWBB 3KQ4B 3THCA 2ZHKA 3N35A 4XFBA 5TSWA 4DEVA 5CADA 1NCRB 5IK5A 4GB33 4D0QA 5H9QA 1SG3A 2VL4A 2WRAA 3ATGA 4MXVA 4R52A 4BZ4A 4W50A 1SZBA 1V6LA 2XL7A 2W3JA 1OA3A 3NVCA 4Y5TA 3WDTA 3RZKA 2CGPA 5FJKA 3Q8FA 4AGGA 2OQ7A 1N3QA 3UGFA 5A3NA 4P14A 1BEV1 3KF5A 4HK8A 4L9BA 1UMIA 1UPSA 4FP2A 4XFFA 5DDJ2 5FOJB 5J36A 4HK9A 1WBFA 3AVSA 3NNMA 1IPJA 1FPN1 1GU3A 4QPGC 5FYYA 4AVTA 2DFCA 3VD9A 2E26A 1VBB3 1GOGA 1S55A 3M3OA 2D6NA 3PTYA 1HW5A 3KCXA 1Y4WA 3H1YA 1E5IA 4UW5A 5FV3A 3SH3A 2VMGA 4XJAA 1MEC2 3WHUA 1S0DA 3H7YA 1V00A 1YI7A 4BQ1A 4DMIA 4CU8A 3U11A 1J58A 3BVCA 4JGYA 2YC4A 1K5JA 1ULOA 4XUNA 5FPVA 2HEYF 4V2VA 1SLBA 2IWGB 4QX0A 2RS51 2B42B 4LBQD 2WT1A 1W99A 1SFYA 4YYOA 1LGCA 2VBBA 3IAQA 1VRBA 1D7PM 3O12A 3VBSB 4OI0A 2YGMA 3WQBA 5GM0A 3J4UH 4KWUA 3DYOA 2YDEA 2V4VA 2YMZA 4NPMA 4QM9A 2IFRA 2Z69A 4YW6A 2HWC3 4CCEA 1IOAA 4WVWA 1CZVA 1V6KA 2CYFA 2GMPA 5EWSA 3VZJA 3IM0A 4Y33A 1SBFA 1QNYA 1HXS2 1HB2A 2HWE2 4XC9A 1SLTA 5E8AA 3HQRA 1FV2A 1MQTC 1DQ0A 3H1WA 4GWIA 5BNPA 1XSQA 4P9GA 2VR4A 4X8PA 1O8SA 3DXUA 1LKNA 4NMIA 2VNGA 1JYWA 4WM7C 4BH9A 5F1RA 2ORZA 3AVRA 2R0HA 4SLIA 2Q8OA 3VKMA 4AQ2A 3V0BB 2XGXA 3KF3A 5FP8A 3R6SA 2RM22 4XCAA 4CA9A 4NJ4A 1O5LA 1W03A 4M00A 5T55A 3IPVB 5FO7B 4NVPA 1H4GA 5I8TA 3D5OA 3OTFA 4PDWB 5CB7A 3OUHA 1YQCA 3POJA 2VTFA 4QKDA 4CDWA 2BFUS 2R072 1NLSA 1PO13 2XQRA 1UYZA 3AP7A 5C9AB 4ZU5A 3GZTB 1XNDA 4XFCA 5LBEA 4I2OA 3FHAA 5A3TA 5FMDA 2R062 2ZGMA 4C0BA 2OYZA 3IPVA 1WCSA 3SKJE 4PDWA 5IK8A 2BGCA 2DCZA 5LA9A 4IW3A 3NAPB 4OHYA 1AX0A 2BWCA 2C26A 5C8WA 1YCIA 4GB31 3BKZA 2DTWA 4HXCA 5C9AA 4IDZA 4BPZA 3QACA 5FLHA 1Q8SA 1QJY2 2ZEWA 3BALA 2QZ3A 4QPIC 4QPYA 5FP3A 5G04L 4AI0A 4FO9A 4TYSA 2VOKA 1K42A 1W2OA 2BYVE 1GR3A 3ZYFA 4OI1A 3M70A 5F8PA 5FK7A 4ZU7A 1JZ3A 4DY5A 4YVWC 2ILMA 4UT5A 1MS5A 4J6GA 3S5QA 3HQUA 4A6OA 4HKWA 2WR9A 1ZZ9A 2XB6C 4GWMA 4DUVA 3GGLA 2BNOA 2VCAA 3NKTA 2WS93 4MV2A 4FFGA 1C8M3 4ZZ8A 1BVVA 1RITA 4EN7B 2LUWA 5DG2A 4CUBA 4F8AA 4Q0UA 4PCRA 1SBEA 1OA2A 2WZR1 2E33A 4IV3B 3KT1A 2W92A 1VPHA 3MUY1 1WBLA 1ZBA1 1AVBA 2W68A 2DCYA 3QD6A 3Q9OA 4NWVA 3ZYPA 1IS5A 1XC6A 2PHLA 1RUJ1 4Y1YA 2W95A 2GC2A 3MIEA 1X36A 1UZVA 1MR5A 2HWC1 3KHBA 2GNMA 4XQWA 2A6XA 3ZN6A 1MPXA 2FDGA 1VLNA 2W94A 1ZBA2 5A1LA 3VLBB 3J9SA 4AEKA 3GBFA 2WNUA 4N9IA 1HV0A 3OF1A 3DCQA 4OYUA 1KDMA 1W06A 2EXIA 4TTGA 3JD71 1QNWA 1XJAA 3ZXJA 1MACA 3NNGA 3ON7A 1Y9QA 2QQJA 3IAPA 1UPIA 3ZFGA 4IEQA 5C70A 1ULCA 3CL1A 1RUC2 4XJZA 3ZN6B 1X33A 5FLIA 4PLMA 1AR71 1H2LA 1HB3A 1FOD1 3ZKYA 2QQUA 1XSRA 2Z42A 4UFHA 5DDJ1 5C8CC 1ENQA 3LPFA 1ULPA 4HVOA 3O7OA 2VUDA 3D8CA 4OMCA 5FKBA 3OSDA 4Q4W3 5J96B 4UOJA 3WCRA 1UXXX 3S5AA 1W6OB 4XZUG 4I02A 1A3KA 1JU4A 3C7GA 3B9CA 4EN9B 5IFPA 2I2SA 2PLV3 3RGBA 2YZ4A 3T2TA 2OZJA 5CFDA 1BEV3 1HXS3 3VZLA 1LAJA 1BVP1 1SLAA 3ES1A 1V6JA 1J83A 1PO23 1T6GC 4QX8A 3RG0A 1C3HA 3AC0A 3PTRB 3LFIA 5LWBA 4OHZA 3JQXA 4NIAA 2MHFA 1AR83 3DYPA 1NQJA 4XJ8A 3ZYIB 1K45A 4ZPIA 4HSLA 2CGOA 4URTA 4N90A 4ASMB 1UOGA 3GBWA 2VU9A 1XE8A 1O4YA 2R063 2XJVA 4B1LA 1WCUA 4AL9A 1LR5A 1U0AA 2WKKA 1AUYA 1XB9A 4KU7A 2GH8A 4Q4V2 2G4IA 4YW2A 1NY72 1RINA 3J7LA 2VUCA 2GC3A 1PIV3 3WHTA 1AR91 4CDQC 5F5CA 2W1SA 5FYSA 5DUWA 1P8JA 1VBA2 1UYYA 1W6NB 5FYUA 5C3SA 1REFA 2GNDA 2VOXA 1G9DA 4K1ZA 4LQRA 4QU2A 4RGGA 4XF3A 2RJLA 4A2UA 2G9FA 1L3JA 2RV9A 2QCSB 2A73B 1PVC3 4LHSA 1F15A 4K6BA 3MUZ1 1RUI2 4XBQA 4AEDB 5JI7A 4DPNA 5HBAA 5FZBA 5BNNA 5CNAA 3VBUC 5D1IA 2XJPA 4KNCA 2NM1A 3ZXKA 3F2ZA 4BMBA 4CCOA 4O61A 4OMDA 3FHIB 4YZ2A 4BISA 1CQ9A 1KD7A 3JBG3 5F3CA 1IQDC 3GM8A 1GP6A 1UZWA 1XNTA 1W8FA 1KEXA 4Q4X2 1HN0A 1FT9A 3DF0A 4XILA 1UZZA 1KITA 4E27A 3ZYHA 3U78A 2HEWF 3GYDA 4ITCA 2PTMA 4QAWA 5BNNB 2HH9A 2EXJA 2PYTA 3VV1A 1HKDA 5A6YA 3LCPA 3N9QA 4Q0QA 4RSUA 1JUIA 2ZGNA 2EXHA 1CGPA 3RSJA 1TVGA 3NJZA 1RUD2 3Q8AA 4NRMA 4YW3A 4H7MA 1XNKA 2FDFA 4GJZA 3VL8A 3HNMA 4IE7A 4XEZA 1FNZA 4YW5A 4D8MA 4WVMA 2OXBA 2VCBA 1TE1B 2XHNA 4FFFA 3PUAA 4AVSA 5FPXA 2ZBJA 1ND3A 2B9VA 4A42A 4Z92B 3TBDA 2IXHA 4F3JA 1RJ7A 3WG2A 4ZY9A 1UAIA 4IETA 3ZXAC 1ST8A 2FQPA 4GWNA 4YZ3A 5DDJ3 3VBHB 3ZIXA 4CPBD 4MGIE 2JKBA 4QDQA 3VD7A 4BQ4A 4RQPC 2C9KA 2XH6A 3WF4A 4QX2A 1JMUB 2WNVA 4GJYA 2FD8A 3HD8B 4QXCA 4ES9A 1QMJA 3FC0A 3HT1A 1QJFA 3R0RA 4AHWA 5T52A 2VVDA 2FBEA 2ZEYA 1F5FA 5F5IA 3HN1A 3CF6E 2WZEA 2VZOA 3LA3A 1OT5A 3N9LA 2LALA 1N47A 1U5ZA 2HLEA 5EP9A 4FTEA 2ENRA 3K46A 5BNNC 1QGLA 5EPAA 3RMXA 1H8TB 2JXAA 3VKNA 1MEC1 4AFBA 4Z2WA 1X8MA 1RUF3 4XJWA 3AZXA 3M3QA 3JUUA 1GQGA 4CU9A 5FZ0A 3E97A 5FY8A 3VZKA 5DPNA 5G05L 2HWB1 5GZEA 4XJUA 2PAEA 4WM8C 4A44A 3RNSA 3EJKA 3JD72 2D3RA 5HPOA 1STMA 1CIWA 1RUF1 3QH6A 2BBAA 1T2XA 2Y6JA 5FZKA 2I07B 4CUAA 3UNPA 3LIGA 1QOTA 2Q8EA 1PMIA 4LA2A 3J8F3 4NR1A 3D3AA 1YFYA 4KBBA 3KSCA 4YM0A 3I4IA 1QOSA 1RUH3 1VB2A 2ZJCA 4K3UA 4Y22B 5IHRA 2PMWB 4DFSA 2ZX0A 2F17A 1RUJ2 4E2GA 1QJEA 2A70A 3ZSLA 2FCTA 1C28A 2IUWA 5F9TA 3BTZA 1FMD2 1KS5A 2OT7A 1QXJA 2JG8A 4IEPA 2I74A 1ND2B 1D4M1 1LCLA 5ABJC 4PIZA 4CU6A 4BJ0A 3H8XA 1CAWB 3VGIA 1TEIA 3AP9A 2PA7A 3FMGA 3ETQA 1UU5A 1J3PA 1MS3A 2MEV3 2WBKA 2PELA 3FUQA 3ME2A 4ZU4A 2X5IC 4FPGA 3SISA 3ZPYA 1D4VB 2JDZA 3NNLA 4CXYA 2HBUA 3KM5A 3BU7A 1OH3A 4Q8KA 4FVVA 4MXWA 1RVF2 2JDKA 2W1UA 1S0EA 3PUQA 1Q56A 5L19A 3VZMA 4Y1UA 5C8CA 2PXJA 5L73A 5HV4A 1G9AA 3ES4A 1WW5A 3N9MA 3DKWA 4DXTA 2IZWA 1DU3D 1OOPC 2CNAA 2WSVA 5F2WA 5C4WB 4YG6A 1AXZA 2X5IA 2TUNA 1RUE2 3O0WA 1HRV1 2P1BA 4QGMA 1VBE2 1L7QA 3M3IA 1AYM1 3OPTA 4JZRA 4MXWB 5FZ4A 4LXLA 3P3NA 5HCAA 1H9WA 2P3IA 3FN9A 2R1DA 3UYJA 3LSEA 5FBJA 1JHNA 2WO1A 2GN3A 2WWSA 1PGW1 4R9BA 2G1MA 3ZMOA 1S0FA 1NXD1 2BUKA 1GZCA 1KJLA 1O59A 1ZZ8A 3KB5A 4FI9A 3K4AA 4AFAA 1G9BA 1RUD1 1JBCA 5B4XA 3WW2A 4D69A 1W8HA 1OC1A 3VDCA 2A3WA 4YSFA 1LHOA 4HETA 3RVHA 1PX4A 1S0CA 4PT6A 3UK9A 4YARA 2PHDA 4EJRA 2OX0A 3N9PA 3ACFA 5L9RA 2H6CA 2CTVA 1AR93 3ZMNA 4XTPA 1TNFA 1JH5A 2C24A 1TMF2 2VOTA 1NCQB 5C9AC 4PI0A 2OZ6A 2VOVA 3KT4A 1BLZA 1VJ2A 5KXCA 4PF1A 4XE9A 5F32A 2FHRA 1ND2C 5FY9A 2FZ1A 2Y6HA 4XUTA 3PL0A 2J1VA 1IS4A 4BQ5A 1QH6A 3DEMA 2ZHNA 4RS5A 1LGBA 1SMVA 1XNBA 1US2A 4MGQA 4O65A 5JUVA 5CBLA 2ZTNA 4LITA 2RS13 5AVPA 1PGSA 3CQOA 3ZYJB 1WLDA 2EF6A 4XJ9A 2XVKA 2YFUA 4QXKA 2EIEA 1VBB1 3I3EA 1J1TA 2Q30A 3O1TA 3PU8A 1FPN3 4FAGA 1E57A 3QBQA 1S2BA 3S0MA 2YUEA 4PJYA 1LHVA 5HCFA 4IUGA 5JMCA 3O1VA 1HN1A 4Q4V1 4CCKA 2D3SA 4MGZE 2G19A 3A0KA 2DVDA 4GB32 4KMQA 5FFOC 1H1IA 1UF2C 4I3PA 3HIFA 4GKYA 2VG9A 4E8DA 1AL0G 1ALYA 2WLQA 5DUVA 3ZVXA 5F37A 3O1RA 3TRSB 3LAGA 2VCMA 2X29A 1H0BA 2AGSA 4B29A 3AZVA 5J48A 1YIPA 5CZKA 1OKQA 4QKBA 4HL0A 1EY2A 5FZOA 3USUA 2P34A 5FZ9A 4LBNA 2DWRA 2QQKA 3ST7A 1AZDA 4DZGA 5A6QA 1O3TA 3V64A 4B8EA 2RMU1 3FHQA 5FCCA 1R081 1SFNA 5CKMA 3ZFGB 4F83A 1CPMA 1OBNA 2PQQA 4UBGA 2EAAA 1DGWA 1W9WA 4HN1A 2ZGTA 4XHXA 5FTTC 4CXXA 1KS4A 1REEA 4QQPA 3LDKA 1RUI3 5A80A 5I93A 2XUMA 3AP5A 3A23A 1UXZA 5JOWA 5K9YA 1W3VA 5EJZB 1F8VA 3GDBA 4LIUA 5M0TA 4JAAA 3WT3A 5L7OB 3ZSJA 2Y6KA 1XOYA 4FSJA 1G8WA 3HJRA 3J7HA 1DYKA 5D21A 4AHZA 2JKXA 3F95A 3I2JA 4RFT0 4QX7A 3R4UA 4W6WA 2VNOA 4YFWA 5KHKA 4QQHA 2XUEA 4JCKA 1SEFA 2EAKA 1LTEA 2JDPA 2XJUA 2VQTA 4OI4A 1AR92 3MF9A 5AFEA 1S0JA 4QKFA 4ATFA 4MADA 5DZGA 1RMU2 1VBA3 4YZ5A 3UJQA 5CA6A 4M01A 1MS0A 4XETA 2Q1MA 4CCMA 1UL9A 4FFIA 4LJHA 2AEYA 4XW3A 3LDRA 4KL1A 4IGQA 1LNSA 3O1SA 3CU7A 2HWE3 4I0BA 2WFPA 2ZMKA 5FIXA 3MPPG 1AXKA 1NYWA 4FXGB 5FOBB 3VN4A 4XDOA 1TME2 3B69A 2JB8A 5FY7A 4D7TA 5FP7A 3D0SA 1WWYA 1H8VA 3AL5A 2NQYA 2ET7A 1HRV2 3WF0A 4DRRA 3VBOA 1HV1A 1AYM2 5KXBA 2BRTA 4TN7A 4XF9A 4AE2A 1S0GA 2B46X 1ULFA 4CP9B 2WNOA 3MYXA 4Q0PA 4DXRA 2UWCA 4BE3A 4UFJA 4MGKE 2VE1A 4H7LA 4P9JA 4Y4RA 1GQPA 1X50A 2ORXA 2VZQA 4XPVA 2WC2A 4P02B 4D6RA 2ADDA 2E32A 3EMRA 4A3ZA 2RHPA 5A3LA 5GJ6A 2NPIA 3B93A 3EYPA 2PHUA 2MPFA 2Y26A 5FYMA 3KVAA 4WM8B 2EALA 4S2GA 4YW1A 3ZXGA 2SBAA 3M3EA 4M3CA 3I3QA 3ACGA 1ZRFA 3LEMA 4S2HA 4J1WA 3RFRA 3V56A 4QHBA 1QY4A 1SDWA 1UOFA 5FYVA 4BQ2A 2XR4A 1CAVB 2D97A 1D0GA 5LRRA 4EV0A 5J7MA 5FY0A 2BFUL 2RR11 3LOIA 5JXJA 1D4M2 4M3CB 4BQWA 4LO5B 1JXNA 5BXXA 3WINE 2BNMA 5FY5A 2IXKA 1JS9A 4PDWC 2CAVA 4NHMA 4FQZA 3V0AA 2E53A 2P37A 3OD4A 5T5PA 4EWEA 1CAVA 1ND3B 4INDA 4PIXA 3DKQA 1Y3TA 4CUCA 5I91A 2YC2A 2FDKA 3OGGA 2Y6LA 4P9WA 5C3RA 3H8RA 4UFKA 2RDRA 4CDUA 4JDMA 1YFXA 5A7OA 4CP2A 4DUWA 2TEPA 5DUUA 5DZFA 1NUKA 1COV3 3AFKA 5A33A 1CPNA 2GZWA 