5HCHA

X-ray structure of a lectin-bound dna duplex containing an unnatural phenanthrenyl pair
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a lectin-bound DNA duplex containing an unnatural phenanthrenyl pair.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
molecule keywords Fucose-binding lectin
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5hchA00
5D2AA 2JDPA 4CE8A 2BP6A 1OVSA 5A3OA 4AOCA 2JDYA 5HCHA 5A70A 1UQXA 2WRAA 2JDNA 1OURA 5A6ZA 2WR9A 3ZDVA 1OVPA 5A6YA 1UZVA 2JDMA 2XR4A 2JDHA 1OXCA 2BOIA 2VUCA 4UT5A 2CHHA 2VUDA 2JDUA 5A6QA 2BV4A 3DCQA 1W8HA 1OUXA 2BOJA 2JDKA 2VNVA 1GZTA 1W8FA 5A6XA 1OUSA
chains in the Genus database with same CATH superfamily
3M1HA 1AXYA 3TBDA 5KHJA 1AXZA 2OX0A 2AREA 2X5IC 4ONUA 3B94A 4KQ7A 4QHOA 2EIDA 1DGRN 4FQZA 4LO6B 1LU2A 2C5DA 3ZYPA 5FTTC 2JD4A 4F7ZA 3VBHB 1AR92 2BNOA 3LDBA 4LHKA 5FYUA 5FZHA 2P3YA 4QX0A 4PDWA 4B29A 5FPLA 3O1OA 5J36A 1QJY3 2IXCA 2OUJA 3JCIA 4I3GA 4BQYA 2X8KA 1QJEA 4MZUA 3KVAA 3VUOA 1MQTC 1TEIA 5BXXA 4BK4A 2YFZA 4EV0A 2CDOA 1ZZ6A 2GNTA 2DBIA 4CP0A 3AJYA 4FP2A 2R072 4CCJA 1CAWB 2WRAA 1AR83 2VE1A 3SEEA 1W2OA 4OULA 4AQTA 2CAVA 3WDWA 5JVVA 3MV01 4UFHA 1QDCA 4R9DA 3OGVA 1QJU1 4LBLA 2BOIA 4UFKA 3FWEA 4L8QA 5ERLA 2P1BA 1AVBA 3AP5A 2VW1A 4Q8KA 3F2ZA 4I09A 3WCRA 1LOEA 1YQ5A 2JDKA 4PIZA 3WR0A 1C1FA 1XRUA 1WLDA 4XQWA 3HBZA 5FPVA 4QX3A 3ZYRA 4AI0A 4MVTA 4YW2A 2Y60A 5FYBA 1VBC1 1LRHA 2P4EA 1C8NA 2ZKNA 1JBCA 1XPWA 4ZS2A 4MYEA 3LFMA 2RG4A 4LHLA 4QPWA 4UAPA 3AC0A 4WVMB 5FZDA 3WNPA 5H9SA 2D7FA 5HV4A 3TEZA 1QQP3 4ZZ5A 4MO3M 5A33B 1WCDJ 5BY5A 3MLKA 1HB2A 1RUF3 1W06A 3EYPA 5LBEA 2J7MA 5ABJC 2RMU2 2VM9A 4CEYA 1JYCA 4COWA 1RYYA 2WC2A 3LEIA 4GWNA 3WW2A 1ND2C 2ZX4A 3FMGA 3VKFC 4EYUA 1W05A 1XNCA 4PHZA 3E97A 3WDTA 5C5TA 1CZTA 1OHFA 4Q4W2 3CJIA 4XIKA 3OEBA 4DB5A 5BYNA 2VCMA 5JMOA 3S7IA 5A3PA 1HXS3 5EP9A 2V5DA 1YFYA 3KF3A 5DPNA 1DZRA 2NZ9A 1O3RA 2QQWA 2W1QA 4JKLA 1SLAA 2UWAA 1MQTB 3U07A 1APNA 4IEZA 2XLGA 1OF3A 3B02A 4IUGA 3OD0A 4ARXA 3WSOA 5LEKA 3N9LA 4K7JA 2RS31 5IK7A 1W2UA 2X53S 5F5QA 3PU8A 2JEMA 3K3OA 5I0RA 3IIIA 1LR5A 1NYWA 2VMHA 1UYYA 5L73A 3ZXAC 3I8TA 4CU8A 3O0XA 5KC6A 4B4PA 4FI9A 5KXDA 2Q4SA 4BCUA 1EYBA 2R6QA 1IG0A 3R0RA 3VD9A 2AEYA 4AFCA 3D0JA 2CAUA 3HNMA 4K1ZA 4OVEA 1YQ6A 2B9UA 5DDJ3 1G7YA 2YGLA 1NA1A 1PO22 4FPYA 2Y6FA 3RYRA 2HWF2 1XE0A 4MV2A 2QBXA 5KXBA 3MW3A 3G6JB 5IATA 4IV1A 2BGCA 1REDA 3RZMA 3H8OA 4NN0A 3IIAA 1KS5A 3VBUA 2AEZA 4HPKA 5CKNA 2V72A 5IVBA 3LOBA 1KS4A 1UO9A 3D5OA 1R1ZA 2XLAA 1GR3A 1XNTA 4BHPA 3NV4A 4AVSA 4YFWA 4CUGA 4IXLA 3AK0A 4JTOA 1LKNA 1UOJA 1VAVA 2Q30A 3RG0A 3HVDA 1UIJA 1JN2P 4BA6A 2HYXA 3WV6A 5D2AA 3BTYA 2FQPA 2JG8A 4DRRA 4AOCA 4B1LA 1QJU2 1DYOA 3H0OA 2B46X 4BQ1A 4YPJA 3LB9A 1XXNA 1N1VA 2BNMA 4RS5B 2WNVC 1OH4A 3LPGA 4AQSA 4BDVB 5LK5A 4PCRA 4XJWA 2VMFA 1W03A 4LKDA 1NCRA 1XYNA 5ACA2 3TOJA 4YZ1A 1D2SA 5AC92 3I3MA 2DCJA 5FZ1A 1UY2A 3AMHA 4FFHA 2EVXA 2ARBA 3AVRA 3AKQA 5A7WB 3V65A 5JPNB 2RS13 4YZ2A 3HMYA 3OPWA 2XL9A 1S0FA 3EO6A 2A6WA 3H9AA 2RR11 2BU9A 4XUOA 5J37A 3OUIA 1AR71 5HI0A 1FOD3 3PUIA 2XJVA 1ULFA 5CFDC 4CEYB 1H1IA 4LE3A 3ZXGA 5FWJA 1SLTA 3B00A 3VZMA 5T52A 3BTZA 1CR7A 1HKDA 3ZYJB 4FFGA 1ZA7A 4UOJA 4HKWA 2W91A 3S0MA 1W6NA 2AGSA 1O4ZA 2W5FA 5EJZB 5IVCA 1QDOA 2WS92 4HL0A 1O5UA 1QU0A 1UY4A 4BE3A 3WW4A 1V6KA 1GSLA 2YZ4A 5DQ0A 2MNGA 2WA4A 4Q4V1 4K8RB 2WBKA 4IEUA 3VZJA 1OLMA 3K51A 1X50A 2WO7A 4DRVA 1ASJ3 2DVFA 5FUIA 1OMIA 4YVWC 1D0HA 4LJHA 4E2GA 3K4DA 2D5FA 1A3KA 2IC1A 2W08A 2IXHA 1AR81 1ZBA2 3GXUA 4KI5M 1RJ7A 5DAQA 1NCQA 5BNOB 4XQDA 4GH4A 1OFNA 5FRAA 3T2OA 2XUEA 1HN0A 1UAIA 3PL0A 4MSVA 1RUOA 5FZ4A 1W2NA 2JG8B 3RNSA 4XHBA 4C8DA 3GGLA 5KHHA 4RHV1 4UT5A 5DABA 1RXFA 4B4RA 4XC9A 4Q0PA 3DPRB 1OOPC 3MI8A 2VC9A 1BVVA 2ZBJA 5F5AA 1Q8PA 2HWB3 4FT8A 4QQOA 3BUCA 2ZGUA 3U14A 5IW0A 4XJ8A 3APBA 4RSUA 5FKBA 5FXXA 1QOOA 3ZXKA 2GN3A 1RHI2 5EWSA 2YFUA 5LCWL 5BV6A 3DXUA 2D6MA 3DKWA 3OBAA 3QBQA 1OLRA 2Z42A 3ZIWA 2BBVA 2CL2A 1O3QA 2Y38A 3OD4A 2V4AA 4MG2A 2R0HA 1VBD3 4FFIA 2WFF2 1FPN1 1GQGA 1MS0A 4RD7A 1YIPA 5A7PA 1JW6A 4D7TA 2XMLA 3M2MA 1W0PA 3K48A 1QH6A 1YXWA 2VUAA 5BNOC 3CDZB 2XH6A 4A6SA 2EALA 2OYZA 4XILA 4K40A 3ROUA 5KWRA 1HLCA 1H4HA 3PIJA 2UWBA 5JLVA 2XKPA 4U36A 1UOBA 5FMOS 3VBRB 4COZA 5F6KA 1AF9A 1CAXB 1QH7A 2R32A 1FATA 4CDWB 5HCHA 4LT5A 3ZKUA 4FSJA 4QDRA 4LKEA 4M3CF 2XWJB 2KD7A 1P8JA 4Q4X2 5FP4A 1QOSA 1RUC3 1RJ8A 3DL3A 4CDUA 5AFBA 1LHUA 3ZN6A 1ALYA 1S0CA 3GZAA 2RJLA 3NO8A 4JRAA 2ZXQA 2OW4A 1BK0A 3IM0A 5IK5A 1CAXA 2ZMNA 1XNAA 4DUXA 2D5HA 4AGGA 3VD4A 1JOJA 3B01A 4OQ8A 4CSWA 1X82A 4JGZA 5F3GA 2RS53 5DUXA 2XJRA 3FHAA 1FX5A 1PGW2 5JOYA 3URFA 5CISA 1MS8A 1NQJA 3TRSB 2BFUL 4DY5A 1PO23 2WFF1 1R1A3 3J26N 4AQ6A 1TMF3 5EZWA 1HRV1 2W52A 1NY72 3BU0A 3WG1A 2PQQA 1IG3A 4AEDB 2NMOA 1COV1 3DGTA 5JXJA 3WD5A 1H30A 3GZUC 4JDOA 3RJ2X 5C3QA 4RHV3 1CVNA 3J7HA 1ZZCA 3PUSA 1VBC2 1MS5A 4ZKTB 1HB3A 3IDEA 4BLIA 4CUBA 4RQPA 4AI8A 5JOZA 1JOPA 2R041 4ASMB 2UYAA 4PI0A 3ZFGB 4HKLA 1ENXA 4FPGA 1IPKA 1H1MA 1DGWA 2P2KA 2R1DA 4CPBD 1G9CA 2GMEA 3WQ7A 1GWKA 1S1AA 3O14A 4AEMA 1W9TA 5FZ8A 1AJOA 2EXJA 1OOPA 3DYPA 4HVOA 3ACHA 4CCNA 4HBNA 1VE0A 1OC1A 1QJX1 1O3SA 3AP4A 3UKNA 1VBD2 3WQ0A 4NO4A 3NWKA 1XJAA 5ACA3 3HN1A 2Q5TA 3AMMA 4M0HA 5FP8A 1HV0A 5FZ0A 3EQEA 4GH4C 1OH3A 1RUH3 2D6OX 4DXRA 2WWJA 4C90A 2Y6JA 5EPAA 3ZO0B 5HPOA 1G9DA 1H2MA 1RMU2 3S7EA 4RGAA 2WT1A 2AYHA 5T5PA 1RHI1 2VNRA 4FQ4A 4Q27A 4YVWA 3SQOA 1AYM1 1RUJ1 2B4KA 2VW2A 5F8PA 3C3VA 2RR13 4QM8A 5E8AA 4QWNA 4QGNA 2XL7A 2YGMA 2VVFA 4MADA 5GLTA 1ZRFA 2IUWA 2PAMA 3AMPA 3SCGA 1IS5A 1ENQA 3I2JA 4NRMA 3I2FA 1SEFA 1V6LA 2X5IA 4DUVA 2R062 1G9BA 3PLQA 3GF6A 2A5ZA 1S2EA 1LOFC 1N47A 4KWJA 4RFT0 1CN1A 3P1IA 2EXIA 2J1TA 2WZPP 4P00B 3WDUA 1H9WA 1STMA 3VDDA 1RUD2 1CPNA 2JB4A 4LE4A 1PVXA 2OVUA 2WNVB 3MW2A 2ZAAA 3DCQA 1VAKA 1SCRA 4SBVA 1OFSA 1UL9A 2DVGA 2EA7A 1ZRRA 5H9PA 4Y20A 2D3PA 3CLPA 2D44A 4NJ4A 3VHPA 2ES3A 1XQNA 5CFCC 1D2QA 3M3IA 1E57A 4Q4Y1 2E26A 3MPPG 2EAAA 3T08A 2ERFA 3LIGA 4NHKA 4XYXA 3WY6A 4CA9A 1HB4A 1ZBE2 3RI9A 2W46A 4FPOB 4LIUA 5CEHA 4H7LA 4QB2A 1IPJA 2OA2A 2DFCA 4XACA 3I2DA 4M3CA 1VMHA 2R061 2HYKA 1NY71 1IS3A 2XONA 1R092 2J1EA 2VMIA 4WV8A 1NZCA 3TYJA 2AZ5A 2FDKA 1BJQA 1YJKA 2VZSA 2FZ1A 4XJUA 3RS6A 4N53C 1J83A 1NOVA 1TG7A 2E32A 3VDAA 1RXGA 1XC6A 3ETQA 3VZKA 1AL22 4FVVA 4PLOA 1V9U1 5FJHA 3H8UA 4N53B 2DTWA 2X29A 3L2HA 1PMIA 3AYDA 4JZRA 3JUUA 4A6OA 5B4NA 5J98B 1POV0 1SZBA 2ORXA 2Z2SB 4BU2A 4F3JA 4O9GA 5FKCA 4P9YA 1FV2A 4N7UA 1L7QA 4OI2A 1F31A 1RITA 1ZYBA 2OPWA 2VZUA 3MIDA 2VUJA 1SLBA 4AEKA 2CWMA 1OBNA 5GZGA 5LY2A 2LALA 4XW3A 2H6CA 3CQOA 1EPZA 5FYTA 2VG9A 3T30A 1LHWA 2HWD3 2I2SA 4M00A 1CAUA 1LGNA 5H9QA 5A7QA 1RUC2 4IE5A 4QQPA 2WZR2 4ZU4A 1WD3A 2Y64A 1NCRB 5LA2A 3VBOC 4DINB 3BALA 1MZEA 4WM8B 4KWUA 1QNYA 4CUCA 5JZGB 2FDGA 4N8MA 2BEOA 3D0SA 2YPJA 3ZSEA 1VR3A 1W9SA 4A44A 4ATFA 1VBA1 1JU4A 4HPKB 4XUQA 2VZPA 5JSOA 1VIWB 4HN0A 5J96B 2AR6A 1OKOA 4Y22B 1RUH1 1VP6A 4BK5A 2Y34A 2O8OA 4IE4A 1POV1 2UURA 2VVDA 5EV7A 1ENRA 1WA6X 3T4VA 1UMZA 3AZWA 3R6SA 1ND2A 4R9CA 1B35B 1JHNA 1W8NA 2WAAA 1DLLA 3VL8A 5SV8A 3HIFA 2XHKA 1LESA 4XTMA 4CCLA 5AC93 4FTBA 4AWDA 1BEV3 1QJU3 1HW5A 4KGQA 1OLQA 3BKZA 3IDBB 2LW8A 5IHRA 3EHKA 3O1PA 2XXZA 2CHHA 3N35A 5I0UA 3WP5A 3ZLIA 5DAXA 3ZFGC 2NPIA 3DYMA 5L7OA 1YEWA 3M3CA 4LXLA 1E5IA 5IT6A 4O65A 1QJX3 4UWDA 4FP3A 1H9PA 4ZXEA 2LTNA 2G1MA 1X9TA 5KXEA 3G7DA 4CDWA 4R9BA 4GQ7A 3WNXA 3ZPYA 4NIGA 4QPIC 1H6XA 4N43B 3MGUA 4XJ9A 1RUH2 3K4ZA 2NMNA 2A6YA 2Y33A 1AL23 5T50A 4FBFA 5A6YA 2W0XA 1UZVA 3N36A 4YZ3A 4DQAA 1JYNA 3E5QA 4DNYA 3Q8BA 4IGQA 4IEQA 4TLGA 1H2LA 1CAUB 1GZ9A 3POWA 2BERA 5GLUA 1K42A 5JSPA 1N3PA 1TME1 2IXLA 1MEC2 2VOWA 4HG6B 4PQQA 1WCUA 2ZEZA 1FMD2 3E6DA 4Q4X1 1R64A 4HK9A 5JZGC 4E4ZA 4AHWA 4Q0UA 3ELNA 5ANQA 1MQTA 3H8XA 4W6YA 3JZVA 4XFBA 1WCKA 3BIEA 1GNZA 3T0DA 5L9RA 4D3WA 1UXXX 4WVMA 5EHDA 3VHOA 4GKYA 4XTPA 2WNEA 2VBPA 1RUE2 5HCFA 2GNBA 4OMCA 2VMDA 1PZ9A 2XHNA 3MLJA 4MHRA 1AX2A 5FP7A 3RGBA 5DAVA 4OI4A 4PDWC 3MEPA 4EN6B 3AB0A 2VZTA 2VVEA 5FXWA 1LOFA 5FZGA 1O8SA 2MEV3 2E9QA 3F95A 3GBFA 3AXDA 1ZZ7A 1HRV2 4ET7A 4YFZA 1YFUA 5A3WA 4XEZA 5EYXA 3DEMA 3BPZA 2YHJA 1D4M1 1EUTA 4J25A 1JHJA 2ID4A 1SPPB 3VBSA 3ZR5A 1W6OB 1GNHA 2ATFA 4IL7A 2TEPA 5FUPA 3QH7A 4EWDA 4JKKA 2VZ3A 3U4SA 4DZGA 4NOTA 2A3YA 3RWNA 2R0FA 3OGGA 5BPXA 3THTA 5A6ZA 1KXGA 5CVRA 2NP0A 1HX6A 3I49A 2XUMA 5CG9A 3B9IA 3H3ZA 4DXTA 2YC4A 4QAWA 1C28A 2ZJCA 5FWEA 1QJX2 1WMFA 2W95A 1SLLA 1WBFA 4M4RA 3O1RA 3H1YA 1CESA 3DYOA 4XF3A 1LHNA 3H42B 