5HCHA

X-ray structure of a lectin-bound dna duplex containing an unnatural phenanthrenyl pair
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fucose-binding lectin
molecule tags Sugar binding protein
source organism Pseudomonas aeruginosa
publication title X-ray structure of a lectin-bound DNA duplex containing an unnatural phenanthrenyl pair.
pubmed doi rcsb
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5hchA00
1OVPA 1OURA 4AOCA 2JDMA 2BV4A 1OUSA 1OUXA 2JDUA 2CHHA 2JDNA 2JDYA 5A6ZA 2VUDA 1W8FA 5A6YA 2JDHA 2WR9A 1OXCA 2VUCA 3DCQA 1GZTA 1OVSA 3ZDVA 4CE8A 2JDPA 2JDKA 2VNVA 1UQXA 2BOIA 4UT5A 2BP6A 5A70A 2XR4A 5A3OA 5D2AA 5A6XA 5A6QA 2BOJA 1UZVA 2WRAA 5HCHA 1W8HA
chains in the Genus database with same CATH superfamily
3GYDA 1V6OA 4LO4B 3ZXAC 1NCRB 4LOSA 4QX5A 1RUF3 3ACHA 1XSRA 3BN6A 3SH3A 5T5PA 3MF9A 3VBFC 3RPQA 2ZMKA 3AP9A 2R072 1A8MA 3CJIC 4HPKA 4N90A 1F31A 2CU5A 3OYWB 4BLJA 1QJU2 3RNSA 2UY8A 2YPDA 1UOGA 4GALA 1GNZA 4OFGA 5CU1A 4QM9A 2WZR3 4YARA 2HH9A 1VMFA 3VLBB 2JKXA 4Z82A 3B01A 1YRZA 1AR63 4P5HA 3WT3A 5FYVA 4QGMA 4QQ2A 1QH7A 3UETA 5FRAA 5GLTA 3WW1A 1QF3A 4DY3A 2WO3A 2W1UA 2DVBA 5GLZA 4OI2A 4LEJA 1D4M1 2HYXA 2D6OX 1JYWA 1PIV2 2AZ5A 3VKOA 1CONA 4K8RB 4DUXA 1ODNA 2D40A 5HV0A 4KG8A 4KBZA 3CLPA 3KF5A 1NOVA 3AKPA 4QB1A 3WDYA 3TOJA 4KWJA 4QX1A 2B9UA 3V64A 3RZJA 1W04A 1G7YA 1W8ZA 1TNFA 4GXLA 5B2GB 2XB6C 4A6OA 5BXXA 3THCA 3RI9A 1XYOA 2VUJA 2DCTA 3ILFA 3H3LA 2BOIA 3J8F3 5FO8B 3MZHA 2ZACA 5EJZB 3LEGA 2RDSA 3GF6A 3ZFGC 4Z2WA 1AR72 5LZ6A 2ZGUA 3D8CA 1QJX2 4UYBA 4WVZA 4OQ9A 3O0XA 4EV0A 4XQWA 1NQDA 3V0BB 2A7AA 2ET1A 4XUTA 5FY0A 5I8SA 2WAOA 4A7KA 4DXTA 1KQRA 4TLFA 3TAYA 1AYM1 3UL2A 1KITA 3FBYA 4JDNA 1U12A 3URFA 3RZKA 3ILNA 2OPWA 1D4M2 4OHWA 3I97A 5D8AC 3WF2A 5CFDC 4HBNA 1Z78A 2UWCA 3M70A 5A3PA 5BNPA 1W2UA 3PUAA 5BNNA 1RUI2 3AMQA 2C4XA 2DYCA 3RJ2X 1SLTA 5JZGC 4CVUA 5DAQA 3AB0A 3IDCB 5KWRA 1A3KA 1F4HA 3ZIWA 3P1IA 3K4DA 3N7MA 3WDUA 2G4IA 4MOAA 2VOXA 3M3QA 1IG0A 5J96B 1IS4A 1LULA 3BPZA 1YYNA 4HKOA 2XDVA 4EWEA 2JD4A 1RMU1 3WNMA 2WR9A 3ZFGB 3WNLA 3NJXA 4D69A 5KXBA 2ARAA 5L7OA 4HG6B 4FT8A 4QGNA 4BU2A 3GM8A 4Y5TA 5IYYA 1XBFA 2IXHA 2I45A 2RS13 1AX1A 2YZ4A 1XC6A 4LULA 5T52A 3M7AA 1YQ6A 1QNWA 2P6HA 3WUDA 1DHKB 5GJ6A 5LASA 3PVOA 1WCSA 1N3QA 2Y6KA 1RJ7A 1UU5A 4MGZE 2RM21 2H0VA 5IVCA 3KM5A 2WA3A 2R0HA 1APNA 3OBTA 5FYYA 1C3HA 3VBSA 1S0BA 1A34A 4YM2A 3VL8A 5HI0A 4RFRB 1LHUA 5J37A 1NZIA 2WABA 4YYOA 1QJEA 3N9PA 2K46A 2WA4A 3A21A 4XACA 4QPGA 4FOWA 2W3JA 4JDMA 4Q29A 1O3TA 3IAPA 4IEWA 3VDDA 1HRV2 2B45X 3PDQA 3LFMA 1LB2A 5JI7A 1DCSA 5C8CB 1PX3A 1FAYA 4J1WA 4XAEA 3I3QA 4BK4A 5C8WA 4RQPB 4X8NA 1SLIA 3CZUA 1K42A 1U5IA 1MPXA 5IVEA 4PF5A 4PDWC 5CKMA 3D3AA 4ZHNA 3KT1A 4IEZA 3VBFB 4HONA 1JZ6A 1W8TA 4QX0A 1WZXA 5DUUA 2C9KA 4AHZA 1OUXA 1HLCA 5KHIA 2XOMA 3WHTA 1LEMA 4AGVA 2I74A 2B4KA 5I8TA 4P9LA 1Y7BA 3KB5A 4DUWA 5J1XA 2O8QA 3M3CA 5FZMA 1QXPA 4WV8A 4XIOA 3PU3A 1PVXA 4LTAA 1B35A 4D6RA 2ZGRA 4EZHA 2JG9C 1IGOA 2QQLA 2QZ2A 1NUKA 3Q8CA 1RHI3 4M0NA 4QQHA 5FYIA 5ABJA 4CUCA 5DZFA 3AZWA 4LK6A 1H9WA 3ZFEA 3LGRA 3LKJA 3ZYIB 3ZYRA 3OG2A 4KBBA 2G9ZA 4QAWA 4ES9A 3MUY1 5C33A 2PMWB 4CDWC 3ZFFB 1Z7S2 4B4QA 2VTXJ 2WYSA 2C5DA 2CDOA 3AKTA 3MF6A 5M0TA 1OQDA 1VLNA 4XQDA 1HRV3 4QHZA 1MS5A 3ACIA 1BVP1 4WM7C 3MV01 4PDWB 4WVWA 2EAKA 2V4VA 3TNPB 5FTTC 1MVQA 4TN7A 4HFSA 5B4XA 1XE8A 2RS52 4X8PA 2OUJA 3D0JA 4M3CA 1JTZX 1YJKA 5IVFA 4XF9A 1ENQA 5JZGB 5J98B 1MS1A 1C8M1 1SQ4A 2R041 5DDJ3 4XJWA 5JXGA 2CGNA 4GB33 4GD4A 1RUJ1 1V6LA 3RWKX 5L19A 1J83A 2W87A 5F2SA 3WDWA 4CDQC 1AUYA 1W2OA 1QJU3 2BYVE 3MBWA 2V09A 3BKZA 1YCIA 5LW9A 1CR7A 1W8HA 1PO11 4LLFA 3GJAA 3POSA 1F4AA 5C7GA 5CB7A 2HEVF 1CX1A 4KWLA 5GZFA 1OQ1A 5BNQA 4B7KA 3VBHB 2HYKA 3ES4A 1LODA 5C8CC 5A3WA 2XBO3 4Q0UA 5J3UA 1DGLA 4Q2FA 1FV2A 2VTXA 3NAPA 3GDBA 4A6SA 2A6VA 5LWBA 2JDKA 3D4KA 4NIDA 5FPAA 2XUMA 1UD1A 2J1VA 3KHBA 2HWE2 2AEYA 1AYM3 3Q8EA 3AYCA 1ODMA 3HQXA 1NCQA 1PGW1 1ASJ2 5IT6A 3EO6A 5DN2A 1RUI3 2WWUA 2E6VA 2GC3A 2D98A 4YW3A 1OUSA 2VZUA 1RUJ2 4IE5A 5FOBB 3H9AA 3M1HA 4I09A 4UF0B 3RGBA 4S2FA 2VMHA 2FD8A 2V5DA 5FV3A 1OOPA 1AJOA 4Y1YA 1JW6A 2W1SA 2ZEWA 4QX3A 5DPNA 2E33A 1UKRA 1W6QB 3H0OA 4OLLA 1HXS2 2VNVA 3FHAA 1KDKA 4FPCA 1R081 4D6SA 4QQPA 2JKBA 1UAIA 1F5JA 5HCAA 4XQ4A 5FBZA 3TNQA 4DIQA 2BNOA 3BUCA 2BOJA 4HVRA 4OMDA 3CBNA 2BWCA 3GCWA 3DPRC 2J1EA 4LLOA 5JIAA 3J9SA 2OQ6A 3UK9A 4HVQA 2QQMA 5IAVA 4DRRA 4E4ZA 5F3GA 4Y33A 4QKFA 3AK0A 1ASJ1 1S2BA 2E51A 4IGQA 2DUQA 2A70A 2VZSA 4IEXA 1JBCA 3NV1A 3OUHA 2W46A 5FY9A 3FHIB 4CCLA 1PMIA 5IWFA 1XYPA 4LPLA 3ROUA 5BNPB 4UAPA 3ACLA 3E5XA 3VZMA 5I0TA 2WNUB 3GGLA 1HXS3 2OPKA 1N1VA 1ULFA 5FZGA 1H1MA 5L73A 5C3RA 4COUA 1WGPA 2C26A 2BP6A 3S7EA 3S5QA 3IDBB 2WNVA 3LAGA 1CIWA 1AR62 2D97A 2GC0A 2ADEA 3AZZA 5FYCA 3S6PA 4F3JA 1Y9GA 2CTVA 4N43B 2VAUA 4ORFA 4BA6A 2WLPA 3WP5A 4K6BA 3HNMA 3I2FA 3T4VA 5T5JA 1TME3 3WLUA 1PK6C 1DGRA 5CYYA 1H8TB 1SHWB 1LKNA 3MIDA 4Q4W3 4UI9L 4XEZA 5FP4A 4JTOA 4QPIC 1EUUA 5JR7B 5BNOB 4H55A 2BWAA 4IL7A 5LBCA 5IAXA 1UPIA 2VNOA 4GWNA 3KCXA 4LKEA 4RQPA 1H2NA 1OBNA 3HNYM 4LKDA 3SITA 4LBLA 2LS6A 1Q43A 3ZXLA 1R1A3 1J58A 3OCPA 3JB4C 5GALA 1LNSA 4AEDC 1O6UA 3AMNA 3PIGA 4XVHA 3UKNA 1YI7A 2VOVA 3WCSA 1F8VA 1H2MA 1ZZ6A 3QLQA 4Q4V2 5FP3A 3WNXA 1PHMA 3N36A 4QWNA 4CCEA 4CXXA 4S2GA 4R9AA 2H6CA 3WNOA 1PO22 2OW4A 3QD6A 5A6QA 2WIIB 4XJ8A 2YC0A 1UYPA 1H9PA 1SACA 1S55A 1UXZA 4LMFA 4ZS2A 1XRUA 3UGGA 4OZOA 3TEWA 2V72A 3ZIXA 2XLFA 3JU9A 3MV11 3RRDA 1ENXA 1XJAA 1N1TA 3ACGA 4EN9B 2FZ1A 1AF9A 3OGJA 1CD3G 5HCFA 1I5PA 3NQHA 1IG3A 2VU9A 4NO4A 3RJRA 2WQ8A 3VD7A 4QKBA 5C70A 3W59A 1FYUA 2F4LA 5AC91 3VKNA 2YFUA 2WFPA 1HV1A 2DU1A 4BXSV 4DS0A 4EN6B 1D7PM 1SG3A 4YVSC 3LOBA 3TEYA 1A8DA 5C9AC 3JBG3 4R9CA 5I0SA 1O3RA 1RHI2 2HWB1 3OSDA 1NCRA 3THDA 4CCDA 4BQYA 2TBVA 2AYHA 3T2OA 3W5NA 2JXAA 3N7KA 2P3KA 1V0AA 3MW4A 2NN8A 2PHDA 4UFIA 4Z8BA 4AEKA 1KRIA 4XILA 4DY5A 4QDSA 3SH5A 3Q8FA 1OFNA 2A6YA 1WMFA 4LIUA 2W08A 5JVVA 2O1QA 2XJPA 1SLCA 4CUBA 1O5LA 2XGXA 4QX8A 4K20A 3VBOA 2EF6A 1WD4A 2ES3A 3WDXA 3E6CC 3AZVA 3H7JA 2W0XA 3U1XA 3P3NA 4AI8A 5KBFA 1YJLA 4QGLA 5C4WA 4D94A 2PHLA 3AYAA 1F9KA 3J7MA 1DQ5A 2Z42A 4GULA 3VV1A 3B9CA 5D21A 1W6PB 3JBG2 2RJLA 5EJ1B 2DWRA 3LSEA 1X8MA 1UU4A 5GZDA 4CCKA 1OH4A 3CDZB 4CTEA 3WF3A 1UZ0A 3H3ZA 1WA6X 1VBE3 3POJA 2CGPA 4YVWC 5GZEA 1NE6A 1DGRN 1RUE3 2VOKA 2YY1A 4FTEA 5FCCA 2VBDA 2UYBA 4KU8A 4XHXA 4C8DA 5A70A 1KFXL 3KT7A 2Q0AA 1XNAA 2XMLA 4RR3B 1PMHX 3RG0A 3IT8A 5J36A 5KHKA 2Q4SA 4YGBA 5FXVA 4D7SA 2C0ZA 3POGA 3JXSA 3SMHA 4RYDA 5JCTA 5JLVA 3E5UA 2AC1A 2YBPA 2VW0A 5GLWA 1TMF1 3M3OA 2ZHMA 5FPUA 1MQTC 3CMGA 4B4RA 2B5HA 2D7FA 2P1BA 4AI1A 3O12A 2JIJA 4JGYB 1W6MB 4UXAA 3B5LB 1GQGA 4Q4Y3 3AP6A 1KD7A 2QQNA 3IIAA 2IXJA 4IW3A 4CEWB 3B3QE 4MVTA 3LEMA 2JE8A 1CIYA 4IV1B 1UY1A 3INAA 1E5SA 5FO9B 5A32A 4UBHA 2VJXA 3B69A 4FPKA 3GCXA 1SPPB 3IPVA 5CKQA 3N7LA 4PDWA 2Y60A 3DEMA 2ZKNA 3MYXA 2OUHA 2VG9A 2ATFA 4GAZA 1CVNA 1D2SA 1MZEA 4KNCA 4PF1A 1Z0HA 3V0AB 3BTZA 1V6JA 2VOWA 4NRQA 3KV4A 1AL21 4C0HA 1QEXA 4RR3C 1WMDA 4OYUA 3FZ3A 4LA2A 1OT5A 1QNYA 2VVDA 2KM2A 5FZ0A 5G04L 3WNPA 5FXZA 4CA9A 5ABJB 5IATA 1VAVA 2DCJA 2L9LA 1RVF3 2YC2A 2PHTA 3LD8A 4QMAA 1S0DA 1DYKA 1Q8SA 5A3MA 4DZGA 2VCMA 4GQ7A 1UMHA 3VB9A 5L36A 1UIJA 1UZVA 3BOWA 3VDBA 3MIFA 5IHRA 1JN2P 2A73B 3AL5A 4XPVA 1GBGA 1RYYA 2R071 4NN0A 4BISA 1QJX3 1XSQA 5GKAC 5KHJA 4OI4A 2RV9A 1QJU1 4HT1T 1H4GA 3BODA 4AXOA 2WWSA 4YW2A 3RYPA 4AR2A 5A6YA 1X36A 1TNRA 1RUJ3 4Z07A 3ZPYA 2DCKA 1VALA 2RMU3 4RA0A 3LFIA 3IDAA 1JU4A 1ZZBA 4AW7A 3VDDB 4Z92B 1CZTA 1UOJA 2HEYF 2ZX3A 3BU0A 2A5ZA 1C8M3 4UT5A 3N9OA 2ZAHA 1CAVA 1KS4A 3I59A 1MZ6A 4FFHA 3ZXJA 5JSPA 3CL1A 5IVVA 1JHNA 1UY2A 1OF4A 2PLV1 2X10A 4YGEA 3ETQA 3A0KA 2Z69A 3VBUA 4BE3A 3OPTA 1VAMA 2MEV3 1DQ4A 2IVJA 4IETA 1POV0 4MGSA 4AFDA 3E1F1 3LF7A 2D6PA 3KZ4C 2QKDA 1X82A 3S7IA 4XFBA 4XJZA 3BIEA 4EQVA 5FQ0A 3UYJA 4NWWA 1LESA 2JIGA 3OY8B 3RMYA 3PUHA 2VVEA 2VZTA 2VZVA 5IVJA 3ZDVA 4EWAA 1H30A 2HBUA 4FPLA 2ZX1A 5K0UB 1ND2C 5IW0A 3LSDA 1AR71 4JGYA 1GQHA 2JDAA 3O1PA 1DF0A 1BZWA 3KS7A 2XJVA 4HN1A 1VBC1 2VCBA 1C57A 1JMUB 4FQZA 1NCQC 1VB4A 2YGLA 1XOYA 5FPVA 5A1AA 1CPNA 1EPWA 4CUGA 5A80A 4AQTA 1YQ8A 5DUVA 2VMDA 3AP4A 3ZXKA 1PGSA 1BMV1 4RHV1 4GWMA 1UIKA 3S30A 2VULA 3K48A 2ORZA 2XQRA 4QPYA 2LM3A 4H14A 4PIYA 2PLV2 3JCIA 2PXJA 4N9HA 5LBBA 1GNHA 2ZZJA 4DXRA 5DMYA 2C6SA 1JYTA 2XJUA 2Y26A 4IGPA 1QOSA 1LOCA 4GZ9A 3ZPOA 2WFF2 1HB2A 3ZYHA 1BEV1 1FATA 4R8HA 2RDQA 3MHZA 2NYYA 4EROA 3AM2A 3E6BA 4QPIB 3GALA 4NHYA 4K3UA 