1GQHA 2WDBA 2XBO3 3CIHA 2ZPXA 3HQXA 3AZZA 4FT8A 2GNTA 1CAUB 4ARYA 4AQSA 4XXPA 2P5BA 3OEAA 4AI8A 2K9ZA 1Y9GA 1SLIA 4IL7A 1OOPB 2C5DA 3WVJA 3D0JA 5IVJA 5D2AA 1IG3A 1RGSA 4WBBA 2ARAA 5FMOL 4HPKA 1YXWA 3WNKA 3ZO0B 4CDUC 3KMHA 4A4AA 4PIYA 3E6BA 1R1ZA 1YRZA 3WZ1A 1NLQA 4CEYA 4FPKA 1SHWB 1R1A1 3M3CA 1ZVFA 1WLWA 2WS92 3CDZB 1Q8VA 4LBJA 3E6CC 1QJY1 1G86A 1AX2A 1ZZBA 3C7EA 4X8NA 3SH4A 3U4SA 3VD5A 4CXWA 3POGA 2DFBA 2BERA 1DHKB 4UXAA 3D82A 4LK7A 3LA7A 1S2EA 4NIIA 5BNOB 2YBPA 3GXUA 2DV9A 4BQYA 1ZREA 3QLQA 4LO6B 3SQOA 4IGOA 3I97A 1OPMA 1NQDA 4LHNA 1DZQA 1XPWA 4Y1XA 4Q0SA 3Q8BA 4Y5Z0 1MZ6A 5DABA 4BIOA 4EN8B 1LOCA 2NYYA 4W4ZA 4ZS2A 5A3OA 1YJLA 3LOBA 2PN5A 1OQDA 1RVF3 4XF1A 4LMFA 5A3UA 3WF1A 5A3MA 4ISQA 4FOWA 4CEWC 3KLSA 1ULEA 1UY2A 3KGZA 3FFZA 1DP0A 1DQ4A 4QPWA 5JSOA 2XJTA 3K48A 4CDQB 1M06G 1WLTA 5A7WB 5DAXA 2JDHA 4TZDA 4ORFA 1A34A 3OOXA 3ZLIA 2YU1A 1ND2A 3EQEA 3AXEA 4Q4Y3 2VM9A 1RC6A 1CAWA 4RGAA 1TNRA 1UY1A 1WCDJ 4FTSA 4W8JA 1NCRC 1AR82 1RUG1 3SXWA 2YXSA 4CEWA 4LO4B 1I3HA 1UIJA 1N3PA 1VBD2 1YUDA 2QQWA 3G6JB 3U75A 4YG0A 2HJIA 2VUJA 3OYWB 4GAZA 4TXWA 3T2OA 1MS1A 3DUIA 2BP6A 4OVEA 1YQ5A 4AYUA 5C8CB 2BDRA 5CYYA 1H2NA 2R041 3A4UA 5FDBA 3P3PA 2O8QA 1VBD1 5GZGA 1JW6A 3JB4C 4AI3A 2R073 5T50A 2XKPA 3ZXDA 1ZBE1 1GOFA 2X5IB 3POEA 3HN3A 1VE0A 4L99A 4I0AA 3OEBA 5AFBA 3C2UA 2WFF2 3QOPA 1R64A 2H6BA 4LA3A 2ZABA 1VRH3 4L11A 1BBT3 1O4TA 1EV11 4XF0A 2QQIA 5KHHA 3ZYRA 3TN91 2V4AA 2VNRA 2H0VA 3CMGA 4CE8A 3TEZA 1Z7S1 4K20A 2WWUA 3B7MA 3D6EA 4AHYA 2HWC2 1W9FA 3H50A 4Y24A 2A6WA 1SFPA 1UY4A 1BJQA 5JSRA 1ENXA 4RHV1 4I3GA 1DG6A 2JE9A 1F31A 2R0FA 1REDA 4YGCA 1W28A 1WMFA 4CTEA 2XKOA 5F3IA 1QJX1 5IVEA 2BTVC 1NA1A 4RR3B 4A3XA 2NN8A 3RI9A 3WD5A 5LY1A 3KHCA 1ZRDA 1OI6A 4KG8A 1YI9A 1RUC1 5I8SA 3WDXA 4A41A 1RYYA 4YNIA 1UU4A 4B7KA 1JZ2A 1MZ5A 1BCXA 5DG1A 1NOVA 3OBAA 2D6PA 4HG6B 1QJU3 2ZACA 2CU5A 1OF4A 2EA7A 1GZ9A 1W0PA 1G7YA 2VOWA 1TG7A 1SPPB 2WUHA 2YHJA 4IV3C 4UWDA 1RUOA 1RIRA 4RR3A 4C8DA 4EN0A 4RS5B 4CUGA 4CZSA 5JPMB 1NY71 1C1LA 3AZYA 3AKQA 1MZEA 2VZUA 3EHKA 4XDPA 3GZUC 4UAPA 3C8XA 4OFGA 2FDIA 2VVFA 3O14A 1MS4A 4PQQA 2HWF1 3PLQA 5A7SA 3SLIA 3N9OA 2WWJA 1YQ8A 3M2MA 1DIWA 5I0UA 2MNGA 4URAA 3O1MA 4K8FA 1U12A 1F2NA 2P6HA 3GBGA 5EYXA 4EWDA 3TEWA 3LA2A 2WABA 2N7GA 1DGWX 4K7JA 4BOWA 3RZZA 2HBTA 1IPKA 3I2DA 3LDBA 2DVGA 4LHKA 3BB6A 4EROA 3OUJA 1V9U2 4PBOA 5A7NA 2GSYA 1GICA 1S2KA 1PK6C 2PHWA 4BLIA 1DGRN 4QDSA 5A70A 1PK6A 2VQ0A 3THTA 1KGYA 2BGPA 2E51A 2JWPA 4XZPA 5E89A 4ASKA 3MLJA 5I0DA 1ASJ2 3AP6A 4IE6A 5FZCA 5LK7B 1AX1A 3VBSA 3R4SA 4AW7A 4LO7A 3VBOC 3ZYBA 3LB9A 4XUQA 5E16A 3PIGA 2D6LX 1ZZCA 1FNYA 2G9GA 2RS32 1VIWB 2YYOA 4PF5A 4BXFA 4RS5C 3ZN4A 2UWAA 3AKTA 4UFIA 1POV1 2ZGOA 3I3DA 5FREA 4ATEA 4CCLA 2CY6A 2XHKA 4Y20A 1OMIA 2VBPA 2WQZC 4P9LA 1JODA 1DGLA 2RM23 2WFF3 3N7MA 3TYJA 1H2KA 4LNVA 4JV4A 4ZZ5A 1GYKA 3MLKA 1K12A 2K2SA 5AC92 1DCSA 5GKAC 1V6NA 1ZA4A 4E4DX 4KG0A 2GP3A 1I5ZA 4GA9A 4H3WA 1BYHA 3B3QE 4COWA 1DF0A 1C1FA 4XAAA 4C0HA 2W9XA 3PUIA 1JN2P 1PM4A 1YO8A 2YFZA 1FI2A 4XDQA 4GMP3 4Y20B 4Y26A 3MF6A 5A3WA 2NZ9A 1FMD3 2V72A 1JTZX 5FZ8A 1TME3 2R30A 4AGVA 3POYA 1LOAA 1CJPA 1CZTA 2XVLA 5EJ3A 2XWJB 1AYN2 3NMBA 1K5MB 5FMBA 3VBUA 2DURA 1C5HA 3IWZA 2PAMA 1BQPA 1DQ1A 2HWD3 3BYWA 5FXXA 3BIWE 2RMU2 3AYAA 4WZCA 4XBLA 4G4FA 1X8EA 2QZ2A 5DAQA 2GAUA 5A6XA 4G9SB 3BGAA 2WJSA 5LCWL 5JR7B 4KH9A 4OQ9A 2P17A 2A3XA 4NRPA 3E5QA 2VZPA 3NAPA 3LEKA 1QQP3 1W6QB 3ZXFA 3T0BA 2A5ZA 1ZM1A 4YVSB 1GNYA 4BYYA 1AR63 3K4DA 1JZ8A 2W46A 4ASLA 3LD8A 3JU9A 5FZFA 1XE7A 1C8M2 4Z07A 1JZ6A 4LTAA 4COUA 3T2QA 1FAYA 1S0IA 2XOMA 5LA1A 1OHFA 2D6MA 1JOJA 2DU1A 5LK5A 3T1MA 4Z2AA 3BCWA 4OLLA 1JZ7A 3GHMA 3VBOB 4L8QA 4ARXA 1RUC3 1LESA 1WD4A 3OBZA 5FYIA 1G9CA 2WO7A 4EYUA 4DS0A 2JENA 3WLUA 2QVSB 2FMYA 2A6YA 3VDDC 3ZXEA 4B4RA 4FBFA 1LJ7A 2DCKA 2YBSA 2FCUA 3HWJA 3RZGA 2WA4A 4FPFA 4YRDA 4ES8A 5A7PA 2VXRA 4IEZA 4IEVA 3S6PA 3PVEA 4MYEA 3HR9A 1XE0A 4AXOA 1OD3A 4JDNA 3W5NA 4WM8A 5CG9A 1J1LA 1VBE1 3J7NA 2ZXQA 3LF7A 3BI3A 1AL23 3MIDA 4IV3A 5JXIA 2WLPA 1QDCA 2A6ZA 4M4PA 1DDLA 1IHMA 4RD7A 5I0SA 3DXTA 2JIGA 4XIOA 5J09A 1DYOA 2VBDA 3WEZA 2V5YA 3SKVA 3V65A 5ACA3 1WMXA 4DXZA 1PGL2 1T6BX 3EXUA 3N7JA 2RS52 1K5MC 1NG0A 5CFCC 1V70A 1ZBE3 1CR7A 3AMMA 4D7YA 4Z1VA 1LEDA 4YZ1A 1AR62 1UMZA 4FQ4A 1RJ8A 4FPEA 2B39A 4XFGA 2JICA 3OPZA 1EAH3 3VDAA 4TWTA 3VD3A 3WQ1A 4IE0A 2VC9A 3OJBA 4R9CA 5F7UA 2ZAAA 3AXDA 3IMMA 1UZYA 1DQ5A 3UL2A 5EV7A 5FWEA 4JDOA 4EWAA 4LUKA 4YGDA 3OB8A 1J59A 1X7NA 2Y38A 3VUOA 5JAXA 3RRDA 3UGGA 3BIEA 5T54A 3ZKUA 3O0VA 4M4RA 3NJXA 3AKPA 1W90A 4QB6A 4NHXA 3K3NA 3H1MA 4FPCA 1AYN3 2OA2A 4HZFA 1ACCA 1JYCA 2HWD2 3LKJA 5CAZA 1Q5OA 2NMOA 4AQTA 1O91A 2X8KA 2XBO2 1CX4A 1O6UA 1HX6A 1OOPA 2WQ8A 2YGLA 3ILNA 3OGSA 4HSJA 4XIKA 5IVCA 5C3PA 1V9U1 3KS7A 4E9KA 4A45A 5A3PA 1OXCA 3I3MA 4D7SA 1VRH2 1Q8OA 3THDA 3H3UA 2RDSA 3AMHA 1LECA 2J1RA 3H8UA 1VP6A 2OPWA 4OUMA 5EHDA 3OD0A 1CAXB 1W0OA 1HQNA 2AACA 5C5TA 1UZ0A 1V6MA 5C3QA 4AOCA 2IXLA 4R9AA 3ZR6A 4QM8A 4Q1RA 5CVRA 1QKQA 1UO9A 2YU2A 1O3RA 2Y0IA 2RS31 3VBFB 2HEVF 3PUSA 4ZS3A 1W6MA 1DGRA 4DEQA 1EPZA 4OZXA 4SBVA 2D6OX 3VBRB 4JGZA 3NQHA 3V0BA 5KR7A 1WZXA 2BOJA 4N53B 4JQTA 1C4RA 3K77A 2QQOA 4GIQA 1R093 2UYBA 2YY1A 3A0NA 1QWRA 2BU9A 2Q0AA 5FZGA 4FPJA 3GCXA 1WA4A 2ZGRA 5KWRA 1DQ2A 4XBNA 3UJOA 2GMEA 3LSDA 5DN2A 4B1MA 4EQVA 2PQSA 5JXGA 3P6BA 1Q43A 3POBA 1M4WA 4HLTA 3U1XA 3J8F2 3C7HA 5FZMA 1COV1 4XOGA 4ZONA 2J1EA 2ES3A 5A6ZA 1I1EA 3DYMA 1U5YA 1R091 4MOAA 1ENSA 3NWKA 2VQUA 4BLJA 5LBCA 3AX4A 3JB8A 4P08A 2RVAA 4YG3A 5I0TA 3SEEA 4CEWB 4XACA 4CVUA 1VAKA 2IVIB 2VTXJ 2ZS6B 5GZDA 5FBZA 3WW4A 4LLFA 3BU0A 3BTYA 3PU3A 2V09A 3WXPA 2WO2A 4XABA 5I8YA 2YBKA 1HRI2 4U36A 3E6DA 5FO9B 2MEV2 2EICA 3ZOIA 2A1XA 2KD7A 1RMU1 2AENA 2X53S 3OGJA 4LBLA 5K0UC 5BV6A 4P9IA 2FCVA 4U2AA 4OHVA 2RR13 3AP4A 3LE0A 3T3YA 3I2FA 1JI6A 1UU6A 4OUEA 2EVXA 2OS2A 1SBDA 1EYBA 5CKQA 4GQ7A 2FDHA 5FZ3A 4OULA 2ZKNA 3ILFA 2J1UA 2BVBA 1D0HA 4YWAA 3MIHA 5FQ0B 1NZCA 4BWOA 2Y0OA 4QX1A 4HANA 5IAVA 3MEPA 2WO3A 3MV01 2TBVA 3W5MA 2D44A 2VZSA 5SV8A 1WCKA 2WYSA 1NCRA 5FMCA 3Q8CA 2BQPA 5CG8A 2X09A 5JCTA 5FYHA 1SCSA 4N43C 1JYVA 1HQWA 4I0WB 1EAH2 2JDNA 2XJRA 1WGPA 1F4AA 1FATA 1NA1B 1N3OA 1V6OA 1O7FA 2GNBA 1CVNA 1MVEA 5B4NA 5KHGA 3AMNA 2O0OA 4LBQA 1MZFA 5JSPA 5IVFA 1JZ4A 3KQRA 4WVVA 1WW7A 2PHTA 3CZJA 3ZYGA 1OLQA 1XYOA 1EAH1 2WNUB 3MIFA 1EUUA 2O8OA 2GU9A 4K40A 2Y33A 3C7FA 5FUPA 1QJU2 3ROUA 1N1YA 3U4XA 4LBQB 1J3QA 2HWE1 4NRQA 1H30A 2QQPA 1B35C 4NHYA 4OZOA 4XCBA 1BBT1 1YQ6A 4K9SA 1PNFA 3AKRA 1VRH1 3ACIA 2W47A 3S7IA 4Q29A 2O14A 4X6RB 4YLZA 4LT5A 4BQXA 4E2SA 5KC5A 1N1TA 3RYPA 2HYKA 3DL3A 1L7LA 3AZWA 1X9TA 3VBRC 1CD3G 2DF7A 3VDBA 2CWMA 4MH0E 4BK4A 4MG2A 1IPSA 2DCJA 5F6KA 1NAEA 4HT1T 1XRUA 1LHUA 4YVSC 3U37A 4NE9A 2WT0A 1KXGA 5FUIA 2VECA 1QF3A 2WAAA 2H0BA 1PK6B 4AVBA 4N43A 3B94A 3I59A 3JXSA 4YGEA 1NE6A 4FAHA 5DAPA 3D4KA 2J1SA 4Q4X3 2DBNA 3WQ7A 4FCAA 1PM7A 1RUG3 2VCCA 3PMSA 5FJHA 4E4ZA 4JTOA 4AI9A 1Z78A 2WYFA 3VBSC 5A1FA 5FRAA 4BXSV 1ODMA 3PJQA 3C7OA 1AYN1 4PLNA 2ZGSA 3CO2A 3U0ZA 4A6SA 2J1TA 1H1MA 3RI8A 2EXKA 2LM3A 1PO22 3I59B 4IGPA 4P9XA 4AEDC 2RMU3 3HVDA 2Q4SA 4Q4X1 5DQ0A 2D3PA 2W1WA 4CDXA 3Q8EA 1NCQC 2A75A 5FUNA 3TWIA 3FLTA 4CDWB 4AWDA 3WDWA 3NV2A 5C4WA 3T1LA 5EFUA 3B01A 2W5FA 5JI9A 2JE8A 3VZNA 2VW0A 4LKFA 5ANNA 1O8PA 4GULA 5A7QA 5L9VA 1W9YA 4QX3A 2HWD1 5BYNA 1BK0A 2XL9A 4BMEA 1HJGA 1KRIA 3O5SA 4IEXA 4MHRA 4AFDA 1PZ7A 1AF9A 5FO8B 1GANA 1NLRA 3HBZA 5FYCA 2VULA 5BNQA 3ABZA 3VBUB 4DO0A 1UOJA 1ZZ7A 2J22A 3IIAA 5CFCB 1PNGA 1IS3A 1IQAA 1US3A 1V6IA 3P1IA 1ULGA 3AJYA 5JOYA 4IV1A 5JZGB 3I7DA 5CKNA 5C7GA 5F5AA 3VHNA 4DNYA 3DGTA 2WAOA 1W8NA 4COYA 1UIKA 5A32A 1Y9MA 3CKHA 2UURA 3GJAA 5T5OA 4W6YA 4BCUA 1W8UA 3NAPC 2ZEXA 5C6CA 4CYDA 2GDFA 1CIYA 2IXIA 3M7AA 2JECA 3WF2A 1V0AA 1NA1C 2UYAA 3HT2A 4H55A 4QKNA 1WMDA 5D8AA 3ACHA 1DZTA 1H1AA 2R32A 3B02A 3DV8A 3MIGA 2DVBA 4IQPA 3AB0A 5LATA 5FR3A 4M3CE 4QGLA 1FXZA 2E63A 5A32B 4FXKB 4W6XA 1Y43B 3NJYA 3B5LB 3ZX7A 1OSGA 3IDAA 2AC1A 3VBHC 4MX3A 5C4WC 1DLCA 4K21A 4DXSA 3N7KA 2IVJA 3E5UA 1ZYBA 2QE3A 3JQWA 4NHKA 3VHRA 5D8AB 1AR61 1KFXL 2JE7A 4LUMA 5IWFA 4KI5M 4Y4YA 5FKCA 1RUF2 3I54A 5JOXA 2ARXA 2W08A 1CZSA 4ZXKA 4QXBA 1BZWA 4S2FA 2CAUA 3MICA 4NPLA 4AK3A 4CDWC 1RHI1 1W39A 2YG0A 3MW2A 2Q8CA 