3I7DA 1OA2A 4QU2A 5CA6A 2WSVA 1V70A 2VZRA 3JD72 2LRPA 1YQ8A 4QPGA 3TEXA 5I8TA 3PU3A 3DV8A 5ISLA 2ZX0A 3LPFA 2I07B 4CDQA 2XJTA 3ES4A 4Q4V2 1AYM2 1RUJ2 3KD4A 1RUI2 4KL1A 3RWKX 5E89A 1LEDA 2AUYA 5DDJ2 3RRDA 2XBO2 4ARYA 3GBGA 2R073 4XMIA 1W8UA 2VZVA 3SEPA 5FO8B 1JODA 3ETPA 1GOFA 2XOMA 4Q4V3 2CSGA 4TN7A 2WT2A 4K20A 5FLJA 1VLNA 2PLV3 4COYA 1VRH1 4FPHA 4GIQA 3ZSLA 4AXOA 4Z8BA 1K12A 1BVP1 5A6QA 1CD3G 3R4UA 4C91A 2BYVE 2B42B 2VNVA 1SACA 4IDZA 3GYDA 2VXJA 2FDJA 4XF9A 3OBRA 1NE6A 3ON7A 4RHV2 3VBRC 3QCWA 3CF6E 3J9SA 1V6OA 4JGZC 4XF1A 1PZ7A 2WA3A 2Y0IA 1ND3C 5BNNB 4KWLA 4QM9A 1XSQA 2WO3A 5A7WA 1ZZBA 3PJYA 4EZ4A 1R1A2 2ZX2A 5DAWA 2E63A 1W8WA 2VPVA 2D6PA 1RHI3 2W92A 2JG9B 3UKTA 5GM0A 4Q4Y2 1GOGA 2E51A 1LGCA 5FLIA 1UD1A 3VDBA 5FQ0A 5FO9B 2HWB2 2PHWA 1HJGA 5FZFA 3RZHA 2XBO1 2XB6C 1V6JA 2QFEA 1XU1A 1UYPA 3KQRA 3J8F2 4FAGA 4N90A 4XJZA 1QXPA 4YW6A 1JZ4A 1G8WA 2PHDA 3A4UA 3FFQA 4FPFA 4E8DA 2GN7A 2VJXA 3CU7A 3V64A 4ISQA 1R091 5LW9A 4TXWA 1VMFA 1VB2A 3AM2A 5FYCA 2JE8A 1S0BA 2VOKA 4QX5A 3VZLA 2DUQA 2ZMLA 2ORZA 3ATGA 5FFOC 1ND2B 4XXAA 2YU1A 4AEDA 4FXKB 2VD7A 4H14A 1PM4A 1ZZ8A 2D3SA 4KG8A 5K0UA 3U78A 3ZIXA 4A3ZA 1VBB1 3OCPA 4YM1A 1OPOA 1H8TC 4GB31 4OLLA 4L11A 4LOTA 3PDQA 1JUIA 1E5RA 2LM3A 5C6CA 3V0AB 3A0KA 1XNBA 5K7PA 4CDUB 2GMPA 5T55A 3RZJA 2J1RA 3IPVA 4UW4A 4YVSA 3AZXA 1XNKA 2JIGA 5F32A 5FO7B 5A3TA 2MPFA 4FPEA 4QKFA 4XETA 4YW7A 2BNNA 5DUWA 4OHZA 1H8VA 1HRV3 4JQTA 5FZKA 1NZIA 3LF7A 2JB8A 1UZZA 3NAPA 4IERA 1J3QA 1IS4A 2Y6GA 3POGA 1FAYA 3I2KA 4OZOA 4FCAA 1Z7S2 1NXD1 4LK6A 1EY2A 3RYKA 4JGYA 3TAYA 5BNPC 4BH9A 4EQVA 4AFAA 1CWPA 1OLME 4EWEA 5BUVA 4QQ2A 4RYDA 1U5ZA 5CAZA 4OHVA 2A75A 2RJ2A 4QMAA 1O59A 2J1AA 3CMGA 3UJQA 5IFTA 3O5SA 4EN0A 4LPLA 4YSFA 4XFCA 2RMU3 5FZIA 2D6LX 2ZGPA 1TMF2 5E88A 2R49A 2X09A 3ASIA 2ZEWA 2Q0AA 4BZ4A 5C3OA 5KHKA 5DDJ1 1EV13 2P6HA 3AP9A 2RS33 2PN5A 2PQSA 2XVLA 1O3TA 4A42A 4I0WB 1W9WA 4NPRA 3T3YA 1MVQA 1IS6A 1OPMA 1YIFA 5ANNA 4XBLA 4YG3A 4MHUA 5GZFA 3IBMA 4TSVA 3UKVA 4PIXA 2SLIA 1IQDC 4NHXA 2PAKA 3WNOA 3GDBA 1MZ6A 1CIWA 2YBPA 1J3RA 4O61A 1N1YA 2JENA 3KCCA 4IEOA 1ZZ9A 4AAPA 1VBD1 3WNLA 2NYYA 2C1FA 2JE9A 3T4HB 3ZYBA 1JZ5A 4XFIA 2F4PA 4QX8A 4XURA 1NQDA 1PIV2 3LEMA 3M3QA 5FYYA 4Q2FA 3RQ0A 1UY3A 3C8XA 4SLIA 1YUDA 4YRDA 3UESA 2BW8A 2HWB1 4YLZA 3UGHA 4KG0A 4Z82A 4ZY9A 2HEVF 1W6MB 2RM21 3ACIA 4AGRA 4JRLA 4D8MA 2FHRA 1O7FA 2XLFA 4HSLA 1JYWA 2WNVA 2N7GA 4HT1T 4NRQA 1A6CA 1YFWA 3WEZA 4UFLA 5C71A 1RUF1 1S2KA 5FY0A 1D0GA 3IMNA 4NMIA 1RUG3 4JTNA 5F5IA 4D7YA 3B5LB 4CEWB 2R1BA 5FZ6A 4DY3A 3BI3A 1F4HA 2DVAA 2B8MA 2E31A 3W5NA 1ULDA 2XQRA 2FMDA 2ZEXA 1RUD1 1GP6A 5HCBA 5LZ6A 5CFDB 4XCBA 5FCCA 2HH9A 4NROA 3ZXDA 4MGQA 2CU5A 5JPMB 1ASJ1 2W1UA 1PX3A 2XVKA 3UETA 4FXGB 2A1XA 1AUYA 4NRPA 3A7QA 3KM5A 2VGDA 3OYWA 5G04L 1NG0A 3Q8FA 1HQNA 4TLFA 1BYHA 1RUE1 4AF9A 1SMVA 2D40A 4HETA 3INAA 2VTXJ 5E16A 3D6EA 5FYZA 5D1IA 4BJ0A 2WUHA 4E2SA 3UV9A 1NXMA 2JWPA 4KBBA 1BBT2 2Q8EA 3VBHA 3WZ1A 3ZFFC 1LOAA 1LOCA 5IJRA 1NUKA 3CBNA 2PA7A 4V1PA 3T0BA 4CDXC 5LWBA 3POYA 1E5SA 3C7FA 2FDFA 2ZPXA 3KQ4B 4H3WA 2O14A 4CE8A 4F83A 3NV2A 5C4WC 3N9QA 1WW5A 4XDQA 3NKTA 1W8OA 4AHZA 4CDXB 1J58A 4S2GA 5FPUA 2FBEA 3P3NA 3SCFA 1YC61 4ZU5A 5A1FA 4NPLA 1F9KA 4XPVA 2HBTA 1O5LA 4C1WA 3CNAA 1Y9MA 1JYIA 1BK1A 1C8M3 5EJ3A 1EPWA 3NJVA 1N3OA 2WQ4A 3THPA 2DU0A 3J7MA 4P5YA 4H2AA 2GZWA 1R082 2BJSA 1LHOA 4OHWA 4UXAA 4MH0E 2OT7A 4W65A 4JHZA 1PVC2 1DDLA 2GDFA 4Y33A 1V6MA 4DO0A 4H55A 3X29B 5FZLA 2BDRA 1MS1A 4R4ZA 5K0UB 2P37A 2GC2A 2HKXA 3VBSB 1HRI3 2EF6A 2XJUA 5FZ9A 2Y6KA 3LA7A 4AE2A 1PGL2 4DEVA 1TE1B 4K6BA 5K8SA 1DU3D 3MLLA 4XDPA 3PUQA 5LB6A 2MHFA 3NVCA 1XE8A 3L9JT 4P9XA 4XCAA 3CZUA 3OTFA 2I74A 4R9AA 4W8JA 2YV8A 3WW1A 4AG4A 1I1EA 3BGAA 4QT6A 4HK8A 3T2PA 2G9FA 3AYAA 1AYN2 4JVAA 5D8AC 2DCTA 4LBNA 3WCSA 3BIWE 1KJLA 4OUMA 4PQ9A 3O1UA 2W94A 2ZACA 2ZEYA 3BU7A 5GJ6A 4BQ3A 4QQLA 3CEWA 1RL3A 3OGRA 1JZ6A 2VCAA 3A0NA 4XFGA 3W21A 3LOIA 1X8MA 3VBFC 4BQWA 4ITCA 4YM0A 1R081 3GBWA 1C57A 2BPA2 2PHTA 4A7KA 4TZDA 4R4XA 3FJSA 2WNUB 3QACA 5JI9A 3RJRA 3SH3A 5IVJA 3CJIB 5I0TA 5JI7A 4HVRA 2L9LA 5C3SA 4XAAA 1GUIA 4GB33 4XFAA 2ENRA 2VXRA 1UXZA 2ZGSA 3O0WA 4R8HA 4BLJA 5FZCA 3WHTA 1YRZA 2VUDA 4K21A 1LJ7A 2WT0A 4YYOA 5J3UA 1SDWA 4GALA 2F6BA 1BHGA 2WNUA 3QH6A 1XB9A 4IE6A 1UOGA 1VJ2A 4LBMA 4YW3A 4OI1A 4I3PA 4PT6A 2GNDA 2JICA 1R093 2VNOA 2VZ1A 4MGYE 1OD3A 4GA9A 4N9IA 3PVNA 3ZYGA 1ODNA 5EJ1B 2QQIA 1QQP1 4DXSA 2G9ZA 2VR4A 2ADDA 2D6KA 5FY4A 2QNKA 4AFMA 1T6BX 4DUWA 5CFCB 3FUOA 4MUVA 2CGPA 1EAH2 3IMMA 4YW4A 3E5UA 1TNFA 5DZEA 1W9FA 2Q1ZB 3FE5A 1C8M1 1OQEA 4UW3A 3N4MA 1FYUA 2W47A 3BOPA 4IE0A 5FREA 2HEYF 5JXGA 5CZKA 5L9VA 5C9AA 1T6GC 5FUNA 2WO2A 2GC0A 2RJKA 1UZYA 2FMYA 1ULGA 2JD9A 2VCCA 2WWSA 3OBTA 2DV9A 3L2YA 3RFRA 1LU1A 2KA3A 4Z07A 4CVUA 2XBO3 3ENRA 2GC3A 2OXBA 4AFBA 2VBBA 4OI0A 5EIYB 2CGOA 1PVC3 2CY6A 2JG9A 3FFZA 3KT7A 1U12A 2R16A 4Y1VA 4Q1RA 4G4FA 2CV6A 4CXYA 1Q8OA 5FY8A 3DXTA 3ZFEC 4EJRA 2DFBA 1Y4WA 3CHXA 3K46A 1WGPA 4LLFA 4OMDA 3SH5A 4AAXA 4Z92B 2VQAA 3NV1A 4I2OA 3MIEA 2D97A 1KEXA 1QQP2 4MX3A 4PJYA 4WM7A 3ILNA 3WXPA 1SPPA 1F5FA 5KBFA 3BVCA 2HWC2 4DXZA 3M3EA 2ETEA 2HWF1 1CAWA 1RUD3 1EUUA 1LEMA 1G6NA 2YU2A 4OYUA 1BMV2 2V73A 1RIRA 3RZLA 1OF4A 4P5HA 1DGLA 4CEWC 1Q8VA 4RA0A 3E5XA 1REFA 4I02A 4QDQA 3FBMA 1Y7BA 1W99A 4IV3A 5FY1A 4GJZA 4XE9A 1UPIA 3H3LA 2YYOA 4D0QA 2J1UA 2A6ZA 2ZHLA 4I0AA 2JDHA 1DCSA 4Z2WA 1SBDA 3I2IA 2RR12 4PBPA 3RDIA 1XU2A 4TTGA 1H8TB 2KXLA 1XNDA 2XGXA 4WM7C 4C0BA 1UKGA 2C6SA 1VMJA 2WS93 4XDOA 1W04A 5C70A 3U0ZA 1VBE2 2BWCA 2K2SA 4YG0A 2RHPA 3TN92 2IWGB 1RMU3 1IPSA 3QOPA 4N9HA 2Q8CA 4LMFA 1UCXA 2NLRA 1FV3A 1QEXA 1KFUL 3NV3A 2EIBA 2VW0A 4META 3C7HA 3MIHA 2ZGLA 1DFQA 2E6VA 5GLVA 1QY4A 3A23A 4K3UA 2GP3A 3K2OA 1IHMA 2WR9A 5DAPA 4JV4A 1PO11 3BYWA 3JD71 2W39A 2V09A 3DUIA 3WF4A 3DPRC 3P3PA 2PXJA 3AP6A 1HJFA 1UY0A 1RUI3 3ZFEB 1WCQA 2DF7A 1J3PA 1K45A 5C9AC 5IAXA 4ZZ8A 1RUI1 1PK6C 3I3QA 2RM22 4P9WA 1UU4A 1ZBA1 1YQ2A 2D98A 3UYJA 3IDCB 5FMOL 4M01A 4MGTA 2P3IA 1C5HA 1DQ6A 4GXLA 5KHIA 2R063 1WLCA 4QGMA 3T2TA 4HZFA 4YZ4A 3VBUB 5IUQA 3WF2A 1IKQA 4IV3C 1W6NB 5A3MA 1UMIA 3VGIA 4QHZA 1JZ7A 3H8RA 1H2KA 4GMP3 1AR63 1DYPA 1OD5A 4Q0VA 4QPGC 5FBZA 2NQYA 2ZTNA 4CRQA 3LSDA 1O4TA 2EAKA 4Y1UA 5FDBA 3N7JA 1X33A 5JDBA 1JXNA 1Z0HA 2YC0A 3Q8EA 2VH9A 4YNIA 3OOXA 5JWPA 4IEXA 4Y1XA 1YFXA 3JB8A 2XKOA 4WZFA 4ASLA 4RS5C 5C8CC 4N43A 1ND3B 3KVBA 3NNMA 5FJKA 4W6XA 2C4XA 3WF3A 4L9BA 4CZSA 1QNWA 5FY9A 5I93A 4LO7A 1TME3 3NQHA 5F9TA 3IDAA 2P3JA 2XJQA 2GC1A 1UY1A 3O1SA 3JQWA 1H0BA 1SHWB 2JKBA 3VV1A 3I3DA 2P17A 3ILFA 2ADEA 1RGSA 2C24A 1T2XA 3I3BA 2BBAA 4UW6A 1SBEA 3I59A 5D8AA 5JR2A 1BMV1 2VNGA 4IW3A 3SC7X 3O1MA 4JGYB 4PI2A 1AR93 5GLWA 3OY8A 3CIHA 4LEJA 1PIV3 2IXKA 3I54A 4LBKA 4WVZA 5GZDA 5IVEA 2WZR3 1F35A 3KV9A 3AFKA 5LA9A 2WQ8A 3V0BA 4DOUA 4LBJA 1HRI2 2LS6A 1WMEA 1POV3 2DDUA 5GZEA 1FNYA 2JJ6A 4BQ4A 2WABA 4M3CE 1MEC3 3V0AA 3N7KA 3ZM8A 3U10A 4P9GA 4QQHA 3POFA 4KH9A 1HN1A 1VBE1 4NE9A 1J59A 2VBDA 4GMP0 1N3QA 3KT4A 2PLV1 4AI2A 2WNUC 1Q3EA 1AX1A 1DQ4A 3LSEA 5JOXA 4ZPIA 3LEGA 1AR91 2B45X 1COV2 3S57A 2BOJA 3SKVA 2I45A 1OUSA 3FUQA 3O7OA 4M3CB 1QJY1 2WWUA 3C7EA 3V56A 3OB8A 5G05L 5C4WB 2GP5A 4MOAA 3OBZA 2DVDA 2O1QA 1US2A 4JC1A 5K9YA 1DHKB 2BTVC 2IZWA 1YQCA 4QPYA 2Y6HA 2Y8KA 3NNLA 3ZSMA 1EV12 5L36A 4LHSA 1UOFA 2BVBA 3ZDVA 5A1LA 1PGW1 3VBFA 4CDXA 4OHXA 2SBAA 2V4VA 4XUPA 1GLHA 2R071 4AW7A 2VZOA 3P6BA 3PUAA 3WNKA 4Q26A 5FOJB 1L3JA 2WKKA 1CZVA 1WW7A 2W1WA 4XUTA 1YCIA 1XOYA 2QCSB 5C5UA 3H3UA 3VD5A 1G86A 1HV1A 3M70A 5BNNA 1V6IA 4FTSA 3POJA 5T3NA 1I3HA 3O1VA 3KV4A 3AZZA 2ARAA 2FZ2A 3WP3A 4AVAA 4XHXA 5FZBA 1QWRA 3PTRB 1EAH3 1HIXA 1GP5A 1X7NA 2QVSB 4P14A 5DG1A 5I8SA 3T1LA 4AEJA 4ES9A 4L92A 1GMMA 1V00A 2JX9A 5J48A 4HOOA 5FP3A 5CBLA 5GZCA 2HWE1 4C0HA 5FAXA 5J09A 1QJY2 1FOD2 5GKAC 2JKXA 1UF2C 4A7YA 4Y4YA 2UU8A 4A3XA 4AI3A 3GCXA 5KC5A 3PMEA 3AMQA 1CJPA 2ZX1A 3PVBB 4UF0A 5I91A 1C3HA 2BZDA 1EAH1 1MPXA 1WW4A 3ZN5A 2GSYA 2MEV1 1ZBE1 2W68A 1J1LA 1W0OA 3C7GA 1WKYA 4B7KA 3NW4A 3WNNA 4Y5Z0 1AXKA 4A7ZA 1QHDA 1NAEA 4IGPA 2GH2A 3JXSA 1W28A 1PO13 2E7QA 4K9SA 1AR62 2DYCA 3VBFB 3KGLA 5F1RA 3C2UA 4G3YC 4BPZA 2JDNA 1PK6A 4E4DX 2BUKA 1MVEA 2PHRA 3JB4C 1PM7A 1LNSA 2JDMA 2QQJA 1JZ8A 1DP0A 1ONAA 4RR3C 2PHFA 2RS52 5C4WA 5TSWA 4E8CA 3LGRA 4CCMA 4R52A 3N9PA 2UY8A 1UYZA 1WD4A 3LE0A 5FPAA 3WUCA 4Q0SA 3VBHC 2RS32 2P34A 4OCTA 3OGJA 1W8FA 4MGIE 1DGWX 1W2TA 3SH4A 1ZREA 4OFGA 1REEA 1ACCA 4EN9B 2OKXA 4DIQA 2XJPA 4Y20B 4XF4A 4LQRA 2WYSA 4NAOA 5F2WA 2MEV2 2AACA 