4JKKA 4P5YA 4PJYA 4XUOA 1X9TA 3AL6A 5FZBA 4KGGA 2RM23 2E32A 4XJ9A 3DECA 1SMVA 1O4TA 2GP3A 3LIHA 1BHGA 1X50A 5FY8A 2Q1FA 4N7UA 1OH3A 5ACA2 1CWPA 1I1EA 4CDXC 2BVBA 4L0PA 5DAPA 2VQAA 1UZZA 2W94A 2EXHA 3HT2A 3FFQA 3WV6A 2P17A 2KR2A 4K40A 1XPWA 4HLTA 4YZ2A 2DDUA 4RHV2 1W3VA 3D82A 3IAQA 1ZBA2 1MS9A 5FWEA 1NY72 3H1WA 1OA3A 2Y6GA 2HJIA 3P3PA 5EV7A 5LA0A 3AMMA 4CU8A 1AYN3 3LQCA 4MHRA 1JH5A 1EYBA 4ZU5A 5T3NA 4OUSA 4AVVA 3WP4A 2W5FA 5A6XA 2RM22 5LY1A 2ZX2A 4OQ8A 4KI5M 2P3YA 2ZEXA 1W0NA 4AL9A 2WFF1 1PK6B 3MLKA 4P9IA 3JUUA 4GIQA 3RYKA 2KA3A 5FZEA 1ND3C 1AL0G 5H9RA 5FMOS 5KXCA 5GZCA 1BJQA 3POWA 1NLQA 4LBMA 4QPWA 1ALYA 2Q30A 1US3A 1UW8A 4DUVA 2EIGA 4F83A 4RQPC 2FMDA 2JB8A 4NRPA 4TSVA 3OGVA 5FZ9A 3I2IA 1PZ9A 3UGFA 1JZ8A 3GHMA 1UQXA 2R043 3PVEA 5FFOC 3WXPA 3RVHA 1RUC3 1O4YA 2VY0A 2GNBA 3G7DA 1QU0A 1COV3 1R093 4AFBA 5C5UA 1RUD1 2HKXA 3V65A 2J7MA 2XVLA 1HB4A 4AHXA 4WM7B 2WLQA 3KV5A 5HCHA 4XFHA 1X8EA 1NY71 2DBIA 2DVFA 3AVSA 4L9BA 3MDPA 2QQPA 1UY4A 1ULPA 1V00A 1POV3 4PLMA 4ZZ5A 1BKZA 4K21A 1VBC3 3OGGA 1IS5A 1S0JA 3FC0A 2GAUA 4IDZA 2K0GA 3I59B 5FLHA 4MH0E 3ZDSA 2GMPA 4YZ3A 1PVC2 2DUOA 2OQ7A 3VHRA 4DRVA 1MZ5A 3DL3A 4YRDA 2CV6A 2XJQA 5C71A 4P14A 1ND2A 2WQZC 5DG2A 5FZ7A 1W9TA 1JI6A 1NA1B 2GMMA 4EWDA 4BH9A 5APAA 4B4PA 3ZVXA 1D4M3 1RUH3 1HX6A 3DKWA 1NQJA 1RVF2 3E97A 5FK8A 1VBB3 2FDGA 5C4WB 2WT0A 2LALA 4LQRA 2N7GA 2VNGA 1ACCA 4XW3A 1YI9A 2JDHA 2Z4FA 4JAAA 4Y26A 4NUBA 3TN92 3W20A 4Q0PA 1UX7A 4OUMA 5FYSA 4PLNA 3KGLA 4A7ZA 5FUPA 5FZCA 5JOWA 1G9CA 4HXCA 3D5OA 4OHVA 3T1LA 4AFAA 4INDA 4IGOA 1XNKA 4JHTA 1AR81 1BBT2 2BFUL 1PO12 2YGMA 1QJX1 2D6NA 5F1RA 1UY0A 1BK1A 1O5UA 3ATGA 2GP5A 1GWMA 4GJZA 1SLAA 2W47A 4A3ZA 3HIFA 3NV4A 1VMHA 4QDRA 4GKXA 3N4MA 1GZCA 4IERA 1MS0A 4AAXA 5CBLA 1S2KA 3FBMA 5JMCA 5L9VA 5EZWA 2Y38A 3SKJE 1DQ6A 5A7QA 1AYM2 1AZDA 3LE0A 3MIEA 1RVF1 1S0EA 4XDPA 4GB32 5FP7A 3WHUA 4AVCA 1TZOA 3AYEA 3OPWA 2C1FA 1GP5A 4HKWA 1UWWA 4JGZA 3RDIA 2A1XA 4FPYA 4PLOA 4Q1RA 3ZR5A 1ND3B 1RXGA 1BBT3 5KR7A 3TN93 5FUIA 1DIWA 1D2QA 1MEC3 3MLJA 1VBB1 4M4RA 1MQTB 2ADDA 3LPGA 4XMIA 4YFZA 3J8F2 4EZ4A 2RR13 4KWUA 3QH6A 4R4XA 4L92A 1ZRFA 3CJXA 3H1YA 4Y4YA 2VGDA 1TVGA 5CFCC 3C7OA 4W6YA 1ZRRA 1RMU2 2GSYA 3IIIA 4DEVA 1A6CA 2WO1A 4FOQA 5E6HA 3NO8A 4P08A 1E57A 1ULEA 3POYA 3KQRA 1AR91 1CJDA 2VMIA 3OF1A 4Y5Z0 1JZ3A 3W58A 3NVCA 4BCUA 3RWNA 2VBBA 2GC1A 3C8XA 4M0HA 2A6ZA 2BDRA 4HK9A 3HEIA 1GR3A 2V5YA 5D2AA 5HPOA 5IK4A 1XB9A 3VDAA 1SDDB 4C90A 2VE1A 4NROA 1WW7A 2H0BA 2EAAA 3FN9A 1JUIA 2GNMA 4CPBD 1VRH2 5JXHA 1UCXA 4Y5SA 4QKDA 3B9IA 5EWSA 3C7EA 4O9GA 4IEOA 4AHYA 4Q0VA 1R091 4R52A 3T09A 5FYZA 3J8F1 1XU2A 2XL7A 5I0RA 4AYUA 1IPKA 1MVEA 4CEWC 4CE8A 4NVPA 1CJPA 4RS5C 1UMZA 4YLZA 3ZFEC 1B35C 1DZQA 3O1SA 5IK8A 3GBFA 4EN8B 3M3EA 5C6CA 3MEPA 1XQNA 3HN3A 2RJ2A 3ON7A 4LK7A 4YNIA 2RS53 1LGBA 5E88A 2DBNA 2XQXA 1RUC2 1IPJA 4N53A 5CG9A 4IE6A 2Y0OA 1VP6A 3VBRA 3WQ7A 3POEA 2ZMLA 2FCVA 2W91A 4BDVB 4XIKA 1QHDA 1UYZA 4WM7A 4KL1A 2B8MA 3J7NA 4MUVA 4NMIA 1POQA 2D3SA 1WUVA 3HVDA 3IMMA 3K4AA 1VMJA 4LIVA 1VJ2A 2W68A 1LECA 2ARCA 3FWEA 5A32B 3MIHA 5K0UC 3O1UA 3H8RA 1ZZCA 3WD5A 1VIWB 1CZSA 4BQ4A 4PQ9A 4LO8A 5LRRA 3ZSKA 3KF3A 1E5RA 1JYVA 3USSA 2VMFA 3WX5A 3WW4A 1KGYA 1UN1A 3NJYA 4H2AA 1W6MA 3OUIA 2HWF3 4AFCA 2WYFA 4SLIA 3O7OA 1NXMA 3QH7A 1OLQA 5J48A 1AYN2 5FQ0B 1OD3A 3O14A 4RFT0 2ZGSA 3U14A 3WUCA 1X9PA 2NZ9A 3NNFA 4QD2A 5T50A 3LIGA 4LOTA 2VMCA 4C1WA 4HZFA 1UZYA 2BGCA 3VBRB 2HWC2 2VO5A 5CAZA 1WW6A 2IXIA 1SBFA 4NHLA 4BIFA 1XNTA 2WL1A 2V4AA 2VMGA 4FP2A 4FAHA 4MXWB 2C9AA 1HRI2 1FI2A 1H4HA 3PL0A 4PQQA 1LCLA 2OA2A 4V2WA 2ARBA 4NE9A 4FFGA 4AZZA 3JD71 3OPZA 2VW1A 1GOFA 4NOTA 2TEPA 2DCZA 3BOPA 3N35A 3NAPB 4M00A 4XHBA 1VBE2 4NRMA 2QCSB 3BTXA 1EAH3 1X7NA 1OSGA 2DFBA 2WSUA 3E6DA 1J3QA 1RB8G 5DUWA 4FQ4A 1MACA 3RI8A 4QXCA 4MX3A 1F5FA 1NLSA 1LU2A 4AOCA 3C7GA 3ITQA 3T2QA 2G9FA 3AXEA 3K2OA 1BCXA 4N43A 2YFZA 4Z1VA 1O7FA 2XKOA 2ZEYA 4A44A 4X6QB 3WINE 5FBJA 1FOD2 2PHRA 1YIPA 4LBJA 5FPXA 3ACFA 2JECA 4FFIA 5FP8A 5FPLA 1W03A 1DLCA 3EHKA 4XFCA 1KDMA 5E1RA 2G1MA 2WNUA 4O7XA 3DXTA 1VBA3 1H1AA 1CAXB 1K12A 4LHSA 4R9DA 4XCAA 4ZS3A 5I93A 2IC1A 4DB5A 1YUDA 4KU7A 1MS4A 3JZVA 1HRI1 2PQSA 2NLRA 4GMP1 3HJRA 4PIXA 1DP0A 4I30A 3TEXA 1GOGA 2Q1ZB 2ZGKA 3PUQA 3I3MA 5A7OA 1TME1 1W8OA 3CO2A 4NHXA 5T5LA 2DUPA 3ZN5A 3J7LA 3LEIA 4GA9A 2MEV1 3ALQA 3I2HA 1QGLA 4LBNA 1ZYBA 4CP9B 3M8LA 5FZ1A 1MS8A 5A7NA 2YROA 2P2KA 3AVRA 5F5IA 4YZ1A 4YW5A 4A41A 2VC9A 2WZEA 3NKTA 2EICA 2W1WA 2HWD3 4FPGA 4WM8C 4IQPA 2ZA9A 3IMNA 1REDA 4I3GA 3ZFEB 1OD5A 3H1MA 1OHFA 2YMZA 1HXS1 5KXDA 1CQ9A 4XURA 4Q4X2 1O8SA 1VBA2 5L7OC 2O8OA 1DZTA 1U0AA 1CAWA 2VXRA 1GZWA 1FOD1 1W2NA 2VZ3A 4SBVA 4W6WA 2CYFA 4WVVA 3HOBA 1ZRIA 1J3PA 1E5IA 4QQOA 3ZN6B 1K3IA 1HW5A 3O1TA 1CPMA 1REFA 2JD9A 2O14A 3ZO0B 4XJAA 4NIIA 3I3DA 2ZGNA 1PK6A 2HBTA 2LRPA 5FYTA 4CU6A 4BK5A 4UFKA 4D3WA 1HN1A 3AC0A 3HBZA 4QX7A 1Q3EA 2DCYA 3T08A 4D7YA 1GYKA 2F6BA 3N7JA 3QCWA 1UX6A 4JV4A 1D4VB 2FCUA 2PFWA 2XBO2 3OD4A 3DGTA 4J25A 4BQ5A 1MR5A 4N9IA 1VRH3 1BQPA 3VKLA 3DXUA 5FZIA 2Q5TA 3HT1A 4AEDB 3HNBM 4FXKB 4WM8B 2WO2A 2DVDA 2ERFA 3B7MA 3UKVA 3CZJA 1AL23 5F6KA 1K5MC 4LKFA 5BNOA 2J1RA 4YG3A 3SHRA 4W6XA 1D0GA 1DG6A 2WDBA 3U75A 4HSLA 5CKNA 2X8KA 5JDBA 4Q4X1 4A42A 1WW4A 2JG8C 4OZXA 1PZ8A 4QU2A 3BB6A 5JXIA 5JWPA 1RUI1 4Q1PA 1BLZA 3BCWA 1FPN2 3IB3A 3LDKA 5FMDA 3PJYA 2Z5WA 5BYNA 2ZAAA 3NNLA 2NMNA 3WF4A 3HN1A 5LEJA 2PELA 3K75B 5F6LB 3OBRA 3UT0A 2QDNA 4IV1C 4K8FA 5LA2A 1LHOA 2QJVA 3M2MA 3PTYA 1QXRA 1S0CA 2G19A 1Q56A 2PQQA 5FKBA 4CCJA 5FZHA 2XBO1 3ZYJB 2DTWA 4M3CB 3ZFGA 2FZ2A 2R1DA 4Y20B 4HPKB 5F8PA 2OYZA 1N3OA 1PO21 2ZJCA 4Q27A 1SDWA 1V9U2 5SV8A 5C9AB 2UWAA 2E53A 2XUEA 3LZZA 3RS6A 4D7TA 2ZCWA 3POIA 3T30A 2ZGQA 3LOIA 4BZ4A 5C9AA 1JZ5A 4Q4Y2 3O1MA 1YEWA 2AEZA 3DPRB 4N43C 3AFGA 2WBKA 5JXJA 3KGZA 2FBEA 2VH9A 4AQ6A 4JTNA 3ZSLA 3VHOA 2VBPA 2VUCA 4Y1VA 4META 5AVAA 2Y6HA 4UFHA 1DZRA 2ZBJA 2VTFA 1KJLA 3KWVA 3A4UA 5F3IA 4ES8A 3VDDC 1FPN1 4COYA 2FDKA 3KVAA 2GN3A 2WC2A 2JG9B 3T1MA 1TE1B 1YFWA 4QXHA 1HJFA 1Y4WA 2RS32 2VXJA 4EJRA 5DUXA 5FYHA 2UU8A 4Y4RA 1IHMA 5C3OA 3WG1A 1W6NB 2VOTA 4P9GA 4NPRA 1FT9A 2WINB 2XH6A 3W5MA 1EV12 1RUE2 2DVGA 4XUPA 4YW1A 2R49A 3P6BA 3ZFFC 4GH4B 4I3PA 4ZONA 1YQ2A 1SFNA 4IEVA 4EYUA 2R7EB 1DGWX 1I5ZA 2JB4A 1RUOA 1I6XA 2WAAA 3LA3A 4Q8LA 1OVSA 1V6MA 5C8CA 2D3RA 4X6RB 2YBKA 2X5IA 1AR93 3RZZA 3KVBA 4F7ZA 4HOOA 4MGIE 3B02A 2A75A 4FCAA 3RZGA 1AXZA 5ISLA 3VDCA 1LGCA 2MNGA 1VBC2 2GH2A 4YM0A 3NV3A 4XF3A 3WQBA 2YB7A 5CZKA 3ZR6A 2GNDA 4W50A 1PM7A 4FOYA 3T0AA 2Y33A 2OZJA 1QJZA 3GJBA 4LO7A 5CFCB 3FUOA 2HWB3 2RR11 1QMJA 3JBG1 4ITCA 3WSOA 4DXZA 1PM4A 4KWKA 1MEC1 1Q8OA 2K9ZA 2WKKA 3WR0A 3H8XA 4YM1A 2BZDA 2WS92 2I07B 2IXKA 4NPLA 5DAXA 1Z7S1 2ET7A 3APBA 1EPZA 4TWTA 1HB1A 4FOVA 4K1ZA 4YZ4A 3ZSMA 3ZSJA 4PBPA 1GFF2 1JYCA 5AFEA 1JOBA 4XETA 2XVGA 3WF0A 4HMZA 2BPA2 4FPJA 2W39A 2EIEA 3FFZA 1HN0A 2UY9A 3NV2A 2YYOA 4QU1A 4CP9A 1HIXA 2R042 4CEYA 4XJUA 3C7FA 3MW2A 5LA1A 3K3NA 3VHPA 1WCDJ 1GICA 4BOWA 5ERLA 2B7YA 2PAKA 2BTVC 2MPFA 3CEWA 3ELNA 3ECQA 3POBA 1W39A 1TMF2 2JDNA 1NAEA 4OULA 2VUDA 4E2SA 1OPMA 2QFEA 3SCFA 5JI9A 3OTFA 1ZRCA 4CDWB 3BI3A 4OUEA 4DO0A 1AR83 1YO8A 4W8JA 4CDQB 5BNNB 2RS11 4AVSA 5ABJC 4CEWA 3U10A 4E4DX 2E31A 2VCAA 1I9RA 5L9BA 4M01A 1IQAA 1URXA 4WVMA 5IFTA 4RSUA 1GNYA 1QH6A 2WNVC 5F5CA 3V56A 4CDUC 3HQRA 5LCWL 1ZRDA 3NJVA 1N1YA 4E2QA 3NMBA 3U07A 5FZAA 2Z79A 4UBGA 4UFMA 3VBFA 2CNAA 5A3LA 2HWE1 4E4HA 1RITA 5F5QA 2DFCA 4I0AA 1NCQB 4AQSA 2B9VA 4FSJA 1N3PA 2VVFA 2NM1A 2P3IA 3WCRA 5E89A 2VQTA 1WCUA 2XKPA 3PMSA 2CWSA 2TUNA 4BWOA 3F2ZA 5DG1A 2XLAA 3DYMA 4WBBA 2XXZA 1PIV1 3HD8B 5KC6A 3AP7A 5L9RA 2FQPA 4LR4A 3VBHC 4ASLA 3NWKA 1G86A 1S0IA 1WA4A 1KEXA 3PUIA 2NMOA 2J1TA 4R9BA 1POV1 4V2VA 1DBNA 5EJ3A 1RGSA 1ZBE1 1OFSA 4NWVA 5FJHA 3OOXA 2R30A 1XE7A 4GWIA 4XXAA 1YWKA 2VD7A 4RL7A 5SV5A 1ZBE3 3VZJA 4I01A 1V6KA 2R1BA 2A3YA 3GNEA 1C28A 3H3UA 4RN5A 4UWDA 4CP2A 1GZWB 3U37A 1LOFA 4LITA 3CKHA 4XUNA 4YWAA 4BJ0A 3NRUA 4UFLA 1LU1A 2JJ6A 2VNRA 3I7DA 3WG3A 4XFFA 5IUQA 1O8PA 2XG3A 1FNZA 4FP3A 5EXOA 3OYWA 3TEZA 3SCHA 2P34A 4QX2A 2JE7A 3DN7A 1H2KA 3S5AA 2KD7A 1OQEA 3IDEA 3JB8A 1LHNA 2WFF3 3PVBB 3UESA 2OZ6A 5EHDA 1OOPC 3T0BA 1QQP1 5FZ4A 3TN91 4COWA 4Y20A 1AR61 2P4EA 5FLJA 5G05L 1OKOA 1PIV3 2D43A 3AP5A 4KH9A 1COV2 3ZXEA 4A7YA 1VAKA 5CFDA 1CAXA 3ETPA 3LDBA 2ORXA 2GC2A 1SFPA 1IPSA 2IUWA 5LK5A 4OHYA 3HR9A 1QY4A 3MFAA 5J09A 2D6MA 1GMMA 4XF0A 4YG6A 2J22A 1WMEA 1G8WA 1W9YA 1L7LA 5DXDA 2XJTA 1NX9A 4ZU4A 4LJHA 5FY4A 5JIUA 4ZXEA 