4COVA 5JPNB 1N1SA 1W8OA 3ELNA 4QU1A 4PBPA 3RWNA 4Q8LA 5JR2A 2C9AA 2VY0A 5F3EA 1YJKA 1RUH2 4A7KA 1F9KA 4R4ZA 4QQOA 1AYM3 2LW8A 4V2WA 2VQAA 5LBBA 3WUCA 4RHV2 1A78A 3TOJA 3USUB 3I49A 2Z5WA 1H4HA 3B9IA 3HNBM 1QEXA 4FOYA 1R092 2K0GA 2OW4A 4LKEA 1O5UA 1O3QA 4JVAA 3VL9A 4META 4JGYB 2LTNA 4QPIA 1ODNA 1ULDA 2OQ6A 1VMJA 4PI2A 4CCJA 1ZX5A 4DY3A 5F6LB 2P3YA 5JMOA 5LBFA 2PHFA 5CFDB 5IYYA 1S1AA 3PJYA 3T08A 1MVQA 3WUDA 2RE9A 3T0DA 3WNMA 2MEV1 4DIQA 3M8LA 4Y22A 5JDBA 1POV3 5FYZA 5F3GA 2BJSA 5L7OA 1QDOA 3AYDA 3ZFEC 4B7EA 2Y34A 5ANQA 3ZFEA 4IE4A 4HVQA 4QPIB 1AHSA 4Q26A 5ACA1 1PIV2 2F4LA 2DYCA 4GXLA 4RFRB 4ZXEA 1Z7S3 1U5XA 1W3XA 5FMOS 3VZOA 2AREA 3QCWA 4V1PA 5BNPB 1PGW2 1VR3A 4UF0B 2BW8A 3WNPA 1VBE3 1BK1A 1QU0A 1YC61 3OCPA 1CAXA 4NAMA 4RN5A 4BDVB 1YNAA 2PFWA 5T5LA 1OVPA 5DAVA 4LKDA 2J42A 4EZHA 3M1HA 4LHLA 2ZA9A 4KQ7A 2JEMA 3LEGA 3WW1A 1SDDB 2DVAA 4FOVA 3ZSMA 4MO3M 4M3CF 5LEKA 3AYCA 4UF0A 5FXZA 3TNPB 3VKOA 2QTWB 2Y8KA 3LQCA 4WVZA 3POWA 4JX0A 1GLHA 1YWKA 2HWF3 4NAOA 1PMJX 3MFCA 1E5HA 1FX5A 4N53A 1GWLA 2PLV2 1GP4A 4AGRA 2VMIA 1WA6X 4FOQA 1RUI1 2E7AA 3MBWA 4IV1C 4HONA 3VBFC 4LO8A 3BTXA 1OH4A 2AR6A 3FL7A 1D2QA 1LODA 5EQUA 5FPLA 5IUQA 2VW2A 1NX9A 1FYUA 4AEMA 1UX7A 1BEV2 2WT2A 2XDVA 1QHDA 2I45A 2BVVA 3DN7A 3QH7A 4YM1A 2ZGPA 1IZ3A 4JRLA 1GV9A 3CNAA 5GLZA 3SCFA 4NIHA 5FY1A 5GZCA 3J26N 3ACLA 2Z4FA 1POV0 3GJBA 3H42B 1EPWA 5C71A 4RL7A 1IS6A 3CBNA 4GKXA 2CDOA 4C1WA 3WSOA 1PVXA 2UY8A 2B8MA 2D43A 3P5BA 4L97A 4RHV3 3GCWA 4Q4Y2 1NCQA 4D6QA 5H9RA 3AFGA 3WOGA 1BMV2 1WMEA 3ZSEA 3T4VA 1JUHA 1UX6A 1LU1A 4YW7A 5EXOA 5FYTA 5IAXA 5IT6A 1VBC2 2ZX4A 4CEYC 4AFCA 4Q4V3 1C5IA 2LROA 3I2GA 1RHI2 3FJSA 3MW3A 2BWAA 5T5JA 1AL21 2VD7A 1JYTA 2VXJA 2WNVB 3VD4A 2VMHA 3ZIWA 4KWJA 3L9JT 2D93A 3PDQA 5T3NA 1L7RA 1DFQA 1LHNA 4GZ9A 5FQ0A 3OGVA 4ET7A 5JOZA 2KR2A 4Q2FA 1RUNA 4JTNA 3MI8A 1OA4A 4P00B 4MUVA 2CWSA 1YIFA 3CJXA 1OLME 3H7JA 3VB9A 4Z8BA 3K75B 3DPRC 3WG4A 2IFWA 3FBMA 4A7ZA 5FXWA 3MHZA 2QFEA 5A33B 1PVC1 3ALQA 4YVWB 4R9DA 4BIFA 3O0XA 1FPN2 4HN0A 3BOPA 2AEZA 2XLGA 5FXVA 3IN9A 2PHXA 2WZR2 3LEIA 1EP0A 3POIA 2Q1ZB 4BM8A 5LRSA 3UT0A 3THPA 2RJKA 4BQ3A 4ZHNA 5IK7A 2ZOEB 1GSLA 3NSTA 5FZIA 2D5FA 2Q5TA 5HV0A 4NHLA 2JD9A 2QKDA 4CEYB 2KA3A 3KD4A 4WV8A 5B2GB 1TQ5A 3BODA 2JDYA 4YGBA 1IGOA 1RUD3 1YQ2A 3APBA 5LA2A 3WDYA 4YVWA 1F35A 4NIDA 2GMMA 2CSGA 4EE2A 1RVF1 4L0PA 3E5XA 3OBTA 5FPBA 5J3UA 3RMYA 3ZPOA 3WG1A 1RHI3 4IEYA 2VZVA 2CL2A 2A3YA 1G9FA 2D6KA 4C91A 2XXZA 2VMCA 1RMU3 1APNA 3ITQA 4B3NA 1VALA 3HAGA 1F5JA 4LK6A 4TLFA 4PLOA 1OKOA 1BKZA 1WW6A 2JG8B 4H2AA 3UV9A 4N8MA 4BHPA 2FMDA 3MFAA 1TME1 5ABJB 3TEXA 4UW6A 1FMD1 1GOHA 3MLLA 2E6VA 4GMP1 1W6PB 2Z79A 1DQ6A 1HXS1 2E9QA 4Y5SA 2HWF2 5KHIA 1ZZ6A 5LASA 2NLRA 2V5DA 3NW4A 1HJFA 4MSVA 5FZ6A 3K51A 1N1VA 5HCHA 3E1F1 3LGRA 3ENRA 4NO4A 4Q4W1 2WFF1 2RM21 4AVAA 2XLFA 4NUBA 1ZNPA 1W6PA 1EUTA 1H2MA 3RS6A 1Z0HA 4QHZA 4QXHA 5ERLA 1FOD3 1BBT2 5L36A 1O3SA 1W6NA 3RQ0A 4JHTA 4RR3C 2RG4A 3ZFFC 5D8AC 5DUXA 3ZN5A 3KV4A 3A21A 3JD73 4AEDA 4CDXB 1GWMA 3TN93 3S30A 1RXFA 4XTMA 2ZX2A 1RUH1 1ZRRA 2QDRA 3LPGA 3VHOA 4F7ZA 5E6HA 2GC0A 4LIVA 1CJDA 3KV5A 4DB5A 2SLIA 4NIGA 4IERA 1VMFA 4RA0A 1H8TC 5FWJA 3T0AA 4CP9A 1RXGA 2QQLA 2R043 4MZUA 1OLMA 1RUJ3 4Y1ZA 1OQ1A 4FPLA 1VMHA 5KXEA 4RQPB 1Y7BA 4HKOA 4DUXA 1B35A 3JCIA 4N7UA 3RJ2X 4O9EA 5CFCA 2GN7A 2WZR3 5EJ1B 3I2IA 5C3OA 3DECA 2Y6FA 3WX5A 3ZM8A 2ET1A 2JIJA 2VJXA 3BOWA 5LA0A 5APAA 3BN6A 3WDVA 3KGLA 2VZRA 5JZGA 5IJRA 1HB1A 1W0NA 2P3KA 2C0ZA 4OCTA 3U14A 3AMPA 3UKNA 4RGKA 1W8ZA 2WA3A 3EBRA 4KWKA 2ZAHA 4WVMB 1PHMA 1WUVA 2TNFA 1U5IA 4RQPA 3VKLA 1UY0A 2GALA 2RR12 1CX1A 2GC1A 1LOFC 2W0XA 2EIBA 4QX5A 4DOUA 1LOFA 1LULA 4XQDA 3VBHA 4CDXC 1OUXA 5AVAA 1OD5A 2VZ1A 4YZ4A 1BMV1 4JQRA 1CONA 1IG0A 5JZGC 4COZA 5FY4A 3INAA 3V0AB 3PUHA 5J37A 5HI0A 1DYPA 2ZGLA 4CCDA 1VBB2 2ZZQA 4CRQA 1RL3A 1R1A2 3NO8A 3RZMA 5F2SA 1MQTA 5BNPC 5EYYA 1URXA 5LEJA 2OIIA 4P5YA 4CDUB 1J3RA 2R49A 3SMHA 2P2KA 3IDCB 5DXDA 4QQLA 1H8TA 1MS9A 1JZ5A 4YW4A 3W59A 4CP1A 1DLLA 1I9RA 2VAUA 2RS12 3AMQA 4GALA 3CLPA 1PMHX 4L2NA 5GLVA 3FBYA 1ZRIA 4HBNA 2PHRA 1CAUA 1MQTB 4H14A 3I3BA 4LEJA 4FPYA 5SV5A 2E7TA 4IESA 3RZLA 1VBA1 4KBZA 1LEMA 2AZ5A 2GH2A 2RS11 1JYIA 3ZR5A 4GH4C 1PO12 3JBG1 3HOBA 1E5SA 3NV4A 4YFZA 4P5HA 2XBO1 4LE3A 3RWKX 2DU0A 4C1XA 3FFQA 4D94A 2BV4A 1AL22 3H9AA 1NE4A 4W65A 2OPKA 4J1XA 2ERFA 5LW9A 1GUIA 3FX3A 5I0RA 2QQNA 1JYXA 1GKBA 1OF3A 4AAXA 3H3ZA 4K8RB 3HMYA 3NV3A 1UOBA 1WLCA 2JD4A 3RZJA 2VO5A 3ZFGC 2YC0A 5EZWA 5JLVA 1Q3EA 3J7MA 4Z82A 5JIUA 4Q4Y1 1FOD2 5FZDA 3DPRA 1W9TA 2Z2SB 3VDDB 2R042 3OGRA 1MS8A 1H9PA 2QBXA 1KDKA 5FYBA 3ZXLA 1BXHA 5K4LA 4D6SA 2G9ZA 3ZFEB 1UYPA 2XLAA 2ARCA 1SACA 4DQAA 2ZCWA 3O1UA 4YM3A 1J84A 1EV12 3TEYA 1RUG2 1YFWA 2JJ6A 4WM7B 5K8SA 4QQ2A 1K3IA 2XONA 3VDDA 4GH4B 5CFDC 2HKXA 1Z7S2 2BOIA 4PQ9A 3UESA 2P4EA 1GNZA 4BB3A 3W20A 4WZFA 5IVBA 3GALA 1AXYA 3KWVA 2IXCA 2B4KA 2OKXA 4O9GA 2YV8A 3WP5A 3HBKA 1QJY3 3USSA 1GBGA 2O1QA 2QNKA 3PVOA 2C1FA 3NNFA 4G3YC 4OI2A 4JGZC 2NMNA 3CZUA 4WM7A 5DAWA 3VHPA 2ZGQA 1XYNA 4J25A 2FZ2A 3PMEA 5LB6A 5FZLA 4YVSA 2DDUA 3AYEA 3HNYM 3HPNA 3VKFC 5BY5A 1GWKA 3IB3A 5IFTA 1LHWA 3UETA 1HQLA 4QHOA 1OURA 4OHXA 4JKLA 2E7QA 2R16A 3CEWA 4LLOA 1YYNA 1FV3A 3WNNA 4AQ6A 1SLLA 3RZHA 1H6XA 3IDBB 2VUAA 4QWNA 1AR73 1D4M3 2R7EB 4MVTA 3WG3A 4DRVA 3IT8A 5H9PA 4XQ4A 5GLTA 2XPJA 2QUOA 5IVYA 1KJRA 2P3JA 2W87A 2CHHA 2ZHLA 3WP6A 2VMFA 4Q4W2 1B09A 4X6QB 2XG3A 2AYHA 3KT7A 4QPGB 1LOGA 5KXDA 5L9BA 4N7IA 2L9LA 4JRAA 5JWPA 4XMIA 3OG2A 2XJQA 2A71A 2RS33 2ZGUA 2ZHMA 2WIIB 3N3HA 1X9PA 3I8TA 3FWEA 2LS6A 3U10A 1OQEA 2WN2A 2B9UA 2BNNA 1OFNA 1COV2 1W2NA 2ARBA 1ZBA3 4QPGA 4CP0A 2ZZJA 5C5UA 3FZ3A 2JDMA 2AH2A 4OQ8A 3PVBB 2OUHA 3N36A 2IC1A 1I5PA 3A22A 4B4PA 1V9U3 2ATFA 2CV6A 4HMZA 4XAEA 2ZX1A 3U07A 2WS91 2D40A 3GNEA 2D98A 5FZAA 1VBC3 3WP3A 3WR0A 3RPQA 5FLJA 4AAPA 4XFHA 1C57A 4P9YA 4XFAA 2KXLA 3ZDVA 3RYRA 1CN1A 3LWCA 4ISRA 4LBMA 3POSA 1HRV3 5IATA 3TB0A 4QD2A 3ILRA 3IMNA 4R8HA 3IKWA 4CPBA 1LGNA 3MGUA 1LRHA 2QQVA 1H6YA 1QJU1 4ONUA 2VH9A 4OUSA 5BPXA 1ZRCA 1DBNA 2Q1FA 5L7OC 2UWBA 1HLCA 4KU8A 2VTXA 2W1QA 3KZ4C 1GZTA 2B5HA 3CHXA 1XXNA 4QT6A 1PZ9A 4QDRA 2CGNA 1HB4A 5FZOB 3URFA 2QQMA 2VZ3A 3AL6A 3OBRA 5IK4A 3LZZA 1HIXA 2VPVA 3CJIC 1RUE1 1LB2A 3K2OA 1QJX3 2JDAA 1TMF3 1WCQA 1CESA 4XMAA 2YROA 4AI1A 1X82A 2JX9A 4GD4A 4Y3OA 5ISLA 2OUJA 3WW3A 2XJSA 3WY6A 3KV9A 3B00A 4OHWA 2KM2A 1UQXA 4UFLA 5GALA 3WCSA 4D3WA 5AC93 2UU8A 4QB2A 3IZOA 4IEUA 4LE4A 3PVNA 4HFSA 4ZKTB 5BNOA 2ETEA 1KQRA 5LZ6A 4L92A 1UNBA 2W2IA 2GP5A 1A8MA 1OUSA 1W2UA 4Y1VA 1UD1A 3I2OA 1A8DA 3NRUA 1QJZA 3J8F1 1GZWA 5LY2A 3FLRA 1ASJ3 3FLPA 5KBFA 4LBOA 5FZ7A 1W6MB 1Q8QA 1W05A 4FFHA 5JVVA 4CDQA 1YLLA 3MIBA 2QJVA 2VZTA 4NPRA 1CWPA 3VBRA 1JYNA 4JGZB 3BUCA 1PVC2 4JGYC 1W9SA 2WSUA 4MLOA 2VNVA 3HEIA 3S7EA 1Q8PA 2JG8C 5ABJA 3W21A 3X29B 3K4ZA 3MO4A 1YHFA 2ZX3A 2HYXA 4XUPA 1JHJA 4QGNA 4AI2A 1GZWB 3CJIB 1NKGA 3ETPA 4EZ4A 2R1BA 5FAXA 3H3LA 1K5MA 4I01A 3SNMA 3T30A 2AUYA 3JBG2 2DUPA 1QQP2 4UFMA 1AJOA 2DCTA 1MEC3 4RYDA 2WL1A 1JOPA 3WDUA 1IKQA 1D2SA 1GNHA 4IEOA 3LFMA 3O1OA 4UW3A 4XXAA 2EIDA 2XMLA 4HVRA 3GF6A 1OLRA 5CEHA 2WNUC 1W8WA 1QQP1 3CJIA 3OPWA 4XURA 3EO6A 2A6VA 4B4QA 3I2HA 1G6NA 1W04A 5GLWA 4DINB 2R061 2ZKLA 3S57A 4AEJA 5HCBA 4FPHA 4KGGA 2C4XA 5FPZA 3SHRA 1XU2A 2BBVA 3AKSA 2DVFA 2VMDA 1GP5A 4S2DA 3UKVA 1NXMA 5IVVA 4E2QA 4PHZA 4Q1PA 3FE5A 1GMMA 1AR81 3KVBA 4FP3A 3TN92 1UMHA 2BZDA 2F6BA 2E31A 1A6CA 2B45X 2OVUA 1S0BA 1UN1A 1PO21 5F5QA 4C90A 1QXPA 4XF4A 2HWB2 2UY9A 4QB1A 2F4PA 1R1A3 4IEWA 3GZAA 5J1XA 1VAMA 2BPA2 5J98B 4LKSA 1B35B 3A7QA 2WNVC 4YPJA 3G7DA 3ZSKA 5F39A 3EB7A 1QJX2 5ACA2 1ZBE2 1YFUA 3W9AA 4E4SA 4M0NA 2ID4A 3W58A 1XQNA 4HOOA 4E8CA 4Q5OA 3SC7X 2RDNA 4JC1A 3O1PA 2JG9C 3RJRA 3SH5A 4I09A 3MZHA 3OUIA 3ORJA 1SPPA 1W8TA 5FP4A 3BTAA 5FZ1A 1XNCA 1OFSA 2XQXA 3AJZA 4N9HA 3TNQA 1WD3A 1WW4A 1S4CA 1IKPA 4UI9L 5E1RA 3NL1A 5CU1A 3N9NA 3IIIA 4TSVA 4AFMA 2P6CA 3H8OA 3R4DB 4AHXA 5IW0A 1ENRA 2Y60A 2V73A 1HDKA 2YPJA 5FK8A 1JOBA 4FPOB 4LULA 4I30A 3WNLA 5KC6A 1W6OA 3GHNA 2Y64A 4LR4A 5BNOC 1AJKA 4BU2A 2VMEA 2K46A 1PIV1 1PZ8A 3UGHA 5A1AA 1SCRA 1E5RA 2DUQA 3K3OA 3T4HB 4XVHA 4BK5A 3TAYA 3AK0A 1W2AX 4M0HA 4HPKB 2RDQA 3L2HA 2HWB3 3PNAA 1W2TA 3ZDSA 2D7FA 1PGL1 1KFUL 1XNAA 1LENA 2WNEA 3KCYA 2XVGA 3RDIA 4MGSA 5H9SA 1R082 4LPLA 1DZRA 2JG9B 5DMYA 4XHBA 1RB8G 4LBKA 3NKGA 4XYXA 3H0OA 1PX3A 1OPOA 2WN3A 2ZGKA 5CIRA 1VAVA 4FTBA 2LRPA 1ASJ1 1ND3C 4KWLA 2FDJA 1NT0A 1UW8A 1UWWA 2C6SA 4Q27A 2WQ4A 4GWJA 5FZEA 3FUOA 2R6QA 4LORA 3PIJA 4JHZA 4XFIA 3WP4A 4BA6A 4N43B 3WV6A 3MV11 1ONAA 1ZA7A 3AM2A 1SLCA 5GLUA 1SQ4A 5CISA 4TLGA 3NNJA 2JG9A 2BGOA 2PLV1 3ZFFA 2J1AA 4UYBA 1VB4A 5JXHA 1HRI3 4IXLA 4AR2A 4Q0VA 2PAKA