2DUOA 4QB1A 5AFEA 1QOTA 4Q4W1 5L19A 3N9OA 3B69A 2WYFA 3KF5A 3D8CA 4LUKA 1YYNA 2EXHA 4QKDA 4PIYA 1WLTA 3FN9A 2BGOA 3HNYM 2J22A 3GALA 4UFIA 5SV5A 1AL21 2VECA 1HQLA 1BXHA 1K5MB 1MZ5A 1YHFA 1S0IA 3POBA 3AKPA 1B35C 3IN9A 2DWRA 5LRSA 4FPKA 3LKJA 1ZNPA 2ZHKA 1W3VA 1AYM3 1RUJ3 2OQ7A 2WZ8A 2KM2A 3MFCA 1ULEA 1DYKA 3NAPB 1VBA2 5FZAA 3WG4A 3AL5A 4E2QA 4EE2A 4B8EA 1U0AA 3VBOB 1VBE3 1OT5A 1XBFA 3MO4A 3N7LA 1DZQA 1OURA 3I2GA 4W6WA 1PVC1 3IPVB 3LEKA 3WQ1A 4YVWB 4BXFA 3KWVA 5FYVA 4YVSC 3RI8A 4KWKA 5LA0A 4YWAA 3I2OA 2RDNA 3NNJA 4CP9A 1O6UA 1Y43B 2WDBA 3ZMNA 3MUY1 4UFJA 2QQKA 2FDIA 2HJIA 1GYKA 3AKRA 4P9LA 4BM8A 3S5AA 2PYTA 3HT1A 1W3XA 1RVF3 2JDUA 1PGL1 2WZR1 1PO12 4MGSA 5FZOA 1YNAA 4UBHA 3DN7A 2OZ6A 1AHSA 4AEDC 2HWE2 4GWIA 1B35A 3VDDC 4CYDA 3USUB 2Q1FA 4NIIA 3HWJA 3VKNA 4CCOA 5A70A 2WFPA 4BWOA 1ENSA 1KD7A 1LGBA 1LTEA 3JBG1 4FPJA 5CNAA 3VLBB 4OHYA 1JTZX 4BQ5A 2PAEA 1JOBA 2XR4A 3Q9OA 4RGKA 5FYMA 2IVJA 2G4IA 3OG2A 5HXMA 1OXCA 3VB9A 4LA2A 4XAEA 5I0SA 3BTXA 4GKXA 3ZXFA 3WOGA 2YUEA 4NAMA 4RL7A 1ZRCA 1RUC1 1A78A 5FY5A 2VQTA 1W8HA 5ABJB 2WIIB 4J1WA 1NE4A 1PO21 2WFF3 3DPRA 3ITQA 5HV0A 1KRIA 1OA4A 4KNCA 1J1TA 2TNFA 1YLLA 1TME2 1VPHA 4JGZB 1UPSA 5T5LA 3MDPA 2RS51 4BOWA 5A3NA 5LA1A 2ZS6B 1V9U3 4GMP1 1ZBE3 4XJAA 1DQ2A 1LB2A 1YJLA 1N1TA 1CX1A 3VBRA 2PHUA 4IEVA 1ST8A 2V5YA 2Q1MA 2QKDA 1GWMA 3NAPC 5CYYA 4FTEA 3AL6A 4GWJA 2HBUA 1RTVA 4DFSA 2W87A 2VTFA 4BQ2A 2ZGMA 2LUWA 2ZHMA 3SMHA 5D8AB 3FC0A 4TYSA 1ZX5A 2FD8A 3VL9A 3PVOA 4P02B 3JBG2 5C3RA 4X8PA 3CKHA 1TNRA 3NNGA 5FIXA 1SDDB 3GCWA 4CP2A 1GZTA 1YO8A 1H8TA 2ZGRA 1I5PA 4LO4B 4XUNA 2CWSA 1NX9A 1HB1A 4XIOA 3B93A 4PF1A 2WS91 3RMYA 1S4CA 4FAHA 5LK7B 2JECA 2VU9A 5A32B 2QZ2A 2A71A 2YY1A 1FXZA 3OYWB 3JD73 4LKFA 1GQPA 2E33A 3WDXA 3I97A 4IE7A 3PNAA 4CXWA 1K5MC 3UGFA 3RPQA 2HWC3 3OUJA 5IK4A 2Y0OA 1TZOA 4GZ9A 2RVAA 4JDNA 4BISA 5LY1A 1A8MA 2VTXA 1TQ5A 3HJRA 4AVTA 2E53A 1AR82 1J84A 4IEPA 1UNBA 3T1MA 1I6XA 3UT0A 4HVQA 3QLQA 3JQXA 2BFUS 1W39A 4Q1PA 1W8TA 1NLSA 4GH4B 4IETA 5A7OA 5A7SA 4CDQB 2R7EB 4OQ9A 2YG0A 4HONA 1F8VA 1K5JA 1Y3TA 4BIOA 5FQ0B 5FPBA 2CNAA 1VRBA 2WL1A 4EN8B 4RFRB 1D4VB 5CADA 4LBQA 2KR2A 2DUPA 4AYUA 3M8LA 1W6PB 3CO2A 3FLPA 4UW5A 3U4XA 1UMHA 1LCLA 4WVWA 3ZSJA 2FCTA 1D4M2 1X36A 4Y5TA 2VQUA 3MW4A 3OEAA 4HXCA 4RR3A 5CU1A 1GZCA 4RR3B 4AL9A 1JYVA 3HPNA 4D6SA 2VMCA 1S55A 1W9YA 1VBC3 3IKWA 3UL2A 2YBSA 3EB7A 4IEYA 5DZFA 4UYBA 3EXUA 2Y26A 2G19A 3MICA 3WDVA 5FOBB 1W6PA 1BZWA 2Z5WA 3N9MA 1WMXA 4UI9L 1FPN2 5E6HA 4LR4A 2FDHA 3POSA 3OPTA 4YM3A 4GAZA 2JDYA 3SISA 1C8M2 2A6XA 3CJXA 1W6OA 3HNBM 4YW5A 5FMBA 4AGVA 2JXAA 5C8WA 5F7UA 1GOHA 2R30A 2RS11 3LIHA 4QU1A 3WF1A 3AP7A 3ZFFA 1LHVA 4JCKA 2OQ6A 5C8CB 1VB4A 3O1TA 3FBYA 1L7RA 3WP4A 3S5QA 3W5MA 3RZZA 2XDVA 1DG6A 1UZ0A 4URAA 3MZHA 3ACGA 3UNPA 5C3PA 3CZJA 2D3RA 2ZHNA 2A3WA 1PHMA 1LAJA 4QPGB 3K3NA 1PNFA 1G9AA 1WWYA 1V0AA 4YARA 4LNVA 1VRH3 2HLEA 2ZOEB 2BV4A 1KFXL 4PLNA 3WW3A 1GZWA 2WAOA 1WMDA 4V2VA 3WUDA 2QTWB 4QPIB 1NLRA 4LO8A 1AL0G 1WW6A 3ZYFA 2DU1A 5JMCA 1COV3 4MXWB 2BP6A 3KCYA 2E7AA 3IAQA 2RM23 4NHMA 5BNNC 1MS9A 1Q43A 3ILRA 5LRRA 4S2FA 4CDWC 2OUHA 4XBQA 4I0BA 5CG8A 1K3IA 4IESA 2CTVA 2W2IA 1KGYA 4YGBA 2R043 4WZCA 1AYN3 1UU6A 3ME2A 4YGCA 1OQ1A 1AX0A 1AR61 1CGPA 2GNMA 3UGGA 3VHNA 1LENA 5JSRA 3ZFGA 2AH2A 2GU9A 2OS2A 2W9XA 4LBQD 4YVSB 2PHXA 5J1XA 1CAVB 4LBOA 2K46A 3OJBA 4N43C 3U11A 2JIJA 4RS5A 3S30A 3IZOA 4LK7A 4P9IA 4FOYA 5A80A 2ZGQA 1R1A1 3O0VA 4N7IA 2D6NA 1NA1B 2RE9A 5A7NA 2UYBA 5FYSA 4HMZA 3MF9A 3BPSA 3W9AA 2Q8DA 3ZXEA 2OIIA 3ZVXA 3K4AA 4M4PA 3HD8B 2FCUA 2YMZA 2BQPA 1ULCA 3IWZA 3W20A 1R083 3VZOA 3OY8B 5IWFA 1CPMA 1BBT3 1S2BA 2BWAA 3KV6A 1JYTA 2LROA 4FOWA 4D69A 1SLIA 3DF0A 1KJRA 2X10A 3KMHA 3H7YA 4CP9B 1SBFA 1JZ3A 5LBFA 4NWWA 3WQBA 1QJZA 4LO5B 5FZ3A 1TVGA 1WBLA 1ZM1A 5DMYA 5I8YA 4QX1A 2DBNA 1ZVFA 3ECQA 1RMU1 3J7NA 3JBG3 3ZSKA 4J6GA 3VBOA 3AXEA 3BODA 3I59B 3SKJE 3WDYA 1VBB2 5IAVA 4NIAA 3S6PA 5F3CA 4O7XA 3MFAA 5FXZA 3HAGA 3RMXA 4QPIA 4XFHA 1FPN3 3OGSA 4PF5A 1HRI1 3TNPB 1CAVA 2EIGA 2DTYA 3D4KA 5FR3A 1M4WA 5LBCA 5IK8A 4MXWA 2GH8A 5FYIA 1XE7A 4ES8A 3FHIB 1GBGA 1I5ZA 5E1RA 3TB0A 3D3AA 4FPCA 1CIYA 5K4LA 1GZWB 3UJOA 5KXCA 1DLCA 4BB3A 5DUUA 3SITA 3U37A 4D6RA 2B9VA 2PFWA 2Z4FA 3IT8A 3VKOA 4AHYA 2QQMA 4YGEA 4HANA 2BGPA 2ET1A 5C8CA 3LCPA 3OPZA 1B09A 3R4SA 2RV9A 2HWF3 2Y6LA 2GAUA 4FPLA 4ZS3A 5JIAA 1MR5A 1QXRA 3J4UH 3MIBA 1FT9A 4F8AA 3HQRA 1IZ3A 3ST7A 2ZGOA 2TUNA 2TBVA 3UK9A 1S0GA 4A2UA 5A33A 4FFFA 1K5MA 4YGDA 1PZ8A 2E7TA 4N53A 2VOXA 1UX7A 3ZKYA 1SCSA 2ZGTA 1OI6A 3ZYIB 3MBWA 4OUEA 1E5HA 2QQOA 5T54A 3RYPA 1KDMA 1Z7S3 5B2GB 4QXKA 4MLOA 1GV9A 4X6RB 4QGLA 3TEWA 4YW1A 4AQ2A 4LOSA 1VALA 4UFMA 1UWWA 1YI7A 3VD3A 4E4HA 1Z7S1 1US3A 4Z1VA 3FLRA 1SFPA 1RUG1 1AR73 1OA3A 2IVIB 5FYHA 3FLTA 1BCXA 2QQLA 3U1XA 4AK3A 3KT1A 3PMSA 1W6QB 5A1AA 3EJKA 3ES1A 4HLTA 1RINA 2J42A 2K9ZA 3BTAA 2ARCA 3W59A 4EROA 3AYEA 4X8NA 1M06G 1QKQA 3ZFEA 4AVVA 1GQHA 1ZRDA 1Y9QA 3H1MA 4AVBA 1EP0A 3FZ3A 1ASJ2 1AJKA 1F2NA 3HQUA 4PDWB 1VBA3 4O9EA 4U2AA 3E6CC 1DQ5A 5F37A 1FOD1 4EN7B 4M0NA 3K75B 3ZR6A 2A73B 3ZPOA 5F3IA 5A6XA 5F2SA 4A4AA 3FX3A 1ODMA 2VULA 4ISRA 3K77A 4XQ4A 3VDDB 3WINE 1Q8QA 3USSA 3ABZA 5A32A 4D6QA 3T09A 1C4RA 1H2NA 1X8EA 3TN93 5JCTA 3POEA 1W8ZA 3WG3A 4FO9A 1UIKA 3KCXA 1YWKA 4P9JA 4XABA 4E27A 1IGOA 5FXVA 5CB7A 4CTEA 3N7MA 4XZPA 1C5IA 2UY9A 3EBRA 1RUG2 1H6YA 1RUNA 5LATA 4QXBA 5JXHA 3MIFA 2ZMKA 4JX0A 2C0ZA 2P3KA 4H7MA 1W90A 5FZEA 2ZX3A 1HQWA 4CCEA 4CUAA 5CKMA 2VAUA 4NUBA 4CEWA 2WQZC 1GANA 1EV11 2QQNA 2X5IB 5BNPA 5FZ7A 4DPNA 1URXA 1OVSA 2RMU1 5FLHA 3WHUA 3N9NA 5BNQA 2CDPA 4Y26A 4KU7A 3MUZ1 5IVVA 1O8PA 5T5JA 4CCKA 3KS7A 3GHNA 2ILMA 4ZHNA 3RSJA 4UBGA 2IFWA 3OF1A 3R05A 3DECA 3TEYA 4S2HA 2ZZJA 2ARXA 3MIGA 4CU6A 3OUHA 3ORJA 2YC2A 4P08A 3SLIA 3RVHA 3KSCA 2DCYA 1H4GA 4LUMA 4HFSA 4RQPC 5L7OB 5DG2A 2VZQA 4B3NA 4Y3OA 1IOAA 3O12A 5K0UC 5FPXA 1QJFA 2EIEA 4ASKA 3TNQA 3KHCA 5EQUA 5JR7B 2CYFA 3PTYA 4Q4X3 2YBKA 3WNMA 1WLWA 4JAAA 1BQPA 3NJYA 4Q5OA 1PX4A 2ZAHA 4CP1A 1AYN1 3AJZA 4FOQA 4ZU7A 2DCZA 3M7AA 1HXS1 5FK8A 4DS0A 2XG3A 3V0BB 4QDSA 4IQPA 3AKSA 1SFYA 2C9KA 2EICA 5A3LA 2QQPA 2P5BA 1GICA 1UKRA 4XZUG 3A22A 2PELA 2XQXA 1DQ1A 1D7PM 5FV3A 2A7AA 2Q8OA 1SG3A 2VUCA 2VY0A 4HSJA 2ZA9A 2H0VA 4ZONA 3GNEA 1U5IA 4NR1A 4WM8C 1QMJA 3M3OA 3TWIA 5L7OC 1IKPA 2BVVA 2DVBA 2WZEA 5FP9A 3ZDSA 1JMUB 4EZHA 3Q8CA 3PVEA 5IVYA 4BMEA 3THDA 1MEC1 4BQXA 1H1AA 5A3OA 1FMD1 1NKGA 2NM1A 4AR2A 3BB6A 4E4SA 4AZZA 3WG2A 1UYXA 5JZGA 3AZVA 4KU8A 5FZOB 4A45A 3VKMA 3ZOIA 1JUHA 2W3JA 4BIFA 1RUE3 2ZKLA 4Q29A 2VL4A 3D82A 4XXPA 3NRUA 4AVCA 4RGGA 2RDSA 1WCSA 3AMNA 4I30A 3ZN6B 1HXS2 1QGLA 2WLQA 1QXJA 5F5CA 1CQ9A 5D21A 3LZZA 2DCKA 1AZDA 1OUXA 1O4YA 4NHYA 1GFF2 1LULA 2FCVA 3LA3A 2PHLA 3HBKA 4Y4RA 3KB5A 4KGGA 3KLSA 1Q56A 2W1SA 3MV11 3NJXA 4CDQC 3MHZA 2CGNA 4QXHA 3VHRA 1JYXA 4LIVA 4Q4W3 1LODA 1PNGA 1X9PA 2JE7A 3POIA 4RQPB 4EWAA 1F15A 2O0OA 5IFPA 2J1SA 1SQ4A 3FHQA 3B9CA 1L7LA 3LA2A 3H7JA 3B7MA 1GWLA 2YB7A 1WZXA 3OSDA 1UU5A 2QJVA 3ACFA 4QD2A 5DXDA 1S0EA 2X05A 4LKSA 4NIHA 1JI6A 4XVHA 3THCA 4INDA 1LOBA 3HR9A 4QX7A 3ZXLA 4CU9A 4HN1A 2WSUA 4QHBA 1S0DA 1JU3A 4S2DA 3VKLA 2HWD1 5APAA 2C9AA 2IXIA 4PLMA 2PMWB 2QQVA 4BMBA 1DZTA 2JDZA 1DF0A 1NLQA 2Z69A 1NCQC 2WLPA 5JOWA 4X6QB 2A3XA 2HWC1 1UQXA 4CDUC 1YI9A 1W0NA 5KR7A 1FNZA 3GHMA 5AVAA 3NJZA 1GU3A 1WA4A 1GNYA 1CX4A 1O91A 1LECA 2UWCA 5A3UA 5J7MA 5EYYA 3QD6A 3ZX7A 3WT3A 2YROA 1ULOA 4NPMA 3SHRA 5KHGA 2A6VA 1MS4A 5BNOA 4E9KA 1C1LA 2EXKA 4KBZA 5BNPB 4TWTA 1KITA 1ZA4A 2WN3A 5LASA 4LORA 1BLZA 4GD4A 2F4LA 1VRH2 3IB3A 4WVVA 1D4M3 2OZJA 1Q8SA 4ORFA 1CONA 2VCBA 4NVPA 4PBOA 2Z79A 5CFDA 4ATEA 4COVA 1QIQA 2VOTA 4BYYA 3GZTB 3R4DB 1OKQA 4BXSV 5FZMA 1JH5A 4L97A 3J8F1 3AVSA 4COUA 5CIRA 1JZ2A 3RZGA 4CPBA 3LDKA 3WVJA 5IYYA 3ZFFB 3ZYHA 4L2NA 2H6BA 2QQUA 2XJSA 2XVGA 3J8F3 4IEWA 3B3QE 4WM7B 2RDQA 3GJAA 5H9RA 4AFDA 3CL1A 1OSGA 2JDAA 3ZN4A 2ZZQA 2VQ0A 3RZKA 4IV3B 2D93A 4WBBA 3BCWA 2VOVA 4B7EA 5F3EA 3LQCA 1DQ0A 4NHLA 3NL1A 4Z2AA 3HN3A 2YPDA 5F6LB 4JHTA 4LTAA 5CKQA 2GALA 1POQA 2B5HA 1MS3A 1UX6A 2C26A 2F17A 2VMGA 4CU7A 3T2QA 4Y24A 1UW8A 4Q4Y3 5EXOA 2WN2A 1U5YA 1QF3A 1VBB3 3M4FA 5JIUA 3TN91 2QDNA 2ZABA 2P6CA 4G9SB 4JDMA 4ZXKA 5C9AB 1OOPB 3VN4A 3MF6A 2RS12 4CCDA 3HOBA 2K0GA 1W6MA 1BEV2 5AVPA 1W6QA 1RC6A 2WNOA 4IV1B 2IFRA 3AYCA 3VBUC 1RVF1 2VMEA 4W50A 4Y1ZA 5CFCA 1ULPA 3C7OA 4MGZE 1A34A 1DBNA 2HEWF 4B1MA 5T5OA 4UF0B 1NA1C 3ACLA 2ZGKA 2DURA 2QZ3A 4GWMA 3HEIA 4K1YA 4AHXA 4XBNA 5F39A 1WUVA 2HWD2 4JQRA 4LULA 3PJQA 1MZFA 4LLOA 