1C1FA 2HWE3 2YBSA 5FJKA 4Q5OA 2ZMNA 5A1LA 2J42A 1RUF1 4MGYE 1GU3A 3MPBA 3WNNA 3AJYA 2W2IA 2XJSA 3LB9A 4BYYA 1RXFA 5IVYA 4BQ2A 1PO13 2F17A 1Y43B 1QJY3 2WQ4A 2J1UA 2WWJA 3CU7A 4S2HA 1C5IA 4W65A 4LE3A 4LBQA 3FLPA 5FK7A 4BQ3A 1YQ5A 4MLOA 4XZPA 4GB31 2BQPA 4WM8A 2FDJA 3BTYA 4IUGA 4YVWA 1F15A 5DDJ1 1Y9QA 5FIXA 5T54A 1ZA7A 2YC4A 4YGCA 1DU3D 1SBDA 1V6IA 1BEV2 5FXXA 3R6SA 3C2UA 4MXWA 2OS2A 5EQUA 1NT0A 4O65A 3G6JB 2PHXA 1VBB2 2D5HA 1OLME 1XNDA 3KCYA 4LKSA 4XFIA 1T2XA 2RHPA 1OLMA 1DLLA 4GH4A 4XMAA 2JDMA 4Y1XA 3VBSC 2SLIA 1HRV1 1RUH1 4AFMA 1LAJA 5T5OA 3CHXA 4CSWA 1DYPA 2GH8A 2R16A 2BERA 2DF7A 3ZN6A 4CXYA 3KHCA 3B93A 1NA1C 5ACA1 2BBAA 3VHNA 4QPGC 1AR73 1RUF2 1DQ1A 4FVVA 1HV0A 3PVNA 4U36A 1RHI1 2HWB2 5L7OB 3LA2A 1ZBA1 1JOPA 2QQOA 3WG2A 4FPOB 1Z7S3 5A7WB 2V73A 2BRTA 5FZKA 4ET7A 1VRBA 1LGNA 4P9WA 5GLVA 2OIIA 2A3XA 3NW4A 1GOHA 4DQAA 4NR1A 4UW5A 4LO6B 4NAOA 2FDHA 1PVC3 1JS9A 5E8AA 1SZBA 4PI0A 1JZ7A 3O1RA 1ZNPA 1JUHA 4AVAA 1LOGA 4ARXA 2PLV3 4TZDA 4MO3M 1OMIA 2QQKA 5DQ0A 3U78A 1ZM1A 4XTPA 4AVTA 5A3NA 2ILMA 1XXNA 2Y64A 4BB3A 4D8MA 3UJQA 5K8SA 4FTSA 1GLHA 5LEKA 2WZR2 1W6QA 3VD5A 4HSJA 4QDQA 5HCBA 4AGRA 5IK5A 1CN1A 1W8NA 3JQWA 3GZAA 1OOPB 3RYRA 1PNFA 1RUD2 3VBRC 3I8TA 3R4SA 4K1YA 4KQ7A 5EFUA 3S57A 1OVPA 3CJIB 1S1AA 2R073 3SISA 3H7YA 4O61A 4EN0A 3V0BA 1FNYA 3ST7A 3ZOIA 4FXGB 4BXFA 1LR5A 2GZWA 5HV4A 4FPHA 2QQWA 2B42B 2X09A 4C1XA 3I3BA 5EYYA 3BU7A 1VBD3 5H9PA 2AENA 2QTWB 2RG4A 3A0NA 3ME2A 1ZVFA 3PURA 4ZU7A 3RZMA 2RS33 3ZYBA 1OI6A 2E7AA 2B39A 3ZXDA 5K9YA 3DYOA 4Y24A 4AI0A 3NL1A 5FY1A 3CF6E 2XLGA 1CX4A 1H6XA 1J1LA 5CEHA 3HQUA 1L7RA 3N9QA 4ISQA 4S2DA 1J3RA 2ZPXA 1H8TA 5FYMA 2GNTA 2YPJA 1PX4A 1Y3TA 1R1ZA 2YV8A 3MIGA 2IXCA 4NPMA 2J1AA 3SXWA 5AFBA 3SH4A 3QBQA 1P8JA 5A1FA 1K45A 2ZS6B 3HWJA 2ZOEB 1WCKA 2VQUA 3O0WA 2PAEA 1QJFA 1PGW2 3ZN4A 1OXCA 1ULCA 1VBD2 3NAPC 5C3SA 5F7UA 1FV3A 1EAH2 2D93A 1HQWA 2D3PA 3OJBA 4ARYA 5CVRA 4BQ1A 5FXWA 2TNFA 2A6WA 1WLTA 4IEPA 1B09A 3DUIA 4J1XA 4JQTA 3I2KA 4B1LA 4QQLA 4CDWA 5HXMA 4JGYC 4XF4A 2BGPA 1TMF3 5FZOA 2PHUA 2I2SA 5I0UA 4GH4C 5DZGA 5JSOA 4DOUA 2DV9A 5B4NA 5CFCA 3I54A 1YFYA 1R082 4E4SA 3GBWA 3WEZA 1EY2A 2OT7A 1JHJA 1RL3A 2OXBA 3POFA 4Q4V3 3SKVA 3TRSB 3L9JT 2YU2A 4OI0A 4AF9A 2D6LX 2YUEA 5F5AA 4I02A 2YDEA 3RMXA 3VD4A 1XE0A 2BNNA 3DKQA 2BGOA 1ZZ8A 3HMYA 5LK7B 2R0FA 1LOEA 3WQ1A 4BQXA 1Y9MA 2BNMA 2EXKA 2HWD1 1S0GA 4ATFA 1U5XA 5BNOC 1VBD1 2Q8CA 4XDOA 1JXNA 4H7LA 1V70A 1TME2 1HJGA 1UU6A 3WF1A 2ZGMA 5IVBA 1RUG2 2VUAA 4P9JA 4P02B 4GJYA 2IZWA 1VB2A 1LHVA 4AI3A 5FKCA 3LA7A 1GQPA 3R4UA 1BXHA 1WLCA 1ZZ7A 3MGUA 3IWZA 3TB0A 1AX0A 3FJSA 2WZ8A 2AREA 3O1VA 4BLIA 2GDFA 1AVBA 3SCGA 1YLLA 3J26N 3ZYGA 3Q8BA 3TBDA 1IKQA 1H8VA 1VBA1 5J7MA 5T55A 1UZWA 5I91A 3FLRA 2PTMA 4H3WA 1S2EA 3A22A 3OGRA 3W9AA 3NJZA 1T6GC 1VPHA 1C4RA 1JU3A 1UPSA 1NZCA 2P3JA 4HN0A 3NNJA 1SCSA 2YXSA 4OVEA 4LT5A 1QDCA 1AHSA 3PNAA 4JRLA 4NIHA 3VKMA 4A45A 3BVCA 3USUA 2ZABA 1ZX5A 3LWCA 5FYUA 1W6NA 1DFQA 2FMYA 1GANA 5FY7A 5KXEA 5EP9A 4GMP3 1ND3A 1W2TA 2VW2A 2WZPP 1JOJA 3IKWA 4IESA 3MO4A 3WDVA 1N1SA 2E63A 1LJ7A 1AXYA 5D8AA 1YC61 5K0UA 1C5HA 1W2AX 3WVJA 1LTEA 1RIRA 3OGSA 4V1PA 3WP3A 3OD0A 5CFDB 4JRAA 4LBKA 3ZKUA 1E5HA 1ZA4A 2R061 5JZGA 1W99A 4DEQA 1RC6A 5ACA3 4B3NA 5F9TA 5JOXA 4KGQA 3FUQA 2ENRA 3H8UA 5ANNA 3AKSA 3ORJA 1OLRA 1L7QA 1H8TC 2LUWA 2CWMA 1M06G 5CNAA 1W3XA 2BJSA 4Q8KA 3AX4A 4KMQA 2WUHA 3ES1A 2P37A 5K7PA 2MHFA 1STMA 5AC92 5KC5A 2HWF1 2CDPA 4DINB 1K5JA 2D5FA 1Q8PA 2AH2A 4MSVA 2JX9A 4NIGA 1IQDC 2WJSA 1JZ4A 3SLIA 4CU9A 4EE2A 1R1A1 1B35B 1PMJX 1F2NA 1CAUB 2X53S 3K4ZA 2LROA 3O0VA 4QB6A 1WD3A 1DQ0A 3K77A 3VD9A 2W92A 2VZRA 3AXDA 1O59A 2JG8B 4XBNA 1NCRC 2HEWF 1JYIA 2DVAA 2R062 1TQ5A 3N9LA 3FHQA 5A7SA 2ZHKA 4GWJA 2HWC1 3EB7A 1BYHA 3U0ZA 3CQOA 4AAPA 2A71A 1WWYA 3B94A 1WBLA 3BYWA 1ZZ9A 1XNBA 3L2HA 4B1MA 3UNPA 1NG0A 2YHJA 4UW4A 4FFFA 5FPBA 5FMCA 4AEDA 3JD72 5F3CA 3CIHA 2X5IB 3VBOC 2RS31 1UKGA 1VBE1 3BPSA 4LA3A 3ZM8A 2H6BA 4I0BA 2WT2A 3O5SA 3LEKA 3HBKA 1QQP3 1ASJ3 4CEYC 1IOAA 1UOFA 2NP0A 1R1A2 4ATEA 3AYDA 5A7PA 3OBZA 3PJQA 2BV4A 4A2UA 3DYPA 4Q26A 5FOJB 3MPPG 3ILRA 1AJKA 1YXWA 4B7EA 3KMHA 1K5MB 4MGKE 1SFYA 1SPPA 4I0WB 5F32A 5H9SA 4HANA 4MZUA 4MGTA 2RS51 3PHMA 3R0RA 4LUMA 2EALA 1UXXX 4D6QA 5FZ6A 3T2TA 1C8M2 1R083 2JG9A 5CISA 1AXKA 1VE0A 1OA2A 2ZGPA 1W0PA 2E7TA 5CA6A 1GUIA 4QT6A 3IM0A 4YW6A 3EBRA 1V9U3 3OBAA 5JSRA 1N47A 2VMEA 4L97A 4CYDA 4F8AA 4K7JA 1DDLA 2GALA 5A3OA 3NNMA 4CDUA 5D1IA 2XPJA 2XWJB 4G4FA 5LB6A 1H6YA 1OURA 4NIAA 5JOZA 4KG0A 2PN5A 3RZHA 1PVC1 3PU8A 1J59A 2W1QA 2MEV2 3OEBA 4CEYB 1Q5OA 2DU0A 4LORA 4N53B 1CGPA 3I2DA 3P5BA 3VZKA 3RQ0A 3HAGA 1V6NA 2BFUS 2CSGA 2VZ1A 1CAVB 3K3OA 1GZ9A 4Y22A 3O1OA 1JODA 3IBMA 1NKGA 3R4DB 4CZSA 1S4CA 1PNGA 3EXUA 2IVIB 1ONAA 4Q4W2 1ZBA3 2EIBA 4XBLA 5IJRA 3SC7X 1G9AA 2JDZA 5HBAA 5FZFA 1O3QA 3JQXA 1JYNA 2JE9A 2JWPA 1HKDA 3BTAA 4N7IA 3FMGA 4NJ4A 5JUVA 3BIWE 3ZMOA 5JOYA 2AR6A 1TG7A 2ZGTA 4YSFA 5FLIA 2CAUA 2Y6FA 1EUTA 2BUKA 5F39A 1IS3A 1W8UA 5EIYB 3N9NA 3DF0A 5FZ3A 2QQUA 4CCOA 2EXIA 1BBT1 4A4AA 3WOGA 1LOFC 2RS12 3DCQA 4YW4A 3K46A 3L2YA 4HETA 3H42B 1QOTA 4UOJA 4XZUG 4UFJA 4IEUA 2LW8A 4JKLA 1X33A 4LHLA 1U5YA 1QDOA 2OX0A 1J1TA 4XUQA 3WW3A 5AVPA 4OHZA 2WNOA 4IE7A 3J4UH 3LCPA 5FYBA 3U4XA 4Q4W1 1I3HA 3WG4A 1UO9A 2WSVA 2WN3A 1MS3A 2D44A 1MQTA 2BU9A 3M3IA 5LRSA 2JDYA 3D0SA 4JQRA 4IXLA 3Q8AA 2E9QA 4XC9A 1JZ2A 1H0BA 1S0FA 2JICA 1UOBA 2Y8KA 4IEQA 2X05A 4XF1A 2QQVA 1ULDA 4COVA 4RGGA 4AEJA 3OUJA 4QB2A 1W28A 2SBAA 4XTMA 3VZOA 4DNYA 2Y6JA 4H7MA 3WW2A 5IK7A 4RS5B 4L2NA 3OB8A 3KSCA 4DPNA 1ZBE2 4XFAA 4YW7A 3VGIA 1W6OB 4IV3B 3DPRA 2WT1A 5JPMB 1DQ2A 3USUB 4XCBA 1AR92 4L11A 4U2AA 2GN7A 1W9WA 4L99A 4QM8A 2DTYA 3F95A 3I3EA 4LHNA 4UW3A 1YHFA 5EYXA 2ZGLA 3SNMA 1DGWA 2VZQA 4BMBA 4AWDA 3GXUA 1QKQA 2QUOA 1FMD3 1REEA 2Y0IA 4HKLA 3MIBA 4JC1A 4ISRA 2EVXA 3IN9A 3ZXFA 4JGZC 4NHMA 1ENRA 1QIQA 2X29A 4XBQA 2EIDA 4ASKA 1UNBA 2P6CA 1R092 3KCCA 1YFUA 4XFGA 1WLDA 4LXLA 4CDXB 1W06A 4FBFA 3ZSEA 3QACA 4FAGA 1AX2A 3VZLA 1VR3A 5CIRA 5FWJA 4CU7A 5JPNB 1BVVA 1Q8VA 1W6PA 1IKPA 1EP0A 1FX5A 1LRHA 1H1IA 1YFXA 5FUNA 2NPIA 4QHOA 1QQP2 4IV3C 4ZY9A 4JZRA 4QPIA 3UJOA 2R6QA 4AI9A 3MW3A 2VZPA 3U11A 3VD3A 2WNVB 2CL2A 1RUD3 2EA7A 2W9XA 1COV1 2ETEA 1TEIA 3C3VA 3KD4A 2UURA 5GLUA 1RUC1 4LNVA 2VM9A 2BVVA 1CAUA 1FPN3 1G6NA 3I49A 3HPNA 1QWRA 1OKQA 1W9SA 4COZA 2LTNA 2R32A 3ZLIA 5TSWA 5LBEA 2Q8OA 3MLLA 4AGGA 1GKBA 2AACA 3X29B 1YIFA 2PYTA 2QVSB 2Y34A 1RMU3 3FX3A 2RE9A 4E8DA 4WZFA 4AEMA 3VBUC 2ZTNA 5A33A 4D0QA 3AZXA 4GKYA 4ZXKA 4YVSB 4JDOA 4XAAA 4BMEA 1HQNA 1U5ZA 5FZOB 1MEC2 2ZHLA 1NE4A 5CG8A 4L8QA 1AYN1 1SLLA 2FHRA 3PUSA 4P9YA 4Y1UA 4AQ2A 4ASMB 1BEV3 1CAWB 1T6BX 2D6KA 1GZTA 1JYXA 1C8NA 5DDJ2 3NSTA 3WY6A 2QQIA 1G9BA 3VUOA 3NNGA 5D8AB 5HXVA 1WBFA 4AG4A 1J84A 5FREA 5FP9A 2WO7A 3GBGA 3T4HB 2QDRA 4AE2A 4DXSA 3THPA 4Q0QA 4TLGA 4UF0A 5FZ8A 3W21A 4IE4A 4RHV3 1A78A 5FAXA 1C1LA 4YVSA 4E2GA 4CP0A 4B29A 3VBUB 3ASIA 3ZX7A 1SCRA 2W52A 3ENRA 3FLTA 1OF3A 1GSLA 4OHXA 4MHUA 3UV9A 2R063 2DURA 2CAVA 4MV2A 3VN4A 3SEEA 1BK0A 4URTA 3I2GA 5BNNC 1FMD1 4PIZA 3ZMNA 2WNUC 2RJKA 4AK3A 3WNKA 3E5QA 2VQ0A 2ZEZA 3NKGA 4G3YC 2YG0A 1IZ3A 1QOOA 4LBQB 4BQWA 1LEDA 1XYNA 4HVOA 5C4WC 3AJZA 3VBHA 2E26A 2QE3A 4AHWA 2XL9A 2ZX0A 3THTA 2RDRA 4C91A 1NYWA 5F2WA 3AFKA 2JG8A 2OKXA 4HK8A 2RMU2 1PGL2 2ZXQA 4CDXA 2C24A 2FCTA 4IE0A 5BY5A 1FXZA 1IS6A 1ND2B 1W8FA 3KQ4B 1GWLA 4YFWA 5DZEA 2Q8DA 3A23A 5CADA 5C5TA 1ZREA 2E7QA 2UWBA 2IFRA 2WZR1 4FO9A 2XHNA 2UYAA 2QBXA 3WP6A 4M4PA 2VECA 4MG2A 4CUAA 3T0DA 2CGOA 2WRAA 4BM8A 3ZXGA 4LBOA 1FMD2 2VZOA 4W4ZA 4CRQA 3H8OA 4M3CF 1W05A 2QQJA 2AUYA 1RTVA 3GHNA 4HL0A 4LHKA 4OMCA 4FI9A 1HDKA 1UF2C 1WCQA 1W6OA 2K2SA 3IPVB 4IV3A 1HQLA 1QXJA 2HLEA 4LBQD 1AR82 1GP6A 1AL22 4CDUB 2EXJA 1HRI3 4XE9A 3T3YA 1KXGA 3T2PA 4JGZB 3GZUC 4QXKA 3A7QA 4O9EA 5ANQA 5BPXA 4ZZ8A 4YG0A 2YU1A 1ENSA 2IWGB 1LOBA 2ZHNA 3U4SA 4NHKA 5FDBA 5IFPA 5LA9A 1CZVA 2RMU1 1PGL1 4FPFA 2XHKA 2A3WA 5E16A 4B8EA 1F35A 2XONA 4Q4V1 1UMIA 4LE4A 4JCKA 5GZGA 3S0MA 2QNKA 1K5MA 3C7HA 4BPZA 1ULGA 2VR4A 3J7HA 4G9SB 1WKYA 2G9GA 3MUZ1 1O4ZA 4E8CA 1G9FA 5DABA 1PO23 5FO7B 3EJKA 3KLSA 2Y6LA 3FL7A 4RR3A 2WS93 5I8YA 4MGQA 2AGSA 1EAH1 1MZFA 4DMIA 4QKNA 4IEYA 1UYXA 2PA7A 3B00A 3KT4A 3WQ0A 2J1SA 1KS5A 5F3EA 5K4LA 2BEOA 1LOAA 3AKRA 4AVBA 4CCCA 4YM3A 2Q1MA 2ZKLA 4PT6A 2W95A 3PLQA 3PIJA 5FZDA 4ZKTB 5BUVA 3BGAA 4TXWA 3QOPA 3UKTA 3WDTA 1RJ8A 3PMEA 4P00B 4TYSA 4ONUA 1XU1A 3WZ1A 3VBSB 5FR3A 2KXLA 3I2JA 1PZ7A 4N53C 3ZYFA 4CPBA 1W0OA 4Q4X3 2ZX4A 2JDUA 