chains in the Genus database with same CATH topology
2JDKA 2CHHA 3DCQA 1W8HA 1OVSA 2JDYA 2VUCA 4AOCA 2JDNA 4CE8A 3ZDVA 2VNVA 1W8FA 5A6XA 1UQXA 5A3OA 5D2AA 2BV4A 5HCHA 5A6ZA 2BP6A 5A6YA 5A70A 2JDPA 1OURA 5A6QA 1OVPA 2BOIA 2BOJA 1GZTA 1OUXA 1UZVA 2WRAA 1OUSA 2VUDA 2JDHA 4UT5A 2XR4A 1OXCA 2JDUA 2JDMA 2WR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDK A;  2CHH A;  3DCQ A;  1W8H A;  1OVS A;  2JDY A;  2VUC A;  4AOC A;  2JDN A;  4CE8 A;  3ZDV A;  2VNV A;  1W8F A;  5A6X A;  1UQX A;  5A3O A;  5D2A A;  2BV4 A;  5HCH A;  5A6Z A;  2BP6 A;  5A6Y A;  5A70 A;  2JDP A;  1OUR A;  5A6Q A;  1OVP A;  2BOI A;  2BOJ A;  1GZT A;  1OUX A;  1UZV A;  2WRA A;  1OUS A;  2VUD A;  2JDH A;  4UT5 A;  2XR4 A;  1OXC A;  2JDU A;  2JDM A;  2WR9 A; 
#chains in the Genus database with same CATH topology
 5AC9 1;  1LU2 A;  3VBF A;  1UYX A;  2J7M A;  4QMA A;  5K7P A;  1LOB A;  4HKL A;  4MGT A;  3WNX A;  2D5H A;  3PHM A;  1UCX A;  4JKM A;  3RYK A;  5C33 A;  2Q8D A;  2WZ8 A;  5A7W A;  5E88 A;  4AG4 A;  2DUO A;  4NRO A;  1TMF 1;  4N53 C;  2VW1 A;  3NJV A;  2ZMN A;  1RUE 3;  4CU7 A;  5FPU A;  3T09 A;  3JZV A;  1NZI A;  3DPR B;  4NN0 A;  3ZFF B;  1HRI 1;  2WIN B;  3R05 A;  3PUR A;  4MHU A;  3WQ0 A;  2DBI A;  1QH7 A;  1GFF 2;  2RJ2 A;  5JIA A;  1UY3 A;  1PO1 1;  2IXJ A;  1EV1 3;  4K1Y A;  1QXR A;  2X05 A;  3SCG A;  3OYW A;  3SEP A;  3MDP A;  4NWW A;  1QOO A;  1WKY A;  4E4H A;  2X10 A;  1AR7 2;  2YPD A;  1C8N A;  1BHG A;  4NOT A;  1I6X A;  1XU1 A;  4GH4 A;  2YB7 A;  1LOE A;  5FZH A;  2R07 1;  1F4H A;  1W6Q A;  5DZE A;  1VBD 3;  5K0U A;  1VBC 1;  1OVS A;  3LIH A;  4IE5 A;  2DTY A;  4LOS A;  2Y6G A;  2W91 A;  3SCH A;  4EN6 B;  5FPA A;  4UBH A;  4YM2 A;  4IV1 B;  4AVC A;  3WF3 A;  4AF9 A;  3N7L A;  2NP0 A;  2ADE A;  3OY8 B;  5BUV A;  3BPZ A;  4AVV A;  3IDE A;  2A7A A;  3T2P A;  1POQ A;  1UKR A;  3NV1 A;  1C8M 1;  2EIG A;  3L2Y A;  4KGQ A;  1XBF A;  2QDN A;  2WZP P;  4CSW A;  2VGD A;  5HXV A;  3UKT A;  1JU3 A;  2CDP A;  2VVE A;  5K0U B;  2W39 A;  2ZEZ A;  4XUO A;  1XYP A;  3MPB A;  3MW4 A;  3SIT A;  3I2K A;  4GMP 0;  2JDU A;  2BEO A;  5HXM A;  5EIY B;  4JKK A;  1TZO A;  3OY8 A;  2JB4 A;  3KV6 A;  1R08 3;  1RTV A;  1UKG A;  5GZF A;  4CCN A;  1QIQ A;  4LOT A;  4AZZ A;  3POF A;  3BPS A;  3KCC A;  2RS5 3;  3C3V A;  2W52 A;  3WNO A;  2ZML A;  4A7Y A;  5FP9 A;  3N4M A;  4MGY E;  4O7X A;  4UW4 A;  4CCC A;  4R4X A;  1O4Z A;  1YEW A;  3GZE A;  3ASI A;  3IBM A;  5KHJ A;  3M4F A;  2B7Y A;  3ECQ A;  2XWB B;  3KQ4 B;  3THC A;  2ZHK A;  3N35 A;  4XFB A;  5TSW A;  4DEV A;  5CAD A;  1NCR B;  5IK5 A;  4GB3 3;  4D0Q A;  5H9Q A;  1SG3 A;  2VL4 A;  2WRA A;  3ATG A;  4MXV A;  4R52 A;  4BZ4 A;  4W50 A;  1SZB A;  1V6L A;  2XL7 A;  2W3J A;  1OA3 A;  3NVC A;  4Y5T A;  3WDT A;  3RZK A;  2CGP A;  5FJK A;  3Q8F A;  4AGG A;  2OQ7 A;  1N3Q A;  3UGF A;  5A3N A;  4P14 A;  1BEV 1;  3KF5 A;  4HK8 A;  4L9B A;  1UMI A;  1UPS A;  4FP2 A;  4XFF A;  5DDJ 2;  5FOJ B;  5J36 A;  4HK9 A;  1WBF A;  3AVS A;  3NNM A;  1IPJ A;  1FPN 1;  1GU3 A;  4QPG C;  5FYY A;  4AVT A;  2DFC A;  3VD9 A;  2E26 A;  1VBB 3;  1GOG A;  1S55 A;  3M3O A;  2D6N A;  3PTY A;  1HW5 A;  3KCX A;  1Y4W A;  3H1Y A;  1E5I A;  4UW5 A;  5FV3 A;  3SH3 A;  2VMG A;  4XJA A;  1MEC 2;  3WHU A;  1S0D A;  3H7Y A;  1V00 A;  1YI7 A;  4BQ1 A;  4DMI A;  4CU8 A;  3U11 A;  1J58 A;  3BVC A;  4JGY A;  2YC4 A;  1K5J A;  1ULO A;  4XUN A;  5FPV A;  2HEY F;  4V2V A;  1SLB A;  2IWG B;  4QX0 A;  2RS5 1;  2B42 B;  4LBQ D;  2WT1 A;  1W99 A;  1SFY A;  4YYO A;  1LGC A;  2VBB A;  3IAQ A;  1VRB A;  1D7P M;  3O12 A;  3VBS B;  4OI0 A;  2YGM A;  3WQB A;  5GM0 A;  3J4U H;  4KWU A;  3DYO A;  2YDE A;  2V4V A;  2YMZ A;  4NPM A;  4QM9 A;  2IFR A;  2Z69 A;  4YW6 A;  2HWC 3;  4CCE A;  1IOA A;  4WVW A;  1CZV A;  1V6K A;  2CYF A;  2GMP A;  5EWS A;  3VZJ A;  3IM0 A;  4Y33 A;  1SBF A;  1QNY A;  1HXS 2;  1HB2 A;  2HWE 2;  4XC9 A;  1SLT A;  5E8A A;  3HQR A;  1FV2 A;  1MQT C;  1DQ0 A;  3H1W A;  4GWI A;  5BNP A;  1XSQ A;  4P9G A;  2VR4 A;  4X8P A;  1O8S A;  3DXU A;  1LKN A;  4NMI A;  2VNG A;  1JYW A;  4WM7 C;  4BH9 A;  5F1R A;  2ORZ A;  3AVR A;  2R0H A;  4SLI A;  2Q8O A;  3VKM A;  4AQ2 A;  3V0B B;  2XGX A;  3KF3 A;  5FP8 A;  3R6S A;  2RM2 2;  4XCA A;  4CA9 A;  4NJ4 A;  1O5L A;  1W03 A;  4M00 A;  5T55 A;  3IPV B;  5FO7 B;  4NVP A;  1H4G A;  5I8T A;  3D5O A;  3OTF A;  4PDW B;  5CB7 A;  3OUH A;  1YQC A;  3POJ A;  2VTF A;  4QKD A;  4CDW A;  2BFU S;  2R07 2;  1NLS A;  1PO1 3;  2XQR A;  1UYZ A;  3AP7 A;  5C9A B;  4ZU5 A;  3GZT B;  1XND A;  4XFC A;  5LBE A;  4I2O A;  3FHA A;  5A3T A;  5FMD A;  2R06 2;  2ZGM A;  4C0B A;  2OYZ A;  3IPV A;  1WCS A;  3SKJ E;  4PDW A;  5IK8 A;  2BGC A;  2DCZ A;  5LA9 A;  4IW3 A;  3NAP B;  4OHY A;  1AX0 A;  2BWC A;  2C26 A;  5C8W A;  1YCI A;  4GB3 1;  3BKZ A;  2DTW A;  4HXC A;  5C9A A;  4IDZ A;  4BPZ A;  3QAC A;  5FLH A;  1Q8S A;  1QJY 2;  2ZEW A;  3BAL A;  2QZ3 A;  4QPI C;  4QPY A;  5FP3 A;  5G04 L;  4AI0 A;  4FO9 A;  4TYS A;  2VOK A;  1K42 A;  1W2O A;  2BYV E;  1GR3 A;  3ZYF A;  4OI1 A;  3M70 A;  5F8P A;  5FK7 A;  4ZU7 A;  1JZ3 A;  4DY5 A;  4YVW C;  2ILM A;  4UT5 A;  1MS5 A;  4J6G A;  3S5Q A;  3HQU A;  4A6O A;  4HKW A;  2WR9 A;  1ZZ9 A;  2XB6 C;  4GWM A;  4DUV A;  3GGL A;  2BNO A;  2VCA A;  3NKT A;  2WS9 3;  4MV2 A;  4FFG A;  1C8M 3;  4ZZ8 A;  1BVV A;  1RIT A;  4EN7 B;  2LUW A;  5DG2 A;  4CUB A;  4F8A A;  4Q0U A;  4PCR A;  1SBE A;  1OA2 A;  2WZR 1;  2E33 A;  4IV3 B;  3KT1 A;  2W92 A;  1VPH A;  3MUY 1;  1WBL A;  1ZBA 1;  1AVB A;  2W68 A;  2DCY A;  3QD6 A;  3Q9O A;  4NWV A;  3ZYP A;  1IS5 A;  1XC6 A;  2PHL A;  1RUJ 1;  4Y1Y A;  2W95 A;  2GC2 A;  3MIE A;  1X36 A;  1UZV A;  1MR5 A;  2HWC 1;  3KHB A;  2GNM A;  4XQW A;  2A6X A;  3ZN6 A;  1MPX A;  2FDG A;  1VLN A;  2W94 A;  1ZBA 2;  5A1L A;  3VLB B;  3J9S A;  4AEK A;  3GBF A;  2WNU A;  4N9I A;  1HV0 A;  3OF1 A;  3DCQ A;  4OYU A;  1KDM A;  1W06 A;  2EXI A;  4TTG A;  3JD7 1;  1QNW A;  1XJA A;  3ZXJ A;  1MAC A;  3NNG A;  3ON7 A;  1Y9Q A;  2QQJ A;  3IAP A;  1UPI A;  3ZFG A;  4IEQ A;  5C70 A;  1ULC A;  3CL1 A;  1RUC 2;  4XJZ A;  3ZN6 B;  1X33 A;  5FLI A;  4PLM A;  1AR7 1;  1H2L A;  1HB3 A;  1FOD 1;  3ZKY A;  2QQU A;  1XSR A;  2Z42 A;  4UFH A;  5DDJ 1;  5C8C C;  1ENQ A;  3LPF A;  1ULP A;  4HVO A;  3O7O A;  2VUD A;  3D8C A;  4OMC A;  5FKB A;  3OSD A;  4Q4W 3;  5J96 B;  4UOJ A;  3WCR A;  1UXX X;  3S5A A;  1W6O B;  4XZU G;  4I02 A;  1A3K A;  1JU4 A;  3C7G A;  3B9C A;  4EN9 B;  5IFP A;  2I2S A;  2PLV 3;  3RGB A;  2YZ4 A;  3T2T A;  2OZJ A;  5CFD A;  1BEV 3;  1HXS 3;  3VZL A;  1LAJ A;  1BVP 1;  1SLA A;  3ES1 A;  1V6J A;  1J83 A;  1PO2 3;  1T6G C;  4QX8 A;  3RG0 A;  1C3H A;  3AC0 A;  3PTR B;  3LFI A;  5LWB A;  4OHZ A;  3JQX A;  4NIA A;  2MHF A;  1AR8 3;  3DYP A;  1NQJ A;  4XJ8 A;  3ZYI B;  1K45 A;  4ZPI A;  4HSL A;  2CGO A;  4URT A;  4N90 A;  4ASM B;  1UOG A;  3GBW A;  2VU9 A;  1XE8 A;  1O4Y A;  2R06 3;  2XJV A;  4B1L A;  1WCU A;  4AL9 A;  1LR5 A;  1U0A A;  2WKK A;  1AUY A;  1XB9 A;  4KU7 A;  2GH8 A;  4Q4V 2;  2G4I A;  4YW2 A;  1NY7 2;  1RIN A;  3J7L A;  2VUC A;  2GC3 A;  1PIV 3;  3WHT A;  1AR9 1;  4CDQ C;  5F5C A;  2W1S A;  5FYS A;  5DUW A;  1P8J A;  1VBA 2;  1UYY A;  1W6N B;  5FYU A;  5C3S A;  1REF A;  2GND A;  2VOX A;  1G9D A;  4K1Z A;  4LQR A;  4QU2 A;  4RGG A;  4XF3 A;  2RJL A;  4A2U A;  2G9F A;  1L3J A;  2RV9 A;  2QCS B;  2A73 B;  1PVC 3;  4LHS A;  1F15 A;  4K6B A;  3MUZ 1;  1RUI 2;  4XBQ A;  4AED B;  5JI7 A;  4DPN A;  5HBA A;  5FZB A;  5BNN A;  5CNA A;  3VBU C;  5D1I A;  2XJP A;  4KNC A;  2NM1 A;  3ZXK A;  3F2Z A;  4BMB A;  4CCO A;  4O61 A;  4OMD A;  3FHI B;  4YZ2 A;  4BIS A;  1CQ9 A;  1KD7 A;  3JBG 3;  5F3C A;  1IQD C;  3GM8 A;  1GP6 