1VAMA 3PIGA 4LITA 5IVFA 4OZXA 3AZYA 3VDCA 3USUA 1ZRIA 1Z78A 3LFIA 5DZGA 3N3HA 3P5BA 2GMMA 4XF0A 4GJYA 5GALA 1GP4A 4D94A 4Y22A 1KQRA 1OQDA 5JXIA 1PGSA 2ZCWA 3H50A 3KHBA 3LAGA 5FPZA 5HCAA 4GULA 2B7YA 3PHMA 3WF0A 1XYPA 4W4ZA 1FMD3 2JDPA 1NCRC 1IQAA 5JAXA 5L9BA 3BOWA 2XPJA 3E1F1 5C7GA 2YDEA 4HKOA 1BEV1 2R042 4Q8LA 4QKNA 3SCHA 5ACA1 3LDRA 4GB32 1LOGA 5AC91 2ET7A 3WX5A 3IAPA 2AC1A 3DKQA 4L0PA 4L99A 4A41A 4YZ5A 4IGOA 5DUVA 1XSRA 1W2AX 3I3EA 1PIV1 4MGKE 3WLUA 2JG8C 5FMDA 4JGYC 4LHNA 1ND3A 3ALQA 1CJDA 3KZ4C 4MXVA 1S0JA 5GLZA 4C1XA 4NWVA 4OUSA 1UZWA 1AR72 4D7SA 3AFGA 4NIDA 3JU9A 4CEYC 5HXVA 3KV5A 4FOVA 1RB8G 5ABJA 1HDKA 3VZNA 5LEJA 4Y5SA 1XYOA 4AI9A 1U5XA 4V2WA 2YXSA 1NT0A 2H0BA 3AKTA 3NMBA 2OPKA 2WJSA 4YG6A 1F5JA 4IV1C 4Q0QA 4YM2A 2QDRA 2WO1A 3H1WA 3SNMA 3AX4A 4QXCA 3I4IA 3WP6A 1KDKA 3W58A 2QUOA 3J7LA 1TMF1 4CXXA 1UN1A 1V9U2 4QKBA 3NKGA 4XMAA 5DN2A 1CZSA 5B4XA 3FL7A 5FY7A 2ZGNA 4QB6A 3EMRA 1Y9GA 2J1VA 4AI1A 2PTMA 4CCCA 2XWBB 1SLCA 3GZEA 1N1SA 2QE3A 3KGZA 4XFFA 5FK7A 5C33A 5JUVA 4QX2A 2B39A 1PMJX 3GM8A 5I0DA 3NSTA 1A8DA 3HQXA 3Q8AA 4K8FA 4DEQA 2NN8A 3GJBA 4URTA 4Y1YA 2G9GA 2WINB 2O8QA 1JS9A 1RUF2 1BKZA 5HBAA 3PUHA 1V6NA 4DMIA 1BBT1 1Q5OA 5FMCA 2BRTA 1DIWA 2HWE3 2PLV2 3BN6A 4J1XA 1NCQB 4RN5A 3LD8A 1PK6B 1OVPA 3E6BA 1MACA 4I01A 2RDRA 1FI2A 2D43A 1ZBA3 5EFUA 3ZXJA 4LBQB 1RVF2 3MYXA 2AENA 1GKBA 3VD7A 3HT2A 1G9FA 2JG9C 1I9RA 1F4AA 3CJIC 5M0TA 3U75A 3MPBA 3LWCA 4B4QA 3I2HA 4JKMA 3PURA 4KMQA 4LA3A 1PMHX 4WM8A 2VO5A 5FBJA 3ZMOA 3A21A 2A70A 2IXJA 3VBSC 1SFNA 1DGRA 4XOGA 3T0AA 5LBBA 3SXWA 3NNFA
chains in the Genus database with same CATH topology
5D2AA 2JDPA 4CE8A 2BP6A 1OVSA 5A3OA 4AOCA 2JDYA 5HCHA 5A70A 1UQXA 2WRAA 2JDNA 1OURA 5A6ZA 2WR9A 3ZDVA 1OVPA 5A6YA 1UZVA 2JDMA 2XR4A 2JDHA 1OXCA 2BOIA 2VUCA 4UT5A 2CHHA 2VUDA 2JDUA 5A6QA 2BV4A 3DCQA 1W8HA 1OUXA 2BOJA 2JDKA 2VNVA 1GZTA 1W8FA 5A6XA 1OUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2A A;  2JDP A;  4CE8 A;  2BP6 A;  1OVS A;  5A3O A;  4AOC A;  2JDY A;  5HCH A;  5A70 A;  1UQX A;  2WRA A;  2JDN A;  1OUR A;  5A6Z A;  2WR9 A;  3ZDV A;  1OVP A;  5A6Y A;  1UZV A;  2JDM A;  2XR4 A;  2JDH A;  1OXC A;  2BOI A;  2VUC A;  4UT5 A;  2CHH A;  2VUD A;  2JDU A;  5A6Q A;  2BV4 A;  3DCQ A;  1W8H A;  1OUX A;  2BOJ A;  2JDK A;  2VNV A;  1GZT A;  1W8F A;  5A6X A;  1OUS A; 
#chains in the Genus database with same CATH topology
 3M1H A;  1AXY A;  3TBD A;  5KHJ A;  1AXZ A;  2OX0 A;  2ARE A;  2X5I C;  4ONU A;  3B94 A;  4KQ7 A;  4QHO A;  2EID A;  1DGR N;  4FQZ A;  4LO6 B;  1LU2 A;  2C5D A;  3ZYP A;  5FTT C;  2JD4 A;  4F7Z A;  3VBH B;  1AR9 2;  2BNO A;  3LDB A;  4LHK A;  5FYU A;  5FZH A;  2P3Y A;  4QX0 A;  4PDW A;  4B29 A;  5FPL A;  3O1O A;  5J36 A;  1QJY 3;  2IXC A;  2OUJ A;  3JCI A;  4I3G A;  4BQY A;  2X8K A;  1QJE A;  4MZU A;  3KVA A;  3VUO A;  1MQT C;  1TEI A;  5BXX A;  4BK4 A;  2YFZ A;  4EV0 A;  2CDO A;  1ZZ6 A;  2GNT A;  2DBI A;  4CP0 A;  3AJY A;  4FP2 A;  2R07 2;  4CCJ A;  1CAW B;  2WRA A;  1AR8 3;  2VE1 A;  3SEE A;  1W2O A;  4OUL A;  4AQT A;  2CAV A;  3WDW A;  5JVV A;  3MV0 1;  4UFH A;  1QDC A;  4R9D A;  3OGV A;  1QJU 1;  4LBL A;  2BOI A;  4UFK A;  3FWE A;  4L8Q A;  5ERL A;  2P1B A;  1AVB A;  3AP5 A;  2VW1 A;  4Q8K A;  3F2Z A;  4I09 A;  3WCR A;  1LOE A;  1YQ5 A;  2JDK A;  4PIZ A;  3WR0 A;  1C1F A;  1XRU A;  1WLD A;  4XQW A;  3HBZ A;  5FPV A;  4QX3 A;  3ZYR A;  4AI0 A;  4MVT A;  4YW2 A;  2Y60 A;  5FYB A;  1VBC 1;  1LRH A;  2P4E A;  1C8N A;  2ZKN A;  1JBC A;  1XPW A;  4ZS2 A;  4MYE A;  3LFM A;  2RG4 A;  4LHL A;  4QPW A;  4UAP A;  3AC0 A;  4WVM B;  5FZD A;  3WNP A;  5H9S A;  2D7F A;  5HV4 A;  3TEZ A;  1QQP 3;  4ZZ5 A;  4MO3 M;  5A33 B;  1WCD J;  5BY5 A;  3MLK A;  1HB2 A;  1RUF 3;  1W06 A;  3EYP A;  5LBE A;  2J7M A;  5ABJ C;  2RMU 2;  2VM9 A;  4CEY A;  1JYC A;  4COW A;  1RYY A;  2WC2 A;  3LEI A;  4GWN A;  3WW2 A;  1ND2 C;  2ZX4 A;  3FMG A;  3VKF C;  4EYU A;  1W05 A;  1XNC A;  4PHZ A;  3E97 A;  3WDT A;  5C5T A;  1CZT A;  1OHF A;  4Q4W 2;  3CJI A;  4XIK A;  3OEB A;  4DB5 A;  5BYN A;  2VCM A;  5JMO A;  3S7I A;  5A3P A;  1HXS 3;  5EP9 A;  2V5D A;  1YFY A;  3KF3 A;  5DPN A;  1DZR A;  2NZ9 A;  1O3R A;  2QQW A;  2W1Q A;  4JKL A;  1SLA A;  2UWA A;  1MQT B;  3U07 A;  1APN A;  4IEZ A;  2XLG A;  1OF3 A;  3B02 A;  4IUG A;  3OD0 A;  4ARX A;  3WSO A;  5LEK A;  3N9L A;  4K7J A;  2RS3 1;  5IK7 A;  1W2U A;  2X53 S;  5F5Q A;  3PU8 A;  2JEM A;  3K3O A;  5I0R A;  3III A;  1LR5 A;  1NYW A;  2VMH A;  1UYY A;  5L73 A;  3ZXA C;  3I8T A;  4CU8 A;  3O0X A;  5KC6 A;  4B4P A;  4FI9 A;  5KXD A;  2Q4S A;  4BCU A;  1EYB A;  2R6Q A;  1IG0 A;  3R0R A;  3VD9 A;  2AEY A;  4AFC A;  3D0J A;  2CAU A;  3HNM A;  4K1Z A;  4OVE A;  1YQ6 A;  2B9U A;  5DDJ 3;  1G7Y A;  2YGL A;  1NA1 A;  1PO2 2;  4FPY A;  2Y6F A;  3RYR A;  2HWF 2;  1XE0 A;  4MV2 A;  2QBX A;  5KXB A;  3MW3 A;  3G6J B;  5IAT A;  4IV1 A;  2BGC A;  1RED A;  3RZM A;  3H8O A;  4NN0 A;  3IIA A;  1KS5 A;  3VBU A;  2AEZ A;  4HPK A;  5CKN A;  2V72 A;  5IVB A;  3LOB A;  1KS4 A;  1UO9 A;  3D5O A;  1R1Z A;  2XLA A;  1GR3 A;  1XNT A;  4BHP A;  3NV4 A;  4AVS A;  4YFW A;  4CUG A;  4IXL A;  3AK0 A;  4JTO A;  1LKN A;  1UOJ A;  1VAV A;  2Q30 A;  3RG0 A;  3HVD A;  1UIJ A;  1JN2 P;  4BA6 A;  2HYX A;  3WV6 A;  5D2A A;  3BTY A;  2FQP A;  2JG8 A;  4DRR A;  4AOC A;  4B1L A;  1QJU 2;  1DYO A;  3H0O A;  2B46 X;  4BQ1 A;  4YPJ A;  3LB9 A;  1XXN A;  1N1V A;  2BNM A;  4RS5 B;  2WNV C;  1OH4 A;  3LPG A;  4AQS A;  4BDV B;  5LK5 A;  4PCR A;  4XJW A;  2VMF A;  1W03 A;  4LKD A;  1NCR A;  1XYN A;  5ACA 2;  3TOJ A;  4YZ1 A;  1D2S A;  5AC9 2;  3I3M A;  2DCJ A;  5FZ1 A;  1UY2 A;  3AMH A;  4FFH A;  2EVX A;  2ARB A;  3AVR A;  3AKQ A;  5A7W B;  3V65 A;  5JPN B;  2RS1 3;  4YZ2 A;  3HMY A;  3OPW A;  2XL9 A;  1S0F A;  3EO6 A;  2A6W A;  3H9A A;  2RR1 1;  2BU9 A;  4XUO A;  5J37 A;  3OUI A;  1AR7 1;  5HI0 A;  1FOD 3;  3PUI A;  2XJV A;  1ULF A;  5CFD C;  4CEY B;  1H1I A;  4LE3 A;  3ZXG A;  5FWJ A;  1SLT A;  3B00 A;  3VZM A;  5T52 A;  3BTZ A;  1CR7 A;  1HKD A;  3ZYJ B;  4FFG A;  1ZA7 A;  4UOJ A;  4HKW A;  2W91 A;  3S0M A;  1W6N A;  2AGS A;  1O4Z A;  2W5F A;  5EJZ B;  5IVC A;  1QDO A;  2WS9 2;  4HL0 A;  1O5U A;  1QU0 A;  1UY4 A;  4BE3 A;  3WW4 A;  1V6K A;  1GSL A;  2YZ4 A;  5DQ0 A;  2MNG A;  2WA4 A;  4Q4V 1;  4K8R B;  2WBK A;  4IEU A;  3VZJ A;  1OLM A;  3K51 A;  1X50 A;  2WO7 A;  4DRV A;  1ASJ 3;  2DVF A;  5FUI A;  1OMI A;  4YVW C;  1D0H A;  4LJH A;  4E2G A;  3K4D A;  2D5F A;  1A3K A;  2IC1 A;  2W08 A;  2IXH A;  1AR8 1;  1ZBA 2;  3GXU A;  4KI5 M;  1RJ7 A;  5DAQ A;  1NCQ A;  5BNO B;  4XQD A;  4GH4 A;  1OFN A;  5FRA A;  3T2O A;  2XUE A;  1HN0 A;  1UAI A;  3PL0 A;  4MSV A;  1RUO A;  5FZ4 A;  1W2N A;  2JG8 B;  3RNS A;  4XHB A;  4C8D A;  3GGL A;  5KHH A;  4RHV 1;  4UT5 A;  5DAB A;  1RXF A;  4B4R A;  4XC9 A;  4Q0P A;  3DPR B;  1OOP C;  3MI8 A;  2VC9 A;  1BVV A;  2ZBJ A;  5F5A A;  1Q8P A;  2HWB 3;  4FT8 A;  4QQO A;  3BUC A;  2ZGU A;  3U14 A;  5IW0 A;  4XJ8 A;  3APB A;  4RSU A;  5FKB A;  5FXX A;  1QOO A;  3ZXK A;  2GN3 A;  1RHI 2;  5EWS A;  2YFU A;  5LCW L;  5BV6 A;  3DXU A;  2D6M A;  3DKW A;  3OBA A;  3QBQ A;  1OLR A;  2Z42 A;  3ZIW A;  2BBV A;  2CL2 A;  1O3Q A;  2Y38 A;  3OD4 A;  2V4A A;  4MG2 A;  2R0H A;  1VBD 3;  4FFI A;  2WFF 2;  1FPN 1;  1GQG A;  1MS0 A;  4RD7 A;  1YIP A;  5A7P A;  1JW6 A;  4D7T A;  2XML A;  3M2M A;  1W0P A;  3K48 A;  1QH6 A;  1YXW A;  2VUA A;  5BNO C;  3CDZ B;  2XH6 A;  4A6S A;  2EAL A;  2OYZ A;  4XIL A;  4K40 A;  3ROU A;  5KWR A;  1HLC A;  1H4H A;  3PIJ A;  2UWB A;  5JLV A;  2XKP A;  4U36 A;  1UOB A;  5FMO S;  3VBR B;  4COZ A;  5F6K A;  1AF9 A;  1CAX B;  1QH7 A;  2R32 A;  1FAT A;  4CDW B;  5HCH A;  4LT5 A;  3ZKU A;  4FSJ A;  4QDR A;  4LKE A;  4M3C F;  2XWJ B;  2KD7 A;  1P8J A;  4Q4X 2;  5FP4 A;  1QOS A;  1RUC 3;  1RJ8 A;  3DL3 A;  4CDU A;  5AFB A;  1LHU A;  3ZN6 A;  1ALY A;  1S0C A;  3GZA A;  2RJL A;  3NO8 A;  4JRA A;  2ZXQ A;  2OW4 A;  1BK0 A;  3IM0 A;  5IK5 A;  1CAX A;  2ZMN A;  1XNA A;  4DUX A;  2D5H A;  4AGG A;  3VD4 A;  1JOJ A;  3B01 A;  4OQ8 A;  4CSW A;  1X82 A;  4JGZ A;  5F3G A;  2RS5 3;  5DUX A;  2XJR A;  3FHA A;  1FX5 A;  1PGW 2;  5JOY A;  3URF A;  5CIS A;  1MS8 A;  1NQJ A;  3TRS B;  2BFU L;  4DY5 A;  1PO2 3;  2WFF 1;  1R1A 3;  3J26 N;  4AQ6 A;  1TMF 3;  5EZW A;  1HRV 1;  2W52 A;  1NY7 2;  3BU0 A;  3WG1 A;  2PQQ A;  1IG3 A;  4AED