3TYJA 1UY3A 3SQOA 5BV6A 3CJIA 1NA1A 4OCTA 3Q9OA 3ZYPA 4GMP0 5FY5A 3RZLA 1GWKA 1SEFA 3M4FA 4LO5B 4WVMB 5C3QA 3ABZA 4JVAA 2PHWA 2XWBB 1V9U1 3N9MA 3OEAA 4RD7A 3TWIA 4DFSA 5LATA 3H50A 1EV13 3I2OA 3LPFA 2HWD2 1GV9A 4Q4Y1 4XYXA 5A3TA 1ULOA 2FDIA 1VRH1 3MFCA 1CESA 3RSJA 4CDQA 4PBOA 3AMPA 4Y22B 2Q8EA 3RFRA 5JMOA 4JX0A 1OC1A 1RUG1 3AKQA 3V0AA 4MXVA 1G9DA 5DAVA 2ID4A 2IFWA 3VZNA 2VL4A 5A3UA 5KHHA 3I4IA 1RUH2 1BMV2 1OA4A 5C3PA 4XXPA 4Y3OA 3ZFFA 1R64A 4E9KA 5A6ZA 1WLWA 1RUG3 2RVAA 5I0DA 5JAXA 1O3SA 4R4ZA 2BW8A 4QHBA 5FMBA 4N8MA 1FOD3 2GU9A 5A7WA 1Q8QA 4RS5A 4XOGA 2O0OA 4IV1A 2IXLA 4FTBA 1ST8A 1O91A 1EV11 1RUE1 5DAWA 5LY2A 3EMRA 4E27A 1SBEA 3EQEA 1OPOA 3AZYA 3LDRA 4Y1ZA 5GM0A 2WNEA 3R05A 3OY8A 3KV9A 3CNAA 3DV8A 5EPAA 2HWC3 2OVUA 2FDFA 5KHGA 3VKFC 4K9SA 1KFUL 1US2A 2NQYA 1RUNA 1YQCA 4JKMA 4UW6A 1UL9A 1W9FA 2P5BA 5A33B 1W90A 4NAMA 1XNCA 4JHZA 2QZ3A 4RGAA 1WMXA 1KJRA 3EYPA 3MICA 4MYEA 3ZKYA 5AC93 4A3XA 4CXWA 4P9XA 1NXD1 4YGDA 5H9QA 4FPEA 4URAA 1H2LA 1QJY2 4YPJA 1UYYA 4C0BA 4CP1A 2JEMA 1D0HA 2JDPA 2RR12 4MADA 5BNPC 4YVWB 4OI1A 2BBVA 2Z2SB 4Z2AA 1NLRA 3D6EA 1DYOA 4QPGB 5LBFA 3PTRB 2ZGOA 1HB3A 5FMOL 4PI2A 4I2OA 4J6GA 1LENA 3GZTB 3IZOA 3K51A 1L3JA 2WS91 4XABA 4XDQA 3FE5A 4ZPIA 4QXBA 3AMHA 4WZCA 2A6XA 4M3CE 3BALA 2B46X 4RGKA 4AI2A 2PAMA 1M4WA 2ZZQA 3UGHA 4CCNA 2GMEA 2PHFA 3GZEA 1LHWA 2CHHA 5JR2A 2JENA 2HWF2 2XJRA 1RINA 3SEPA 4EN7B 4BHPA 5F37A 3N3HA 4PCRA 5FZLA 5FPZA 2VPVA 2X5IC 2F4PA 3VBOB 1WW5A 2CY6A 4PHZA 3KV6A 4YZ5A 3JD73 2VCCA 1W8WA 1SLBA 2RDNA 4LUKA 4CCMA 4Q0SA 2XR4A 4BIOA 1YNAA 1GP4A 3VL9A 1QJY1 2XVKA 2ARXA 2WN2A 3MI8A 4TTGA
chains in the Genus database with same CATH topology
1OVPA 1OURA 4AOCA 2JDMA 2BV4A 1OUSA 1OUXA 2JDUA 2CHHA 2JDNA 2JDYA 5A6ZA 2VUDA 1W8FA 5A6YA 2JDHA 2WR9A 1OXCA 2VUCA 3DCQA 1GZTA 1OVSA 3ZDVA 4CE8A 2JDPA 2JDKA 2VNVA 1UQXA 2BOIA 4UT5A 2BP6A 5A70A 2XR4A 5A3OA 5D2AA 5A6XA 5A6QA 2BOJA 1UZVA 2WRAA 5HCHA 1W8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVP A;  1OUR A;  4AOC A;  2JDM A;  2BV4 A;  1OUS A;  1OUX A;  2JDU A;  2CHH A;  2JDN A;  2JDY A;  5A6Z A;  2VUD A;  1W8F A;  5A6Y A;  2JDH A;  2WR9 A;  1OXC A;  2VUC A;  3DCQ A;  1GZT A;  1OVS A;  3ZDV A;  4CE8 A;  2JDP A;  2JDK A;  2VNV A;  1UQX A;  2BOI A;  4UT5 A;  2BP6 A;  5A70 A;  2XR4 A;  5A3O A;  5D2A A;  5A6X A;  5A6Q A;  2BOJ A;  1UZV A;  2WRA A;  5HCH A;  1W8H A; 
#chains in the Genus database with same CATH topology
 3GYD A;  1V6O A;  4LO4 B;  3ZXA C;  1NCR B;  4LOS A;  4QX5 A;  1RUF 3;  3ACH A;  1XSR A;  3BN6 A;  3SH3 A;  5T5P A;  3MF9 A;  3VBF C;  3RPQ A;  2ZMK A;  3AP9 A;  2R07 2;  1A8M A;  3CJI C;  4HPK A;  4N90 A;  1F31 A;  2CU5 A;  3OYW B;  4BLJ A;  1QJU 2;  3RNS A;  2UY8 A;  2YPD A;  1UOG A;  4GAL A;  1GNZ A;  4OFG A;  5CU1 A;  4QM9 A;  2WZR 3;  4YAR A;  2HH9 A;  1VMF A;  3VLB B;  2JKX A;  4Z82 A;  3B01 A;  1YRZ A;  1AR6 3;  4P5H A;  3WT3 A;  5FYV A;  4QGM A;  4QQ2 A;  1QH7 A;  3UET A;  5FRA A;  5GLT A;  3WW1 A;  1QF3 A;  4DY3 A;  2WO3 A;  2W1U A;  2DVB A;  5GLZ A;  4OI2 A;  4LEJ A;  1D4M 1;  2HYX A;  2D6O X;  1JYW A;  1PIV 2;  2AZ5 A;  3VKO A;  1CON A;  4K8R B;  4DUX A;  1ODN A;  2D40 A;  5HV0 A;  4KG8 A;  4KBZ A;  3CLP A;  3KF5 A;  1NOV A;  3AKP A;  4QB1 A;  3WDY A;  3TOJ A;  4KWJ A;  4QX1 A;  2B9U A;  3V64 A;  3RZJ A;  1W04 A;  1G7Y A;  1W8Z A;  1TNF A;  4GXL A;  5B2G B;  2XB6 C;  4A6O A;  5BXX A;  3THC A;  3RI9 A;  1XYO A;  2VUJ A;  2DCT A;  3ILF A;  3H3L A;  2BOI A;  3J8F 3;  5FO8 B;  3MZH A;  2ZAC A;  5EJZ B;  3LEG A;  2RDS A;  3GF6 A;  3ZFG C;  4Z2W A;  1AR7 2;  5LZ6 A;  2ZGU A;  3D8C A;  1QJX 2;  4UYB A;  4WVZ A;  4OQ9 A;  3O0X A;  4EV0 A;  4XQW A;  1NQD A;  3V0B B;  2A7A A;  2ET1 A;  4XUT A;  5FY0 A;  5I8S A;  2WAO A;  4A7K A;  4DXT A;  1KQR A;  4TLF A;  3TAY A;  1AYM 1;  3UL2 A;  1KIT A;  3FBY A;  4JDN A;  1U12 A;  3URF A;  3RZK A;  3ILN A;  2OPW A;  1D4M 2;  4OHW A;  3I97 A;  5D8A C;  3WF2 A;  5CFD C;  4HBN A;  1Z78 A;  2UWC A;  3M70 A;  5A3P A;  5BNP A;  1W2U A;  3PUA A;  5BNN A;  1RUI 2;  3AMQ A;  2C4X A;  2DYC A;  3RJ2 X;  1SLT A;  5JZG C;  4CVU A;  5DAQ A;  3AB0 A;  3IDC B;  5KWR A;  1A3K A;  1F4H A;  3ZIW A;  3P1I A;  3K4D A;  3N7M A;  3WDU A;  2G4I A;  4MOA A;  2VOX A;  3M3Q A;  1IG0 A;  5J96 B;  1IS4 A;  1LUL A;  3BPZ A;  1YYN A;  4HKO A;  2XDV A;  4EWE A;  2JD4 A;  1RMU 1;  3WNM A;  2WR9 A;  3ZFG B;  3WNL A;  3NJX A;  4D69 A;  5KXB A;  2ARA A;  5L7O A;  4HG6 B;  4FT8 A;  4QGN A;  4BU2 A;  3GM8 A;  4Y5T A;  5IYY A;  1XBF A;  2IXH A;  2I45 A;  2RS1 3;  1AX1 A;  2YZ4 A;  1XC6 A;  4LUL A;  5T52 A;  3M7A A;  1YQ6 A;  1QNW A;  2P6H A;  3WUD A;  1DHK B;  5GJ6 A;  5LAS A;  3PVO A;  1WCS A;  1N3Q A;  2Y6K A;  1RJ7 A;  1UU5 A;  4MGZ E;  2RM2 1;  2H0V A;  5IVC A;  3KM5 A;  2WA3 A;  2R0H A;  1APN A;  3OBT A;  5FYY A;  1C3H A;  3VBS A;  1S0B A;  1A34 A;  4YM2 A;  3VL8 A;  5HI0 A;  4RFR B;  1LHU A;  5J37 A;  1NZI A;  2WAB A;  4YYO A;  1QJE A;  3N9P A;  2K46 A;  2WA4 A;  3A21 A;  4XAC A;  4QPG A;  4FOW A;  2W3J A;  4JDM A;  4Q29 A;  1O3T A;  3IAP A;  4IEW A;  3VDD A;  1HRV 2;  2B45 X;  3PDQ A;  3LFM A;  1LB2 A;  5JI7 A;  1DCS A;  5C8C B;  1PX3 A;  1FAY A;  4J1W A;  4XAE A;  3I3Q A;  4BK4 A;  5C8W A;  4RQP B;  4X8N A;  1SLI A;  3CZU A;  1K42 A;  1U5I A;  1MPX A;  5IVE A;  4PF5 A;  4PDW C;  5CKM A;  3D3A A;  4ZHN A;  3KT1 A;  4IEZ A;  3VBF B;  4HON A;  1JZ6 A;  1W8T A;  4QX0 A;  1WZX A;  5DUU A;  2C9K A;  4AHZ A;  1OUX A;  1HLC A;  5KHI A;  2XOM A;  3WHT A;  1LEM A;  4AGV A;  2I74 A;  2B4K A;  5I8T A;  4P9L A;  1Y7B A;  3KB5 A;  4DUW A;  5J1X A;  2O8Q A;  3M3C A;  5FZM A;  1QXP A;  4WV8 A;  4XIO A;  3PU3 A;  1PVX A;  4LTA A;  1B35 A;  4D6R A;  2ZGR A;  4EZH A;  2JG9 C;  1IGO A;  2QQL A;  2QZ2 A;  1NUK A;  3Q8C A;  1RHI 3;  4M0N A;  4QQH A;  5FYI A;  5ABJ A;  4CUC A;  5DZF A;  3AZW A;  4LK6 A;  1H9W A;  3ZFE A;  3LGR A;  3LKJ A;  3ZYI B;  3ZYR A;  3OG2 A;  4KBB A;  2G9Z A;  4QAW A;  4ES9 A;  3MUY 1;  5C33 A;  2PMW B;  4CDW C;  3ZFF B;  1Z7S 2;  4B4Q A;  2VTX J;  2WYS A;  2C5D A;  2CDO A;  3AKT A;  3MF6 A;  5M0T A;  1OQD A;  1VLN A;  4XQD A;  1HRV 3;  4QHZ A;  1MS5 A;  3ACI A;  1BVP 1;  4WM7 C;  3MV0 1;  4PDW B;  4WVW A;  2EAK A;  2V4V A;  3TNP B;  5FTT C;  1MVQ A;  4TN7 A;  4HFS A;  5B4X A;  1XE8 A;  2RS5 2;  4X8P A;  2OUJ A;  3D0J A;  4M3C A;  1JTZ X;  1YJK A;  5IVF A;  4XF9 A;  1ENQ A;  5JZG B;  5J98 B;  1MS1 A;  1C8M 1;  1SQ4 A;  2R04 1;  5DDJ 3;  4XJW A;  5JXG A;  2CGN A;  4GB3 3;  4GD4 A;  1RUJ 1;  1V6L A;  3RWK X;  5L19 A;  1J83 A;  2W87 A;  5F2S A;  3WDW A;  4CDQ C;  1AUY A;  1W2O A;  1QJU 3;  2BYV E;  3MBW A;  2V09 A;  3BKZ A;  1YCI A;  5LW9 A;  1CR7 A;  1W8H A;  1PO1 1;  4LLF A;  3GJA A;  3POS A;  1F4A A;  5C7G A;  5CB7 A;  2HEV F;  1CX1 A;  4KWL A;  5GZF A;  1OQ1 A;  5BNQ A;  4B7K A;  3VBH B;  2HYK A;  3ES4 A;  1LOD A;  5C8C C;  5A3W A;  2XBO 3;  4Q0U A;  5J3U A;  1DGL A;  4Q2F A;  1FV2 A;  2VTX A;  3NAP A;  3GDB A;  4A6S A;  2A6V A;  5LWB A;  2JDK A;  3D4K A;  4NID A;  5FPA A;  2XUM A;  1UD1 A;  2J1V A;  3KHB A;  2HWE 2;  2AEY A;  1AYM 3;  3Q8E A;  3AYC A;  1ODM A;  3HQX A;  1NCQ A;  1PGW 1;  1ASJ 2;  5IT6 A;  3EO6 A;  5DN2 A;  1RUI 3;  2WWU A;  2E6V A;  2GC3 A;  2D98 A;  4YW3 A;  1OUS A;  2VZU A;  1RUJ 2;  4IE5 A;  5FOB B;  3H9A A;  3M1H A;  4I09 A;  4UF0 B;  3RGB A;  4S2F A;  2VMH A;  2FD8 A;  2V5D A;  5FV3 A;  1OOP A;  1AJO A;  4Y1Y A;  1JW6 A;  2W1S A;  2ZEW A;  4QX3 A;  5DPN A;  2E33 A;  1UKR A;  1W6Q B;  3H0O A;  4OLL A;  1HXS 2;  2VNV A;  3FHA A;  1KDK A;  4FPC A;  1R08 1;  4D6S A;  4QQP A;  2JKB A;  1UAI A;  1F5J A;  5HCA A;  4XQ4 A;  5FBZ A;  3TNQ A;  4DIQ A;  2BNO A;  3BUC A;  2BOJ A;  4HVR A;  4OMD A;  3CBN A;  2BWC A;  3GCW A;  3DPR C;  2J1E A;  4LLO A;  5JIA A;  3J9S A;  2OQ6 A;  3UK9 A;  4HVQ A;  2QQM A;  5IAV A;  4DRR A;  4E4Z A;  5F3G A;  4Y33 A;  4QKF A;  3AK0 A;  1ASJ 1;  1S2B A;  2E51 A;  4IGQ A;  2DUQ A;  2A70 A;  2VZS A;  4IEX A;  1JBC A;  3NV1 A;  3OUH A;  2W46 A;  5FY9 A;  3FHI B;  4CCL A;  1PMI A;  5IWF A;  1XYP A;  4LPL A;  3ROU A;  5BNP B;  4UAP A;  3ACL A;  3E5X A;  3VZM A;  5I0T A;  2WNU B;  3GGL A;  1HXS 3;  2OPK A;  1N1V A;  1ULF A;  5FZG A;  1H1M A;  5L73 A;  5C3R A;  4COU A;  1WGP A;  2C26 A;  2BP6 A;  3S7E A;  3S5Q A;  3IDB B;  2WNV A;  3LAG A;  1CIW A;  1AR6 2;  2D97 A;  2GC0 A;  2ADE A;  3AZZ A;  5FYC A;  3S6P A;  4F3J A;  1Y9G A;  2CTV