A;  1UZW A;  1XNT A;  1W8F A;  1KEX A;  4Q4X 2;  1HN0 A;  1FT9 A;  3DF0 A;  4XIL A;  1UZZ A;  1KIT A;  4E27 A;  3ZYH A;  3U78 A;  2HEW F;  3GYD A;  4ITC A;  2PTM A;  4QAW A;  5BNN B;  2HH9 A;  2EXJ A;  2PYT A;  3VV1 A;  1HKD A;  5A6Y A;  3LCP A;  3N9Q A;  4Q0Q A;  4RSU A;  1JUI A;  2ZGN A;  2EXH A;  1CGP A;  3RSJ A;  1TVG A;  3NJZ A;  1RUD 2;  3Q8A A;  4NRM A;  4YW3 A;  4H7M A;  1XNK A;  2FDF A;  4GJZ A;  3VL8 A;  3HNM A;  4IE7 A;  4XEZ A;  1FNZ A;  4YW5 A;  4D8M A;  4WVM A;  2OXB A;  2VCB A;  1TE1 B;  2XHN A;  4FFF A;  3PUA A;  4AVS A;  5FPX A;  2ZBJ A;  1ND3 A;  2B9V A;  4A42 A;  4Z92 B;  3TBD A;  2IXH A;  4F3J A;  1RJ7 A;  3WG2 A;  4ZY9 A;  1UAI A;  4IET A;  3ZXA C;  1ST8 A;  2FQP A;  4GWN A;  4YZ3 A;  5DDJ 3;  3VBH B;  3ZIX A;  4CPB D;  4MGI E;  2JKB A;  4QDQ A;  3VD7 A;  4BQ4 A;  4RQP C;  2C9K A;  2XH6 A;  3WF4 A;  4QX2 A;  1JMU B;  2WNV A;  4GJY A;  2FD8 A;  3HD8 B;  4QXC A;  4ES9 A;  1QMJ A;  3FC0 A;  3HT1 A;  1QJF A;  3R0R A;  4AHW A;  5T52 A;  2VVD A;  2FBE A;  2ZEY A;  1F5F A;  5F5I A;  3HN1 A;  3CF6 E;  2WZE A;  2VZO A;  3LA3 A;  1OT5 A;  3N9L A;  2LAL A;  1N47 A;  1U5Z A;  2HLE A;  5EP9 A;  4FTE A;  2ENR A;  3K46 A;  5BNN C;  1QGL A;  5EPA A;  3RMX A;  1H8T B;  2JXA A;  3VKN A;  1MEC 1;  4AFB A;  4Z2W A;  1X8M A;  1RUF 3;  4XJW A;  3AZX A;  3M3Q A;  3JUU A;  1GQG A;  4CU9 A;  5FZ0 A;  3E97 A;  5FY8 A;  3VZK A;  5DPN A;  5G05 L;  2HWB 1;  5GZE A;  4XJU A;  2PAE A;  4WM8 C;  4A44 A;  3RNS A;  3EJK A;  3JD7 2;  2D3R A;  5HPO A;  1STM A;  1CIW A;  1RUF 1;  3QH6 A;  2BBA A;  1T2X A;  2Y6J A;  5FZK A;  2I07 B;  4CUA A;  3UNP A;  3LIG A;  1QOT A;  2Q8E A;  1PMI A;  4LA2 A;  3J8F 3;  4NR1 A;  3D3A A;  1YFY A;  4KBB A;  3KSC A;  4YM0 A;  3I4I A;  1QOS A;  1RUH 3;  1VB2 A;  2ZJC A;  4K3U A;  4Y22 B;  5IHR A;  2PMW B;  4DFS A;  2ZX0 A;  2F17 A;  1RUJ 2;  4E2G A;  1QJE A;  2A70 A;  3ZSL A;  2FCT A;  1C28 A;  2IUW A;  5F9T A;  3BTZ A;  1FMD 2;  1KS5 A;  2OT7 A;  1QXJ A;  2JG8 A;  4IEP A;  2I74 A;  1ND2 B;  1D4M 1;  1LCL A;  5ABJ C;  4PIZ A;  4CU6 A;  4BJ0 A;  3H8X A;  1CAW B;  3VGI A;  1TEI A;  3AP9 A;  2PA7 A;  3FMG A;  3ETQ A;  1UU5 A;  1J3P A;  1MS3 A;  2MEV 3;  2WBK A;  2PEL A;  3FUQ A;  3ME2 A;  4ZU4 A;  2X5I C;  4FPG A;  3SIS A;  3ZPY A;  1D4V B;  2JDZ A;  3NNL A;  4CXY A;  2HBU A;  3KM5 A;  3BU7 A;  1OH3 A;  4Q8K A;  4FVV A;  4MXW A;  1RVF 2;  2JDK A;  2W1U A;  1S0E A;  3PUQ A;  1Q56 A;  5L19 A;  3VZM A;  4Y1U A;  5C8C A;  2PXJ A;  5L73 A;  5HV4 A;  1G9A A;  3ES4 A;  1WW5 A;  3N9M A;  3DKW A;  4DXT A;  2IZW A;  1DU3 D;  1OOP C;  2CNA A;  2WSV A;  5F2W A;  5C4W B;  4YG6 A;  1AXZ A;  2X5I A;  2TUN A;  1RUE 2;  3O0W A;  1HRV 1;  2P1B A;  4QGM A;  1VBE 2;  1L7Q A;  3M3I A;  1AYM 1;  3OPT A;  4JZR A;  4MXW B;  5FZ4 A;  4LXL A;  3P3N A;  5HCA A;  1H9W A;  2P3I A;  3FN9 A;  2R1D A;  3UYJ A;  3LSE A;  5FBJ A;  1JHN A;  2WO1 A;  2GN3 A;  2WWS A;  1PGW 1;  4R9B A;  2G1M A;  3ZMO A;  1S0F A;  1NXD 1;  2BUK A;  1GZC A;  1KJL A;  1O59 A;  1ZZ8 A;  3KB5 A;  4FI9 A;  3K4A A;  4AFA A;  1G9B A;  1RUD 1;  1JBC A;  5B4X A;  3WW2 A;  4D69 A;  1W8H A;  1OC1 A;  3VDC A;  2A3W A;  4YSF A;  1LHO A;  4HET A;  3RVH A;  1PX4 A;  1S0C A;  4PT6 A;  3UK9 A;  4YAR A;  2PHD A;  4EJR A;  2OX0 A;  3N9P A;  3ACF A;  5L9R A;  2H6C A;  2CTV A;  1AR9 3;  3ZMN A;  4XTP A;  1TNF A;  1JH5 A;  2C24 A;  1TMF 2;  2VOT A;  1NCQ B;  5C9A C;  4PI0 A;  2OZ6 A;  2VOV A;  3KT4 A;  1BLZ A;  1VJ2 A;  5KXC A;  4PF1 A;  4XE9 A;  5F32 A;  2FHR A;  1ND2 C;  5FY9 A;  2FZ1 A;  2Y6H A;  4XUT A;  3PL0 A;  2J1V A;  1IS4 A;  4BQ5 A;  1QH6 A;  3DEM A;  2ZHN A;  4RS5 A;  1LGB A;  1SMV A;  1XNB A;  1US2 A;  4MGQ A;  4O65 A;  5JUV A;  5CBL A;  2ZTN A;  4LIT A;  2RS1 3;  5AVP A;  1PGS A;  3CQO A;  3ZYJ B;  1WLD A;  2EF6 A;  4XJ9 A;  2XVK A;  2YFU A;  4QXK A;  2EIE A;  1VBB 1;  3I3E A;  1J1T A;  2Q30 A;  3O1T A;  3PU8 A;  1FPN 3;  4FAG A;  1E57 A;  3QBQ A;  1S2B A;  3S0M A;  2YUE A;  4PJY A;  1LHV A;  5HCF A;  4IUG A;  5JMC A;  3O1V A;  1HN1 A;  4Q4V 1;  4CCK A;  2D3S A;  4MGZ E;  2G19 A;  3A0K A;  2DVD A;  4GB3 2;  4KMQ A;  5FFO C;  1H1I A;  1UF2 C;  4I3P A;  3HIF A;  4GKY A;  2VG9 A;  4E8D A;  1AL0 G;  1ALY A;  2WLQ A;  5DUV A;  3ZVX A;  5F37 A;  3O1R A;  3TRS B;  3LAG A;  2VCM A;  2X29 A;  1H0B A;  2AGS A;  4B29 A;  3AZV A;  5J48 A;  1YIP A;  5CZK A;  1OKQ A;  4QKB A;  4HL0 A;  1EY2 A;  5FZO A;  3USU A;  2P34 A;  5FZ9 A;  4LBN A;  2DWR A;  2QQK A;  3ST7 A;  1AZD A;  4DZG A;  5A6Q A;  1O3T A;  3V64 A;  4B8E A;  2RMU 1;  3FHQ A;  5FCC A;  1R08 1;  1SFN A;  5CKM A;  3ZFG B;  4F83 A;  1CPM A;  1OBN A;  2PQQ A;  4UBG A;  2EAA A;  1DGW A;  1W9W A;  4HN1 A;  2ZGT A;  4XHX A;  5FTT C;  4CXX A;  1KS4 A;  1REE A;  4QQP A;  3LDK A;  1RUI 3;  5A80 A;  5I93 A;  2XUM A;  3AP5 A;  3A23 A;  1UXZ A;  5JOW A;  5K9Y A;  1W3V A;  5EJZ B;  1F8V A;  3GDB A;  4LIU A;  5M0T A;  4JAA A;  3WT3 A;  5L7O B;  3ZSJ A;  2Y6K A;  1XOY A;  4FSJ A;  1G8W A;  3HJR A;  3J7H A;  1DYK A;  5D21 A;  4AHZ A;  2JKX A;  3F95 A;  3I2J A;  4RFT 0;  4QX7 A;  3R4U A;  4W6W A;  2VNO A;  4YFW A;  5KHK A;  4QQH A;  2XUE A;  4JCK A;  1SEF A;  2EAK A;  1LTE A;  2JDP A;  2XJU A;  2VQT A;  4OI4 A;  1AR9 2;  3MF9 A;  5AFE A;  1S0J A;  4QKF A;  4ATF A;  4MAD A;  5DZG A;  1RMU 2;  1VBA 3;  4YZ5 A;  3UJQ A;  5CA6 A;  4M01 A;  1MS0 A;  4XET A;  2Q1M A;  4CCM A;  1UL9 A;  4FFI A;  4LJH A;  2AEY A;  4XW3 A;  3LDR A;  4KL1 A;  4IGQ A;  1LNS A;  3O1S A;  3CU7 A;  2HWE 3;  4I0B A;  2WFP A;  2ZMK A;  5FIX A;  3MPP G;  1AXK A;  1NYW A;  4FXG B;  5FOB B;  3VN4 A;  4XDO A;  1TME 2;  3B69 A;  2JB8 A;  5FY7 A;  4D7T A;  5FP7 A;  3D0S A;  1WWY A;  1H8V A;  3AL5 A;  2NQY A;  2ET7 A;  1HRV 2;  3WF0 A;  4DRR A;  3VBO A;  1HV1 A;  1AYM 2;  5KXB A;  2BRT A;  4TN7 A;  4XF9 A;  4AE2 A;  1S0G A;  2B46 X;  1ULF A;  4CP9 B;  2WNO A;  3MYX A;  4Q0P A;  4DXR A;  2UWC A;  4BE3 A;  4UFJ A;  4MGK E;  2VE1 A;  4H7L A;  4P9J A;  4Y4R A;  1GQP A;  1X50 A;  2ORX A;  2VZQ A;  4XPV A;  2WC2 A;  4P02 B;  4D6R A;  2ADD A;  2E32 A;  3EMR A;  4A3Z A;  2RHP A;  5A3L A;  5GJ6 A;  2NPI A;  3B93 A;  3EYP A;  2PHU A;  2MPF A;  2Y26 A;  5FYM A;  3KVA A;  4WM8 B;  2EAL A;  4S2G A;  4YW1 A;  3ZXG A;  2SBA A;  3M3E A;  4M3C A;  3I3Q A;  3ACG A;  1ZRF A;  3LEM A;  4S2H A;  4J1W A;  3RFR A;  3V56 A;  4QHB A;  1QY4 A;  1SDW A;  1UOF A;  5FYV A;  4BQ2 A;  2XR4 A;  1CAV B;  2D97 A;  1D0G A;  5LRR A;  4EV0 A;  5J7M A;  5FY0 A;  2BFU L;  2RR1 1;  3LOI A;  5JXJ A;  1D4M 2;  4M3C B;  4BQW A;  4LO5 B;  1JXN A;  5BXX A;  3WIN E;  2BNM A;  5FY5 A;  2IXK A;  1JS9 A;  4PDW C;  2CAV A;  4NHM A;  4FQZ A;  3V0A A;  2E53 A;  2P37 A;  3OD4 A;  5T5P A;  4EWE A;  1CAV A;  1ND3 B;  4IND A;  4PIX A;  3DKQ A;  1Y3T A;  4CUC A;  5I91 A;  2YC2 A;  2FDK A;  3OGG A;  2Y6L A;  4P9W A;  5C3R A;  3H8R A;  4UFK A;  2RDR A;  4CDU A;  4JDM A;  1YFX A;  5A7O A;  4CP2 A;  4DUW A;  2TEP A;  5DUU A;  5DZF A;  1NUK A;  1COV 3;  3AFK A;  5A33 A;  1CPN A;  2GZW A;  1GQH A;  2WDB A;  2XBO 3;  3CIH A;  2ZPX A;  3HQX A;  3AZZ A;  4FT8 A;  2GNT A;  1CAU B;  4ARY A;  4AQS A;  4XXP A;  2P5B A;  3OEA A;  4AI8 A;  2K9Z A;  1Y9G A;  1SLI A;  4IL7 A;  1OOP B;  2C5D A;  3WVJ A;  3D0J A;  5IVJ A;  5D2A A;  1IG3 A;  1RGS A;  4WBB A;  2ARA A;  5FMO L;  4HPK A;  1YXW A;  3WNK A;  3ZO0 B;  4CDU C;  3KMH A;  4A4A A;  4PIY A;  3E6B A;  1R1Z A;  1YRZ A;  3WZ1 A;  1NLQ A;  4CEY A;  4FPK A;  1SHW B;  1R1A 1;  3M3C A;  1ZVF A;  1WLW A;  2WS9 2;  3CDZ B;  1Q8V A;  4LBJ A;  3E6C C;  1QJY 1;  1G86 A;  1AX2 A;  1ZZB A;  3C7E A;  4X8N A;  3SH4 A;  3U4S A;  3VD5 A;  4CXW A;  3POG A;  2DFB A;  2BER A;  1DHK B;  4UXA A;  3D82 A;  4LK7 A;  3LA7 A;  1S2E A;  4NII A;  5BNO B;  2YBP A;  3GXU A;  2DV9 A;  4BQY A;  1ZRE A;  3QLQ A;  4LO6 B;  3SQO A;  4IGO A;  3I97 A;  1OPM A;  1NQD A;  4LHN A;  1DZQ A;  1XPW A;  4Y1X A;  4Q0S A;  3Q8B A;  4Y5Z 0;  1MZ6 A;  5DAB A;  4BIO A;  4EN8 B;  1LOC A;  2NYY A;  4W4Z A;  4ZS2 A;  5A3O A;  1YJL A;  3LOB A;  2PN5 A;  1OQD A;  1RVF 3;  4XF1 A;  4LMF A;  5A3U A;  3WF1 A;  5A3M A;  4ISQ A;  4FOW A;  4CEW C;  3KLS A;  1ULE A;  1UY2 A;  