B;  2NMO A;  1COV 1;  3DGT A;  5JXJ A;  3WD5 A;  1H30 A;  3GZU C;  4JDO A;  3RJ2 X;  5C3Q A;  4RHV 3;  1CVN A;  3J7H A;  1ZZC A;  3PUS A;  1VBC 2;  1MS5 A;  4ZKT B;  1HB3 A;  3IDE A;  4BLI A;  4CUB A;  4RQP A;  4AI8 A;  5JOZ A;  1JOP A;  2R04 1;  4ASM B;  2UYA A;  4PI0 A;  3ZFG B;  4HKL A;  1ENX A;  4FPG A;  1IPK A;  1H1M A;  1DGW A;  2P2K A;  2R1D A;  4CPB D;  1G9C A;  2GME A;  3WQ7 A;  1GWK A;  1S1A A;  3O14 A;  4AEM A;  1W9T A;  5FZ8 A;  1AJO A;  2EXJ A;  1OOP A;  3DYP A;  4HVO A;  3ACH A;  4CCN A;  4HBN A;  1VE0 A;  1OC1 A;  1QJX 1;  1O3S A;  3AP4 A;  3UKN A;  1VBD 2;  3WQ0 A;  4NO4 A;  3NWK A;  1XJA A;  5ACA 3;  3HN1 A;  2Q5T A;  3AMM A;  4M0H A;  5FP8 A;  1HV0 A;  5FZ0 A;  3EQE A;  4GH4 C;  1OH3 A;  1RUH 3;  2D6O X;  4DXR A;  2WWJ A;  4C90 A;  2Y6J A;  5EPA A;  3ZO0 B;  5HPO A;  1G9D A;  1H2M A;  1RMU 2;  3S7E A;  4RGA A;  2WT1 A;  2AYH A;  5T5P A;  1RHI 1;  2VNR A;  4FQ4 A;  4Q27 A;  4YVW A;  3SQO A;  1AYM 1;  1RUJ 1;  2B4K A;  2VW2 A;  5F8P A;  3C3V A;  2RR1 3;  4QM8 A;  5E8A A;  4QWN A;  4QGN A;  2XL7 A;  2YGM A;  2VVF A;  4MAD A;  5GLT A;  1ZRF A;  2IUW A;  2PAM A;  3AMP A;  3SCG A;  1IS5 A;  1ENQ A;  3I2J A;  4NRM A;  3I2F A;  1SEF A;  1V6L A;  2X5I A;  4DUV A;  2R06 2;  1G9B A;  3PLQ A;  3GF6 A;  2A5Z A;  1S2E A;  1LOF C;  1N47 A;  4KWJ A;  4RFT 0;  1CN1 A;  3P1I A;  2EXI A;  2J1T A;  2WZP P;  4P00 B;  3WDU A;  1H9W A;  1STM A;  3VDD A;  1RUD 2;  1CPN A;  2JB4 A;  4LE4 A;  1PVX A;  2OVU A;  2WNV B;  3MW2 A;  2ZAA A;  3DCQ A;  1VAK A;  1SCR A;  4SBV A;  1OFS A;  1UL9 A;  2DVG A;  2EA7 A;  1ZRR A;  5H9P A;  4Y20 A;  2D3P A;  3CLP A;  2D44 A;  4NJ4 A;  3VHP A;  2ES3 A;  1XQN A;  5CFC C;  1D2Q A;  3M3I A;  1E57 A;  4Q4Y 1;  2E26 A;  3MPP G;  2EAA A;  3T08 A;  2ERF A;  3LIG A;  4NHK A;  4XYX A;  3WY6 A;  4CA9 A;  1HB4 A;  1ZBE 2;  3RI9 A;  2W46 A;  4FPO B;  4LIU A;  5CEH A;  4H7L A;  4QB2 A;  1IPJ A;  2OA2 A;  2DFC A;  4XAC A;  3I2D A;  4M3C A;  1VMH A;  2R06 1;  2HYK A;  1NY7 1;  1IS3 A;  2XON A;  1R09 2;  2J1E A;  2VMI A;  4WV8 A;  1NZC A;  3TYJ A;  2AZ5 A;  2FDK A;  1BJQ A;  1YJK A;  2VZS A;  2FZ1 A;  4XJU A;  3RS6 A;  4N53 C;  1J83 A;  1NOV A;  1TG7 A;  2E32 A;  3VDA A;  1RXG A;  1XC6 A;  3ETQ A;  3VZK A;  1AL2 2;  4FVV A;  4PLO A;  1V9U 1;  5FJH A;  3H8U A;  4N53 B;  2DTW A;  2X29 A;  3L2H A;  1PMI A;  3AYD A;  4JZR A;  3JUU A;  4A6O A;  5B4N A;  5J98 B;  1POV 0;  1SZB A;  2ORX A;  2Z2S B;  4BU2 A;  4F3J A;  4O9G A;  5FKC A;  4P9Y A;  1FV2 A;  4N7U A;  1L7Q A;  4OI2 A;  1F31 A;  1RIT A;  1ZYB A;  2OPW A;  2VZU A;  3MID A;  2VUJ A;  1SLB A;  4AEK A;  2CWM A;  1OBN A;  5GZG A;  5LY2 A;  2LAL A;  4XW3 A;  2H6C A;  3CQO A;  1EPZ A;  5FYT A;  2VG9 A;  3T30 A;  1LHW A;  2HWD 3;  2I2S A;  4M00 A;  1CAU A;  1LGN A;  5H9Q A;  5A7Q A;  1RUC 2;  4IE5 A;  4QQP A;  2WZR 2;  4ZU4 A;  1WD3 A;  2Y64 A;  1NCR B;  5LA2 A;  3VBO C;  4DIN B;  3BAL A;  1MZE A;  4WM8 B;  4KWU A;  1QNY A;  4CUC A;  5JZG B;  2FDG A;  4N8M A;  2BEO A;  3D0S A;  2YPJ A;  3ZSE A;  1VR3 A;  1W9S A;  4A44 A;  4ATF A;  1VBA 1;  1JU4 A;  4HPK B;  4XUQ A;  2VZP A;  5JSO A;  1VIW B;  4HN0 A;  5J96 B;  2AR6 A;  1OKO A;  4Y22 B;  1RUH 1;  1VP6 A;  4BK5 A;  2Y34 A;  2O8O A;  4IE4 A;  1POV 1;  2UUR A;  2VVD A;  5EV7 A;  1ENR A;  1WA6 X;  3T4V A;  1UMZ A;  3AZW A;  3R6S A;  1ND2 A;  4R9C A;  1B35 B;  1JHN A;  1W8N A;  2WAA A;  1DLL A;  3VL8 A;  5SV8 A;  3HIF A;  2XHK A;  1LES A;  4XTM A;  4CCL A;  5AC9 3;  4FTB A;  4AWD A;  1BEV 3;  1QJU 3;  1HW5 A;  4KGQ A;  1OLQ A;  3BKZ A;  3IDB B;  2LW8 A;  5IHR A;  3EHK A;  3O1P A;  2XXZ A;  2CHH A;  3N35 A;  5I0U A;  3WP5 A;  3ZLI A;  5DAX A;  3ZFG C;  2NPI A;  3DYM A;  5L7O A;  1YEW A;  3M3C A;  4LXL A;  1E5I A;  5IT6 A;  4O65 A;  1QJX 3;  4UWD A;  4FP3 A;  1H9P A;  4ZXE A;  2LTN A;  2G1M A;  1X9T A;  5KXE A;  3G7D A;  4CDW A;  4R9B A;  4GQ7 A;  3WNX A;  3ZPY A;  4NIG A;  4QPI C;  1H6X A;  4N43 B;  3MGU A;  4XJ9 A;  1RUH 2;  3K4Z A;  2NMN A;  2A6Y A;  2Y33 A;  1AL2 3;  5T50 A;  4FBF A;  5A6Y A;  2W0X A;  1UZV A;  3N36 A;  4YZ3 A;  4DQA A;  1JYN A;  3E5Q A;  4DNY A;  3Q8B A;  4IGQ A;  4IEQ A;  4TLG A;  1H2L A;  1CAU B;  1GZ9 A;  3POW A;  2BER A;  5GLU A;  1K42 A;  5JSP A;  1N3P A;  1TME 1;  2IXL A;  1MEC 2;  2VOW A;  4HG6 B;  4PQQ A;  1WCU A;  2ZEZ A;  1FMD 2;  3E6D A;  4Q4X 1;  1R64 A;  4HK9 A;  5JZG C;  4E4Z A;  4AHW A;  4Q0U A;  3ELN A;  5ANQ A;  1MQT A;  3H8X A;  4W6Y A;  3JZV A;  4XFB A;  1WCK A;  3BIE A;  1GNZ A;  3T0D A;  5L9R A;  4D3W A;  1UXX X;  4WVM A;  5EHD A;  3VHO A;  4GKY A;  4XTP A;  2WNE A;  2VBP A;  1RUE 2;  5HCF A;  2GNB A;  4OMC A;  2VMD A;  1PZ9 A;  2XHN A;  3MLJ A;  4MHR A;  1AX2 A;  5FP7 A;  3RGB A;  5DAV A;  4OI4 A;  4PDW C;  3MEP A;  4EN6 B;  3AB0 A;  2VZT A;  2VVE A;  5FXW A;  1LOF A;  5FZG A;  1O8S A;  2MEV 3;  2E9Q A;  3F95 A;  3GBF A;  3AXD A;  1ZZ7 A;  1HRV 2;  4ET7 A;  4YFZ A;  1YFU A;  5A3W A;  4XEZ A;  5EYX A;  3DEM A;  3BPZ A;  2YHJ A;  1D4M 1;  1EUT A;  4J25 A;  1JHJ A;  2ID4 A;  1SPP B;  3VBS A;  3ZR5 A;  1W6O B;  1GNH A;  2ATF A;  4IL7 A;  2TEP A;  5FUP A;  3QH7 A;  4EWD A;  4JKK A;  2VZ3 A;  3U4S A;  4DZG A;  4NOT A;  2A3Y A;  3RWN A;  2R0F A;  3OGG A;  5BPX A;  3THT A;  5A6Z A;  1KXG A;  5CVR A;  2NP0 A;  1HX6 A;  3I49 A;  2XUM A;  5CG9 A;  3B9I A;  3H3Z A;  4DXT A;  2YC4 A;  4QAW A;  1C28 A;  2ZJC A;  5FWE A;  1QJX 2;  1WMF A;  2W95 A;  1SLL A;  1WBF A;  4M4R A;  3O1R A;  3H1Y A;  1CES A;  3DYO A;  4XF3 A;  1LHN A;  3H42 B;  3I7D A;  1OA2 A;  4QU2 A;  5CA6 A;  2WSV A;  1V70 A;  2VZR A;  3JD7 2;  2LRP A;  1YQ8 A;  4QPG A;  3TEX A;  5I8T A;  3PU3 A;  3DV8 A;  5ISL A;  2ZX0 A;  3LPF A;  2I07 B;  4CDQ A;  2XJT A;  3ES4 A;  4Q4V 2;  1AYM 2;  1RUJ 2;  3KD4 A;  1RUI 2;  4KL1 A;  3RWK X;  5E89 A;  1LED A;  2AUY A;  5DDJ 2;  3RRD A;  2XBO 2;  4ARY A;  3GBG A;  2R07 3;  4XMI A;  1W8U A;  2VZV A;  3SEP A;  5FO8 B;  1JOD A;  3ETP A;  1GOF A;  2XOM A;  4Q4V 3;  2CSG A;  4TN7 A;  2WT2 A;  4K20 A;  5FLJ A;  1VLN A;  2PLV 3;  4COY A;  1VRH 1;  4FPH A;  4GIQ A;  3ZSL A;  4AXO A;  4Z8B A;  1K12 A;  1BVP 1;  5A6Q A;  1CD3 G;  3R4U A;  4C91 A;  2BYV E;  2B42 B;  2VNV A;  1SAC A;  4IDZ A;  3GYD A;  2VXJ A;  2FDJ A;  4XF9 A;  3OBR A;  1NE6 A;  3ON7 A;  4RHV 2;  3VBR C;  3QCW A;  3CF6 E;  3J9S A;  1V6O A;  4JGZ C;  4XF1 A;  1PZ7 A;  2WA3 A;  2Y0I A;  1ND3 C;  5BNN B;  4KWL A;  4QM9 A;  1XSQ A;  2WO3 A;  5A7W A;  1ZZB A;  3PJY A;  4EZ4 A;  1R1A 2;  2ZX2 A;  5DAW A;  2E63 A;  1W8W A;  2VPV A;  2D6P A;  1RHI 3;  2W92 A;  2JG9 B;  3UKT A;  5GM0 A;  4Q4Y 2;  1GOG A;  2E51 A;  1LGC A;  5FLI A;  1UD1 A;  3VDB A;  5FQ0 A;  5FO9 B;  2HWB 2;  2PHW A;  1HJG A;  5FZF A;  3RZH A;  2XBO 1;  2XB6 C;  1V6J A;  2QFE A;  1XU1 A;  1UYP A;  3KQR A;  3J8F 2;  4FAG A;  4N90 A;  4XJZ A;  1QXP A;  4YW6 A;  1JZ4 A;  1G8W A;  2PHD A;  3A4U A;  3FFQ A;  4FPF A;  4E8D A;  2GN7 A;  2VJX A;  3CU7 A;  3V64 A;  4ISQ A;  1R09 1;  5LW9 A;  4TXW A;  1VMF A;  1VB2 A;  3AM2 A;  5FYC A;  2JE8 A;  1S0B A;  2VOK A;  4QX5 A;  3VZL A;  2DUQ A;  2ZML A;  2ORZ A;  3ATG A;  5FFO C;  1ND2 B;  4XXA A;  2YU1 A;  4AED A;  4FXK B;  2VD7 A;  4H14 A;  1PM4 A;  1ZZ8 A;  2D3S A;  4KG8 A;  5K0U A;  3U78 A;  3ZIX A;  4A3Z A;  1VBB 1;  3OCP A;  4YM1 A;  1OPO A;  1H8T C;  4GB3 1;  4OLL A;  4L11 A;  4LOT A;  3PDQ A;  1JUI A;  1E5R A;  2LM3 A;  5C6C A;  3V0A B;  3A0K A;  1XNB A;  5K7P A;  4CDU B;  2GMP A;  5T55 A;  3RZJ A;  2J1R A;  3IPV A;  4UW4 A;  4YVS A;  3AZX A;  1XNK A;  2JIG A;  5F32 A;  5FO7 B;  5A3T A;  2MPF A;  4FPE A;  4QKF A;  4XET A;  4YW7 A;  2BNN A;  5DUW A;  4OHZ A;  1H8V A;  1HRV 3;  4JQT A;  5FZK A;  1NZI A;  3LF7 A;  2JB8 A;  1UZZ A;  3NAP A;  4IER A;  1J3Q A;  1IS4 A;  2Y6G A;  3POG A;  1FAY A;  3I2K A;  4OZO A;  4FCA A;  1Z7S 2;  1NXD 1;  4LK6 A;  1EY2 A;  3RYK A;  4JGY A;  3TAY A;  5BNP C;  4BH9 A;  4EQV A;  4AFA A;  1CWP A;  1OLM E;  4EWE A;  5BUV A;  4QQ2 A;  4RYD A;  1U5Z A;  5CAZ A;  4OHV A;  2A75 A;  2RJ2 A;  4QMA A;  1O59 A;  2J1A A;  3CMG A;  3UJQ A;  5IFT A;  3O5S A;  4EN0 A;  4LPL A;  4YSF A;  4XFC A;  2RMU 3;  5FZI A;  2D6L X;  2ZGP A;  1TMF 2;  5E88 A;  2R49 A;  2X09 A;  3ASI A;  2ZEW A;  2Q0A A;  4BZ4 A;  5C3O A;  5KHK A;  5DDJ 1;  1EV1 3;  2P6H A;  3AP9 A;  2RS3 3;  2PN5 A;  2PQS A;  2XVL A;  1O3T A;  4A42 A;  4I0W B;  1W9W A;  4NPR A;  3T3Y A;  1MVQ A;  