5HD7A

Dissecting therapeutic resistance to erk inhibition rat mutant sch772984 in complex with (3r)-1-(2-oxo-2-{4-[4-(pyrimidin-2-yl)phenyl]piperazin-1-yl}ethyl)-n-[3-(pyridin-4-yl)-2h-indazol-5-yl]pyrrolidine-3-carboxamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
347
structure length
347
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFDLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Dissecting Therapeutic Resistance to ERK Inhibition.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 115
structure length 347
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hd7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hd7A01
3RPVA 3OHTA 2ETKA 2ZM1A 3QX4A 4DH1A 4ENYA 3TTIA 2A2AA 4HVGA 2J6MA 4RLLA 4MX9A 2W4KA 1MUOA 2V7OA 2VUWA 5J7BA 3PIYA 4LQMA 4JRVA 3RPYA 4OTRA 1WVXA 1H1QA 3TWJA 2JITA 3C13A 4FKOA 5DA3A 4AAAA 2YHVA 4BR3A 2IJMA 1CDKA 2R3HA 3R1QA 4NEUA 4BY9E 5T3QA 4Y83A 1B38A 4H36A 3MJ2A 2UZEA 3BLHA 5JQ8A 5HO8A 3CD3A 2EUFB 4MKCA 2PVHA 3UQFA 1OM1A 4QP9A 3V8WA 5IQCA 3KEXA 2CHLA 4FOCA 4ITJA 5T68A 4UWBA 4BIEA 4YZBA 4C57A 1I44A 5M51A 3NLBA 1A9UA 2W1EA 2X8DA 3OWPA 3UOJA 4KB8A 4ZSAA 5BMSA 5CF8A 5IUGA 3DFAA 5KMMA 4GT5A 3R30A 5CU0A 3O51A 3ZUUA 1NW1A 3QQGA 4NW5A 5C8MA 3LQ8A 5HBJA 4QMPA 3FYJX 1V0BA 3LVPA 5EOBA 3IW4A 4E6DA 3TN8A 1ZMWA 4D1XA 4ZS0A 3UIXA 3C1XA 1PXIA 3MTFA 4AP7A 4C3PA 3HUCA 2CCIA 4E8AA 3NS9A 3LM5A 4RIOA 4BZNA 3V5QA 4R3CA 4HVSA 4L44A 4FG8A 4PY1A 5JMSA 3DXPA 2R7IA 5L6OA 2J2IB 1ERKA 5IA2A 4G34A 3NUSA 5FEQA 4FVPA 2UUEA 4ACCA 3L8VA 4JG7A 4IDVA 2X2KA 4HNIA 1G8AA 4JLCA 2A27A 4PNIA 3ORMA 2DWBA 3F88A 3IO7A 1B39A 5EW9A 3QRIA 1SNUA 4XBRA 3G90X 5IPJA 3TEIA 2XNOA 3FI8A 5B7VA 4DG0E 4F63A 2VTHA 3K5VA 2YITA 4JRNA 4WSQA 3VS6A 4ZZNA 3QFVA 3FZTA 4O0YA 1ZOHA 2YA9A 3OWJA 4LRKA 5M44A 1QPDA 3FL4A 3RKBA 5CQWA 3OD6X 3RPSA 4E6AA 5DMZA 4RC3A 5LXMA 3TIYA 4O1PA 4D2TA 3O8PA 5F9EA 1FGKA 4ANOA 3VUMA 3MIAA 5HGIA 3D5VA 3P5KA 3MFUA 3Q9XA 3MS9A 4RIYB 4KS7A 1BX6A 3QRKA 5HG8A 5KMKA 2VNYA 3EQBA 1PY5A 3UG2A 3NPCA 3BE2A 1GZKA 2R3RA 4GV1A 5ETIA 5GZ9A 3R83A 4E5AX 5HBEA 1IAJA 3PVGA 3UZRA 5CVHA 3BU6A 1Y6BA 3ACJA 2PMIA 3CPCA 4O1OA 4S2ZA 4C37A 4XG3A 1B6CB 4YSMA 3HP5A 2PYWA 4ALWA 2BZKB 2XNGA 3D9VA 3OP5A 5DN3A 2XNEA 3R8UA 2X7OA 1ZYCA 1WBVA 3HRFA 4QPSA 2JKQA 2F4JA 3D7TA 3GU4A 4ALVA 4EH7A 4FTUA 1BLXA 3H4JA 4WNMA 2PL0A 4EQMA 3KMMA 3ATSA 1J1CA 2BALA 2J5FA 3P7CA 2XJ2A 4Y5QA 4DGLC 3KK8A 4AGCA 3IGGA 4OW8A 4IH8A 5HO7A 3OY1A 2RL5A 4EZ5A 3RCJA 3F3TA 3KXZA 2CLXA 3R1YA 3LFQA 4JOAA 3D94A 4FYNA 4UWYA 4HYUA 4BC6A 4BWPA 2AC3A 1PMEA 4GKIA 1UVRA 1WZYA 3NYXA 5BVEA 4IX4A 