3KGZ A;  3FFZ A;  1DP0 A;  1DQ4 A;  4QPW A;  5JSO A;  2XJT A;  3K48 A;  4CDQ B;  1M06 G;  1WLT A;  5A7W B;  5DAX A;  2JDH A;  4TZD A;  4ORF A;  1A34 A;  3OOX A;  3ZLI A;  2YU1 A;  1ND2 A;  3EQE A;  3AXE A;  4Q4Y 3;  2VM9 A;  1RC6 A;  1CAW A;  4RGA A;  1TNR A;  1UY1 A;  1WCD J;  4FTS A;  4W8J A;  1NCR C;  1AR8 2;  1RUG 1;  3SXW A;  2YXS A;  4CEW A;  4LO4 B;  1I3H A;  1UIJ A;  1N3P A;  1VBD 2;  1YUD A;  2QQW A;  3G6J B;  3U75 A;  4YG0 A;  2HJI A;  2VUJ A;  3OYW B;  4GAZ A;  4TXW A;  3T2O A;  1MS1 A;  3DUI A;  2BP6 A;  4OVE A;  1YQ5 A;  4AYU A;  5C8C B;  2BDR A;  5CYY A;  1H2N A;  2R04 1;  3A4U A;  5FDB A;  3P3P A;  2O8Q A;  1VBD 1;  5GZG A;  1JW6 A;  3JB4 C;  4AI3 A;  2R07 3;  5T50 A;  2XKP A;  3ZXD A;  1ZBE 1;  1GOF A;  2X5I B;  3POE A;  3HN3 A;  1VE0 A;  4L99 A;  4I0A A;  3OEB A;  5AFB A;  3C2U A;  2WFF 2;  3QOP A;  1R64 A;  2H6B A;  4LA3 A;  2ZAB A;  1VRH 3;  4L11 A;  1BBT 3;  1O4T A;  1EV1 1;  4XF0 A;  2QQI A;  5KHH A;  3ZYR A;  3TN9 1;  2V4A A;  2VNR A;  2H0V A;  3CMG A;  4CE8 A;  3TEZ A;  1Z7S 1;  4K20 A;  2WWU A;  3B7M A;  3D6E A;  4AHY A;  2HWC 2;  1W9F A;  3H50 A;  4Y24 A;  2A6W A;  1SFP A;  1UY4 A;  1BJQ A;  5JSR A;  1ENX A;  4RHV 1;  4I3G A;  1DG6 A;  2JE9 A;  1F31 A;  2R0F A;  1RED A;  4YGC A;  1W28 A;  1WMF A;  4CTE A;  2XKO A;  5F3I A;  1QJX 1;  5IVE A;  2BTV C;  1NA1 A;  4RR3 B;  4A3X A;  2NN8 A;  3RI9 A;  3WD5 A;  5LY1 A;  3KHC A;  1ZRD A;  1OI6 A;  4KG8 A;  1YI9 A;  1RUC 1;  5I8S A;  3WDX A;  4A41 A;  1RYY A;  4YNI A;  1UU4 A;  4B7K A;  1JZ2 A;  1MZ5 A;  1BCX A;  5DG1 A;  1NOV A;  3OBA A;  2D6P A;  4HG6 B;  1QJU 3;  2ZAC A;  2CU5 A;  1OF4 A;  2EA7 A;  1GZ9 A;  1W0P A;  1G7Y A;  2VOW A;  1TG7 A;  1SPP B;  2WUH A;  2YHJ A;  4IV3 C;  4UWD A;  1RUO A;  1RIR A;  4RR3 A;  4C8D A;  4EN0 A;  4RS5 B;  4CUG A;  4CZS A;  5JPM B;  1NY7 1;  1C1L A;  3AZY A;  3AKQ A;  1MZE A;  2VZU A;  3EHK A;  4XDP A;  3GZU C;  4UAP A;  3C8X A;  4OFG A;  2FDI A;  2VVF A;  3O14 A;  1MS4 A;  4PQQ A;  2HWF 1;  3PLQ A;  5A7S A;  3SLI A;  3N9O A;  2WWJ A;  1YQ8 A;  3M2M A;  1DIW A;  5I0U A;  2MNG A;  4URA A;  3O1M A;  4K8F A;  1U12 A;  1F2N A;  2P6H A;  3GBG A;  5EYX A;  4EWD A;  3TEW A;  3LA2 A;  2WAB A;  2N7G A;  1DGW X;  4K7J A;  4BOW A;  3RZZ A;  2HBT A;  1IPK A;  3I2D A;  3LDB A;  2DVG A;  4LHK A;  3BB6 A;  4ERO A;  3OUJ A;  1V9U 2;  4PBO A;  5A7N A;  2GSY A;  1GIC A;  1S2K A;  1PK6 C;  2PHW A;  4BLI A;  1DGR N;  4QDS A;  5A70 A;  1PK6 A;  2VQ0 A;  3THT A;  1KGY A;  2BGP A;  2E51 A;  2JWP A;  4XZP A;  5E89 A;  4ASK A;  3MLJ A;  5I0D A;  1ASJ 2;  3AP6 A;  4IE6 A;  5FZC A;  5LK7 B;  1AX1 A;  3VBS A;  3R4S A;  4AW7 A;  4LO7 A;  3VBO C;  3ZYB A;  3LB9 A;  4XUQ A;  5E16 A;  3PIG A;  2D6L X;  1ZZC A;  1FNY A;  2G9G A;  2RS3 2;  1VIW B;  2YYO A;  4PF5 A;  4BXF A;  4RS5 C;  3ZN4 A;  2UWA A;  3AKT A;  4UFI A;  1POV 1;  2ZGO A;  3I3D A;  5FRE A;  4ATE A;  4CCL A;  2CY6 A;  2XHK A;  4Y20 A;  1OMI A;  2VBP A;  2WQZ C;  4P9L A;  1JOD A;  1DGL A;  2RM2 3;  2WFF 3;  3N7M A;  3TYJ A;  1H2K A;  4LNV A;  4JV4 A;  4ZZ5 A;  1GYK A;  3MLK A;  1K12 A;  2K2S A;  5AC9 2;  1DCS A;  5GKA C;  1V6N A;  1ZA4 A;  4E4D X;  4KG0 A;  2GP3 A;  1I5Z A;  4GA9 A;  4H3W A;  1BYH A;  3B3Q E;  4COW A;  1DF0 A;  1C1F A;  4XAA A;  4C0H A;  2W9X A;  3PUI A;  1JN2 P;  1PM4 A;  1YO8 A;  2YFZ A;  1FI2 A;  4XDQ A;  4GMP 3;  4Y20 B;  4Y26 A;  3MF6 A;  5A3W A;  2NZ9 A;  1FMD 3;  2V72 A;  1JTZ X;  5FZ8 A;  1TME 3;  2R30 A;  4AGV A;  3POY A;  1LOA A;  1CJP A;  1CZT A;  2XVL A;  5EJ3 A;  2XWJ B;  1AYN 2;  3NMB A;  1K5M B;  5FMB A;  3VBU A;  2DUR A;  1C5H A;  3IWZ A;  2PAM A;  1BQP A;  1DQ1 A;  2HWD 3;  3BYW A;  5FXX A;  3BIW E;  2RMU 2;  3AYA A;  4WZC A;  4XBL A;  4G4F A;  1X8E A;  2QZ2 A;  5DAQ A;  2GAU A;  5A6X A;  4G9S B;  3BGA A;  2WJS A;  5LCW L;  5JR7 B;  4KH9 A;  4OQ9 A;  2P17 A;  2A3X A;  4NRP A;  3E5Q A;  2VZP A;  3NAP A;  3LEK A;  1QQP 3;  1W6Q B;  3ZXF A;  3T0B A;  2A5Z A;  1ZM1 A;  4YVS B;  1GNY A;  4BYY A;  1AR6 3;  3K4D A;  1JZ8 A;  2W46 A;  4ASL A;  3LD8 A;  3JU9 A;  5FZF A;  1XE7 A;  1C8M 2;  4Z07 A;  1JZ6 A;  4LTA A;  4COU A;  3T2Q A;  1FAY A;  1S0I A;  2XOM A;  5LA1 A;  1OHF A;  2D6M A;  1JOJ A;  2DU1 A;  5LK5 A;  3T1M A;  4Z2A A;  3BCW A;  4OLL A;  1JZ7 A;  3GHM A;  3VBO B;  4L8Q A;  4ARX A;  1RUC 3;  1LES A;  1WD4 A;  3OBZ A;  5FYI A;  1G9C A;  2WO7 A;  4EYU A;  4DS0 A;  2JEN A;  3WLU A;  2QVS B;  2FMY A;  2A6Y A;  3VDD C;  3ZXE A;  4B4R A;  4FBF A;  1LJ7 A;  2DCK A;  2YBS A;  2FCU A;  3HWJ A;  3RZG A;  2WA4 A;  4FPF A;  4YRD A;  4ES8 A;  5A7P A;  2VXR A;  4IEZ A;  4IEV A;  3S6P A;  3PVE A;  4MYE A;  3HR9 A;  1XE0 A;  4AXO A;  1OD3 A;  4JDN A;  3W5N A;  4WM8 A;  5CG9 A;  1J1L A;  1VBE 1;  3J7N A;  2ZXQ A;  3LF7 A;  3BI3 A;  1AL2 3;  3MID A;  4IV3 A;  5JXI A;  2WLP A;  1QDC A;  2A6Z A;  4M4P A;  1DDL A;  1IHM A;  4RD7 A;  5I0S A;  3DXT A;  2JIG A;  4XIO A;  5J09 A;  1DYO A;  2VBD A;  3WEZ A;  2V5Y A;  3SKV A;  3V65 A;  5ACA 3;  1WMX A;  4DXZ A;  1PGL 2;  1T6B X;  3EXU A;  3N7J A;  2RS5 2;  1K5M C;  1NG0 A;  5CFC C;  1V70 A;  1ZBE 3;  1CR7 A;  3AMM A;  4D7Y A;  4Z1V A;  1LED A;  4YZ1 A;  1AR6 2;  1UMZ A;  4FQ4 A;  1RJ8 A;  4FPE A;  2B39 A;  4XFG A;  2JIC A;  3OPZ A;  1EAH 3;  3VDA A;  4TWT A;  3VD3 A;  3WQ1 A;  4IE0 A;  2VC9 A;  3OJB A;  4R9C A;  5F7U A;  2ZAA A;  3AXD A;  3IMM A;  1UZY A;  1DQ5 A;  3UL2 A;  5EV7 A;  5FWE A;  4JDO A;  4EWA A;  4LUK A;  4YGD A;  3OB8 A;  1J59 A;  1X7N A;  2Y38 A;  3VUO A;  5JAX A;  3RRD A;  3UGG A;  3BIE A;  5T54 A;  3ZKU A;  3O0V A;  4M4R A;  3NJX A;  3AKP A;  1W90 A;  4QB6 A;  4NHX A;  3K3N A;  3H1M A;  4FPC A;  1AYN 3;  2OA2 A;  4HZF A;  1ACC A;  1JYC A;  2HWD 2;  3LKJ A;  5CAZ A;  1Q5O A;  2NMO A;  4AQT A;  1O91 A;  2X8K A;  2XBO 2;  1CX4 A;  1O6U A;  1HX6 A;  1OOP A;  2WQ8 A;  2YGL A;  3ILN A;  3OGS A;  4HSJ A;  4XIK A;  5IVC A;  5C3P A;  1V9U 1;  3KS7 A;  4E9K A;  4A45 A;  5A3P A;  1OXC A;  3I3M A;  4D7S A;  1VRH 2;  1Q8O A;  3THD A;  3H3U A;  2RDS A;  3AMH A;  1LEC A;  2J1R A;  3H8U A;  1VP6 A;  2OPW A;  4OUM A;  5EHD A;  3OD0 A;  1CAX B;  1W0O A;  1HQN A;  2AAC A;  5C5T A;  1UZ0 A;  1V6M A;  5C3Q A;  4AOC A;  2IXL A;  4R9A A;  3ZR6 A;  4QM8 A;  4Q1R A;  5CVR A;  1QKQ A;  1UO9 A;  2YU2 A;  1O3R A;  2Y0I A;  2RS3 1;  3VBF B;  2HEV F;  3PUS A;  4ZS3 A;  1W6M A;  1DGR A;  4DEQ A;  1EPZ A;  4OZX A;  4SBV A;  2D6O X;  3VBR B;  4JGZ A;  3NQH A;  3V0B A;  5KR7 A;  1WZX A;  2BOJ A;  4N53 B;  4JQT A;  1C4R A;  3K77 A;  2QQO A;  4GIQ A;  1R09 3;  2UYB A;  2YY1 A;  3A0N A;  1QWR A;  2BU9 A;  2Q0A A;  5FZG A;  4FPJ A;  3GCX A;  1WA4 A;  2ZGR A;  5KWR A;  1DQ2 A;  4XBN A;  3UJO A;  2GME A;  3LSD A;  5DN2 A;  4B1M A;  4EQV A;  2PQS A;  5JXG A;  3P6B A;  1Q43 A;  3POB A;  1M4W A;  4HLT A;  3U1X A;  3J8F 2;  3C7H A;  5FZM A;  1COV 1;  4XOG A;  4ZON A;  2J1E A;  2ES3 A;  5A6Z A;  1I1E A;  3DYM A;  1U5Y A;  1R09 1;  4MOA A;  1ENS A;  3NWK A;  2VQU A;  4BLJ A;  5LBC A;  3AX4 A;  3JB8 A;  4P08 A;  2RVA A;  4YG3 A;  5I0T A;  3SEE A;  4CEW B;  4XAC A;  4CVU A;  1VAK A;  2IVI B;  2VTX J;  2ZS6 B;  5GZD A;  5FBZ A;  3WW4 A;  4LLF A;  3BU0 A;  3BTY A;  3PU3 A;  2V09 A;  3WXP A;  2WO2 A;  4XAB A;  5I8Y A;  2YBK A;  1HRI 2;  4U36 A;  3E6D A;  5FO9 B;  2MEV 2;  2EIC A;  3ZOI A;  2A1X A;  2KD7 A;  1RMU 1;  2AEN A;  2X53 S;  3OGJ A;  4LBL A;  5K0U C;  5BV6 A;  4P9I A;  2FCV A;  4U2A A;  4OHV A;  2RR1 3;  3AP4 A;  3LE0 A;  3T3Y A;  3I2F A;  1JI6 A;  1UU6 A;  4OUE A;  2EVX A;  2OS2 A;  1SBD A;  1EYB A;  5CKQ A;  4GQ7 A;  2FDH A;  5FZ3 A;  4OUL A;  2ZKN A;  3ILF A;  2J1U A;  2BVB A;  1D0H A;  4YWA A;  3MIH A;  5FQ0 B;  1NZC A;  4BWO A;  2Y0O A;  4QX1 A;  4HAN A;  5IAV A;  3MEP A;  2WO3 A;  3MV0 1;  2TBV A;  3W5M A;  2D44 A;  2VZS A;  5SV8 A;  1WCK A;  2WYS A;  1NCR A;  5FMC A;  3Q8C A;  2BQP A;  5CG8 A;  2X09 A;  5JCT A;  5FYH A;  1SCS A;  4N43 C;  1JYV A;  1HQW A;  4I0W B;  1EAH 2;  2JDN A;  2XJR A;  1WGP A;  1F4A A;  1FAT A;  1NA1 B;  1N3O A;  1V6O A;  1O7F A;  2GNB A;  1CVN A;  1MVE A;  5B4N A;  5KHG A;  3AMN A;  2O0O A;  4LBQ A;  1MZF A;  5JSP A;  5IVF A;  1JZ4 A;  