A;  4N43 B;  2VAU A;  4ORF A;  4BA6 A;  2WLP A;  3WP5 A;  4K6B A;  3HNM A;  3I2F A;  3T4V A;  5T5J A;  1TME 3;  3WLU A;  1PK6 C;  1DGR A;  5CYY A;  1H8T B;  1SHW B;  1LKN A;  3MID A;  4Q4W 3;  4UI9 L;  4XEZ A;  5FP4 A;  4JTO A;  4QPI C;  1EUU A;  5JR7 B;  5BNO B;  4H55 A;  2BWA A;  4IL7 A;  5LBC A;  5IAX A;  1UPI A;  2VNO A;  4GWN A;  3KCX A;  4LKE A;  4RQP A;  1H2N A;  1OBN A;  3HNY M;  4LKD A;  3SIT A;  4LBL A;  2LS6 A;  1Q43 A;  3ZXL A;  1R1A 3;  1J58 A;  3OCP A;  3JB4 C;  5GAL A;  1LNS A;  4AED C;  1O6U A;  3AMN A;  3PIG A;  4XVH A;  3UKN A;  1YI7 A;  2VOV A;  3WCS A;  1F8V A;  1H2M A;  1ZZ6 A;  3QLQ A;  4Q4V 2;  5FP3 A;  3WNX A;  1PHM A;  3N36 A;  4QWN A;  4CCE A;  4CXX A;  4S2G A;  4R9A A;  2H6C A;  3WNO A;  1PO2 2;  2OW4 A;  3QD6 A;  5A6Q A;  2WII B;  4XJ8 A;  2YC0 A;  1UYP A;  1H9P A;  1SAC A;  1S55 A;  1UXZ A;  4LMF A;  4ZS2 A;  1XRU A;  3UGG A;  4OZO A;  3TEW A;  2V72 A;  3ZIX A;  2XLF A;  3JU9 A;  3MV1 1;  3RRD A;  1ENX A;  1XJA A;  1N1T A;  3ACG A;  4EN9 B;  2FZ1 A;  1AF9 A;  3OGJ A;  1CD3 G;  5HCF A;  1I5P A;  3NQH A;  1IG3 A;  2VU9 A;  4NO4 A;  3RJR A;  2WQ8 A;  3VD7 A;  4QKB A;  5C70 A;  3W59 A;  1FYU A;  2F4L A;  5AC9 1;  3VKN A;  2YFU A;  2WFP A;  1HV1 A;  2DU1 A;  4BXS V;  4DS0 A;  4EN6 B;  1D7P M;  1SG3 A;  4YVS C;  3LOB A;  3TEY A;  1A8D A;  5C9A C;  3JBG 3;  4R9C A;  5I0S A;  1O3R A;  1RHI 2;  2HWB 1;  3OSD A;  1NCR A;  3THD A;  4CCD A;  4BQY A;  2TBV A;  2AYH A;  3T2O A;  3W5N A;  2JXA A;  3N7K A;  2P3K A;  1V0A A;  3MW4 A;  2NN8 A;  2PHD A;  4UFI A;  4Z8B A;  4AEK A;  1KRI A;  4XIL A;  4DY5 A;  4QDS A;  3SH5 A;  3Q8F A;  1OFN A;  2A6Y A;  1WMF A;  4LIU A;  2W08 A;  5JVV A;  2O1Q A;  2XJP A;  1SLC A;  4CUB A;  1O5L A;  2XGX A;  4QX8 A;  4K20 A;  3VBO A;  2EF6 A;  1WD4 A;  2ES3 A;  3WDX A;  3E6C C;  3AZV A;  3H7J A;  2W0X A;  3U1X A;  3P3N A;  4AI8 A;  5KBF A;  1YJL A;  4QGL A;  5C4W A;  4D94 A;  2PHL A;  3AYA A;  1F9K A;  3J7M A;  1DQ5 A;  2Z42 A;  4GUL A;  3VV1 A;  3B9C A;  5D21 A;  1W6P B;  3JBG 2;  2RJL A;  5EJ1 B;  2DWR A;  3LSE A;  1X8M A;  1UU4 A;  5GZD A;  4CCK A;  1OH4 A;  3CDZ B;  4CTE A;  3WF3 A;  1UZ0 A;  3H3Z A;  1WA6 X;  1VBE 3;  3POJ A;  2CGP A;  4YVW C;  5GZE A;  1NE6 A;  1DGR N;  1RUE 3;  2VOK A;  2YY1 A;  4FTE A;  5FCC A;  2VBD A;  2UYB A;  4KU8 A;  4XHX A;  4C8D A;  5A70 A;  1KFX L;  3KT7 A;  2Q0A A;  1XNA A;  2XML A;  4RR3 B;  1PMH X;  3RG0 A;  3IT8 A;  5J36 A;  5KHK A;  2Q4S A;  4YGB A;  5FXV A;  4D7S A;  2C0Z A;  3POG A;  3JXS A;  3SMH A;  4RYD A;  5JCT A;  5JLV A;  3E5U A;  2AC1 A;  2YBP A;  2VW0 A;  5GLW A;  1TMF 1;  3M3O A;  2ZHM A;  5FPU A;  1MQT C;  3CMG A;  4B4R A;  2B5H A;  2D7F A;  2P1B A;  4AI1 A;  3O12 A;  2JIJ A;  4JGY B;  1W6M B;  4UXA A;  3B5L B;  1GQG A;  4Q4Y 3;  3AP6 A;  1KD7 A;  2QQN A;  3IIA A;  2IXJ A;  4IW3 A;  4CEW B;  3B3Q E;  4MVT A;  3LEM A;  2JE8 A;  1CIY A;  4IV1 B;  1UY1 A;  3INA A;  1E5S A;  5FO9 B;  5A32 A;  4UBH A;  2VJX A;  3B69 A;  4FPK A;  3GCX A;  1SPP B;  3IPV A;  5CKQ A;  3N7L A;  4PDW A;  2Y60 A;  3DEM A;  2ZKN A;  3MYX A;  2OUH A;  2VG9 A;  2ATF A;  4GAZ A;  1CVN A;  1D2S A;  1MZE A;  4KNC A;  4PF1 A;  1Z0H A;  3V0A B;  3BTZ A;  1V6J A;  2VOW A;  4NRQ A;  3KV4 A;  1AL2 1;  4C0H A;  1QEX A;  4RR3 C;  1WMD A;  4OYU A;  3FZ3 A;  4LA2 A;  1OT5 A;  1QNY A;  2VVD A;  2KM2 A;  5FZ0 A;  5G04 L;  3WNP A;  5FXZ A;  4CA9 A;  5ABJ B;  5IAT A;  1VAV A;  2DCJ A;  2L9L A;  1RVF 3;  2YC2 A;  2PHT A;  3LD8 A;  4QMA A;  1S0D A;  1DYK A;  1Q8S A;  5A3M A;  4DZG A;  2VCM A;  4GQ7 A;  1UMH A;  3VB9 A;  5L36 A;  1UIJ A;  1UZV A;  3BOW A;  3VDB A;  3MIF A;  5IHR A;  1JN2 P;  2A73 B;  3AL5 A;  4XPV A;  1GBG A;  1RYY A;  2R07 1;  4NN0 A;  4BIS A;  1QJX 3;  1XSQ A;  5GKA C;  5KHJ A;  4OI4 A;  2RV9 A;  1QJU 1;  4HT1 T;  1H4G A;  3BOD A;  4AXO A;  2WWS A;  4YW2 A;  3RYP A;  4AR2 A;  5A6Y A;  1X36 A;  1TNR A;  1RUJ 3;  4Z07 A;  3ZPY A;  2DCK A;  1VAL A;  2RMU 3;  4RA0 A;  3LFI A;  3IDA A;  1JU4 A;  1ZZB A;  4AW7 A;  3VDD B;  4Z92 B;  1CZT A;  1UOJ A;  2HEY F;  2ZX3 A;  3BU0 A;  2A5Z A;  1C8M 3;  4UT5 A;  3N9O A;  2ZAH A;  1CAV A;  1KS4 A;  3I59 A;  1MZ6 A;  4FFH A;  3ZXJ A;  5JSP A;  3CL1 A;  5IVV A;  1JHN A;  1UY2 A;  1OF4 A;  2PLV 1;  2X10 A;  4YGE A;  3ETQ A;  3A0K A;  2Z69 A;  3VBU A;  4BE3 A;  3OPT A;  1VAM A;  2MEV 3;  1DQ4 A;  2IVJ A;  4IET A;  1POV 0;  4MGS A;  4AFD A;  3E1F 1;  3LF7 A;  2D6P A;  3KZ4 C;  2QKD A;  1X82 A;  3S7I A;  4XFB A;  4XJZ A;  3BIE A;  4EQV A;  5FQ0 A;  3UYJ A;  4NWW A;  1LES A;  2JIG A;  3OY8 B;  3RMY A;  3PUH A;  2VVE A;  2VZT A;  2VZV A;  5IVJ A;  3ZDV A;  4EWA A;  1H30 A;  2HBU A;  4FPL A;  2ZX1 A;  5K0U B;  1ND2 C;  5IW0 A;  3LSD A;  1AR7 1;  4JGY A;  1GQH A;  2JDA A;  3O1P A;  1DF0 A;  1BZW A;  3KS7 A;  2XJV A;  4HN1 A;  1VBC 1;  2VCB A;  1C57 A;  1JMU B;  4FQZ A;  1NCQ C;  1VB4 A;  2YGL A;  1XOY A;  5FPV A;  5A1A A;  1CPN A;  1EPW A;  4CUG A;  5A80 A;  4AQT A;  1YQ8 A;  5DUV A;  2VMD A;  3AP4 A;  3ZXK A;  1PGS A;  1BMV 1;  4RHV 1;  4GWM A;  1UIK A;  3S30 A;  2VUL A;  3K48 A;  2ORZ A;  2XQR A;  4QPY A;  2LM3 A;  4H14 A;  4PIY A;  2PLV 2;  3JCI A;  2PXJ A;  4N9H A;  5LBB A;  1GNH A;  2ZZJ A;  4DXR A;  5DMY A;  2C6S A;  1JYT A;  2XJU A;  2Y26 A;  4IGP A;  1QOS A;  1LOC A;  4GZ9 A;  3ZPO A;  2WFF 2;  1HB2 A;  3ZYH A;  1BEV 1;  1FAT A;  4R8H A;  2RDQ A;  3MHZ A;  2NYY A;  4ERO A;  3AM2 A;  3E6B A;  4QPI B;  3GAL A;  4NHY A;  4K3U A;  4JKK A;  4P5Y A;  4PJY A;  4XUO A;  1X9T A;  3AL6 A;  5FZB A;  4KGG A;  2RM2 3;  2E32 A;  4XJ9 A;  3DEC A;  1SMV A;  1O4T A;  2GP3 A;  3LIH A;  1BHG A;  1X50 A;  5FY8 A;  2Q1F A;  4N7U A;  1OH3 A;  5ACA 2;  1CWP A;  1I1E A;  4CDX C;  2BVB A;  4L0P A;  5DAP A;  2VQA A;  1UZZ A;  2W94 A;  2EXH A;  3HT2 A;  3FFQ A;  3WV6 A;  2P17 A;  2KR2 A;  4K40 A;  1XPW A;  4HLT A;  4YZ2 A;  2DDU A;  4RHV 2;  1W3V A;  3D82 A;  3IAQ A;  1ZBA 2;  1MS9 A;  5FWE A;  1NY7 2;  3H1W A;  1OA3 A;  2Y6G A;  2HJI A;  3P3P A;  5EV7 A;  5LA0 A;  3AMM A;  4CU8 A;  1AYN 3;  3LQC A;  4MHR A;  1JH5 A;  1EYB A;  4ZU5 A;  5T3N A;  4OUS A;  4AVV A;  3WP4 A;  2W5F A;  5A6X A;  2RM2 2;  5LY1 A;  2ZX2 A;  4OQ8 A;  4KI5 M;  2P3Y A;  2ZEX A;  1W0N A;  4AL9 A;  2WFF 1;  1PK6 B;  3MLK A;  4P9I A;  3JUU A;  4GIQ A;  3RYK A;  2KA3 A;  5FZE A;  1ND3 C;  1AL0 G;  5H9R A;  5FMO S;  5KXC A;  5GZC A;  1BJQ A;  3POW A;  1NLQ A;  4LBM A;  4QPW A;  1ALY A;  2Q30 A;  1US3 A;  1UW8 A;  4DUV A;  2EIG A;  4F83 A;  4RQP C;  2FMD A;  2JB8 A;  4NRP A;  4TSV A;  3OGV A;  5FZ9 A;  3I2I A;  1PZ9 A;  3UGF A;  1JZ8 A;  3GHM A;  1UQX A;  2R04 3;  3PVE A;  5FFO C;  3WXP A;  3RVH A;  1RUC 3;  1O4Y A;  2VY0 A;  2GNB A;  3G7D A;  1QU0 A;  1COV 3;  1R09 3;  4AFB A;  5C5U A;  1RUD 1;  2HKX A;  3V65 A;  2J7M A;  2XVL A;  1HB4 A;  4AHX A;  4WM7 B;  2WLQ A;  3KV5 A;  5HCH A;  4XFH A;  1X8E A;  1NY7 1;  2DBI A;  2DVF A;  3AVS A;  4L9B A;  3MDP A;  2QQP A;  1UY4 A;  1ULP A;  1V00 A;  1POV 3;  4PLM A;  4ZZ5 A;  1BKZ A;  4K21 A;  1VBC 3;  3OGG A;  1IS5 A;  1S0J A;  3FC0 A;  2GAU A;  4IDZ A;  2K0G A;  3I59 B;  5FLH A;  4MH0 E;  3ZDS A;  2GMP A;  4YZ3 A;  1PVC 2;  2DUO A;  2OQ7 A;  3VHR A;  4DRV A;  1MZ5 A;  3DL3 A;  4YRD A;  2CV6 A;  2XJQ A;  5C71 A;  4P14 A;  1ND2 A;  2WQZ C;  5DG2 A;  5FZ7 A;  1W9T A;  1JI6 A;  1NA1 B;  2GMM A;  4EWD A;  4BH9 A;  5APA A;  4B4P A;  3ZVX A;  1D4M 3;  1RUH 3;  1HX6 A;  3DKW A;  1NQJ A;  1RVF 2;  3E97 A;  5FK8 A;  1VBB 3;  2FDG A;  5C4W B;  2WT0 A;  2LAL A;  4LQR A;  2N7G A;  2VNG A;  1ACC A;  4XW3 A;  1YI9 A;  2JDH A;  2Z4F A;  4JAA A;  4Y26 A;  4NUB A;  3TN9 2;  3W20 A;  4Q0P A;  1UX7 A;  4OUM A;  5FYS A;  4PLN A;  3KGL A;  4A7Z A;  5FUP A;  5FZC A;  5JOW A;  1G9C A;  4HXC A;  3D5O A;  4OHV A;  3T1L A;  4AFA A;  4IND A;  4IGO A;  1XNK A;  4JHT A;  1AR8 1;  1BBT 2;  2BFU L;  1PO1 2;  2YGM A;  1QJX 1;  2D6N A;  5F1R A;  1UY0 A;  1BK1 A;  1O5U A;  3ATG A;  2GP5 A;  1GWM A;  4GJZ A;  1SLA A;  2W47 A;  4A3Z A;  3HIF A;  3NV4 A;  1VMH A;  4QDR A;  4GKX A;  3N4M A;  1GZC A;  4IER A;  1MS0 A;  4AAX A;  5CBL A;  1S2K A;  3FBM A;  5JMC A;  5L9V A;  5EZW A;  2Y38 A;  3SKJ E;  1DQ6 A;  5A7Q A;  1AYM 2;  1AZD A;  3LE0 A;  3MIE A;  1RVF 1;  1S0E A;  4XDP A;  4GB3 2;  5FP7 A;  3WHU A;  4AVC A;  1TZO A;  3AYE A;  3OPW A;  2C1F A;  1GP5 A;  4HKW A;  1UWW A;  4JGZ A;  3RDI A;  2A1X A;  4FPY A;  4PLO