1IS6 A;  1OPM A;  1YIF A;  5ANN A;  4XBL A;  4YG3 A;  4MHU A;  5GZF A;  3IBM A;  4TSV A;  3UKV A;  4PIX A;  2SLI A;  1IQD C;  4NHX A;  2PAK A;  3WNO A;  3GDB A;  1MZ6 A;  1CIW A;  2YBP A;  1J3R A;  4O61 A;  1N1Y A;  2JEN A;  3KCC A;  4IEO A;  1ZZ9 A;  4AAP A;  1VBD 1;  3WNL A;  2NYY A;  2C1F A;  2JE9 A;  3T4H B;  3ZYB A;  1JZ5 A;  4XFI A;  2F4P A;  4QX8 A;  4XUR A;  1NQD A;  1PIV 2;  3LEM A;  3M3Q A;  5FYY A;  4Q2F A;  3RQ0 A;  1UY3 A;  3C8X A;  4SLI A;  1YUD A;  4YRD A;  3UES A;  2BW8 A;  2HWB 1;  4YLZ A;  3UGH A;  4KG0 A;  4Z82 A;  4ZY9 A;  2HEV F;  1W6M B;  2RM2 1;  3ACI A;  4AGR A;  4JRL A;  4D8M A;  2FHR A;  1O7F A;  2XLF A;  4HSL A;  1JYW A;  2WNV A;  2N7G A;  4HT1 T;  4NRQ A;  1A6C A;  1YFW A;  3WEZ A;  4UFL A;  5C71 A;  1RUF 1;  1S2K A;  5FY0 A;  1D0G A;  3IMN A;  4NMI A;  1RUG 3;  4JTN A;  5F5I A;  4D7Y A;  3B5L B;  4CEW B;  2R1B A;  5FZ6 A;  4DY3 A;  3BI3 A;  1F4H A;  2DVA A;  2B8M A;  2E31 A;  3W5N A;  1ULD A;  2XQR A;  2FMD A;  2ZEX A;  1RUD 1;  1GP6 A;  5HCB A;  5LZ6 A;  5CFD B;  4XCB A;  5FCC A;  2HH9 A;  4NRO A;  3ZXD A;  4MGQ A;  2CU5 A;  5JPM B;  1ASJ 1;  2W1U A;  1PX3 A;  2XVK A;  3UET A;  4FXG B;  2A1X A;  1AUY A;  4NRP A;  3A7Q A;  3KM5 A;  2VGD A;  3OYW A;  5G04 L;  1NG0 A;  3Q8F A;  1HQN A;  4TLF A;  1BYH A;  1RUE 1;  4AF9 A;  1SMV A;  2D40 A;  4HET A;  3INA A;  2VTX J;  5E16 A;  3D6E A;  5FYZ A;  5D1I A;  4BJ0 A;  2WUH A;  4E2S A;  3UV9 A;  1NXM A;  2JWP A;  4KBB A;  1BBT 2;  2Q8E A;  3VBH A;  3WZ1 A;  3ZFF C;  1LOA A;  1LOC A;  5IJR A;  1NUK A;  3CBN A;  2PA7 A;  4V1P A;  3T0B A;  4CDX C;  5LWB A;  3POY A;  1E5S A;  3C7F A;  2FDF A;  2ZPX A;  3KQ4 B;  4H3W A;  2O14 A;  4CE8 A;  4F83 A;  3NV2 A;  5C4W C;  3N9Q A;  1WW5 A;  4XDQ A;  3NKT A;  1W8O A;  4AHZ A;  4CDX B;  1J58 A;  4S2G A;  5FPU A;  2FBE A;  3P3N A;  3SCF A;  1YC6 1;  4ZU5 A;  5A1F A;  4NPL A;  1F9K A;  4XPV A;  2HBT A;  1O5L A;  4C1W A;  3CNA A;  1Y9M A;  1JYI A;  1BK1 A;  1C8M 3;  5EJ3 A;  1EPW A;  3NJV A;  1N3O A;  2WQ4 A;  3THP A;  2DU0 A;  3J7M A;  4P5Y A;  4H2A A;  2GZW A;  1R08 2;  2BJS A;  1LHO A;  4OHW A;  4UXA A;  4MH0 E;  2OT7 A;  4W65 A;  4JHZ A;  1PVC 2;  1DDL A;  2GDF A;  4Y33 A;  1V6M A;  4DO0 A;  4H55 A;  3X29 B;  5FZL A;  2BDR A;  1MS1 A;  4R4Z A;  5K0U B;  2P37 A;  2GC2 A;  2HKX A;  3VBS B;  1HRI 3;  2EF6 A;  2XJU A;  5FZ9 A;  2Y6K A;  3LA7 A;  4AE2 A;  1PGL 2;  4DEV A;  1TE1 B;  4K6B A;  5K8S A;  1DU3 D;  3MLL A;  4XDP A;  3PUQ A;  5LB6 A;  2MHF A;  3NVC A;  1XE8 A;  3L9J T;  4P9X A;  4XCA A;  3CZU A;  3OTF A;  2I74 A;  4R9A A;  4W8J A;  2YV8 A;  3WW1 A;  4AG4 A;  1I1E A;  3BGA A;  4QT6 A;  4HK8 A;  3T2P A;  2G9F A;  3AYA A;  1AYN 2;  4JVA A;  5D8A C;  2DCT A;  4LBN A;  3WCS A;  3BIW E;  1KJL A;  4OUM A;  4PQ9 A;  3O1U A;  2W94 A;  2ZAC A;  2ZEY A;  3BU7 A;  5GJ6 A;  4BQ3 A;  4QQL A;  3CEW A;  1RL3 A;  3OGR A;  1JZ6 A;  2VCA A;  3A0N A;  4XFG A;  3W21 A;  3LOI A;  1X8M A;  3VBF C;  4BQW A;  4ITC A;  4YM0 A;  1R08 1;  3GBW A;  1C57 A;  2BPA 2;  2PHT A;  4A7K A;  4TZD A;  4R4X A;  3FJS A;  2WNU B;  3QAC A;  5JI9 A;  3RJR A;  3SH3 A;  5IVJ A;  3CJI B;  5I0T A;  5JI7 A;  4HVR A;  2L9L A;  5C3S A;  4XAA A;  1GUI A;  4GB3 3;  4XFA A;  2ENR A;  2VXR A;  1UXZ A;  2ZGS A;  3O0W A;  4R8H A;  4BLJ A;  5FZC A;  3WHT A;  1YRZ A;  2VUD A;  4K21 A;  1LJ7 A;  2WT0 A;  4YYO A;  5J3U A;  1SDW A;  4GAL A;  2F6B A;  1BHG A;  2WNU A;  3QH6 A;  1XB9 A;  4IE6 A;  1UOG A;  1VJ2 A;  4LBM A;  4YW3 A;  4OI1 A;  4I3P A;  4PT6 A;  2GND A;  2JIC A;  1R09 3;  2VNO A;  2VZ1 A;  4MGY E;  1OD3 A;  4GA9 A;  4N9I A;  3PVN A;  3ZYG A;  1ODN A;  5EJ1 B;  2QQI A;  1QQP 1;  4DXS A;  2G9Z A;  2VR4 A;  2ADD A;  2D6K A;  5FY4 A;  2QNK A;  4AFM A;  1T6B X;  4DUW A;  5CFC B;  3FUO A;  4MUV A;  2CGP A;  1EAH 2;  3IMM A;  4YW4 A;  3E5U A;  1TNF A;  5DZE A;  1W9F A;  2Q1Z B;  3FE5 A;  1C8M 1;  1OQE A;  4UW3 A;  3N4M A;  1FYU A;  2W47 A;  3BOP A;  4IE0 A;  5FRE A;  2HEY F;  5JXG A;  5CZK A;  5L9V A;  5C9A A;  1T6G C;  5FUN A;  2WO2 A;  2GC0 A;  2RJK A;  1UZY A;  2FMY A;  1ULG A;  2JD9 A;  2VCC A;  2WWS A;  3OBT A;  2DV9 A;  3L2Y A;  3RFR A;  1LU1 A;  2KA3 A;  4Z07 A;  4CVU A;  2XBO 3;  3ENR A;  2GC3 A;  2OXB A;  4AFB A;  2VBB A;  4OI0 A;  5EIY B;  2CGO A;  1PVC 3;  2CY6 A;  2JG9 A;  3FFZ A;  3KT7 A;  1U12 A;  2R16 A;  4Y1V A;  4Q1R A;  4G4F A;  2CV6 A;  4CXY A;  1Q8O A;  5FY8 A;  3DXT A;  3ZFE C;  4EJR A;  2DFB A;  1Y4W A;  3CHX A;  3K46 A;  1WGP A;  4LLF A;  4OMD A;  3SH5 A;  4AAX A;  4Z92 B;  2VQA A;  3NV1 A;  4I2O A;  3MIE A;  2D97 A;  1KEX A;  1QQP 2;  4MX3 A;  4PJY A;  4WM7 A;  3ILN A;  3WXP A;  1SPP A;  1F5F A;  5KBF A;  3BVC A;  2HWC 2;  4DXZ A;  3M3E A;  2ETE A;  2HWF 1;  1CAW A;  1RUD 3;  1EUU A;  1LEM A;  1G6N A;  2YU2 A;  4OYU A;  1BMV 2;  2V73 A;  1RIR A;  3RZL A;  1OF4 A;  4P5H A;  1DGL A;  4CEW C;  1Q8V A;  4RA0 A;  3E5X A;  1REF A;  4I02 A;  4QDQ A;  3FBM A;  1Y7B A;  1W99 A;  4IV3 A;  5FY1 A;  4GJZ A;  4XE9 A;  1UPI A;  3H3L A;  2YYO A;  4D0Q A;  2J1U A;  2A6Z A;  2ZHL A;  4I0A A;  2JDH A;  1DCS A;  4Z2W A;  1SBD A;  3I2I A;  2RR1 2;  4PBP A;  3RDI A;  1XU2 A;  4TTG A;  1H8T B;  2KXL A;  1XND A;  2XGX A;  4WM7 C;  4C0B A;  1UKG A;  2C6S A;  1VMJ A;  2WS9 3;  4XDO A;  1W04 A;  5C70 A;  3U0Z A;  1VBE 2;  2BWC A;  2K2S A;  4YG0 A;  2RHP A;  3TN9 2;  2IWG B;  1RMU 3;  1IPS A;  3QOP A;  4N9H A;  2Q8C A;  4LMF A;  1UCX A;  2NLR A;  1FV3 A;  1QEX A;  1KFU L;  3NV3 A;  2EIB A;  2VW0 A;  4MET A;  3C7H A;  3MIH A;  2ZGL A;  1DFQ A;  2E6V A;  5GLV A;  1QY4 A;  3A23 A;  4K3U A;  2GP3 A;  3K2O A;  1IHM A;  2WR9 A;  5DAP A;  4JV4 A;  1PO1 1;  3BYW A;  3JD7 1;  2W39 A;  2V09 A;  3DUI A;  3WF4 A;  3DPR C;  3P3P A;  2PXJ A;  3AP6 A;  1HJF A;  1UY0 A;  1RUI 3;  3ZFE B;  1WCQ A;  2DF7 A;  1J3P A;  1K45 A;  5C9A C;  5IAX A;  4ZZ8 A;  1RUI 1;  1PK6 C;  3I3Q A;  2RM2 2;  4P9W A;  1UU4 A;  1ZBA 1;  1YQ2 A;  2D98 A;  3UYJ A;  3IDC B;  5FMO L;  4M01 A;  4MGT A;  2P3I A;  1C5H A;  1DQ6 A;  4GXL A;  5KHI A;  2R06 3;  1WLC A;  4QGM A;  3T2T A;  4HZF A;  4YZ4 A;  3VBU B;  5IUQ A;  3WF2 A;  1IKQ A;  4IV3 C;  1W6N B;  5A3M A;  1UMI A;  3VGI A;  4QHZ A;  1JZ7 A;  3H8R A;  1H2K A;  4GMP 3;  1AR6 3;  1DYP A;  1OD5 A;  4Q0V A;  4QPG C;  5FBZ A;  2NQY A;  2ZTN A;  4CRQ A;  3LSD A;  1O4T A;  2EAK A;  4Y1U A;  5FDB A;  3N7J A;  1X33 A;  5JDB A;  1JXN A;  1Z0H A;  2YC0 A;  3Q8E A;  2VH9 A;  4YNI A;  3OOX A;  5JWP A;  4IEX A;  4Y1X A;  1YFX A;  3JB8 A;  2XKO A;  4WZF A;  4ASL A;  4RS5 C;  5C8C C;  4N43 A;  1ND3 B;  3KVB A;  3NNM A;  5FJK A;  4W6X A;  2C4X A;  3WF3 A;  4L9B A;  4CZS A;  1QNW A;  5FY9 A;  5I93 A;  4LO7 A;  1TME 3;  3NQH A;  5F9T A;  3IDA A;  2P3J A;  2XJQ A;  2GC1 A;  1UY1 A;  3O1S A;  3JQW A;  1H0B A;  1SHW B;  2JKB A;  3VV1 A;  3I3D A;  2P17 A;  3ILF A;  2ADE A;  1RGS A;  2C24 A;  1T2X A;  3I3B A;  2BBA A;  4UW6 A;  1SBE A;  3I59 A;  5D8A A;  5JR2 A;  1BMV 1;  2VNG A;  4IW3 A;  3SC7 X;  3O1M A;  4JGY B;  4PI2 A;  1AR9 3;  5GLW A;  3OY8 A;  3CIH A;  4LEJ A;  1PIV 3;  2IXK A;  3I54 A;  4LBK A;  4WVZ A;  5GZD A;  5IVE A;  2WZR 3;  1F35 A;  3KV9 A;  3AFK A;  5LA9 A;  2WQ8 A;  3V0B A;  4DOU A;  4LBJ A;  1HRI 2;  2LS6 A;  1WME A;  1POV 3;  2DDU A;  5GZE A;  1FNY A;  2JJ6 A;  4BQ4 A;  2WAB A;  4M3C E;  1MEC 3;  3V0A A;  3N7K A;  3ZM8 A;  3U10 A;  4P9G A;  4QQH A;  3POF A;  4KH9 A;  1HN1 A;  1VBE 1;  4NE9 A;  1J59 A;  2VBD A;  4GMP 0;  1N3Q A;  3KT4 A;  2PLV 1;  4AI2 A;  2WNU C;  1Q3E A;  1AX1 A;  1DQ4 A;  3LSE A;  5JOX A;  4ZPI A;  3LEG A;  1AR9 1;  2B45 X;  1COV 2;  3S57 A;  2BOJ A;  3SKV A;  2I45 A;  1OUS A;  3FUQ A;  3O7O A;  4M3C B;  1QJY 1;  2WWU A;  3C7E A;  3V56 A;  3OB8 A;  5G05 L;  5C4W B;  2GP5 A;  4MOA A;  3OBZ A;  2DVD A;  2O1Q A;  1US2 A;  4JC1 A;  5K9Y A;  1DHK B;  2BTV C;  2IZW A;  1YQC A;  4QPY A;  2Y6H A;  2Y8K A;  3NNL A;  3ZSM A;  1EV1 2;  5L36 A;  4LHS A;  1UOF A;  2BVB A;  3ZDV A;  5A1L A;  1PGW 1;  3VBF A;  4CDX A;  4OHX A;  2SBA A;  2V4V A;  4XUP A;  1GLH A;  2R07 1;  4AW7 A;  2VZO A;  3P6B A;  3PUA A;  3WNK A;  4Q26 A;  5FOJ B;  1L3J A;  2WKK A;  1CZV A;  1WW7 A;  2W1W A;  4XUT A;  1YCI A;  1XOY A;  2QCS B;  5C5U A;  3H3U A;  3VD5 A;  1G86 A;  1HV1 A;  3M70 A;  5BNN A;  1V6I A;  4FTS A;  3POJ A;  5T3N A;  1I3H A;  3O1V A;  3KV4 A;  3AZZ A;  2ARA A;  2FZ2 A;  3WP3 A;  4AVA A;  4XHX