1R39A 3A7FA 3BE9A 2Q0NA 2P4IA 2P3GX 2YM5A 3QYZA 3R21A 4L67A 5C8KA 4CFNA 4TXCA 5G6VA 4N6ZA 2YZAA 2VTJA 3BYVA 4V01A 4UZDA 5ANKA 4PMPA 5KX8A 2VN9A 5L3AA 2BRMA 4PPAA 5TR6A 4RZWA 3PVWA 3R1SA 3FYKX 4BDKA 2CCHA 2QNJA 2JDRA 2QG5A 2PK9A 2YCFA 3HV3A 3ORPA 3P78A 4TZRA 4BHZA 4BZDA 2QD9A 4U5JA 2Y6MA 5BMMA 5KE0A 3RJCA 3DA6A 3E3BX 4I94A 4U41A 5J95A 4CRSA 4RX5A 5EM6A 3GUBA 4HGEA 3JYAA 3QC9A 5CTPA 1RJBA 3UOLA 3BV2A 1FMOE 4JS8A 2OIQA 3R00A 5HHWA 4FTJA 1OKZA 5AJQA 3PE1A 3F5XA 4X2FA 5M56A 5FRIA 3BCEA 5KKRC 4EK6A 4NKAA 3SG8A 5ACKA 4OTWA 5K5NA 5AV3A 5BVWA 1LEZA 4AN2A 2OZAB 4B4LA 4CZTA 5J1VA 4DFLA 2ZB1A 3L8XA 1V1KA 4BDIA 3W2CA 1UNHA 4F6SA 4NFNA 4YHFA 4FKRA 3HUBA 2ITTA 2Y0AA 2VO3A 2X9EA 4FNZA 2PVMA 3FZOA 2J4ZA 4E20A 3CTJA 1OBGA 4JG6A 5FXQA 4C58A 4D0WA 5B2LA 4J8NA 3WZJA 1J1BA 4BCOA 2ZOQA 4IFCA 4QP8A 4KBAA 3G51A 4FVRA 3GB2A 4YJPA 4C02A 4DG3E 3EYGA 4B6LA 1OL6A 4QQJA 5EKNA 2RFDA 5IH6A 4WOVA 4L8MA 1H8FA 3QAME 3SKCA 4Z7GA 4QT1A 3CY3A 4ZZOA 3R71A 2WQEA 4KRCA 4JG8A 2X7FA 4GG7A 5M09A 3LLTA 4QNYA 2UVXA 1U54A 4V0GA 3F2AA 4QYYA 5KBQA 4FV0A 5DE2A 3ZRLA 4JBVA 4CMUA 5A6NA 4HGLA 4LOOA 4U6RA 5IEVA 4AF3A 3RWQA 5JGDA 2Z7LA 3ORTA 4MBLA 4USDA 4R1VA 4E7WA 3GU5A 1BKXA 5DOSA 4HNFA 1H28A 2O64A 5K0KA 4DFZE 3NX8A 4R3RA 2OICA 3FHIA 1XH6A 3ORIA 5FP5A 4QRCA 2XS0A 3UIMA 3FMHA 3RALA 1JQHA 5B0XA 1YWRA 1CTPE 3LCTA 5FM3A 2WMAA 3W33A 3DK3A 2VD5A 4CD0A 5A9UA 5F20A 5TO8A 2Y4PA 3SX9A 4QMVA 3EL8A 3LAUA 3MI9A 4QMTA 3OXIA 4TYHA 1MRUA 4WO5A 4TWNA 3W32A 3EQFA 3ORKA 4CMTA 3PG3A 4F65A 3UMWA 4LG4A 4D1SA 4Y72A 2QCSA 1XH9A 4C3RA 3DPKA 3NW7A 3QWKA 4GK4A 5HI2A 3OS3A 3UYSA 1ZAOA 2QO7A 1H24A 4YC6A 4CFVA 2RFEA 4F7SA 4E5WA 4DEEA 2R0UA 3VBWA 3PJ3A 4XEYA 5CF6A 2HWOA 5DNRA 4QMLA 5A4LA 3G9LX 3ZLYA 4KINA 4AW5A 5I0BA 2GMXA 4O7RA 2VNWA 4DAWA 3A2CA 2XK3A 2OIDA 5I9UA 2GDOA 3ORXA 4DEIA 4FV5A 4AT4A 4EL9A 3Q6UA 4TPTA 4FTCA 4F09A 4BRXA 1FVRA 3ENHA 5I9VA 1OL2A 2GHGA 1Y8GA 5L2IA 1G5SA 4EH6A 3R9RA 2X81A 3AD6A 3P86A 4I4FA 4JIKA 3FQSA 4P2KA 4YBJA 3W2PA 4F0FA 4U8ZA 4YTCA 3QBNA 2JIIA 5HEZA 5D10A 3RM7A 4XG4A 4G6LA 4NYEA 3KXHA 5DWRA 4K77A 4EK3A 3WF6A 1K2PA 3V3VA 1IG1A 2WTVA 3FPQA 1Q4LA 2QC6A 2QOQA 2IVTA 3IW5A 5E4HA 3DLZA 5AR8A 4EOOA 4BI0A 3CQUA 3AXWA 1Y57A 3VS1A 4LRMA 3TDWA 4W4XA 3TZ9A 2O0UA 3JS2A 4DTAA 2VTTA 3CP9A 4FTQA 4FKIA 2HENA 1OKWA 3IOPA 2P0CA 4L45A 4YZCA 3R9OA 3TT0A 1OIUA 1YDTE 4FZDB 2E2BA 3ROYA 4DINA 3NW6A 5CSPA 4DFNA 3COKA 2ERZE 1L3RE 1NA7A 2IW6A 3EQCA 4I5MA 4G3DA 3KCKA 3KMUA 3CS9A 4IHPA 4DBXA 4G2FA 1T45A 2UW5A 3AQVA 2PU8A 2X8IA 2VTIA 2X9FA 4QQCA 4O81A 5M57A 2GQGA 4JQ7A 3QD3A 3W18A 5FD2A 4CVAA 1WFCA 1Q97A 4AQCA 3D0EA 