A;  4Q1R A;  3ZR5 A;  1ND3 B;  1RXG A;  1BBT 3;  5KR7 A;  3TN9 3;  5FUI A;  1DIW A;  1D2Q A;  1MEC 3;  3MLJ A;  1VBB 1;  4M4R A;  1MQT B;  2ADD A;  3LPG A;  4XMI A;  4YFZ A;  3J8F 2;  4EZ4 A;  2RR1 3;  4KWU A;  3QH6 A;  4R4X A;  4L92 A;  1ZRF A;  3CJX A;  3H1Y A;  4Y4Y A;  2VGD A;  1TVG A;  5CFC C;  3C7O A;  4W6Y A;  1ZRR A;  1RMU 2;  2GSY A;  3III A;  4DEV A;  1A6C A;  2WO1 A;  4FOQ A;  5E6H A;  3NO8 A;  4P08 A;  1E57 A;  1ULE A;  3POY A;  3KQR A;  1AR9 1;  1CJD A;  2VMI A;  3OF1 A;  4Y5Z 0;  1JZ3 A;  3W58 A;  3NVC A;  4BCU A;  3RWN A;  2VBB A;  2GC1 A;  3C8X A;  4M0H A;  2A6Z A;  2BDR A;  4HK9 A;  3HEI A;  1GR3 A;  2V5Y A;  5D2A A;  5HPO A;  5IK4 A;  1XB9 A;  3VDA A;  1SDD B;  4C90 A;  2VE1 A;  4NRO A;  1WW7 A;  2H0B A;  2EAA A;  3FN9 A;  1JUI A;  2GNM A;  4CPB D;  1VRH 2;  5JXH A;  1UCX A;  4Y5S A;  4QKD A;  3B9I A;  5EWS A;  3C7E A;  4O9G A;  4IEO A;  4AHY A;  4Q0V A;  1R09 1;  4R52 A;  3T09 A;  5FYZ A;  3J8F 1;  1XU2 A;  2XL7 A;  5I0R A;  4AYU A;  1IPK A;  1MVE A;  4CEW C;  4CE8 A;  4NVP A;  1CJP A;  4RS5 C;  1UMZ A;  4YLZ A;  3ZFE C;  1B35 C;  1DZQ A;  3O1S A;  5IK8 A;  3GBF A;  4EN8 B;  3M3E A;  5C6C A;  3MEP A;  1XQN A;  3HN3 A;  2RJ2 A;  3ON7 A;  4LK7 A;  4YNI A;  2RS5 3;  1LGB A;  5E88 A;  2DBN A;  2XQX A;  1RUC 2;  1IPJ A;  4N53 A;  5CG9 A;  4IE6 A;  2Y0O A;  1VP6 A;  3VBR A;  3WQ7 A;  3POE A;  2ZML A;  2FCV A;  2W91 A;  4BDV B;  4XIK A;  1QHD A;  1UYZ A;  4WM7 A;  4KL1 A;  2B8M A;  3J7N A;  4MUV A;  4NMI A;  1POQ A;  2D3S A;  1WUV A;  3HVD A;  3IMM A;  3K4A A;  1VMJ A;  4LIV A;  1VJ2 A;  2W68 A;  1LEC A;  2ARC A;  3FWE A;  5A32 B;  3MIH A;  5K0U C;  3O1U A;  3H8R A;  1ZZC A;  3WD5 A;  1VIW B;  1CZS A;  4BQ4 A;  4PQ9 A;  4LO8 A;  5LRR A;  3ZSK A;  3KF3 A;  1E5R A;  1JYV A;  3USS A;  2VMF A;  3WX5 A;  3WW4 A;  1KGY A;  1UN1 A;  3NJY A;  4H2A A;  1W6M A;  3OUI A;  2HWF 3;  4AFC A;  2WYF A;  4SLI A;  3O7O A;  1NXM A;  3QH7 A;  1OLQ A;  5J48 A;  1AYN 2;  5FQ0 B;  1OD3 A;  3O14 A;  4RFT 0;  2ZGS A;  3U14 A;  3WUC A;  1X9P A;  2NZ9 A;  3NNF A;  4QD2 A;  5T50 A;  3LIG A;  4LOT A;  2VMC A;  4C1W A;  4HZF A;  1UZY A;  2BGC A;  3VBR B;  2HWC 2;  2VO5 A;  5CAZ A;  1WW6 A;  2IXI A;  1SBF A;  4NHL A;  4BIF A;  1XNT A;  2WL1 A;  2V4A A;  2VMG A;  4FP2 A;  4FAH A;  4MXW B;  2C9A A;  1HRI 2;  1FI2 A;  1H4H A;  3PL0 A;  4PQQ A;  1LCL A;  2OA2 A;  4V2W A;  2ARB A;  4NE9 A;  4FFG A;  4AZZ A;  3JD7 1;  3OPZ A;  2VW1 A;  1GOF A;  4NOT A;  2TEP A;  2DCZ A;  3BOP A;  3N35 A;  3NAP B;  4M00 A;  4XHB A;  1VBE 2;  4NRM A;  2QCS B;  3BTX A;  1EAH 3;  1X7N A;  1OSG A;  2DFB A;  2WSU A;  3E6D A;  1J3Q A;  1RB8 G;  5DUW A;  4FQ4 A;  1MAC A;  3RI8 A;  4QXC A;  4MX3 A;  1F5F A;  1NLS A;  1LU2 A;  4AOC A;  3C7G A;  3ITQ A;  3T2Q A;  2G9F A;  3AXE A;  3K2O A;  1BCX A;  4N43 A;  2YFZ A;  4Z1V A;  1O7F A;  2XKO A;  2ZEY A;  4A44 A;  4X6Q B;  3WIN E;  5FBJ A;  1FOD 2;  2PHR A;  1YIP A;  4LBJ A;  5FPX A;  3ACF A;  2JEC A;  4FFI A;  5FP8 A;  5FPL A;  1W03 A;  1DLC A;  3EHK A;  4XFC A;  1KDM A;  5E1R A;  2G1M A;  2WNU A;  4O7X A;  3DXT A;  1VBA 3;  1H1A A;  1CAX B;  1K12 A;  4LHS A;  4R9D A;  4XCA A;  4ZS3 A;  5I93 A;  2IC1 A;  4DB5 A;  1YUD A;  4KU7 A;  1MS4 A;  3JZV A;  1HRI 1;  2PQS A;  2NLR A;  4GMP 1;  3HJR A;  4PIX A;  1DP0 A;  4I30 A;  3TEX A;  1GOG A;  2Q1Z B;  2ZGK A;  3PUQ A;  3I3M A;  5A7O A;  1TME 1;  1W8O A;  3CO2 A;  4NHX A;  5T5L A;  2DUP A;  3ZN5 A;  3J7L A;  3LEI A;  4GA9 A;  2MEV 1;  3ALQ A;  3I2H A;  1QGL A;  4LBN A;  1ZYB A;  4CP9 B;  3M8L A;  5FZ1 A;  1MS8 A;  5A7N A;  2YRO A;  2P2K A;  3AVR A;  5F5I A;  4YZ1 A;  4YW5 A;  4A41 A;  2VC9 A;  2WZE A;  3NKT A;  2EIC A;  2W1W A;  2HWD 3;  4FPG A;  4WM8 C;  4IQP A;  2ZA9 A;  3IMN A;  1RED A;  4I3G A;  3ZFE B;  1OD5 A;  3H1M A;  1OHF A;  2YMZ A;  1HXS 1;  5KXD A;  1CQ9 A;  4XUR A;  4Q4X 2;  1O8S A;  1VBA 2;  5L7O C;  2O8O A;  1DZT A;  1U0A A;  1CAW A;  2VXR A;  1GZW A;  1FOD 1;  1W2N A;  2VZ3 A;  4SBV A;  4W6W A;  2CYF A;  4WVV A;  3HOB A;  1ZRI A;  1J3P A;  1E5I A;  4QQO A;  3ZN6 B;  1K3I A;  1HW5 A;  3O1T A;  1CPM A;  1REF A;  2JD9 A;  2O14 A;  3ZO0 B;  4XJA A;  4NII A;  3I3D A;  2ZGN A;  1PK6 A;  2HBT A;  2LRP A;  5FYT A;  4CU6 A;  4BK5 A;  4UFK A;  4D3W A;  1HN1 A;  3AC0 A;  3HBZ A;  4QX7 A;  1Q3E A;  2DCY A;  3T08 A;  4D7Y A;  1GYK A;  2F6B A;  3N7J A;  3QCW A;  1UX6 A;  4JV4 A;  1D4V B;  2FCU A;  2PFW A;  2XBO 2;  3OD4 A;  3DGT A;  4J25 A;  4BQ5 A;  1MR5 A;  4N9I A;  1VRH 3;  1BQP A;  3VKL A;  3DXU A;  5FZI A;  2Q5T A;  3HT1 A;  4AED B;  3HNB M;  4FXK B;  4WM8 B;  2WO2 A;  2DVD A;  2ERF A;  3B7M A;  3UKV A;  3CZJ A;  1AL2 3;  5F6K A;  1K5M C;  4LKF A;  5BNO A;  2J1R A;  4YG3 A;  3SHR A;  4W6X A;  1D0G A;  1DG6 A;  2WDB A;  3U75 A;  4HSL A;  5CKN A;  2X8K A;  5JDB A;  4Q4X 1;  4A42 A;  1WW4 A;  2JG8 C;  4OZX A;  1PZ8 A;  4QU2 A;  3BB6 A;  5JXI A;  5JWP A;  1RUI 1;  4Q1P A;  1BLZ A;  3BCW A;  1FPN 2;  3IB3 A;  3LDK A;  5FMD A;  3PJY A;  2Z5W A;  5BYN A;  2ZAA A;  3NNL A;  2NMN A;  3WF4 A;  3HN1 A;  5LEJ A;  2PEL A;  3K75 B;  5F6L B;  3OBR A;  3UT0 A;  2QDN A;  4IV1 C;  4K8F A;  5LA2 A;  1LHO A;  2QJV A;  3M2M A;  3PTY A;  1QXR A;  1S0C A;  2G19 A;  1Q56 A;  2PQQ A;  5FKB A;  4CCJ A;  5FZH A;  2XBO 1;  3ZYJ B;  2DTW A;  4M3C B;  3ZFG A;  2FZ2 A;  2R1D A;  4Y20 B;  4HPK B;  5F8P A;  2OYZ A;  1N3O A;  1PO2 1;  2ZJC A;  4Q27 A;  1SDW A;  1V9U 2;  5SV8 A;  5C9A B;  2UWA A;  2E53 A;  2XUE A;  3LZZ A;  3RS6 A;  4D7T A;  2ZCW A;  3POI A;  3T30 A;  2ZGQ A;  3LOI A;  4BZ4 A;  5C9A A;  1JZ5 A;  4Q4Y 2;  3O1M A;  1YEW A;  2AEZ A;  3DPR B;  4N43 C;  3AFG A;  2WBK A;  5JXJ A;  3KGZ A;  2FBE A;  2VH9 A;  4AQ6 A;  4JTN A;  3ZSL A;  3VHO A;  2VBP A;  2VUC A;  4Y1V A;  4MET A;  5AVA A;  2Y6H A;  4UFH A;  1DZR A;  2ZBJ A;  2VTF A;  1KJL A;  3KWV A;  3A4U A;  5F3I A;  4ES8 A;  3VDD C;  1FPN 1;  4COY A;  2FDK A;  3KVA A;  2GN3 A;  2WC2 A;  2JG9 B;  3T1M A;  1TE1 B;  1YFW A;  4QXH A;  1HJF A;  1Y4W A;  2RS3 2;  2VXJ A;  4EJR A;  5DUX A;  5FYH A;  2UU8 A;  4Y4R A;  1IHM A;  5C3O A;  3WG1 A;  1W6N B;  2VOT A;  4P9G A;  4NPR A;  1FT9 A;  2WIN B;  2XH6 A;  3W5M A;  1EV1 2;  1RUE 2;  2DVG A;  4XUP A;  4YW1 A;  2R49 A;  3P6B A;  3ZFF C;  4GH4 B;  4I3P A;  4ZON A;  1YQ2 A;  1SFN A;  4IEV A;  4EYU A;  2R7E B;  1DGW X;  1I5Z A;  2JB4 A;  1RUO A;  1I6X A;  2WAA A;  3LA3 A;  4Q8L A;  1OVS A;  1V6M A;  5C8C A;  2D3R A;  4X6R B;  2YBK A;  2X5I A;  1AR9 3;  3RZZ A;  3KVB A;  4F7Z A;  4HOO A;  4MGI E;  3B02 A;  2A75 A;  4FCA A;  3RZG A;  1AXZ A;  5ISL A;  3VDC A;  1LGC A;  2MNG A;  1VBC 2;  2GH2 A;  4YM0 A;  3NV3 A;  4XF3 A;  3WQB A;  2YB7 A;  5CZK A;  3ZR6 A;  2GND A;  4W50 A;  1PM7 A;  4FOY A;  3T0A A;  2Y33 A;  2OZJ A;  1QJZ A;  3GJB A;  4LO7 A;  5CFC B;  3FUO A;  2HWB 3;  2RR1 1;  1QMJ A;  3JBG 1;  4ITC A;  3WSO A;  4DXZ A;  1PM4 A;  4KWK A;  1MEC 1;  1Q8O A;  2K9Z A;  2WKK A;  3WR0 A;  3H8X A;  4YM1 A;  2BZD A;  2WS9 2;  2I07 B;  2IXK A;  4NPL A;  5DAX A;  1Z7S 1;  2ET7 A;  3APB A;  1EPZ A;  4TWT A;  1HB1 A;  4FOV A;  4K1Z A;  4YZ4 A;  3ZSM A;  3ZSJ A;  4PBP A;  1GFF 2;  1JYC A;  5AFE A;  1JOB A;  4XET A;  2XVG A;  3WF0 A;  4HMZ A;  2BPA 2;  4FPJ A;  2W39 A;  2EIE A;  3FFZ A;  1HN0 A;  2UY9 A;  3NV2 A;  2YYO A;  4QU1 A;  4CP9 A;  1HIX A;  2R04 2;  4CEY A;  4XJU A;  3C7F A;  3MW2 A;  5LA1 A;  3K3N A;  3VHP A;  1WCD J;  1GIC A;  4BOW A;  5ERL A;  2B7Y A;  2PAK A;  2BTV C;  2MPF A;  3CEW A;  3ELN A;  3ECQ A;  3POB A;  1W39 A;  1TMF 2;  2JDN A;  1NAE A;  4OUL A;  2VUD A;  4E2S A;  1OPM A;  2QFE A;  3SCF A;  5JI9 A;  3OTF A;  1ZRC A;  4CDW B;  3BI3 A;  4OUE A;  4DO0 A;  1AR8 3;  1YO8 A;  4W8J A;  4CDQ B;  5BNN B;  2RS1 1;  4AVS A;  5ABJ C;  4CEW A;  3U10 A;  4E4D X;  2E31 A;  2VCA A;  1I9R A;  5L9B A;  4M01 A;  1IQA A;  1URX A;  4WVM A;  5IFT A;  4RSU A;  1GNY A;  1QH6 A;  2WNV C;  5F5C A;  3V56 A;  4CDU C;  3HQR A;  5LCW L;  1ZRD A;  3NJV A;  1N1Y A;  4E2Q A;  3NMB A;  3U07 A;  5FZA A;  2Z79 A;  4UBG A;  4UFM A;  3VBF A;  2CNA A;  5A3L A;  2HWE 1;  4E4H A;  1RIT A;  5F5Q A;  2DFC A;  4I0A A;  1NCQ B;  4AQS A;  2B9V A;  4FSJ A;  1N3P A;  2VVF A;  2NM1 A;  2P3I A;  3WCR A;  5E89 A;  2VQT A;  1WCU A;  2XKP A;  3PMS A;  2CWS A;  2TUN A;  4BWO A;  3F2Z A;  5DG1 A;  2XLA A;  3DYM A;  4WBB A;  2XXZ A;  1PIV 1;  3HD8 B;  5KC6 A;  3AP7 A;  5L9R A;  2FQP A;  