3KQR A;  4WVV A;  1WW7 A;  2PHT A;  3CZJ A;  3ZYG A;  1OLQ A;  1XYO A;  1EAH 1;  2WNU B;  3MIF A;  1EUU A;  2O8O A;  2GU9 A;  4K40 A;  2Y33 A;  3C7F A;  5FUP A;  1QJU 2;  3ROU A;  1N1Y A;  3U4X A;  4LBQ B;  1J3Q A;  2HWE 1;  4NRQ A;  1H30 A;  2QQP A;  1B35 C;  4NHY A;  4OZO A;  4XCB A;  1BBT 1;  1YQ6 A;  4K9S A;  1PNF A;  3AKR A;  1VRH 1;  3ACI A;  2W47 A;  3S7I A;  4Q29 A;  2O14 A;  4X6R B;  4YLZ A;  4LT5 A;  4BQX A;  4E2S A;  5KC5 A;  1N1T A;  3RYP A;  2HYK A;  3DL3 A;  1L7L A;  3AZW A;  1X9T A;  3VBR C;  1CD3 G;  2DF7 A;  3VDB A;  2CWM A;  4MH0 E;  4BK4 A;  4MG2 A;  1IPS A;  2DCJ A;  5F6K A;  1NAE A;  4HT1 T;  1XRU A;  1LHU A;  4YVS C;  3U37 A;  4NE9 A;  2WT0 A;  1KXG A;  5FUI A;  2VEC A;  1QF3 A;  2WAA A;  2H0B A;  1PK6 B;  4AVB A;  4N43 A;  3B94 A;  3I59 A;  3JXS A;  4YGE A;  1NE6 A;  4FAH A;  5DAP A;  3D4K A;  2J1S A;  4Q4X 3;  2DBN A;  3WQ7 A;  4FCA A;  1PM7 A;  1RUG 3;  2VCC A;  3PMS A;  5FJH A;  4E4Z A;  4JTO A;  4AI9 A;  1Z78 A;  2WYF A;  3VBS C;  5A1F A;  5FRA A;  4BXS V;  1ODM A;  3PJQ A;  3C7O A;  1AYN 1;  4PLN A;  2ZGS A;  3CO2 A;  3U0Z A;  4A6S A;  2J1T A;  1H1M A;  3RI8 A;  2EXK A;  2LM3 A;  1PO2 2;  3I59 B;  4IGP A;  4P9X A;  4AED C;  2RMU 3;  3HVD A;  2Q4S A;  4Q4X 1;  5DQ0 A;  2D3P A;  2W1W A;  4CDX A;  3Q8E A;  1NCQ C;  2A75 A;  5FUN A;  3TWI A;  3FLT A;  4CDW B;  4AWD A;  3WDW A;  3NV2 A;  5C4W A;  3T1L A;  5EFU A;  3B01 A;  2W5F A;  5JI9 A;  2JE8 A;  3VZN A;  2VW0 A;  4LKF A;  5ANN A;  1O8P A;  4GUL A;  5A7Q A;  5L9V A;  1W9Y A;  4QX3 A;  2HWD 1;  5BYN A;  1BK0 A;  2XL9 A;  4BME A;  1HJG A;  1KRI A;  3O5S A;  4IEX A;  4MHR A;  4AFD A;  1PZ7 A;  1AF9 A;  5FO8 B;  1GAN A;  1NLR A;  3HBZ A;  5FYC A;  2VUL A;  5BNQ A;  3ABZ A;  3VBU B;  4DO0 A;  1UOJ A;  1ZZ7 A;  2J22 A;  3IIA A;  5CFC B;  1PNG A;  1IS3 A;  1IQA A;  1US3 A;  1V6I A;  3P1I A;  1ULG A;  3AJY A;  5JOY A;  4IV1 A;  5JZG B;  3I7D A;  5CKN A;  5C7G A;  5F5A A;  3VHN A;  4DNY A;  3DGT A;  2WAO A;  1W8N A;  4COY A;  1UIK A;  5A32 A;  1Y9M A;  3CKH A;  2UUR A;  3GJA A;  5T5O A;  4W6Y A;  4BCU A;  1W8U A;  3NAP C;  2ZEX A;  5C6C A;  4CYD A;  2GDF A;  1CIY A;  2IXI A;  3M7A A;  2JEC A;  3WF2 A;  1V0A A;  1NA1 C;  2UYA A;  3HT2 A;  4H55 A;  4QKN A;  1WMD A;  5D8A A;  3ACH A;  1DZT A;  1H1A A;  2R32 A;  3B02 A;  3DV8 A;  3MIG A;  2DVB A;  4IQP A;  3AB0 A;  5LAT A;  5FR3 A;  4M3C E;  4QGL A;  1FXZ A;  2E63 A;  5A32 B;  4FXK B;  4W6X A;  1Y43 B;  3NJY A;  3B5L B;  3ZX7 A;  1OSG A;  3IDA A;  2AC1 A;  3VBH C;  4MX3 A;  5C4W C;  1DLC A;  4K21 A;  4DXS A;  3N7K A;  2IVJ A;  3E5U A;  1ZYB A;  2QE3 A;  3JQW A;  4NHK A;  3VHR A;  5D8A B;  1AR6 1;  1KFX L;  2JE7 A;  4LUM A;  5IWF A;  4KI5 M;  4Y4Y A;  5FKC A;  1RUF 2;  3I54 A;  5JOX A;  2ARX A;  2W08 A;  1CZS A;  4ZXK A;  4QXB A;  1BZW A;  4S2F A;  2CAU A;  3MIC A;  4NPL A;  4AK3 A;  4CDW C;  1RHI 1;  1W39 A;  2YG0 A;  3MW2 A;  2Q8C A;  4COV A;  5JPN B;  1N1S A;  1W8O A;  3ELN A;  4QU1 A;  4PBP A;  3RWN A;  4Q8L A;  5JR2 A;  2C9A A;  2VY0 A;  5F3E A;  1YJK A;  1RUH 2;  4A7K A;  1F9K A;  4R4Z A;  4QQO A;  1AYM 3;  2LW8 A;  4V2W A;  2VQA A;  5LBB A;  3WUC A;  4RHV 2;  1A78 A;  3TOJ A;  3USU B;  3I49 A;  2Z5W A;  1H4H A;  3B9I A;  3HNB M;  1QEX A;  4FOY A;  1R09 2;  2K0G A;  2OW4 A;  4LKE A;  1O5U A;  1O3Q A;  4JVA A;  3VL9 A;  4MET A;  4JGY B;  2LTN A;  4QPI A;  1ODN A;  1ULD A;  2OQ6 A;  1VMJ A;  4PI2 A;  4CCJ A;  1ZX5 A;  4DY3 A;  5F6L B;  2P3Y A;  5JMO A;  5LBF A;  2PHF A;  5CFD B;  5IYY A;  1S1A A;  3PJY A;  3T08 A;  1MVQ A;  3WUD A;  2RE9 A;  3T0D A;  3WNM A;  2MEV 1;  4DIQ A;  3M8L A;  4Y22 A;  5JDB A;  1POV 3;  5FYZ A;  5F3G A;  2BJS A;  5L7O A;  1QDO A;  3AYD A;  3ZFE C;  4B7E A;  2Y34 A;  5ANQ A;  3ZFE A;  4IE4 A;  4HVQ A;  4QPI B;  1AHS A;  4Q26 A;  5ACA 1;  1PIV 2;  2F4L A;  2DYC A;  4GXL A;  4RFR B;  4ZXE A;  1Z7S 3;  1U5X A;  1W3X A;  5FMO S;  3VZO A;  2ARE A;  3QCW A;  4V1P A;  5BNP B;  1PGW 2;  1VR3 A;  4UF0 B;  2BW8 A;  3WNP A;  1VBE 3;  1BK1 A;  1QU0 A;  1YC6 1;  3OCP A;  1CAX A;  4NAM A;  4RN5 A;  4BDV B;  1YNA A;  2PFW A;  5T5L A;  1OVP A;  5DAV A;  4LKD A;  2J42 A;  4EZH A;  3M1H A;  4LHL A;  2ZA9 A;  4KQ7 A;  2JEM A;  3LEG A;  3WW1 A;  1SDD B;  2DVA A;  4FOV A;  3ZSM A;  4MO3 M;  4M3C F;  5LEK A;  3AYC A;  4UF0 A;  5FXZ A;  3TNP B;  3VKO A;  2QTW B;  2Y8K A;  3LQC A;  4WVZ A;  3POW A;  4JX0 A;  1GLH A;  1YWK A;  2HWF 3;  4NAO A;  1PMJ X;  3MFC A;  1E5H A;  1FX5 A;  4N53 A;  1GWL A;  2PLV 2;  1GP4 A;  4AGR A;  2VMI A;  1WA6 X;  4FOQ A;  1RUI 1;  2E7A A;  3MBW A;  4IV1 C;  4HON A;  3VBF C;  4LO8 A;  3BTX A;  1OH4 A;  2AR6 A;  3FL7 A;  1D2Q A;  1LOD A;  5EQU A;  5FPL A;  5IUQ A;  2VW2 A;  1NX9 A;  1FYU A;  4AEM A;  1UX7 A;  1BEV 2;  2WT2 A;  2XDV A;  1QHD A;  2I45 A;  2BVV A;  3DN7 A;  3QH7 A;  4YM1 A;  2ZGP A;  1IZ3 A;  4JRL A;  1GV9 A;  3CNA A;  5GLZ A;  3SCF A;  4NIH A;  5FY1 A;  5GZC A;  3J26 N;  3ACL A;  2Z4F A;  1POV 0;  3GJB A;  3H42 B;  1EPW A;  5C71 A;  4RL7 A;  1IS6 A;  3CBN A;  4GKX A;  2CDO A;  4C1W A;  3WSO A;  1PVX A;  2UY8 A;  2B8M A;  2D43 A;  3P5B A;  4L97 A;  4RHV 3;  3GCW A;  4Q4Y 2;  1NCQ A;  4D6Q A;  5H9R A;  3AFG A;  3WOG A;  1BMV 2;  1WME A;  3ZSE A;  3T4V A;  1JUH A;  1UX6 A;  1LU1 A;  4YW7 A;  5EXO A;  5FYT A;  5IAX A;  5IT6 A;  1VBC 2;  2ZX4 A;  4CEY C;  4AFC A;  4Q4V 3;  1C5I A;  2LRO A;  3I2G A;  1RHI 2;  3FJS A;  3MW3 A;  2BWA A;  5T5J A;  1AL2 1;  2VD7 A;  1JYT A;  2VXJ A;  2WNV B;  3VD4 A;  2VMH A;  3ZIW A;  4KWJ A;  3L9J T;  2D93 A;  3PDQ A;  5T3N A;  1L7R A;  1DFQ A;  1LHN A;  4GZ9 A;  5FQ0 A;  3OGV A;  4ET7 A;  5JOZ A;  2KR2 A;  4Q2F A;  1RUN A;  4JTN A;  3MI8 A;  1OA4 A;  4P00 B;  4MUV A;  2CWS A;  1YIF A;  3CJX A;  1OLM E;  3H7J A;  3VB9 A;  4Z8B A;  3K75 B;  3DPR C;  3WG4 A;  2IFW A;  3FBM A;  4A7Z A;  5FXW A;  3MHZ A;  2QFE A;  5A33 B;  1PVC 1;  3ALQ A;  4YVW B;  4R9D A;  4BIF A;  3O0X A;  1FPN 2;  4HN0 A;  3BOP A;  2AEZ A;  2XLG A;  5FXV A;  3IN9 A;  2PHX A;  2WZR 2;  3LEI A;  1EP0 A;  3POI A;  2Q1Z B;  4BM8 A;  5LRS A;  3UT0 A;  3THP A;  2RJK A;  4BQ3 A;  4ZHN A;  5IK7 A;  2ZOE B;  1GSL A;  3NST A;  5FZI A;  2D5F A;  2Q5T A;  5HV0 A;  4NHL A;  2JD9 A;  2QKD A;  4CEY B;  2KA3 A;  3KD4 A;  4WV8 A;  5B2G B;  1TQ5 A;  3BOD A;  2JDY A;  4YGB A;  1IGO A;  1RUD 3;  1YQ2 A;  3APB A;  5LA2 A;  3WDY A;  4YVW A;  1F35 A;  4NID A;  2GMM A;  2CSG A;  4EE2 A;  1RVF 1;  4L0P A;  3E5X A;  3OBT A;  5FPB A;  5J3U A;  3RMY A;  3ZPO A;  3WG1 A;  1RHI 3;  4IEY A;  2VZV A;  2CL2 A;  2A3Y A;  1G9F A;  2D6K A;  4C91 A;  2XXZ A;  2VMC A;  1RMU 3;  1APN A;  3ITQ A;  4B3N A;  1VAL A;  3HAG A;  1F5J A;  4LK6 A;  4TLF A;  4PLO A;  1OKO A;  1BKZ A;  1WW6 A;  2JG8 B;  4H2A A;  3UV9 A;  4N8M A;  4BHP A;  2FMD A;  3MFA A;  1TME 1;  5ABJ B;  3TEX A;  4UW6 A;  1FMD 1;  1GOH A;  3MLL A;  2E6V A;  4GMP 1;  1W6P B;  2Z79 A;  1DQ6 A;  1HXS 1;  2E9Q A;  4Y5S A;  2HWF 2;  5KHI A;  1ZZ6 A;  5LAS A;  2NLR A;  2V5D A;  3NW4 A;  1HJF A;  4MSV A;  5FZ6 A;  3K51 A;  1N1V A;  5HCH A;  3E1F 1;  3LGR A;  3ENR A;  4NO4 A;  4Q4W 1;  2WFF 1;  2RM2 1;  4AVA A;  2XLF A;  4NUB A;  1ZNP A;  1W6P A;  1EUT A;  1H2M A;  3RS6 A;  1Z0H A;  4QHZ A;  4QXH A;  5ERL A;  1FOD 3;  1BBT 2;  5L36 A;  1O3S A;  1W6N A;  3RQ0 A;  4JHT A;  4RR3 C;  2RG4 A;  3ZFF C;  5D8A C;  5DUX A;  3ZN5 A;  3KV4 A;  3A21 A;  3JD7 3;  4AED A;  4CDX B;  1GWM A;  3TN9 3;  3S30 A;  1RXF A;  4XTM A;  2ZX2 A;  1RUH 1;  1ZRR A;  2QDR A;  3LPG A;  3VHO A;  4F7Z A;  5E6H A;  2GC0 A;  4LIV A;  1CJD A;  3KV5 A;  4DB5 A;  2SLI A;  4NIG A;  4IER A;  1VMF A;  4RA0 A;  1H8T C;  5FWJ A;  3T0A A;  4CP9 A;  1RXG A;  2QQL A;  2R04 3;  4MZU A;  1OLM A;  1RUJ 3;  4Y1Z A;  1OQ1 A;  4FPL A;  1VMH A;  5KXE A;  4RQP B;  1Y7B A;  4HKO A;  4DUX A;  1B35 A;  3JCI A;  4N7U A;  3RJ2 X;  4O9E A;  5CFC A;  2GN7 A;  2WZR 3;  5EJ1 B;  3I2I A;  5C3O A;  3DEC A;  2Y6F A;  3WX5 A;  3ZM8 A;  2ET1 A;  2JIJ A;  2VJX A;  3BOW A;  5LA0 A;  5APA A;  3BN6 A;  3WDV A;  3KGL A;  2VZR A;  5JZG A;  5IJR A;  1HB1 A;  1W0N A;  2P3K A;  2C0Z A;  4OCT A;  3U14 A;  3AMP A;  3UKN A;  4RGK A;  1W8Z A;  2WA3 