4ZSEA 1YXXA 2W4JA 2I0VA 3MA3A 1JSUA 5HG9A 5JRQA 4DYMA 2QHMA 4M15A 4TL0A 3FMNA 4FYOA 3FKLA 2PUNA 4LRJA 4RFYA 3ZU7A 2YABA 2Q0BA 2ZMCA 3EHAA 3HMMA 1KV2A 4FNXA 5I9ZA 4RQKA 4Q5EA 4DFUA 3RMFA 5HNBA 5GIOE 1R78A 4UY9A 4EH2A 4FKJA 5D7VA 1OIQA 4FZFB 3CTHA 4N0SA 3KCFA 3H0ZA 4AZWA 4RIWA 4FNYA 2XP2A 4ZTSA 2JKMA 4MBIA 4EWHA 3ZFMA 3PA5A 4A06A 4DEBA 4MCVA 2JIUA 5EFQA 2YAKA 3E62A 1ZXEA 4WNKA 3PPZA 3BHTA 3ZRMA 4BTJA 4KKGA 3GU8A 5HOAA 2HCKA 4J97A 3LCDA 1YHSA 2VWXA 4MK0A 3ZBXA 2YEXA 2UVZA 3KXNA 2HELA 2I0HA 5KZIA 5AA8A 4C61A 1PYXA 4WT6A 4D58A 5EM8A 3RTPA 1KV1A 2WMWA 3KC3A 4A4LA 4NKSA 5DI1A 5HE0A 2UVYA 4ZZMA 3B8RA 3V6RA 3JR1A 1IA9A 4EC9A 2WMBA 5D1JA 4GH2A 2F7ZE 3FV8A 4USFA 3RM6A 4IM3A 4E6CA 4NH1A 3TV7A 2HW6A 2QO9A 3PXZA 5A14A 1XWSA 3DNEA 4DTBA 3COIA 2CN5A 1GJOA 3KRRA 5E8TA 1J7LA 3QKKA 3IOKA 3JVRA 3DT1A 3BELA 2P55A 1Y91A 4QP6A 3ALNA 4RLKA 3FE3A 4FKPA 3WYYA 3FI3A 2VZ6A 3KGAA 4LOQA 2PMNX 3ENMA 4YO6A 3ZUTA 1IASA 2HZIA 4EI4A 4H58A 2BKZA 3FZ1A 4QYGA 4FTTA 3OC1A 4WIHA 3AT4A 5IKWA 3LFNA 3AD4A 4NSTA 3PWDA 5EM5A 1URCA 5C9CA 2QR7A 2HW7A 4DT9A 3K3JA 2HAKA 3F5GA 3OXZA 3VNTA 2C1BA 1H25A 1L8TA 2BFXA 2XEZA 3CJFA 3GT8A 3Q3BA 4D55A 4RFZA 2G9XA 4OBOA 3R7IA 5CEOA 1M2RA 1VJYA 2IZTA 3VS7A 4CCBA 4RMZA 4YLKA 5L8LA 4R3PA 3VO3A 5HTBA 4NJDA 3QA8A 4A7CA 3O96A 5HIBA 3TZ8A 4FVQA 3ZO1A 4FEXA 3BEAA 3FLSA 4NK9A 1OIRA 1Q99A 1PMNA 1JAMA 4RJ4A 3VHEA 3UQGA 1SVEA 4GJ2A 4ASXA 5LMKA 5HE1A 3W2RA 5J79A 3I7CA 3W10A 4RIYA 2ESMA 4F7NA 4PMSA 5BUJA 2DQ7X 2YM4A 4RVKA 2ITZA 3MPTA 2CKEA 4RC2A 2BVAA 1UU8A 2EXCX 4TW9A 2ETRA 4QTAA 4W9WA 4EOQA 5I4NA 3O0GA 4AXAA 2JAMA 4NM5A 2B4SB 3Q4CA 3U6JA 4IACA 5LVNA 4RG0A 4J98A 5IQAA 4U97A 3DDQA 3ZZWA 3NNVA 4I6HA 1JKLA 3MVMA 2QOLA 3CKWA 5L2QA 4OTIA 4BDGA 5I3RA 5JQ5A 1RW8A 2WAJA 2OJGA 2XIYA 1U5RA 3LQ3A 3OCSA 3WYXA 3S95A 4WBBB 2WIPA 4ZY4A 3P79A 2VWIA 4I5HA 1CSNA 3PJ8A 3CQWA 4FTIA 1FVTA 4W4YA 4X3JA 3ZH8A 1NXKA 1O6YA 3R0TA 1KSWA 5LCJA 3OWLA 3GCQA 2XB7A 3KU2A 3IGOA 4BZOA 3E8EA 2X7GA 4LGHA 2BMCA 4FKUA 4AUAA 1H4LA 3NUYA 4QQ5A 4ZJVA 4CTCA 3KN6A 4HZRA 5IH4A 2OFUA 3UOKA 4G9CA 3VN9A 5IQDA 4DFBA 2YLEA 2ZV2A 1NVRA 4IAAA 4DGNA 2BZJA 3QD4A 4IVBA 4MVFA 4G17A 2BROA 4RX8A 1XBBA 4F9YA 3MFTA 4NZWB 4WNOA 2GS7A 1ZYLA 3A62A 3LJ2A 4L01A 4BB4A 3U9CA 5CSVA 1OB3A 3AG9A 3RK9A 2J0IA 2XRUA 5JFVA 3E93A 3TNIA 3ET7A 2GPHA 3GU6A 3BU5A 3MB7A 5AUUA 4J71A 5DBXA 4K6ZA 2WMUA 3W2SA 3RAHA 4RJ3A 3GENA 1BYGA 4E5BA 4ZLOA 1JKKA 2W4OA 2WEVA 2CNQA 3VF9A 4O2PA 4UMPA 3ZSIA 2YCRA 3MV5A 1UKHA 2REIA 3NWWA 4ONAA 4ZIMA 4QYHA 4XCUA 2EVAA 3DQWA 3ZZEA 5IEXA 2YWVA 4ASDA 2OZAA 5HCZA 1CMKE 5BVOA 4IXPA 2UZDA 2JAVA 3IW8A 