4LR4 A;  3VBH C;  4ASL A;  3NWK A;  1G86 A;  1S0I A;  1WA4 A;  1KEX A;  3PUI A;  2NMO A;  2J1T A;  4R9B A;  1POV 1;  4V2V A;  1DBN A;  5EJ3 A;  1RGS A;  1ZBE 1;  1OFS A;  4NWV A;  5FJH A;  3OOX A;  2R30 A;  1XE7 A;  4GWI A;  4XXA A;  1YWK A;  2VD7 A;  4RL7 A;  5SV5 A;  1ZBE 3;  3VZJ A;  4I01 A;  1V6K A;  2R1B A;  2A3Y A;  3GNE A;  1C28 A;  3H3U A;  4RN5 A;  4UWD A;  4CP2 A;  1GZW B;  3U37 A;  1LOF A;  4LIT A;  3CKH A;  4XUN A;  4YWA A;  4BJ0 A;  3NRU A;  4UFL A;  1LU1 A;  2JJ6 A;  2VNR A;  3I7D A;  3WG3 A;  4XFF A;  5IUQ A;  1O8P A;  2XG3 A;  1FNZ A;  4FP3 A;  5EXO A;  3OYW A;  3TEZ A;  3SCH A;  2P34 A;  4QX2 A;  2JE7 A;  3DN7 A;  1H2K A;  3S5A A;  2KD7 A;  1OQE A;  3IDE A;  3JB8 A;  1LHN A;  2WFF 3;  3PVB B;  3UES A;  2OZ6 A;  5EHD A;  1OOP C;  3T0B A;  1QQP 1;  5FZ4 A;  3TN9 1;  4COW A;  4Y20 A;  1AR6 1;  2P4E A;  5FLJ A;  5G05 L;  1OKO A;  1PIV 3;  2D43 A;  3AP5 A;  4KH9 A;  1COV 2;  3ZXE A;  4A7Y A;  1VAK A;  5CFD A;  1CAX A;  3ETP A;  3LDB A;  2ORX A;  2GC2 A;  1SFP A;  1IPS A;  2IUW A;  5LK5 A;  4OHY A;  3HR9 A;  1QY4 A;  3MFA A;  5J09 A;  2D6M A;  1GMM A;  4XF0 A;  4YG6 A;  2J22 A;  1WME A;  1G8W A;  1W9Y A;  1L7L A;  5DXD A;  2XJT A;  1NX9 A;  4ZU4 A;  4LJH A;  5FY4 A;  5JIU A;  4ZXE A;  1C1F A;  2HWE 3;  2YBS A;  5FJK A;  4Q5O A;  2ZMN A;  5A1L A;  2J42 A;  1RUF 1;  4MGY E;  1GU3 A;  3MPB A;  3WNN A;  3AJY A;  2W2I A;  2XJS A;  3LB9 A;  4BYY A;  1RXF A;  5IVY A;  4BQ2 A;  1PO1 3;  2F17 A;  1Y43 B;  1QJY 3;  2WQ4 A;  2J1U A;  2WWJ A;  3CU7 A;  4S2H A;  1C5I A;  4W65 A;  4LE3 A;  4LBQ A;  3FLP A;  5FK7 A;  4BQ3 A;  1YQ5 A;  4MLO A;  4XZP A;  4GB3 1;  2BQP A;  4WM8 A;  2FDJ A;  3BTY A;  4IUG A;  4YVW A;  1F15 A;  5DDJ 1;  1Y9Q A;  5FIX A;  5T54 A;  1ZA7 A;  2YC4 A;  4YGC A;  1DU3 D;  1SBD A;  1V6I A;  1BEV 2;  5FXX A;  3R6S A;  3C2U A;  4MXW A;  2OS2 A;  5EQU A;  1NT0 A;  4O65 A;  3G6J B;  2PHX A;  1VBB 2;  2D5H A;  1OLM E;  1XND A;  3KCY A;  4LKS A;  4XFI A;  1T2X A;  2RHP A;  1OLM A;  1DLL A;  4GH4 A;  4XMA A;  2JDM A;  4Y1X A;  3VBS C;  2SLI A;  1HRV 1;  1RUH 1;  4AFM A;  1LAJ A;  5T5O A;  3CHX A;  4CSW A;  1DYP A;  2GH8 A;  2R16 A;  2BER A;  2DF7 A;  3ZN6 A;  4CXY A;  3KHC A;  3B93 A;  1NA1 C;  5ACA 1;  2BBA A;  3VHN A;  4QPG C;  1AR7 3;  1RUF 2;  1DQ1 A;  4FVV A;  1HV0 A;  3PVN A;  4U36 A;  1RHI 1;  2HWB 2;  5L7O B;  3LA2 A;  1ZBA 1;  1JOP A;  2QQO A;  3WG2 A;  4FPO B;  1Z7S 3;  5A7W B;  2V73 A;  2BRT A;  5FZK A;  4ET7 A;  1VRB A;  1LGN A;  4P9W A;  5GLV A;  2OII A;  2A3X A;  3NW4 A;  1GOH A;  4DQA A;  4NR1 A;  4UW5 A;  4LO6 B;  4NAO A;  2FDH A;  1PVC 3;  1JS9 A;  5E8A A;  1SZB A;  4PI0 A;  1JZ7 A;  3O1R A;  1ZNP A;  1JUH A;  4AVA A;  1LOG A;  4ARX A;  2PLV 3;  4TZD A;  4MO3 M;  1OMI A;  2QQK A;  5DQ0 A;  3U78 A;  1ZM1 A;  4XTP A;  4AVT A;  5A3N A;  2ILM A;  1XXN A;  2Y64 A;  4BB3 A;  4D8M A;  3UJQ A;  5K8S A;  4FTS A;  1GLH A;  5LEK A;  2WZR 2;  1W6Q A;  3VD5 A;  4HSJ A;  4QDQ A;  5HCB A;  4AGR A;  5IK5 A;  1CN1 A;  1W8N A;  3JQW A;  3GZA A;  1OOP B;  3RYR A;  1PNF A;  1RUD 2;  3VBR C;  3I8T A;  3R4S A;  4K1Y A;  4KQ7 A;  5EFU A;  3S57 A;  1OVP A;  3CJI B;  1S1A A;  2R07 3;  3SIS A;  3H7Y A;  4O61 A;  4EN0 A;  3V0B A;  1FNY A;  3ST7 A;  3ZOI A;  4FXG B;  4BXF A;  1LR5 A;  2GZW A;  5HV4 A;  4FPH A;  2QQW A;  2B42 B;  2X09 A;  4C1X A;  3I3B A;  5EYY A;  3BU7 A;  1VBD 3;  5H9P A;  2AEN A;  2QTW B;  2RG4 A;  3A0N A;  3ME2 A;  1ZVF A;  3PUR A;  4ZU7 A;  3RZM A;  2RS3 3;  3ZYB A;  1OI6 A;  2E7A A;  2B39 A;  3ZXD A;  5K9Y A;  3DYO A;  4Y24 A;  4AI0 A;  3NL1 A;  5FY1 A;  3CF6 E;  2XLG A;  1CX4 A;  1H6X A;  1J1L A;  5CEH A;  3HQU A;  1L7R A;  3N9Q A;  4ISQ A;  4S2D A;  1J3R A;  2ZPX A;  1H8T A;  5FYM A;  2GNT A;  2YPJ A;  1PX4 A;  1Y3T A;  1R1Z A;  2YV8 A;  3MIG A;  2IXC A;  4NPM A;  2J1A A;  3SXW A;  5AFB A;  3SH4 A;  3QBQ A;  1P8J A;  5A1F A;  1K45 A;  2ZS6 B;  3HWJ A;  2ZOE B;  1WCK A;  2VQU A;  3O0W A;  2PAE A;  1QJF A;  1PGW 2;  3ZN4 A;  1OXC A;  1ULC A;  1VBD 2;  3NAP C;  5C3S A;  5F7U A;  1FV3 A;  1EAH 2;  2D93 A;  1HQW A;  2D3P A;  3OJB A;  4ARY A;  5CVR A;  4BQ1 A;  5FXW A;  2TNF A;  2A6W A;  1WLT A;  4IEP A;  1B09 A;  3DUI A;  4J1X A;  4JQT A;  3I2K A;  4B1L A;  4QQL A;  4CDW A;  5HXM A;  4JGY C;  4XF4 A;  2BGP A;  1TMF 3;  5FZO A;  2PHU A;  2I2S A;  5I0U A;  4GH4 C;  5DZG A;  5JSO A;  4DOU A;  2DV9 A;  5B4N A;  5CFC A;  3I54 A;  1YFY A;  1R08 2;  4E4S A;  3GBW A;  3WEZ A;  1EY2 A;  2OT7 A;  1JHJ A;  1RL3 A;  2OXB A;  3POF A;  4Q4V 3;  3SKV A;  3TRS B;  3L9J T;  2YU2 A;  4OI0 A;  4AF9 A;  2D6L X;  2YUE A;  5F5A A;  4I02 A;  2YDE A;  3RMX A;  3VD4 A;  1XE0 A;  2BNN A;  3DKQ A;  2BGO A;  1ZZ8 A;  3HMY A;  5LK7 B;  2R0F A;  1LOE A;  3WQ1 A;  4BQX A;  1Y9M A;  2BNM A;  2EXK A;  2HWD 1;  1S0G A;  4ATF A;  1U5X A;  5BNO C;  1VBD 1;  2Q8C A;  4XDO A;  1JXN A;  4H7L A;  1V70 A;  1TME 2;  1HJG A;  1UU6 A;  3WF1 A;  2ZGM A;  5IVB A;  1RUG 2;  2VUA A;  4P9J A;  4P02 B;  4GJY A;  2IZW A;  1VB2 A;  1LHV A;  4AI3 A;  5FKC A;  3LA7 A;  1GQP A;  3R4U A;  1BXH A;  1WLC A;  1ZZ7 A;  3MGU A;  3IWZ A;  3TB0 A;  1AX0 A;  3FJS A;  2WZ8 A;  2ARE A;  3O1V A;  4BLI A;  2GDF A;  1AVB A;  3SCG A;  1YLL A;  3J26 N;  3ZYG A;  3Q8B A;  3TBD A;  1IKQ A;  1H8V A;  1VBA 1;  5J7M A;  5T55 A;  1UZW A;  5I91 A;  3FLR A;  2PTM A;  4H3W A;  1S2E A;  3A22 A;  3OGR A;  3W9A A;  3NJZ A;  1T6G C;  1VPH A;  1C4R A;  1JU3 A;  1UPS A;  1NZC A;  2P3J A;  4HN0 A;  3NNJ A;  1SCS A;  2YXS A;  4OVE A;  4LT5 A;  1QDC A;  1AHS A;  3PNA A;  4JRL A;  4NIH A;  3VKM A;  4A45 A;  3BVC A;  3USU A;  2ZAB A;  1ZX5 A;  3LWC A;  5FYU A;  1W6N A;  1DFQ A;  2FMY A;  1GAN A;  5FY7 A;  5KXE A;  5EP9 A;  4GMP 3;  1ND3 A;  1W2T A;  2VW2 A;  2WZP P;  1JOJ A;  3IKW A;  4IES A;  3MO4 A;  3WDV A;  1N1S A;  2E63 A;  1LJ7 A;  1AXY A;  5D8A A;  1YC6 1;  5K0U A;  1C5H A;  1W2A X;  3WVJ A;  1LTE A;  1RIR A;  3OGS A;  4V1P A;  3WP3 A;  3OD0 A;  5CFD B;  4JRA A;  4LBK A;  3ZKU A;  1E5H A;  1ZA4 A;  2R06 1;  5JZG A;  1W99 A;  4DEQ A;  1RC6 A;  5ACA 3;  4B3N A;  5F9T A;  5JOX A;  4KGQ A;  3FUQ A;  2ENR A;  3H8U A;  5ANN A;  3AKS A;  3ORJ A;  1OLR A;  1L7Q A;  1H8T C;  2LUW A;  2CWM A;  1M06 G;  5CNA A;  1W3X A;  2BJS A;  4Q8K A;  3AX4 A;  4KMQ A;  2WUH A;  3ES1 A;  2P37 A;  5K7P A;  2MHF A;  1STM A;  5AC9 2;  5KC5 A;  2HWF 1;  2CDP A;  4DIN B;  1K5J A;  2D5F A;  1Q8P A;  2AH2 A;  4MSV A;  2JX9 A;  4NIG A;  1IQD C;  2WJS A;  1JZ4 A;  3SLI A;  4CU9 A;  4EE2 A;  1R1A 1;  1B35 B;  1PMJ X;  1F2N A;  1CAU B;  2X53 S;  3K4Z A;  2LRO A;  3O0V A;  4QB6 A;  1WD3 A;  1DQ0 A;  3K77 A;  3VD9 A;  2W92 A;  2VZR A;  3AXD A;  1O59 A;  2JG8 B;  4XBN A;  1NCR C;  2HEW F;  1JYI A;  2DVA A;  2R06 2;  1TQ5 A;  3N9L A;  3FHQ A;  5A7S A;  2ZHK A;  4GWJ A;  2HWC 1;  3EB7 A;  1BYH A;  3U0Z A;  3CQO A;  4AAP A;  2A71 A;  1WWY A;  3B94 A;  1WBL A;  3BYW A;  1ZZ9 A;  1XNB A;  3L2H A;  4B1M A;  3UNP A;  1NG0 A;  2YHJ A;  4UW4 A;  4FFF A;  5FPB A;  5FMC A;  4AED A;  3JD7 2;  5F3C A;  3CIH A;  2X5I B;  3VBO C;  2RS3 1;  1UKG A;  1VBE 1;  3BPS A;  4LA3 A;  3ZM8 A;  2H6B A;  4I0B A;  2WT2 A;  3O5S A;  3LEK A;  3HBK A;  1QQP 3;  1ASJ 3;  4CEY C;  1IOA A;  1UOF A;  2NP0 A;  1R1A 2;  4ATE A;  3AYD A;  5A7P A;  3OBZ A;  3PJQ A;  2BV4 A;  4A2U A;  3DYP A;  4Q26 A;  5FOJ B;  3MPP G;  3ILR A;  1AJK A;  1YXW A;  4B7E A;  3KMH A;  1K5M B;  4MGK E;  1SFY A;  1SPP A;  4I0W B;  5F32 A;  5H9S A;  4HAN A;  4MZU A;  4MGT A;  2RS5 1;  3PHM A;  3R0R A;  4LUM A;  2EAL A;  1UXX X;  4D6Q A;  5FZ6 A;  3T2T A;  1C8M 2;  1R08 3;  2JG9 A;  5CIS A;  1AXK A;  1VE0 A;  1OA2 A;  2ZGP A;  1W0P A;  2E7T A;  5CA6 A;  1GUI A;  4QT6 A;  3IM0 A;  4YW6 A;  3EBR A;  1V9U 3;  3OBA A;  5JSR A;  1N47 A;  2VME A;  4L97 A;  4CYD A;  4F8A A;  4K7J A;  1DDL A;  2GAL A;  5A3O A;  3NNM A;  4CDU A;  5D1I A;  2XPJ A;  2XWJ B;  4G4F A;  5LB6 A;  1H6Y A;  1OUR A;  4NIA A;  5JOZ A;  4KG0 A;  2PN5 A;  3RZH A;  1PVC 1;  3PU8 A;  1J59 A;  2W1Q A;  2MEV 2;  3OEB A;  4CEY B;  1Q5O A;  2DU0 A;  4LOR A;  4N53 B;  1CGP A;  3I2D A;  3P5B A;  3VZK A;  3RQ0 A;  3HAG A;  1V6N A;  2BFU S;  2CSG A;  2VZ1 A;  1CAV B;  3K3O A;  1GZ9 A;  4Y22 A;  3O1O A;  1JOD A;  3IBM A;  1NKG A;  3R4D B;  4CZS A;  1S4C A;  1PNG A;  3EXU A;  2IVI B;  1ONA A;  4Q4W 2;  1ZBA 3;  2EIB A;  4XBL A;  5IJR A;  3SC7 X;  1G9A A;  2JDZ A;  5HBA