A;  3EBR A;  4KWK A;  2ZAH A;  4WVM B;  1PHM A;  1WUV A;  2TNF A;  1U5I A;  4RQP A;  3VKL A;  1UY0 A;  2GAL A;  2RR1 2;  1CX1 A;  2GC1 A;  1LOF C;  2W0X A;  2EIB A;  4QX5 A;  4DOU A;  1LOF A;  1LUL A;  4XQD A;  3VBH A;  4CDX C;  1OUX A;  5AVA A;  1OD5 A;  2VZ1 A;  4YZ4 A;  1BMV 1;  4JQR A;  1CON A;  1IG0 A;  5JZG C;  4COZ A;  5FY4 A;  3INA A;  3V0A B;  3PUH A;  5J37 A;  5HI0 A;  1DYP A;  2ZGL A;  4CCD A;  1VBB 2;  2ZZQ A;  4CRQ A;  1RL3 A;  1R1A 2;  3NO8 A;  3RZM A;  5F2S A;  1MQT A;  5BNP C;  5EYY A;  1URX A;  5LEJ A;  2OII A;  4P5Y A;  4CDU B;  1J3R A;  2R49 A;  3SMH A;  2P2K A;  3IDC B;  5DXD A;  4QQL A;  1H8T A;  1MS9 A;  1JZ5 A;  4YW4 A;  3W59 A;  4CP1 A;  1DLL A;  1I9R A;  2VAU A;  2RS1 2;  3AMQ A;  4GAL A;  3CLP A;  1PMH X;  4L2N A;  5GLV A;  3FBY A;  1ZRI A;  4HBN A;  2PHR A;  1CAU A;  1MQT B;  4H14 A;  3I3B A;  4LEJ A;  4FPY A;  5SV5 A;  2E7T A;  4IES A;  3RZL A;  1VBA 1;  4KBZ A;  1LEM A;  2AZ5 A;  2GH2 A;  2RS1 1;  1JYI A;  3ZR5 A;  4GH4 C;  1PO1 2;  3JBG 1;  3HOB A;  1E5S A;  3NV4 A;  4YFZ A;  4P5H A;  2XBO 1;  4LE3 A;  3RWK X;  2DU0 A;  4C1X A;  3FFQ A;  4D94 A;  2BV4 A;  1AL2 2;  3H9A A;  1NE4 A;  4W65 A;  2OPK A;  4J1X A;  2ERF A;  5LW9 A;  1GUI A;  3FX3 A;  5I0R A;  2QQN A;  1JYX A;  1GKB A;  1OF3 A;  4AAX A;  3H3Z A;  4K8R B;  3HMY A;  3NV3 A;  1UOB A;  1WLC A;  2JD4 A;  3RZJ A;  2VO5 A;  3ZFG C;  2YC0 A;  5EZW A;  5JLV A;  1Q3E A;  3J7M A;  4Z82 A;  5JIU A;  4Q4Y 1;  1FOD 2;  5FZD A;  3DPR A;  1W9T A;  2Z2S B;  3VDD B;  2R04 2;  3OGR A;  1MS8 A;  1H9P A;  2QBX A;  1KDK A;  5FYB A;  3ZXL A;  1BXH A;  5K4L A;  4D6S A;  2G9Z A;  3ZFE B;  1UYP A;  2XLA A;  2ARC A;  1SAC A;  4DQA A;  2ZCW A;  3O1U A;  4YM3 A;  1J84 A;  1EV1 2;  3TEY A;  1RUG 2;  1YFW A;  2JJ6 A;  4WM7 B;  5K8S A;  4QQ2 A;  1K3I A;  2XON A;  3VDD A;  4GH4 B;  5CFD C;  2HKX A;  1Z7S 2;  2BOI A;  4PQ9 A;  3UES A;  2P4E A;  1GNZ A;  4BB3 A;  3W20 A;  4WZF A;  5IVB A;  3GAL A;  1AXY A;  3KWV A;  2IXC A;  2B4K A;  2OKX A;  4O9G A;  2YV8 A;  3WP5 A;  3HBK A;  1QJY 3;  3USS A;  1GBG A;  2O1Q A;  2QNK A;  3PVO A;  2C1F A;  3NNF A;  4G3Y C;  4OI2 A;  4JGZ C;  2NMN A;  3CZU A;  4WM7 A;  5DAW A;  3VHP A;  2ZGQ A;  1XYN A;  4J25 A;  2FZ2 A;  3PME A;  5LB6 A;  5FZL A;  4YVS A;  2DDU A;  3AYE A;  3HNY M;  3HPN A;  3VKF C;  5BY5 A;  1GWK A;  3IB3 A;  5IFT A;  1LHW A;  3UET A;  1HQL A;  4QHO A;  1OUR A;  4OHX A;  4JKL A;  2E7Q A;  2R16 A;  3CEW A;  4LLO A;  1YYN A;  1FV3 A;  3WNN A;  4AQ6 A;  1SLL A;  3RZH A;  1H6X A;  3IDB B;  2VUA A;  4QWN A;  1AR7 3;  1D4M 3;  2R7E B;  4MVT A;  3WG3 A;  4DRV A;  3IT8 A;  5H9P A;  4XQ4 A;  5GLT A;  2XPJ A;  2QUO A;  5IVY A;  1KJR A;  2P3J A;  2W87 A;  2CHH A;  2ZHL A;  3WP6 A;  2VMF A;  4Q4W 2;  1B09 A;  4X6Q B;  2XG3 A;  2AYH A;  3KT7 A;  4QPG B;  1LOG A;  5KXD A;  5L9B A;  4N7I A;  2L9L A;  4JRA A;  5JWP A;  4XMI A;  3OG2 A;  2XJQ A;  2A71 A;  2RS3 3;  2ZGU A;  2ZHM A;  2WII B;  3N3H A;  1X9P A;  3I8T A;  3FWE A;  2LS6 A;  3U10 A;  1OQE A;  2WN2 A;  2B9U A;  2BNN A;  1OFN A;  1COV 2;  1W2N A;  2ARB A;  1ZBA 3;  4QPG A;  4CP0 A;  2ZZJ A;  5C5U A;  3FZ3 A;  2JDM A;  2AH2 A;  4OQ8 A;  3PVB B;  2OUH A;  3N36 A;  2IC1 A;  1I5P A;  3A22 A;  4B4P A;  1V9U 3;  2ATF A;  2CV6 A;  4HMZ A;  4XAE A;  2ZX1 A;  3U07 A;  2WS9 1;  2D40 A;  3GNE A;  2D98 A;  5FZA A;  1VBC 3;  3WP3 A;  3WR0 A;  3RPQ A;  5FLJ A;  4AAP A;  4XFH A;  1C57 A;  4P9Y A;  4XFA A;  2KXL A;  3ZDV A;  3RYR A;  1CN1 A;  3LWC A;  4ISR A;  4LBM A;  3POS A;  1HRV 3;  5IAT A;  3TB0 A;  4QD2 A;  3ILR A;  3IMN A;  4R8H A;  3IKW A;  4CPB A;  1LGN A;  3MGU A;  1LRH A;  2QQV A;  1H6Y A;  1QJU 1;  4ONU A;  2VH9 A;  4OUS A;  5BPX A;  1ZRC A;  1DBN A;  2Q1F A;  5L7O C;  2UWB A;  1HLC A;  4KU8 A;  2VTX A;  2W1Q A;  3KZ4 C;  1GZT A;  2B5H A;  3CHX A;  1XXN A;  4QT6 A;  1PZ9 A;  4QDR A;  2CGN A;  1HB4 A;  5FZO B;  3URF A;  2QQM A;  2VZ3 A;  3AL6 A;  3OBR A;  5IK4 A;  3LZZ A;  1HIX A;  2VPV A;  3CJI C;  1RUE 1;  1LB2 A;  3K2O A;  1QJX 3;  2JDA A;  1TMF 3;  1WCQ A;  1CES A;  4XMA A;  2YRO A;  4AI1 A;  1X82 A;  2JX9 A;  4GD4 A;  4Y3O A;  5ISL A;  2OUJ A;  3WW3 A;  2XJS A;  3WY6 A;  3KV9 A;  3B00 A;  4OHW A;  2KM2 A;  1UQX A;  4UFL A;  5GAL A;  3WCS A;  4D3W A;  5AC9 3;  2UU8 A;  4QB2 A;  3IZO A;  4IEU A;  4LE4 A;  3PVN A;  4HFS A;  4ZKT B;  5BNO A;  2ETE A;  1KQR A;  5LZ6 A;  4L92 A;  1UNB A;  2W2I A;  2GP5 A;  1A8M A;  1OUS A;  1W2U A;  4Y1V A;  1UD1 A;  3I2O A;  1A8D A;  3NRU A;  1QJZ A;  3J8F 1;  1GZW A;  5LY2 A;  3FLR A;  1ASJ 3;  3FLP A;  5KBF A;  4LBO A;  5FZ7 A;  1W6M B;  1Q8Q A;  1W05 A;  4FFH A;  5JVV A;  4CDQ A;  1YLL A;  3MIB A;  2QJV A;  2VZT A;  4NPR A;  1CWP A;  3VBR A;  1JYN A;  4JGZ B;  3BUC A;  1PVC 2;  4JGY C;  1W9S A;  2WSU A;  4MLO A;  2VNV A;  3HEI A;  3S7E A;  1Q8P A;  2JG8 C;  5ABJ A;  3W21 A;  3X29 B;  3K4Z A;  3MO4 A;  1YHF A;  2ZX3 A;  2HYX A;  4XUP A;  1JHJ A;  4QGN A;  4AI2 A;  1GZW B;  3CJI B;  1NKG A;  3ETP A;  4EZ4 A;  2R1B A;  5FAX A;  3H3L A;  1K5M A;  4I01 A;  3SNM A;  3T30 A;  2AUY A;  3JBG 2;  2DUP A;  1QQP 2;  4UFM A;  1AJO A;  2DCT A;  1MEC 3;  4RYD A;  2WL1 A;  1JOP A;  3WDU A;  1IKQ A;  1D2S A;  1GNH A;  4IEO A;  3LFM A;  3O1O A;  4UW3 A;  4XXA A;  2EID A;  2XML A;  4HVR A;  3GF6 A;  1OLR A;  5CEH A;  2WNU C;  1W8W A;  1QQP 1;  3CJI A;  3OPW A;  4XUR A;  3EO6 A;  2A6V A;  4B4Q A;  3I2H A;  1G6N A;  1W04 A;  5GLW A;  4DIN B;  2R06 1;  2ZKL A;  3S57 A;  4AEJ A;  5HCB A;  4FPH A;  4KGG A;  2C4X A;  5FPZ A;  3SHR A;  1XU2 A;  2BBV A;  3AKS A;  2DVF A;  2VMD A;  1GP5 A;  4S2D A;  3UKV A;  1NXM A;  5IVV A;  4E2Q A;  4PHZ A;  4Q1P A;  3FE5 A;  1GMM A;  1AR8 1;  3KVB A;  4FP3 A;  3TN9 2;  1UMH A;  2BZD A;  2F6B A;  2E31 A;  1A6C A;  2B45 X;  2OVU A;  1S0B A;  1UN1 A;  1PO2 1;  5F5Q A;  4C90 A;  1QXP A;  4XF4 A;  2HWB 2;  2UY9 A;  4QB1 A;  2F4P A;  1R1A 3;  4IEW A;  3GZA A;  5J1X A;  1VAM A;  2BPA 2;  5J98 B;  4LKS A;  1B35 B;  3A7Q A;  2WNV C;  4YPJ A;  3G7D A;  3ZSK A;  5F39 A;  3EB7 A;  1QJX 2;  5ACA 2;  1ZBE 2;  1YFU A;  3W9A A;  4E4S A;  4M0N A;  2ID4 A;  3W58 A;  1XQN A;  4HOO A;  4E8C A;  4Q5O A;  3SC7 X;  2RDN A;  4JC1 A;  3O1P A;  2JG9 C;  3RJR A;  3SH5 A;  4I09 A;  3MZH A;  3OUI A;  3ORJ A;  1SPP A;  1W8T A;  5FP4 A;  3BTA A;  5FZ1 A;  1XNC A;  1OFS A;  2XQX A;  3AJZ A;  4N9H A;  3TNQ A;  1WD3 A;  1WW4 A;  1S4C A;  1IKP A;  4UI9 L;  5E1R A;  3NL1 A;  5CU1 A;  3N9N A;  3III A;  4TSV A;  4AFM A;  2P6C A;  3H8O A;  3R4D B;  4AHX A;  5IW0 A;  1ENR A;  2Y60 A;  2V73 A;  1HDK A;  2YPJ A;  5FK8 A;  1JOB A;  4FPO B;  4LUL A;  4I30 A;  3WNL A;  5KC6 A;  1W6O A;  3GHN A;  2Y64 A;  4LR4 A;  5BNO C;  1AJK A;  4BU2 A;  2VME A;  2K46 A;  1PIV 1;  1PZ8 A;  3UGH A;  5A1A A;  1SCR A;  1E5R A;  2DUQ A;  3K3O A;  3T4H B;  4XVH A;  4BK5 A;  3TAY A;  3AK0 A;  1W2A X;  4M0H A;  4HPK B;  2RDQ A;  3L2H A;  2HWB 3;  3PNA A;  1W2T A;  3ZDS A;  2D7F A;  1PGL 1;  1KFU L;  1XNA A;  1LEN A;  2WNE A;  3KCY A;  2XVG A;  3RDI A;  4MGS A;  5H9S A;  1R08 2;  4LPL A;  1DZR A;  2JG9 B;  5DMY A;  4XHB A;  1RB8 G;  4LBK A;  3NKG A;  4XYX A;  3H0O A;  1PX3 A;  1OPO A;  2WN3 A;  2ZGK A;  5CIR A;  1VAV A;  4FTB A;  2LRP A;  1ASJ 1;  1ND3 C;  4KWL A;  2FDJ A;  1NT0 A;  1UW8 A;  1UWW A;  2C6S A;  4Q27 A;  2WQ4 A;  4GWJ A;  5FZE A;  3FUO A;  2R6Q A;  4LOR A;  3PIJ A;  4JHZ A;  4XFI A;  3WP4 A;  4BA6 A;  4N43 B;  3WV6 A;  3MV1 1;  1ONA A;  1ZA7 A;  3AM2 A;  1SLC A;  5GLU A;  1SQ4 A;  5CIS A;  4TLG A;  3NNJ A;  2JG9 A;  2BGO A;  2PLV 1;  3ZFF A;  2J1A A;  4UYB A;  1VB4 A;  5JXH A;  1HRI 3;  4IXL A;  4AR2 A;  4Q0V A;  2PAK A; 
#chains in the Genus database with same CATH homology
 2JDK A;  2CHH A;  3DCQ A;  1W8H A;  1OVS A;  2JDY A;  2VUC A;  4AOC A;  2JDN A;  4CE8 A;  3ZDV A;  2VNV A;  1W8F A;  5A6X A;  1UQX A;  5A3O A;  5D2A A;  2BV4 A;  5HCH A;  5A6Z A;  2BP6 A;  5A6Y A;  5A70 A;  2JDP A;  1OUR A;  5A6Q A;  1OVP A;  2BOI A;  2BOJ A;  1GZT A;  1OUX A;  1UZV A;  2WRA A;  1OUS A;  2VUD A;  2JDH A;  4UT5 A;  2XR4 A;  1OXC A;  2JDU A;  2JDM A;  2WR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...