1ZYSA 3NNUA 4DGMA 2C69A 2R5TA 3PJ2A 2C5YA 3EN5A 3R1NA 3JPVA 5M4UA 4HCUA 3V5TA 4EQCA 4FIGA 4ZSJA 5AR2A 3PP1A 5AP2A 4FG9A 3I6UA 2OIBA 4TYGA 3C4ZA 4OLIA 1G8SA 1ND4A 4G31A 4GW8A 5AUZA 3WF9A 2C6DA 4EOIA 4F64A 4I6BA 3S0OA 4YTIA 4AT3A 4RGJA 1QCFA 4BI1A 1Q24A 4KABA 3ZRKA 3CC6A 3CTQA 3HRBA 3ACKA 4MXCA 1KE7A 3Q96A 2C3KA 2Y8OA 5KMIA 4CT2A 5AFVA 2QO2A 5AAGA 3NSZA 1FGIA 2VTAA 4TWCA 1PYEA 3EN9A 4YJUA 4H39A 1DAWA 2EWAA 2HZ4A 3VC4A 4QTEA 5LMKC 1WBPA 4FIIA 4FSRA 1S9JA 3PRIA 4FV6A 4O0UA 1GIHA 3FZRA 4UEUA 3UYTA 4F70A 1OL7A 3MYGA 4XV9A 3BWJA 1VYZA 3R2BA 2VTQA 5CS6A 5HVJA 4QMYA 4KKEA 5CEMA 1XBAA 4V04A 3A60A 5C27A 4BKZA 1S9IA 2UZNA 4LGDA 4L43A 3KVXA 3TZMA 5BPYA 5HORA 2G2IA 4IWPA 5EOLA 1Y8YA 2VO0A 2IW9A 1OMWA 4B9DA 1YXTA 2IVVA 4ASEA 4W4VA 4M84A 4UMRA 3ZM9A 4CEGA 3QTQA 4I6QA 5K4JA 3C5UA 4EUTA 1WMKA 4CTBA 3Q9WA 4OAUC 4FT9A 5KBRA 4GU6A 2PTKA 3GC8A 3UPZA 5E91A 2OKRA 1GIJA 3FXXA 2XJ1A 4FT0A 4ZTRA 5AV0A 4D2SA 1NT2A 3RCDA 4ANMA 4BL1A 1YDSE 2H34A 4W8EA 1UA2A 3Q4TA 2PHKA 2YDKA 4YJTA 5AM6A 5EM7A 2QQ7A 5CAPA 4GT4A 1Z5MA 2VTSA 5IH5A 3EN4A 4KBKA 4OTGA 4UMQA 2WTWA 4U40A 4NTSA 3QLGA 4TTHB 2UW8A 3UO5A 4WSYA 3SG9A 5C01A 4CXAA 3BYUA 4D2VA 2A4LA 4LUDA 5KO1A 1WAKA 2WMRA 4D4YA 1Q62A 4IX6A 4A4XA 5JFSA 5FEDA 1H07A 3O8UA 2Q83A 2V5QA 5JFXA 1P2AA 2ITOA 4WUNA 1KE9A 5M06A 4P7EA 5CZIA 3QZHA 3THBA 5HG7A 3PLAE 5M07A 5CI7A 4J8MA 5CENA 4M67A 3P7BA 4EOPA 4U9AA 2W5HA 5TE0A 4UMUA 5KMOA 2EB3A 2C6EA 3DKFA 3MVJA 5LQFA 4B8MA 3QXOA 2VTPA 2OWBA 2C3LA 3DQXA 4QMUA 3UIBA 3ITZA 2UW4A 4MD8E 3OROA 4AW0A 4F08A 4ERKA 3MESA 2RSVA 3ORNA 2BAKA 3QZFA 1SM2A 1WBSA 3D4QA 3DTCA 3KVWA 4IE9A 4F1OA 4S33A 4QQTA 5CF4A 4C62A 4U7ZA 4D1ZA 1JNKA 4FT5A 4QP1A 4XP3A 4RVLA 5LARA 3FBVA 5BUIA 3QTZA 5ETFA 1FOTA 3DAKA 1ZY4A 4AW2A 3A7JA 4R8QA 1KE8A 4PWNA 4A9YA 4I1ZA 5BNJA 3O7LD 4EH3A 5FWKK 1VZOA 4W9XA 4GJ3A 4FIFA 2QOKA 5AWMA 4GK2A 2JIVA 4IZYA 4X2NA 4J95A 5IQFA 4DEAA 1P4OA 3UVRA 3GCPA 3W16A 3VS0A 3P1AA 3AMYA 3ZXZA 4KS8A 3AMBA 3HMIA 3LXLA 4K18A 3P08A 3SV0A 3VUIA 1P5EA 2GHMA 1K3AA 1OGUA 1UWHA 4ITIA 4I23A 2FSOX 5AP3A 1ZRZA 2PVRA 3DZQA 3LW0A 4G5PA 4CMOA 3TV6A 1MRYA 4C4GA 2YCSA 3UC3A 2ZV9A 4QTBA 3DLSA 4X7QA 5F94A 4O0SA 3BQCA 4I24A 4FV9A 4WKQA 3KFAA 4Q2AA 5CSXA 2FH9A 2CKQA 1YXUA 2PE0A 3VVHA 3PJ1A 3HMPA 4IBMA 3Q6WA 5LMBA 5JGBA 2XYNA 1MP8A 3QCYA 2QLUA 3R63A 2ITNA 2WHBA 2C47A 3FEGA 3G5DA 4G3GA 3NAYA 3P7AA 4XRLA 5TT7A 2C6IA 3OEZA 5KHWA 4MXZA 5D41A 4FTAA 5LOHA 4O7ZA 4QNAA 1F3MC 4MQ1A 4AN9A 3BYOA 4C35A 4FI1A 5JZNA 3FZPA 4XLVA 3QQKA 1WVWA 4ACHA 4BBEA 5IA4A 3AC1A 4QYEA 3H3CA 2VWUA 5J9YA 2CGXA 3M2WA 4EHVA 4GKHA 4AE6A 1XH4A 4MHAA 4DG2E 1W82A 