A;  5FZF A;  1O3Q A;  3JQX A;  1JYN A;  2JE9 A;  2JWP A;  1HKD A;  3BTA A;  4N7I A;  3FMG A;  4NJ4 A;  5JUV A;  3BIW E;  3ZMO A;  5JOY A;  2AR6 A;  1TG7 A;  2ZGT A;  4YSF A;  5FLI A;  2CAU A;  2Y6F A;  1EUT A;  2BUK A;  5F39 A;  1IS3 A;  1W8U A;  5EIY B;  3N9N A;  3DF0 A;  5FZ3 A;  2QQU A;  4CCO A;  2EXI A;  1BBT 1;  4A4A A;  3WOG A;  1LOF C;  2RS1 2;  3DCQ A;  4YW4 A;  3K46 A;  3L2Y A;  4HET A;  3H42 B;  1QOT A;  4UOJ A;  4XZU G;  4UFJ A;  4IEU A;  2LW8 A;  4JKL A;  1X33 A;  4LHL A;  1U5Y A;  1QDO A;  2OX0 A;  1J1T A;  4XUQ A;  3WW3 A;  5AVP A;  4OHZ A;  2WNO A;  4IE7 A;  3J4U H;  3LCP A;  5FYB A;  3U4X A;  4Q4W 1;  1I3H A;  3WG4 A;  1UO9 A;  2WSV A;  2WN3 A;  1MS3 A;  2D44 A;  1MQT A;  2BU9 A;  3M3I A;  5LRS A;  2JDY A;  3D0S A;  4JQR A;  4IXL A;  3Q8A A;  2E9Q A;  4XC9 A;  1JZ2 A;  1H0B A;  1S0F A;  2JIC A;  1UOB A;  2Y8K A;  4IEQ A;  2X05 A;  4XF1 A;  2QQV A;  1ULD A;  4COV A;  4RGG A;  4AEJ A;  3OUJ A;  4QB2 A;  1W28 A;  2SBA A;  4XTM A;  3VZO A;  4DNY A;  2Y6J A;  4H7M A;  3WW2 A;  5IK7 A;  4RS5 B;  4L2N A;  3OB8 A;  3KSC A;  4DPN A;  1ZBE 2;  4XFA A;  4YW7 A;  3VGI A;  1W6O B;  4IV3 B;  3DPR A;  2WT1 A;  5JPM B;  1DQ2 A;  3USU B;  4XCB A;  1AR9 2;  4L11 A;  4U2A A;  2GN7 A;  1W9W A;  4L99 A;  4QM8 A;  2DTY A;  3F95 A;  3I3E A;  4LHN A;  4UW3 A;  1YHF A;  5EYX A;  2ZGL A;  3SNM A;  1DGW A;  2VZQ A;  4BMB A;  4AWD A;  3GXU A;  1QKQ A;  2QUO A;  1FMD 3;  1REE A;  2Y0I A;  4HKL A;  3MIB A;  4JC1 A;  4ISR A;  2EVX A;  3IN9 A;  3ZXF A;  4JGZ C;  4NHM A;  1ENR A;  1QIQ A;  2X29 A;  4XBQ A;  2EID A;  4ASK A;  1UNB A;  2P6C A;  1R09 2;  3KCC A;  1YFU A;  4XFG A;  1WLD A;  4LXL A;  4CDX B;  1W06 A;  4FBF A;  3ZSE A;  3QAC A;  4FAG A;  1AX2 A;  3VZL A;  1VR3 A;  5CIR A;  5FWJ A;  4CU7 A;  5JPN B;  1BVV A;  1Q8V A;  1W6P A;  1IKP A;  1EP0 A;  1FX5 A;  1LRH A;  1H1I A;  1YFX A;  5FUN A;  2NPI A;  4QHO A;  1QQP 2;  4IV3 C;  4ZY9 A;  4JZR A;  4QPI A;  3UJO A;  2R6Q A;  4AI9 A;  3MW3 A;  2VZP A;  3U11 A;  3VD3 A;  2WNV B;  2CL2 A;  1RUD 3;  2EA7 A;  2W9X A;  1COV 1;  2ETE A;  1TEI A;  3C3V A;  3KD4 A;  2UUR A;  5GLU A;  1RUC 1;  4LNV A;  2VM9 A;  2BVV A;  1CAU A;  1FPN 3;  1G6N A;  3I49 A;  3HPN A;  1QWR A;  1OKQ A;  1W9S A;  4COZ A;  2LTN A;  2R32 A;  3ZLI A;  5TSW A;  5LBE A;  2Q8O A;  3MLL A;  4AGG A;  1GKB A;  2AAC A;  3X29 B;  1YIF A;  2PYT A;  2QVS B;  2Y34 A;  1RMU 3;  3FX3 A;  2RE9 A;  4E8D A;  4WZF A;  4AEM A;  3VBU C;  2ZTN A;  5A33 A;  4D0Q A;  3AZX A;  4GKY A;  4ZXK A;  4YVS B;  4JDO A;  4XAA A;  4BME A;  1HQN A;  1U5Z A;  5FZO B;  1MEC 2;  2ZHL A;  1NE4 A;  5CG8 A;  4L8Q A;  1AYN 1;  1SLL A;  2FHR A;  3PUS A;  4P9Y A;  4Y1U A;  4AQ2 A;  4ASM B;  1BEV 3;  1CAW B;  1T6B X;  2D6K A;  1GZT A;  1JYX A;  1C8N A;  5DDJ 2;  3NST A;  3WY6 A;  2QQI A;  1G9B A;  3VUO A;  3NNG A;  5D8A B;  5HXV A;  1WBF A;  4AG4 A;  1J84 A;  5FRE A;  5FP9 A;  2WO7 A;  3GBG A;  3T4H B;  2QDR A;  4AE2 A;  4DXS A;  3THP A;  4Q0Q A;  4TLG A;  4UF0 A;  5FZ8 A;  3W21 A;  4IE4 A;  4RHV 3;  1A78 A;  5FAX A;  1C1L A;  4YVS A;  4E2G A;  4CP0 A;  4B29 A;  3VBU B;  3ASI A;  3ZX7 A;  1SCR A;  2W52 A;  3ENR A;  3FLT A;  1OF3 A;  1GSL A;  4OHX A;  4MHU A;  3UV9 A;  2R06 3;  2DUR A;  2CAV A;  4MV2 A;  3VN4 A;  3SEE A;  1BK0 A;  4URT A;  3I2G A;  5BNN C;  1FMD 1;  4PIZ A;  3ZMN A;  2WNU C;  2RJK A;  4AK3 A;  3WNK A;  3E5Q A;  2VQ0 A;  2ZEZ A;  3NKG A;  4G3Y C;  2YG0 A;  1IZ3 A;  1QOO A;  4LBQ B;  4BQW A;  1LED A;  1XYN A;  4HVO A;  5C4W C;  3AJZ A;  3VBH A;  2E26 A;  2QE3 A;  4AHW A;  2XL9 A;  2ZX0 A;  3THT A;  2RDR A;  4C91 A;  1NYW A;  5F2W A;  3AFK A;  2JG8 A;  2OKX A;  4HK8 A;  2RMU 2;  1PGL 2;  2ZXQ A;  4CDX A;  2C24 A;  2FCT A;  4IE0 A;  5BY5 A;  1FXZ A;  1IS6 A;  1ND2 B;  1W8F A;  3KQ4 B;  1GWL A;  4YFW A;  5DZE A;  2Q8D A;  3A23 A;  5CAD A;  5C5T A;  1ZRE A;  2E7Q A;  2UWB A;  2IFR A;  2WZR 1;  4FO9 A;  2XHN A;  2UYA A;  2QBX A;  3WP6 A;  4M4P A;  2VEC A;  4MG2 A;  4CUA A;  3T0D A;  2CGO A;  2WRA A;  4BM8 A;  3ZXG A;  4LBO A;  1FMD 2;  2VZO A;  4W4Z A;  4CRQ A;  3H8O A;  4M3C F;  1W05 A;  2QQJ A;  2AUY A;  1RTV A;  3GHN A;  4HL0 A;  4LHK A;  4OMC A;  4FI9 A;  1HDK A;  1UF2 C;  1WCQ A;  1W6O A;  2K2S A;  3IPV B;  4IV3 A;  1HQL A;  1QXJ A;  2HLE A;  4LBQ D;  1AR8 2;  1GP6 A;  1AL2 2;  4CDU B;  2EXJ A;  1HRI 3;  4XE9 A;  3T3Y A;  1KXG A;  3T2P A;  4JGZ B;  3GZU C;  4QXK A;  3A7Q A;  4O9E A;  5ANQ A;  5BPX A;  4ZZ8 A;  4YG0 A;  2YU1 A;  1ENS A;  2IWG B;  1LOB A;  2ZHN A;  3U4S A;  4NHK A;  5FDB A;  5IFP A;  5LA9 A;  1CZV A;  2RMU 1;  1PGL 1;  4FPF A;  2XHK A;  2A3W A;  5E16 A;  4B8E A;  1F35 A;  2XON A;  4Q4V 1;  1UMI A;  4LE4 A;  4JCK A;  5GZG A;  3S0M A;  2QNK A;  1K5M A;  3C7H A;  4BPZ A;  1ULG A;  2VR4 A;  3J7H A;  4G9S B;  1WKY A;  2G9G A;  3MUZ 1;  1O4Z A;  4E8C A;  1G9F A;  5DAB A;  1PO2 3;  5FO7 B;  3EJK A;  3KLS A;  2Y6L A;  3FL7 A;  4RR3 A;  2WS9 3;  5I8Y A;  4MGQ A;  2AGS A;  1EAH 1;  1MZF A;  4DMI A;  4QKN A;  4IEY A;  1UYX A;  2PA7 A;  3B00 A;  3KT4 A;  3WQ0 A;  2J1S A;  1KS5 A;  5F3E A;  5K4L A;  2BEO A;  1LOA A;  3AKR A;  4AVB A;  4CCC A;  4YM3 A;  2Q1M A;  2ZKL A;  4PT6 A;  2W95 A;  3PLQ A;  3PIJ A;  5FZD A;  4ZKT B;  5BUV A;  3BGA A;  4TXW A;  3QOP A;  3UKT A;  3WDT A;  1RJ8 A;  3PME A;  4P00 B;  4TYS A;  4ONU A;  1XU1 A;  3WZ1 A;  3VBS B;  5FR3 A;  2KXL A;  3I2J A;  1PZ7 A;  4N53 C;  3ZYF A;  4CPB A;  1W0O A;  4Q4X 3;  2ZX4 A;  2JDU A;  3TYJ A;  1UY3 A;  3SQO A;  5BV6 A;  3CJI A;  1NA1 A;  4OCT A;  3Q9O A;  3ZYP A;  4GMP 0;  5FY5 A;  3RZL A;  1GWK A;  1SEF A;  3M4F A;  4LO5 B;  4WVM B;  5C3Q A;  3ABZ A;  4JVA A;  2PHW A;  2XWB B;  1V9U 1;  3N9M A;  3OEA A;  4RD7 A;  3TWI A;  4DFS A;  5LAT A;  3H50 A;  1EV1 3;  3I2O A;  3LPF A;  2HWD 2;  1GV9 A;  4Q4Y 1;  4XYX A;  5A3T A;  1ULO A;  2FDI A;  1VRH 1;  3MFC A;  1CES A;  3RSJ A;  4CDQ A;  4PBO A;  3AMP A;  4Y22 B;  2Q8E A;  3RFR A;  5JMO A;  4JX0 A;  1OC1 A;  1RUG 1;  3AKQ A;  3V0A A;  4MXV A;  1G9D A;  5DAV A;  2ID4 A;  2IFW A;  3VZN A;  2VL4 A;  5A3U A;  5KHH A;  3I4I A;  1RUH 2;  1BMV 2;  1OA4 A;  5C3P A;  4XXP A;  4Y3O A;  3ZFF A;  1R64 A;  4E9K A;  5A6Z A;  1WLW A;  1RUG 3;  2RVA A;  5I0D A;  5JAX A;  1O3S A;  4R4Z A;  2BW8 A;  4QHB A;  5FMB A;  4N8M A;  1FOD 3;  2GU9 A;  5A7W A;  1Q8Q A;  4RS5 A;  4XOG A;  2O0O A;  4IV1 A;  2IXL A;  4FTB A;  1ST8 A;  1O91 A;  1EV1 1;  1RUE 1;  5DAW A;  5LY2 A;  3EMR A;  4E27 A;  1SBE A;  3EQE A;  1OPO A;  3AZY A;  3LDR A;  4Y1Z A;  5GM0 A;  2WNE A;  3R05 A;  3OY8 A;  3KV9 A;  3CNA A;  3DV8 A;  5EPA A;  2HWC 3;  2OVU A;  2FDF A;  5KHG A;  3VKF C;  4K9S A;  1KFU L;  1US2 A;  2NQY A;  1RUN A;  1YQC A;  4JKM A;  4UW6 A;  1UL9 A;  1W9F A;  2P5B A;  5A33 B;  1W90 A;  4NAM A;  1XNC A;  4JHZ A;  2QZ3 A;  4RGA A;  1WMX A;  1KJR A;  3EYP A;  3MIC A;  4MYE A;  3ZKY A;  5AC9 3;  4A3X A;  4CXW A;  4P9X A;  1NXD 1;  4YGD A;  5H9Q A;  4FPE A;  4URA A;  1H2L A;  1QJY 2;  4YPJ A;  1UYY A;  4C0B A;  4CP1 A;  2JEM A;  1D0H A;  2JDP A;  2RR1 2;  4MAD A;  5BNP C;  4YVW B;  4OI1 A;  2BBV A;  2Z2S B;  4Z2A A;  1NLR A;  3D6E A;  1DYO A;  4QPG B;  5LBF A;  3PTR B;  2ZGO A;  1HB3 A;  5FMO L;  4PI2 A;  4I2O A;  4J6G A;  1LEN A;  3GZT B;  3IZO A;  3K51 A;  1L3J A;  2WS9 1;  4XAB A;  4XDQ A;  3FE5 A;  4ZPI A;  4QXB A;  3AMH A;  4WZC A;  2A6X A;  4M3C E;  3BAL A;  2B46 X;  4RGK A;  4AI2 A;  2PAM A;  1M4W A;  2ZZQ A;  3UGH A;  4CCN A;  2GME A;  2PHF A;  3GZE A;  1LHW A;  2CHH A;  5JR2 A;  2JEN A;  2HWF 2;  2XJR A;  1RIN A;  3SEP A;  4EN7 B;  4BHP A;  5F37 A;  3N3H A;  4PCR A;  5FZL A;  5FPZ A;  2VPV A;  2X5I C;  2F4P A;  3VBO B;  1WW5 A;  2CY6 A;  4PHZ A;  3KV6 A;  4YZ5 A;  3JD7 3;  2VCC A;  1W8W A;  1SLB A;  2RDN A;  4LUK A;  4CCM A;  4Q0S A;  2XR4 A;  4BIO A;  1YNA A;  1GP4 A;  3VL9 A;  1QJY 1;  2XVK A;  2ARX A;  2WN2 A;  3MI8 A;  4TTG A; 
#chains in the Genus database with same CATH homology
 1OVP A;  1OUR A;  4AOC A;  2JDM A;  2BV4 A;  1OUS A;  1OUX A;  2JDU A;  2CHH A;  2JDN A;  2JDY A;  5A6Z A;  2VUD A;  1W8F A;  5A6Y A;  2JDH A;  2WR9 A;  1OXC A;  2VUC A;  3DCQ A;  1GZT A;  1OVS A;  3ZDV A;  4CE8 A;  2JDP A;  2JDK A;  2VNV A;  1UQX A;  2BOI A;  4UT5 A;  2BP6 A;  5A70 A;  2XR4 A;  5A3O A;  5D2A A;  5A6X A;  5A6Q A;  2BOJ A;  1UZV A;  2WRA A;  5HCH A;  1W8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...