A;  5FZB A;  1QWR A;  3PTR B;  1EAH 3;  1HIX A;  1GP5 A;  1X7N A;  2QVS B;  4P14 A;  5DG1 A;  5I8S A;  3T1L A;  4AEJ A;  4ES9 A;  4L92 A;  1GMM A;  1V00 A;  2JX9 A;  5J48 A;  4HOO A;  5FP3 A;  5CBL A;  5GZC A;  2HWE 1;  4C0H A;  5FAX A;  5J09 A;  1QJY 2;  1FOD 2;  5GKA C;  2JKX A;  1UF2 C;  4A7Y A;  4Y4Y A;  2UU8 A;  4A3X A;  4AI3 A;  3GCX A;  5KC5 A;  3PME A;  3AMQ A;  1CJP A;  2ZX1 A;  3PVB B;  4UF0 A;  5I91 A;  1C3H A;  2BZD A;  1EAH 1;  1MPX A;  1WW4 A;  3ZN5 A;  2GSY A;  2MEV 1;  1ZBE 1;  2W68 A;  1J1L A;  1W0O A;  3C7G A;  1WKY A;  4B7K A;  3NW4 A;  3WNN A;  4Y5Z 0;  1AXK A;  4A7Z A;  1QHD A;  1NAE A;  4IGP A;  2GH2 A;  3JXS A;  1W28 A;  1PO1 3;  2E7Q A;  4K9S A;  1AR6 2;  2DYC A;  3VBF B;  3KGL A;  5F1R A;  3C2U A;  4G3Y C;  4BPZ A;  2JDN A;  1PK6 A;  4E4D X;  2BUK A;  1MVE A;  2PHR A;  3JB4 C;  1PM7 A;  1LNS A;  2JDM A;  2QQJ A;  1JZ8 A;  1DP0 A;  1ONA A;  4RR3 C;  2PHF A;  2RS5 2;  5C4W A;  5TSW A;  4E8C A;  3LGR A;  4CCM A;  4R52 A;  3N9P A;  2UY8 A;  1UYZ A;  1WD4 A;  3LE0 A;  5FPA A;  3WUC A;  4Q0S A;  3VBH C;  2RS3 2;  2P34 A;  4OCT A;  3OGJ A;  1W8F A;  4MGI E;  1DGW X;  1W2T A;  3SH4 A;  1ZRE A;  4OFG A;  1REE A;  1ACC A;  4EN9 B;  2OKX A;  4DIQ A;  2XJP A;  4Y20 B;  4XF4 A;  4LQR A;  2WYS A;  4NAO A;  5F2W A;  2MEV 2;  2AAC A;  2DUO A;  4QB1 A;  5AFE A;  1QOT A;  4Q4W 1;  5L19 A;  3N9O A;  3B69 A;  2WYF A;  3KF5 A;  3D8C A;  4LUK A;  1YYN A;  2EXH A;  4QKD A;  4PIY A;  1WLT A;  3FN9 A;  2BGO A;  3HNY M;  2J22 A;  3GAL A;  4UFI A;  5SV5 A;  1AL2 1;  2VEC A;  1HQL A;  1BXH A;  1K5M B;  1MZ5 A;  1YHF A;  1S0I A;  3POB A;  3AKP A;  1B35 C;  3IN9 A;  2DWR A;  5LRS A;  4FPK A;  3LKJ A;  1ZNP A;  2ZHK A;  1W3V A;  1AYM 3;  1RUJ 3;  2OQ7 A;  2WZ8 A;  2KM2 A;  3MFC A;  1ULE A;  1DYK A;  3NAP B;  1VBA 2;  5FZA A;  3WG4 A;  3AL5 A;  4E2Q A;  4EE2 A;  4B8E A;  1U0A A;  3VBO B;  1VBE 3;  1OT5 A;  1XBF A;  3MO4 A;  3N7L A;  1DZQ A;  1OUR A;  3I2G A;  4W6W A;  1PVC 1;  3IPV B;  3LEK A;  3WQ1 A;  4YVW B;  4BXF A;  3KWV A;  5FYV A;  4YVS C;  3RI8 A;  4KWK A;  5LA0 A;  4YWA A;  3I2O A;  2RDN A;  3NNJ A;  4CP9 A;  1O6U A;  1Y43 B;  2WDB A;  3ZMN A;  3MUY 1;  4UFJ A;  2QQK A;  2FDI A;  2HJI A;  1GYK A;  3AKR A;  4P9L A;  4BM8 A;  3S5A A;  2PYT A;  3HT1 A;  1W3X A;  1RVF 3;  2JDU A;  1PGL 1;  2WZR 1;  1PO1 2;  4MGS A;  5FZO A;  1YNA A;  4UBH A;  3DN7 A;  2OZ6 A;  1AHS A;  4AED C;  2HWE 2;  4GWI A;  1B35 A;  3VDD C;  4CYD A;  3USU B;  2Q1F A;  4NII A;  3HWJ A;  3VKN A;  4CCO A;  5A70 A;  2WFP A;  4BWO A;  1ENS A;  1KD7 A;  1LGB A;  1LTE A;  3JBG 1;  4FPJ A;  5CNA A;  3VLB B;  4OHY A;  1JTZ X;  4BQ5 A;  2PAE A;  1JOB A;  2XR4 A;  3Q9O A;  4RGK A;  5FYM A;  2IVJ A;  2G4I A;  3OG2 A;  5HXM A;  1OXC A;  3VB9 A;  4LA2 A;  4XAE A;  5I0S A;  3BTX A;  4GKX A;  3ZXF A;  3WOG A;  2YUE A;  4NAM A;  4RL7 A;  1ZRC A;  1RUC 1;  1A78 A;  5FY5 A;  2VQT A;  1W8H A;  5ABJ B;  2WII B;  4J1W A;  1NE4 A;  1PO2 1;  2WFF 3;  3DPR A;  3ITQ A;  5HV0 A;  1KRI A;  1OA4 A;  4KNC A;  1J1T A;  2TNF A;  1YLL A;  1TME 2;  1VPH A;  4JGZ B;  1UPS A;  5T5L A;  3MDP A;  2RS5 1;  4BOW A;  5A3N A;  5LA1 A;  2ZS6 B;  1V9U 3;  4GMP 1;  1ZBE 3;  4XJA A;  1DQ2 A;  1LB2 A;  1YJL A;  1N1T A;  1CX1 A;  3VBR A;  2PHU A;  4IEV A;  1ST8 A;  2V5Y A;  2Q1M A;  2QKD A;  1GWM A;  3NAP C;  5CYY A;  4FTE A;  3AL6 A;  4GWJ A;  2HBU A;  1RTV A;  4DFS A;  2W87 A;  2VTF A;  4BQ2 A;  2ZGM A;  2LUW A;  2ZHM A;  3SMH A;  5D8A B;  3FC0 A;  4TYS A;  1ZX5 A;  2FD8 A;  3VL9 A;  3PVO A;  4P02 B;  3JBG 2;  5C3R A;  4X8P A;  3CKH A;  1TNR A;  3NNG A;  5FIX A;  1SDD B;  3GCW A;  4CP2 A;  1GZT A;  1YO8 A;  1H8T A;  2ZGR A;  1I5P A;  4LO4 B;  4XUN A;  2CWS A;  1NX9 A;  1HB1 A;  4XIO A;  3B93 A;  4PF1 A;  2WS9 1;  3RMY A;  1S4C A;  4FAH A;  5LK7 B;  2JEC A;  2VU9 A;  5A32 B;  2QZ2 A;  2A71 A;  2YY1 A;  1FXZ A;  3OYW B;  3JD7 3;  4LKF A;  1GQP A;  2E33 A;  3WDX A;  3I97 A;  4IE7 A;  3PNA A;  4CXW A;  1K5M C;  3UGF A;  3RPQ A;  2HWC 3;  3OUJ A;  5IK4 A;  2Y0O A;  1TZO A;  4GZ9 A;  2RVA A;  4JDN A;  4BIS A;  5LY1 A;  1A8M A;  2VTX A;  1TQ5 A;  3HJR A;  4AVT A;  2E53 A;  1AR8 2;  1J84 A;  4IEP A;  1UNB A;  3T1M A;  1I6X A;  3UT0 A;  4HVQ A;  3QLQ A;  3JQX A;  2BFU S;  1W39 A;  4Q1P A;  1W8T A;  1NLS A;  4GH4 B;  4IET A;  5A7O A;  5A7S A;  4CDQ B;  2R7E B;  4OQ9 A;  2YG0 A;  4HON A;  1F8V A;  1K5J A;  1Y3T A;  4BIO A;  5FQ0 B;  5FPB A;  2CNA A;  1VRB A;  2WL1 A;  4EN8 B;  4RFR B;  1D4V B;  5CAD A;  4LBQ A;  2KR2 A;  2DUP A;  4AYU A;  3M8L A;  1W6P B;  3CO2 A;  3FLP A;  4UW5 A;  3U4X A;  1UMH A;  1LCL A;  4WVW A;  3ZSJ A;  2FCT A;  1D4M 2;  1X36 A;  4Y5T A;  2VQU A;  3MW4 A;  3OEA A;  4HXC A;  4RR3 A;  5CU1 A;  1GZC A;  4RR3 B;  4AL9 A;  1JYV A;  3HPN A;  4D6S A;  2VMC A;  1S55 A;  1W9Y A;  1VBC 3;  3IKW A;  3UL2 A;  2YBS A;  3EB7 A;  4IEY A;  5DZF A;  4UYB A;  3EXU A;  2Y26 A;  2G19 A;  3MIC A;  3WDV A;  5FOB B;  1W6P A;  1BZW A;  2Z5W A;  3N9M A;  1WMX A;  4UI9 L;  1FPN 2;  5E6H A;  4LR4 A;  2FDH A;  3POS A;  3OPT A;  4YM3 A;  4GAZ A;  2JDY A;  3SIS A;  1C8M 2;  2A6X A;  3CJX A;  1W6O A;  3HNB M;  4YW5 A;  5FMB A;  4AGV A;  2JXA A;  5C8W A;  5F7U A;  1GOH A;  2R30 A;  2RS1 1;  3LIH A;  4QU1 A;  3WF1 A;  3AP7 A;  3ZFF A;  1LHV A;  4JCK A;  2OQ6 A;  5C8C B;  1VB4 A;  3O1T A;  3FBY A;  1L7R A;  3WP4 A;  3S5Q A;  3W5M A;  3RZZ A;  2XDV A;  1DG6 A;  1UZ0 A;  4URA A;  3MZH A;  3ACG A;  3UNP A;  5C3P A;  3CZJ A;  2D3R A;  2ZHN A;  2A3W A;  1PHM A;  1LAJ A;  4QPG B;  3K3N A;  1PNF A;  1G9A A;  1WWY A;  1V0A A;  4YAR A;  4LNV A;  1VRH 3;  2HLE A;  2ZOE B;  2BV4 A;  1KFX L;  4PLN A;  3WW3 A;  1GZW A;  2WAO A;  1WMD A;  4V2V A;  3WUD A;  2QTW B;  4QPI B;  1NLR A;  4LO8 A;  1AL0 G;  1WW6 A;  3ZYF A;  2DU1 A;  5JMC A;  1COV 3;  4MXW B;  2BP6 A;  3KCY A;  2E7A A;  3IAQ A;  2RM2 3;  4NHM A;  5BNN C;  1MS9 A;  1Q43 A;  3ILR A;  5LRR A;  4S2F A;  4CDW C;  2OUH A;  4XBQ A;  4I0B A;  5CG8 A;  1K3I A;  4IES A;  2CTV A;  2W2I A;  1KGY A;  4YGB A;  2R04 3;  4WZC A;  1AYN 3;  1UU6 A;  3ME2 A;  4YGC A;  1OQ1 A;  1AX0 A;  1AR6 1;  1CGP A;  2GNM A;  3UGG A;  3VHN A;  1LEN A;  5JSR A;  3ZFG A;  2AH2 A;  2GU9 A;  2OS2 A;  2W9X A;  4LBQ D;  4YVS B;  2PHX A;  5J1X A;  1CAV B;  4LBO A;  2K46 A;  3OJB A;  4N43 C;  3U11 A;  2JIJ A;  4RS5 A;  3S30 A;  3IZO A;  4LK7 A;  4P9I A;  4FOY A;  5A80 A;  2ZGQ A;  1R1A 1;  3O0V A;  4N7I A;  2D6N A;  1NA1 B;  2RE9 A;  5A7N A;  2UYB A;  5FYS A;  4HMZ A;  3MF9 A;  3BPS A;  3W9A A;  2Q8D A;  3ZXE A;  2OII A;  3ZVX A;  3K4A A;  4M4P A;  3HD8 B;  2FCU A;  2YMZ A;  2BQP A;  1ULC A;  3IWZ A;  3W20 A;  1R08 3;  3VZO A;  3OY8 B;  5IWF A;  1CPM A;  1BBT 3;  1S2B A;  2BWA A;  3KV6 A;  1JYT A;  2LRO A;  4FOW A;  4D69 A;  1SLI A;  3DF0 A;  1KJR A;  2X10 A;  3KMH A;  3H7Y A;  4CP9 B;  1SBF A;  1JZ3 A;  5LBF A;  4NWW A;  3WQB A;  1QJZ A;  4LO5 B;  5FZ3 A;  1TVG A;  1WBL A;  1ZM1 A;  5DMY A;  5I8Y A;  4QX1 A;  2DBN A;  1ZVF A;  3ECQ A;  1RMU 1;  3J7N A;  3JBG 3;  3ZSK A;  4J6G A;  3VBO A;  3AXE A;  3BOD A;  3I59 B;  3SKJ E;  3WDY A;  1VBB 2;  5IAV A;  4NIA A;  3S6P A;  5F3C A;  4O7X A;  3MFA A;  5FXZ A;  3HAG A;  3RMX A;  4QPI A;  4XFH A;  1FPN 3;  3OGS A;  4PF5 A;  1HRI 1;  3TNP B;  1CAV A;  2EIG A;  2DTY A;  3D4K A;  5FR3 A;  1M4W A;  5LBC A;  5IK8 A;  4MXW A;  2GH8 A;  5FYI A;  1XE7 A;  4ES8 A;  3FHI B;  1GBG A;  1I5Z A;  5E1R A;  3TB0 A;  3D3A A;  4FPC A;  1CIY A;  5K4L A;  1GZW B;  3UJO A;  5KXC A;  1DLC A;  4BB3 A;  5DUU A;  3SIT A;  3U37 A;  4D6R A;  2B9V A;  2PFW A;  2Z4F A;  3IT8 A;  3VKO A;  4AHY A;  2QQM A;  4YGE A;  4HAN A;  2BGP A;  2ET1 A;  5C8C A;  3LCP A;  3OPZ A;  1B09 A;  3R4S A;  2RV9 A;  2HWF 3;  2Y6L A;  2GAU A;  4FPL A;  4ZS3 A;  5JIA A;  1MR5 A;  1QXR A;  3J4U H;  3MIB A;  1FT9 A;  4F8A A;  3HQR A;  1IZ3 A;  3ST7 A;  2ZGO A;  2TUN A;  2TBV A;  3UK9 A;  1S0G A;  4A2U A;  5A33 A;  4FFF A;  1K5M A;  4YGD A;  1PZ8 A;  2E7T A;  4N53 A;  2VOX A;  1UX7 A;  3ZKY A;  1SCS A;  2ZGT A;  1OI6 A;  3ZYI B;  3MBW A;  4OUE A;  1E5H A;  2QQO A;  5T54 A;  3RYP A;  1KDM A;  1Z7S 3;  5B2G B;  4QXK A;  4MLO A;  1GV9 A;  4X6R B;  4QGL A;  3TEW A;  4YW1 A;  4AQ2 A;  4LOS A;  1VAL A;  4UFM A;  1UWW A;  1YI7 A;  3VD3 A;  4E4H A;  1Z7S 1;  1US3 A;  4Z1V A;  3FLR A;  1SFP A;  1RUG 1;  1AR7 3;  1OA3 A;  2IVI B;  5FYH A;  3FLT A;  1BCX A;  