5CASA 5CXHA 5BUEA 2ZM4A 4ASZA 5LVPA 2OJIA 1O9UA 2BKKA 3OCBA 1UNGA 3QHRA 3UQCA 2B1PA 5DHJA 3IPHA 1GZ8A 4L52A 3EZRA 3PE2A 4DGGA 3DK7A 2EU9A 4YZNA 5AR4A 5AAEA 5M55A 1PXMA 4BWXA 1ATPE 1MRVA 3QWJA 4IX5A 1QMZA 4ZSGA 3B2WA 2JDVA 1V0OA 2BDWA 2V0DA 3R7YA 4D4VA 3ID6C 5H8BA 4EH8A 5H8EA 5CAVA 4YMJA 5HLPA 4UX9A 5CAUA 5E1EA 1VEBA 2F57A 2HXLA 5FXSA 1PXOA 4JXFA 1P14A 3O2MA 2VGPA 2NRUA 4BCMA 4JL9A 3QUPA 3UP7A 3E8DA 4PDSA 4G5JA 3G6GA 3C50A 4QPMA 3HGKA 3COHA 4NM7A 2WGJA 3TKHA 4UYNA 3ZCLA 4AN3A 2QLQA 3LPBA 3PSDA 4ZJIA 4D9TA 2F7XE 3DOGA 4BGGA 4AZSA 4EZ7A 2E9VA 2GTMA 2JC6A 2VX1A 3HKOA 3NVKI 5IA5A 4NFMA 2XM9A 1FINA 3FY0A 2LAVA 2VWVA 3ATTA 4F6WA 2PUPA 2BRBA 4BGHA 3VQUA 2PVKA 4NCTC 2CKPA 2R3LA 4XX9A 3UZTA 3SA0A 5E90A 1HCLA 4U3YA 4ARKA 4MNEB 5K5XA 3SLSA 4DFXE 4M69B 4OBPA 3ZO3A 2CKOA 4EBVA 3FKOA 3I79A 4K8AA 4GRBA 5LMAA 3TKUA 3A7GA 1ZARA 2YJRA 4UALA 1DS5A 2ZAZA 3E5AA 3Q4ZA 3ALOA 4EHGA 4DLJA 3G9NA 3FXWA 4RVTA 5JK3A 3DAJA 1WBNA 3W1FA 3ZOSA 3IDBA 3LXKA 4IAFA 4PPCA 4XOZA 4EWQA 5ICPA 3KK9A 4FZ6A 3S1HA 3UZPA 3ZDIA 5EDPA 5DYJA 3DCVA 4GFMA 4GU9A 3DY7A 1Q3DA 3GCUA 4FV3A 5CYIA 5A46A 2RGPA 5HU3A 2I7QA 3RHKA 4MXOA 5GHVA 4BCPA 3F9NA 3G6HA 5AP4A 4DITA 3MN3A 4CLJA 3F66A 4ALUA 3CCNA 2QOBA 4PF4A 4X3FB 3ZC6A 3N4VA 4YNEA 3REPA 5DT4A 2JFLA 3R7GA 4GYGA 4ZLYA 4U79A 4RX9A 5HCXA 4YUQA 1PKGA 4MH7A 2H9VA 5KCVA 2W9FB 2EXEA 2GNLA 1PMUA 4IVAA 2YM7A 4K9YA 4E6QA 4FKWA 5AUTA 4BDEA 2GNJA 2CNUA 5BYLA 1M17A 2FYSA 3MDYA 4O0RA 2WPAA 2EXMA 1YOMA 1OIYA 3EQRA 4K11A 3KB7A 4O6EA 3FWQA 2P33A 3T8OA 5CZHA 2GU8A 4FBXA 5DRBA 1FMKA 1TQMA 4FTKA 5DEWA 5H2UA 3BPRA 3E88A 4O96A 3B2TA 2XMYA 4QYFA 5D9HA 2DYLA 4G3EA 2QURA 3AC4A 4Q9SA 4HYHA 2RIOA 2C0OA 3LCOA 3H9RA 1ZYDA 3UVQA 2B9FA 3VHKA 5BVNA 2RG5A 5K3YA 3V6SA 4BF2A 3BQRA 3S00A 4ERWA 3DNDA 5HG5A 4KIQA 5J87A 2R3KA 3LLAA 4FK3A 4J52A 3ZHPC 3MH0A 2PUIA 1Q61A 2GCDA 5BVDA 3FC2A 3OFMA 4RC4A 2V22A 5ITAA 2W7XA 4G16A 4IB5A 2YWPA 3R02A 4BDCA 1PXPA 3ULIA 3CGOA 4IVDA 4CQGA 4YR8A 4R77A 4UMTA 2HYYA 2X2MA 2UW9A 4KSPA 5IA1A 2HXQA 2WD1A 3QC4A 4IM0A 5EHOA 3JY0A 1OPLA 5E8XA 2PVJA 4JBQA 4ENXA 2R7BA 2PZPA 3R8VA 5HX6A 4CZYB 3EWHA 2XNNA 3DV3A 3Q52A 5CNNA 1YI6A 3R8LA 1REJA 2R9SA 5L2TA 2VTOA 5ANGA 5HLNA 4RWIA 3UNJA 5AP0A 2BRHA 3DTWA 3DS6A 2B53A 4TT7A 4QMQA 1JVPP 2DS1A 2R3OA 2VAGA 2WTKC 3L9PA 3OBGA 3OUKA 4FKSA 3RVGA 2FSMX 2ETMA 3PP0A 4AA0A 2ONLC 2FVDA 2UW0A 4U80A 3LMHA 2JKKA 2UZWE 4E93A 2Z7RA 4R7HA 2QHNA 5EKOA 2XK9A 4AACA 5EQYA 1SNXA 4C0TA 4YBKA 4FX3A 2YIWA 1MQ4A 3QU0A 2VO7A 5JRSA 3Q9YA 1TKIA 3CGFA 2P2HA 2YFXA 4UV0A 4O7NA 3F3ZA 2BZHB 1TQIA 3VUHA 1LR4A 3GOPA 1E9HA 3VS3A 3SOCA 4IVCA 3U51A 3SDJA 2E9OA 4II5A 3LFEA 2JKOA 3OWKA 2JFMA 3RHXA 4BKYA 5KNJA 2QODA 5D12A 1M7QA 1VR2A 2GSFA 2XK6A 3LQ5A 3E8NA 4X6QC 1ZY5A 4EONA 4MF1A 4CV8A 2BRGA 1BL6A 2ERKA 2W1GA 3DJ6A 3UO6A 4FEQA 4E73A 3R2YA 3GOKA 2GTNA 3EFWA 1H08A 3R7VA 3VUGA 4ANNA 2XUUA 2JDOA 3HRCA 4JQ8A 1BMKA 4FIJA 2CJMA 2OU7A 4Z9LA 1URWA 2YISA 2J0MB 5IUIA 3ROCA 4ZAUA 5GZ8A 3O7LB 4CLIA 4JAJA 3V8TA 3ZSHA 3HYHA 2HZ0A 3DBQA 3F2NA 3FSKA 3FMMA 2W1FA 3QL8A 4IIRA 4WA9A 4XBUA 4HVDA 3EFLA 3N9XA 4XG6A 2XIRA 4FTNA 4RWKA 5FP6A 4BWKA 4L00A 2PZ5A 4G3CA 3UO4A 3WILA 3U4UA 3PXKA 2PSQA 4D2PA 2GNGA 1H01A 4DE4A 3NIZA 2C6MA 3P9JA 3UODA 2IPXA 1OECA 2BR1A 4C34A 3U6HA 2UZOA 4ZEGA 2BPMA 5TOZA 3UE4A 2PWLA 1GZNA 2R3IA 1M7NA 3V51A 2V62A 3I0QA 3PJCA 4XP2A 5AUYA 3VS5A 3WIKA 4I0SA 4Y95A 5E8YA 5D7AA 1YW2A 3NW5A 3SRVB 4JJRA 4KWPA 5CEQA 2C3IB 4AOJA 3DGKA 2B0QA 4KUJA 4QP7A 4FKTA 5EW3A 5FEEA 5TF9A 4KA3A 2YAAA 3FXZA 2QG7A 3ULZA 3HL7A 3F3VA 4BCQA 1V0PA 3E87A 2B52A 2OH4A 1PW2A 1QPCA 1YRPA 2ZB0A 3TDVA 3VF8A 3KKVA 2CLQA 4G3FA 2CMWA 3CQEA 1WVYA 3TI1A 1O6LA 3WBLA 4CFMA 3LMGA 4EOKA 4I22A 3VBYA 3ODZX 3QTUA 2A1AB 4NM3A 3U6IA 2JLDA 4FV8A 3Q32A 2QOCA 4PTEA 1H0VA 1M52A 3NGAA 5L8KA 1Q8ZA 2QR8A 3QTWA 5B2MA 1J7IA 4WG3A 4YJSA 3CLYA 5C03A 4TKSA 3QX2A 5HD4A 5K9IA 5M4IA 3BYMA 3EQPA 5ETCA 3KF4A 3LIJA 3FI4A 3UNKA 1OVEA 5FXRA 5CU6A 1PJKA 3OVVA 2FSTX 3R6XA 5AP1A 4FSNA 2PZIA 2VWBA 3DAEA 4EYMA 4N6YA 3C4WA 1YQJA 4GEOA 1SYKA 4EZ3A 2XIXA 2BHHA 1YXSA 4O84A 3VIDA 4JAIA 1ZZLA 4H05A 3H10A 2CDZA 3OF0A 4D5HA 2QKWB 4O7LA 2HIWA 1AD5A 3F2RA 2XNPA 3WIGA 4PL3A 5CQUA 1UU9A 3W2QA 2JBOA 3P0MA 5DIAA 4EC8A 1JOWB 2P2IA 3LE6A 2ZYBA 3HDNA 5BYYA 1EH4A 4PDYA 3MA6A 4IZ5A 1Q8WA 4ZY6A 5EQPA 2YCQA 2BDFA 5J9LA 3VAPA 2VU3A 4FE2A 5EG3A 1GIIA 1PMVA 1Q8TA 2J51A 3BKBA 3WF7A 5KUPA 3R73A 2XYUA 1PHKA 3FMKA 3FZSA 1J91A 1W7HA 4FGBA 4M12A 4QP2A 2PVFA 4W8DA 4YHJA 5GJDA 4RSSA 4ZTQA 5ACBC 4L53A 2GS6A 4XG9A 3L8PA 3AT2A 1YWVA 4P4CA 2WTKB 5F4NA 5M4CA 3PY0A 2YLFA 4LL0A 2BIKB 4BDAA 4EJ7A 4LYNA 1U5QA 4RQVA 3ZXTA 3FQEA 5IA3A 4FEWA 5LWNA 3NUNA 4AZFA 1Y6AA 4DCEA 1JPAA 2OLCA 3LOKA 2W17A 3BGZA 4AGDA 2R3JA 3UNZA 2W1DA 3F5UA 1ZOEA 4NL0A 1TQPA 2OFVA 1JSTA 3PFQA 4BCKA 1LPUA 1FQ1B 4MQ2A 4YLLA 3G33A 2F9GA 3QXPA 2UZBA 4DT8A 3UOHA 2H8HA 4WNPA 1JKTA 1Q8UA 3VRYA 4DH5A 4G6NA 3EQHA 3OTVA 5CVGA 3QQHA 3OT3A 4JX7A 3SC1A 5A6OA 5D11A 3NCGA 2JD5A 2RFSA 4IM2A 4N57A 5BYZA 3WF8A 5EH0A 3QGYA 3PWYA 5E1SA 3T9TA 4RT7A 4RJ6A 5FBOA 4ZS4A 5L4QA 2BILB 1E1VA 3TNHA 2OJ9A 4PL5A 3MB6A 4X2KA 5IQGA 2BTRA 3MVHA 4GFGA 3ZFXA 5IG1A 3CSVA 4LFIA 5HTIA 3AOXA 5ANJA 4EKKA 3UG1A 3I4BA 3NYOA 4C4HA 3CD8A 1UKIA 3F3UA 4QP3A 3BHHA 