2QQL A;  3U1X A;  4AK3 A;  3KT1 A;  3PMS A;  1W6Q B;  5A1A A;  3EJK A;  3ES1 A;  4HLT A;  1RIN A;  2J42 A;  2K9Z A;  3BTA A;  2ARC A;  3W59 A;  4ERO A;  3AYE A;  4X8N A;  1M06 G;  1QKQ A;  3ZFE A;  4AVV A;  1GQH A;  1ZRD A;  1Y9Q A;  3H1M A;  4AVB A;  1EP0 A;  3FZ3 A;  1ASJ 2;  1AJK A;  1F2N A;  3HQU A;  4PDW B;  1VBA 3;  4O9E A;  4U2A A;  3E6C C;  1DQ5 A;  5F37 A;  1FOD 1;  4EN7 B;  4M0N A;  3K75 B;  3ZR6 A;  2A73 B;  3ZPO A;  5F3I A;  5A6X A;  5F2S A;  4A4A A;  3FX3 A;  1ODM A;  2VUL A;  4ISR A;  3K77 A;  4XQ4 A;  3VDD B;  3WIN E;  1Q8Q A;  3USS A;  3ABZ A;  5A32 A;  4D6Q A;  3T09 A;  1C4R A;  1H2N A;  1X8E A;  3TN9 3;  5JCT A;  3POE A;  1W8Z A;  3WG3 A;  4FO9 A;  1UIK A;  3KCX A;  1YWK A;  4P9J A;  4XAB A;  4E27 A;  1IGO A;  5FXV A;  5CB7 A;  4CTE A;  3N7M A;  4XZP A;  1C5I A;  2UY9 A;  3EBR A;  1RUG 2;  1H6Y A;  1RUN A;  5LAT A;  4QXB A;  5JXH A;  3MIF A;  2ZMK A;  4JX0 A;  2C0Z A;  2P3K A;  4H7M A;  1W90 A;  5FZE A;  2ZX3 A;  1HQW A;  4CCE A;  4CUA A;  5CKM A;  2VAU A;  4NUB A;  4CEW A;  2WQZ C;  1GAN A;  1EV1 1;  2QQN A;  2X5I B;  5BNP A;  5FZ7 A;  4DPN A;  1URX A;  1OVS A;  2RMU 1;  5FLH A;  3WHU A;  3N9N A;  5BNQ A;  2CDP A;  4Y26 A;  4KU7 A;  3MUZ 1;  5IVV A;  1O8P A;  5T5J A;  4CCK A;  3KS7 A;  3GHN A;  2ILM A;  4ZHN A;  3RSJ A;  4UBG A;  2IFW A;  3OF1 A;  3R05 A;  3DEC A;  3TEY A;  4S2H A;  2ZZJ A;  2ARX A;  3MIG A;  4CU6 A;  3OUH A;  3ORJ A;  2YC2 A;  4P08 A;  3SLI A;  3RVH A;  3KSC A;  2DCY A;  1H4G A;  4LUM A;  4HFS A;  4RQP C;  5L7O B;  5DG2 A;  2VZQ A;  4B3N A;  4Y3O A;  1IOA A;  3O12 A;  5K0U C;  5FPX A;  1QJF A;  2EIE A;  4ASK A;  3TNQ A;  3KHC A;  5EQU A;  5JR7 B;  2CYF A;  3PTY A;  4Q4X 3;  2YBK A;  3WNM A;  1WLW A;  4JAA A;  1BQP A;  3NJY A;  4Q5O A;  1PX4 A;  2ZAH A;  4CP1 A;  1AYN 1;  3AJZ A;  4FOQ A;  4ZU7 A;  2DCZ A;  3M7A A;  1HXS 1;  5FK8 A;  4DS0 A;  2XG3 A;  3V0B B;  4QDS A;  4IQP A;  3AKS A;  1SFY A;  2C9K A;  2EIC A;  5A3L A;  2QQP A;  2P5B A;  1GIC A;  1UKR A;  4XZU G;  3A22 A;  2PEL A;  2XQX A;  1DQ1 A;  1D7P M;  5FV3 A;  2A7A A;  2Q8O A;  1SG3 A;  2VUC A;  2VY0 A;  4HSJ A;  2ZA9 A;  2H0V A;  4ZON A;  3GNE A;  1U5I A;  4NR1 A;  4WM8 C;  1QMJ A;  3M3O A;  3TWI A;  5L7O C;  1IKP A;  2BVV A;  2DVB A;  2WZE A;  5FP9 A;  3ZDS A;  1JMU B;  4EZH A;  3Q8C A;  3PVE A;  5IVY A;  4BME A;  3THD A;  1MEC 1;  4BQX A;  1H1A A;  5A3O A;  1FMD 1;  1NKG A;  2NM1 A;  4AR2 A;  3BB6 A;  4E4S A;  4AZZ A;  3WG2 A;  1UYX A;  5JZG A;  3AZV A;  4KU8 A;  5FZO B;  4A45 A;  3VKM A;  3ZOI A;  1JUH A;  2W3J A;  4BIF A;  1RUE 3;  2ZKL A;  4Q29 A;  2VL4 A;  3D82 A;  4XXP A;  3NRU A;  4AVC A;  4RGG A;  2RDS A;  1WCS A;  3AMN A;  4I30 A;  3ZN6 B;  1HXS 2;  1QGL A;  2WLQ A;  1QXJ A;  5F5C A;  1CQ9 A;  5D21 A;  3LZZ A;  2DCK A;  1AZD A;  1OUX A;  1O4Y A;  4NHY A;  1GFF 2;  1LUL A;  2FCV A;  3LA3 A;  2PHL A;  3HBK A;  4Y4R A;  3KB5 A;  4KGG A;  3KLS A;  1Q56 A;  2W1S A;  3MV1 1;  3NJX A;  4CDQ C;  3MHZ A;  2CGN A;  4QXH A;  3VHR A;  1JYX A;  4LIV A;  4Q4W 3;  1LOD A;  1PNG A;  1X9P A;  2JE7 A;  3POI A;  4RQP B;  4EWA A;  1F15 A;  2O0O A;  5IFP A;  2J1S A;  1SQ4 A;  3FHQ A;  3B9C A;  1L7L A;  3LA2 A;  3H7J A;  3B7M A;  1GWL A;  2YB7 A;  1WZX A;  3OSD A;  1UU5 A;  2QJV A;  3ACF A;  4QD2 A;  5DXD A;  1S0E A;  2X05 A;  4LKS A;  4NIH A;  1JI6 A;  4XVH A;  3THC A;  4IND A;  1LOB A;  3HR9 A;  4QX7 A;  3ZXL A;  4CU9 A;  4HN1 A;  2WSU A;  4QHB A;  1S0D A;  1JU3 A;  4S2D A;  3VKL A;  2HWD 1;  5APA A;  2C9A A;  2IXI A;  4PLM A;  2PMW B;  2QQV A;  4BMB A;  1DZT A;  2JDZ A;  1DF0 A;  1NLQ A;  2Z69 A;  1NCQ C;  2WLP A;  5JOW A;  4X6Q B;  2A3X A;  2HWC 1;  1UQX A;  4CDU C;  1YI9 A;  1W0N A;  5KR7 A;  1FNZ A;  3GHM A;  5AVA A;  3NJZ A;  1GU3 A;  1WA4 A;  1GNY A;  1CX4 A;  1O91 A;  1LEC A;  2UWC A;  5A3U A;  5J7M A;  5EYY A;  3QD6 A;  3ZX7 A;  3WT3 A;  2YRO A;  1ULO A;  4NPM A;  3SHR A;  5KHG A;  2A6V A;  1MS4 A;  5BNO A;  4E9K A;  1C1L A;  2EXK A;  4KBZ A;  5BNP B;  4TWT A;  1KIT A;  1ZA4 A;  2WN3 A;  5LAS A;  4LOR A;  1BLZ A;  4GD4 A;  2F4L A;  1VRH 2;  3IB3 A;  4WVV A;  1D4M 3;  2OZJ A;  1Q8S A;  4ORF A;  1CON A;  2VCB A;  4NVP A;  4PBO A;  2Z79 A;  5CFD A;  4ATE A;  4COV A;  1QIQ A;  2VOT A;  4BYY A;  3GZT B;  3R4D B;  1OKQ A;  4BXS V;  5FZM A;  1JH5 A;  4L97 A;  3J8F 1;  3AVS A;  4COU A;  5CIR A;  1JZ2 A;  3RZG A;  4CPB A;  3LDK A;  3WVJ A;  5IYY A;  3ZFF B;  3ZYH A;  4L2N A;  2H6B A;  2QQU A;  2XJS A;  2XVG A;  3J8F 3;  4IEW A;  3B3Q E;  4WM7 B;  2RDQ A;  3GJA A;  5H9R A;  4AFD A;  3CL1 A;  1OSG A;  2JDA A;  3ZN4 A;  2ZZQ A;  2VQ0 A;  3RZK A;  4IV3 B;  2D93 A;  4WBB A;  3BCW A;  2VOV A;  4B7E A;  5F3E A;  3LQC A;  1DQ0 A;  4NHL A;  3NL1 A;  4Z2A A;  3HN3 A;  2YPD A;  5F6L B;  4JHT A;  4LTA A;  5CKQ A;  2GAL A;  1POQ A;  2B5H A;  1MS3 A;  1UX6 A;  2C26 A;  2F17 A;  2VMG A;  4CU7 A;  3T2Q A;  4Y24 A;  1UW8 A;  4Q4Y 3;  5EXO A;  2WN2 A;  1U5Y A;  1QF3 A;  1VBB 3;  3M4F A;  5JIU A;  3TN9 1;  2QDN A;  2ZAB A;  2P6C A;  4G9S B;  4JDM A;  4ZXK A;  5C9A B;  1OOP B;  3VN4 A;  3MF6 A;  2RS1 2;  4CCD A;  3HOB A;  2K0G A;  1W6M A;  1BEV 2;  5AVP A;  1W6Q A;  1RC6 A;  2WNO A;  4IV1 B;  2IFR A;  3AYC A;  3VBU C;  1RVF 1;  2VME A;  4W50 A;  4Y1Z A;  5CFC A;  1ULP A;  3C7O A;  4MGZ E;  1A34 A;  1DBN A;  2HEW F;  4B1M A;  5T5O A;  4UF0 B;  1NA1 C;  3ACL A;  2ZGK A;  2DUR A;  2QZ3 A;  4GWM A;  3HEI A;  4K1Y A;  4AHX A;  4XBN A;  5F39 A;  1WUV A;  2HWD 2;  4JQR A;  4LUL A;  3PJQ A;  1MZF A;  4LLO A;  1VAM A;  3PIG A;  4LIT A;  5IVF A;  4OZX A;  3AZY A;  3VDC A;  3USU A;  1ZRI A;  1Z78 A;  3LFI A;  5DZG A;  3N3H A;  3P5B A;  2GMM A;  4XF0 A;  4GJY A;  5GAL A;  1GP4 A;  4D94 A;  4Y22 A;  1KQR A;  1OQD A;  5JXI A;  1PGS A;  2ZCW A;  3H50 A;  3KHB A;  3LAG A;  5FPZ A;  5HCA A;  4GUL A;  2B7Y A;  3PHM A;  3WF0 A;  1XYP A;  4W4Z A;  1FMD 3;  2JDP A;  1NCR C;  1IQA A;  5JAX A;  5L9B A;  3BOW A;  2XPJ A;  3E1F 1;  5C7G A;  2YDE A;  4HKO A;  1BEV 1;  2R04 2;  4Q8L A;  4QKN A;  3SCH A;  5ACA 1;  3LDR A;  4GB3 2;  1LOG A;  5AC9 1;  2ET7 A;  3WX5 A;  3IAP A;  2AC1 A;  3DKQ A;  4L0P A;  4L99 A;  4A41 A;  4YZ5 A;  4IGO A;  5DUV A;  1XSR A;  1W2A X;  3I3E A;  1PIV 1;  4MGK E;  3WLU A;  2JG8 C;  5FMD A;  4JGY C;  4LHN A;  1ND3 A;  3ALQ A;  1CJD A;  3KZ4 C;  4MXV A;  1S0J A;  5GLZ A;  4C1X A;  4NWV A;  4OUS A;  1UZW A;  1AR7 2;  4D7S A;  3AFG A;  4NID A;  3JU9 A;  4CEY C;  5HXV A;  3KV5 A;  4FOV A;  1RB8 G;  5ABJ A;  1HDK A;  3VZN A;  5LEJ A;  4Y5S A;  1XYO A;  4AI9 A;  1U5X A;  4V2W A;  2YXS A;  1NT0 A;  2H0B A;  3AKT A;  3NMB A;  2OPK A;  2WJS A;  4YG6 A;  1F5J A;  4IV1 C;  4Q0Q A;  4YM2 A;  2QDR A;  2WO1 A;  3H1W A;  3SNM A;  3AX4 A;  4QXC A;  3I4I A;  3WP6 A;  1KDK A;  3W58 A;  2QUO A;  3J7L A;  1TMF 1;  4CXX A;  1UN1 A;  1V9U 2;  4QKB A;  3NKG A;  4XMA A;  5DN2 A;  1CZS A;  5B4X A;  3FL7 A;  5FY7 A;  2ZGN A;  4QB6 A;  3EMR A;  1Y9G A;  2J1V A;  4AI1 A;  2PTM A;  4CCC A;  2XWB B;  1SLC A;  3GZE A;  1N1S A;  2QE3 A;  3KGZ A;  4XFF A;  5FK7 A;  5C33 A;  5JUV A;  4QX2 A;  2B39 A;  1PMJ X;  3GM8 A;  5I0D A;  3NST A;  1A8D A;  3HQX A;  3Q8A A;  4K8F A;  4DEQ A;  2NN8 A;  3GJB A;  4URT A;  4Y1Y A;  2G9G A;  2WIN B;  2O8Q A;  1JS9 A;  1RUF 2;  1BKZ A;  5HBA A;  3PUH A;  1V6N A;  4DMI A;  1BBT 1;  1Q5O A;  5FMC A;  2BRT A;  1DIW A;  2HWE 3;  2PLV 2;  3BN6 A;  4J1X A;  1NCQ B;  4RN5 A;  3LD8 A;  1PK6 B;  1OVP A;  3E6B A;  1MAC A;  4I01 A;  2RDR A;  1FI2 A;  2D43 A;  1ZBA 3;  5EFU A;  3ZXJ A;  4LBQ B;  1RVF 2;  3MYX A;  2AEN A;  1GKB A;  3VD7 A;  3HT2 A;  1G9F A;  2JG9 C;  1I9R A;  1F4A A;  3CJI C;  5M0T A;  3U75 A;  3MPB A;  3LWC A;  4B4Q A;  3I2H A;  4JKM A;  3PUR A;  4KMQ A;  4LA3 A;  1PMH X;  4WM8 A;  2VO5 A;  5FBJ A;  3ZMO A;  3A21 A;  2A70 A;  2IXJ A;  3VBS C;  1SFN A;  1DGR A;  4XOG A;  3T0A A;  5LBB A;  3SXW A;  3NNF A; 
#chains in the Genus database with same CATH homology
 5D2A A;  2JDP A;  4CE8 A;  2BP6 A;  1OVS A;  5A3O A;  4AOC A;  2JDY A;  5HCH A;  5A70 A;  1UQX A;  2WRA A;  2JDN A;  1OUR A;  5A6Z A;  2WR9 A;  3ZDV A;  1OVP A;  5A6Y A;  1UZV A;  2JDM A;  2XR4 A;  2JDH A;  1OXC A;  2BOI A;  2VUC A;  4UT5 A;  2CHH A;  2VUD A;  2JDU A;  5A6Q A;  2BV4 A;  3DCQ A;  1W8H A;  1OUX A;  2BOJ A;  2JDK A;  2VNV A;  1GZT A;  1W8F A;  5A6X A;  1OUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...