3GEQA 3RK7A 4ANBA 2G2HA 4FKVA 3P4KA 4BTFA 4EUUA 2WTDA 4YU2A 3PUPA 2PVLA 1PF8A 2X2LA 3AT3A 4MYGA 4OUCA 4ZMEA 3TNPC 1Q8YA 3NEWA 1CKJA 2ZMDA 2OXYA 3BBWA 3HVCA 4IZ7A 4MNEA 3U9NA 3ZYAA 4L42A 3FAAA 4M69A 5CWZA 1GZOA 4KIPA 1KWPA 4PUZA 3JUHA 4U43A 3IG7A 3MW1A 1HCKA 4Z16A 4AOTA 1NVSA 4Z55A 3U54A 4EH4A 4F1TA 4EOLA 3NNXA 3VW8A 5I9WA 3BIZA 2UV2A 3A8WA 2QONA 4C4JA 1RE8A 2G15A 2OGVA 3R7OA 1Q3WA 5LCKA 1DI9A 2O3PA 3QUDA 5I9XA 3BRBA 4ZK5A 2XF0A 2HOGA 3WI6A 4IAIA 2QOHA 2VWZA 3TNWA 5HX8A 3CPBA 3FLQA 4O0VA 3PVUA 1PXJA 2BAQA 3QCXA 2W96B 2PUUA 5E8UA 4E4MA 1OZ1A 3C7QA 3NUAA 4O27B 4X3FA 1UV5A 4EOSA 4CFUA 4HCTA 3HNGA 3HV6A 3HX4A 4RRVA 3WE8A 1YHVA 4YJRA 3RBWA 5CY3A 1G3NA 3GXLA 4JDKA 3FPMA 4MD7E 3O71A 3G15A 3TUDA 4KAOA 2C30A 3GP0A 3I7BA 1WBOA 4C4IA 5CVFA 2OW3A 4OAVB 3QQJA 2X4FA 4YC3A 2QI8A 2XZSA 3ZBFA 3BEGA 5CSHA 5E8VA 2W9ZB 2ACXA 2R64A 3ZO2A 2ITPA 4PMMA 3DXQA 3KY2A 4QPAA 3VBVA 2R4BA 2B7AA 2YM3A 2WTCA 3FHRA 4RVMA 5L6PA 2FUMA 3TJDA 3WE4A 3LM0A 3POZA 4D5KA 5CEPA 5HIEA 3E3PA 2Y7JA 3FI2A 3KF7A 3F7WA 3PSBA 5EW8A 3UDBA 4Q9ZA 2PZRA 1GNGA 3EN7A 4EJNA 3IONA 3RZBA 5J7HA 1H27A 5A4CA 4P5QA 2VWYA 3ZC5A 4AX8A 3G0FA 4L6QA 4L9IA 2Y9QA 4U42A 5I5ZA 4LGGA 4XG2A 4IMYA 4AS0A 1DM2A 5JFWA 3PRFA 1ZMUA 5JH6A 3EQGA 5CANA 3L1SA 3K2LA 2WQNA 5EI8A 3UJGA 4EKLA 4YZMA 3QZGA 2UZVA 4IWQA 5E8WA 4HOKA 4CG9A 4EQUA 3VUKA 3BV3A 4F1MA 4D4RA 3HDMA 1XO2B 2VRXA 5DRDA 3BHUA 5CAQA 1REKA 3F69A 3R22A 2Y4IB 5IQIA 5JZJA 4IJ9A 4RJ5A 3TIZA 2R3PA 1YDRE 2WEIA 4QTCA 3UBDA 4C33A 3DBCA 4O82A 2WO6A 1YXVA 1ZMVA 1KOAA 1PRYA 2CNVA 3LCSA 4C2VA 2KULA 4AA5A 5AV4A 2B9JA 5HE2A 3R9NA 5GZAA 3H0YA 4JDJA 3ELJA 4TRLA 3QTSA 2XBAA 3AD5A 5FGKA 2W1HA 4ZY5A 3HV4A 2E9PA 5F1ZA 3U55A 5GJFA 2AYPA 3LFSA 4XS2A 4ANSA 4KRDA 3D5UA 3GQIA 2A19B 3OCGA 4GVAA 3U4WA 2YIXA 2SRCA 4PQNA 4FC0A 4NIFB 3WZUA 5AR7A 4BCNA 3HAVA 5CXZA 2BZIB 4X0MA 2WKMA 1OI9A 4RWJA 4YURA 3M42A 1YOLA 3I6WA 4MXXA 3DB6A 5CEKA 4F9WA 3PXRA 3EFKA 4X2JA 4KIKB 3ZSGA 3VS2A 3MSSA 2PE2A 5CNOA 3IDPA 3DDPA 2J5EA 4JR3A 4PTCA 5LVLA 4PMTA 5HVKA 3NDMA 4H3PA 3D5XA 2C5NA 3OBJA 3TACA 4D28A 3HA8A 2J0JA 4I21A 3MVLA 2XIKA 1FVVA 4K2RA 5CI6A 2W0JA 2IZSA 2NRYA 4OTHA 3KA0A 3WZKA 2V55A 4Z3VA 2VV9A 3LJ1A 3PXYA 4HGSA 4IZAA 5DFPA 4LUEA 2ITVA 3OMVA 3C0IA 1OBDA 3DJ7A 3FC1X 4FG7A 1H1RA 4NW6A 2QU5A 4U3ZA 3TUCA 3TNQB 3LXNA 4NCTA 4X3FC 5JGAA 4HPUE 2R0IA 3O23A 4KSQA 4HJOA 5DEYA 5GJGA 4MBJA 2G2FA 4O38A 3V04A 1XHAA 3NAXA 5L2SA 3Q60A 4GG5A 3F6XA 2C0IA 4TWPA 4BDHA 2UW7A 2Z2WA 3A4OX 3BBTB 2C68A 1Q5KA 2IVSA 3FLYA 4NJ3A 4XJ0A 2OI4X 5AX9A 3PPJA 4PRJA 4BCHA 3FL5A 4IB3A 4HYSA 5DT3A 4EYJA 4DH3A 5KZ0A 2B9IA 4DC2A 4I41A 3N4TA 4BIDA 2R3GA 4FV4A 3NR9A 4FTLA 3RZFA 2F2UA 4CKIA 3NRMA 3Q5IA 5A4TA 1A48A 3NYVA 2PE1A 3BX5A 1Q41A 3KXGA 3VS4A 3ZFYA 4CSVA 2VTMA 4FV1A 3GCSA 3A8XA 3MH3A 3MPMA 1W8CA 4MXAA 4NT4A 3SRVA 1YWNA 2F49A 3AC2A 4YPDA 3DKCA 4O7VA 4K33A 4CT1A 3OT8A 4U81A 3C4FA 3NVMB 2BTSA 4H1MA 5DR6A 2ZDTA 1LEWA 2FO0A 3E92A 1PXLA 4IWDA 1M2PA 5AUVA 4EBWA 2CN8A 1KE5A 4DH8A 4F4PA 4MF0A 3PTGA 1XJDA 5IDPA 5JN2A 4FSTA 2XKCA 4D2WA 3L9MA 5G1XA 3MY5A 4KNBA 2R3NA 4AZVA 2I0YA 4KKHA 3HZTA 2QOIA 4E4NA 3HECA 4R7BA 4TNDA 2JDSA 3QQFA 1Z9XA 3FJQE 3LZBA 4NTTA 3V5WA 4J1RA 4AG8A 2Z8CA 2XCHA 1FPUA 5CU4A 3BU3A 3DU8A 4YLJA 3RAKA 4CYIA 3Q2JA 4DH7A 3NUXA 2QKRA 3PLSA 1I09A 5CT7A 5AR5A 2XEYA 5H3QA 4FGRA 2WMVA 2W06A 3CY2A 4TYEA 1JKSA 3IK3A 2I6LA 5HBHA 4AFEA 3UC4A 4RPVA 2IVUA 5AIRA 4CRLA 5BVKA 3NYNA 3NZ0A 4H1JA 1YHWA 5AX3A 5J8IA 3QF9A 2VX0A 4YO4A 3GC7A 2HZNA 2W1IA 1W83A 3VQHA 1Z57A 2BDJA 3PA4A 1W84A 2XNBA 4YC8A 2O63A 5AAFA 4YZDA 4JVGA 3EL7A 4IEBA 5EDQA 3S4QA 4PP7A 4EH9A 5IQBA 2AUHA 3SAYA 5DT0A 2YDIA 4M0ZA 1BL7A 1E1XA 3TUBA 4MEDA 2VTLA 4BCFA 3WOWA 3E8CA 4O86A 4RJ7A 4O91A 5CU2A 5E8ZA 4PDPA 3R04A 4GFOA 3ZS5A 5HVYA 3VBTA 4Z7HA 5AR3A 4YJVA 4JQEA 2YACA 1M2QA 2GNIA 2IZUA 1YI4A 3M11A 4MD9E 4ZLZA 4GSBA 3ZM4A 2HWPA 4M66A 4JBPA 4FNWA 1OUKA 3PXFA 5DVRA 3TG1A 2IG7A 5EYDA 3VW6A 3UPXA 3R8ZA 4M3QA 3OXTA 4M8TA 2B54A 5BX0A 3GC9A 4PL4A 3I60A 3BLRA 4RA5A 5CSWA 4I0TA 5FTQA 2BAJA 4M0YA 3BHYA 4BI2A 2ONLA 2J7TA 3C0HA 3VJNA 4B8LA 3ETAA 2JBPA 1H1WA 2ZM3A 4OBQA 2W1CA 4E3CA 4I4EA 4BFMA 3GQLA 5KMJA 3UP2A 3QHWA 4M7IA 4F99A 3RNYA 4BDJA 4BGQA 5I9YA 5H8GA 4XNEA 4DA5A 5KMLA 3Q5ZA 5BVFA 2C5VA 3TL8A 4AFJA 3DBDA 1NY3A 4XV1A 2R3FA 3Q9ZA 5HCYA 3LHJA 4DFYA 2FB8A 3ZONA 4AZTA 4BDFA 3OCTA 1VYWA 4IDTA 5EDRA 2R2PA 4O6LA 3KRXA 1LUFA 5EHLA 4EHZA 3KMWA 4NUSA 3D14A 4LOPA 4WRSA 5DR2A 5E9EA 2ITYA 3H9FA 3QQUA 2XNMA 3GBZA 4S34A 4XV3A 5HNGA 5L6WL 1OITA 3ZTXA 4A4OA 1MQBA 4XH6A 5L2WA 3TCPA 4DTKA 3F5PA 4YJQA 2VWWA 4FT3A 2X0GA 2GQRA 4YNOA 2PMLX 4IWOA 3RK5A 3ZUVA 3FUPA 3PY1A 4X6RA 3CIKA 3FY2A 3OOGA 4ZTLA 4RBLA 3OEFX 2JDTA 4FKLA 3SXSA 3FSFA 3V5LA 4P90A 2YZLA 5AP7A 2FGIA 3QD2B 2B9HA 4BYJA 4C59A 3LXPA 3UMXA 2Z7QA 3MJ1A 2CSNA 2H6DA 3QRUA 3KXXA 4H3QA 5IQHA 1QPJA 4BDBA 2ZVAA 2WTIA 2OZOA 4IADA 4DCAA 5M4FA 4C7TA 2Z60A 3UTOA 2XA4A 4C4FA 4FSMA 1R0EA 5EYMA 5EYKA 2OH0E 3MFRA 2XKEA 1SVGA 3BGPA 5GNKA 4F7LA 1UU7A 1OKYA 2GNFA 3EIDA 4FA2A 4HCVA 3PZHA 2OBJA 3MIYA 4FZAB 3RPRA 2NO3A 4B0GA 2WQMA 1CKIA 3KULB 4FIHA 3TM0A 3HEGA 3R9DA 3ZLSA 1O6KA 5HO6A 3F3WA 2NPQA 4FEVA 4UXLA 4AWIA 4QMOA 3SGCA 3KRLA 3DFCB 4CG8A 4GYIA 4FSWA 2ITWA 3LKMA 4O2ZA 5AM7A 3CR0A 4AA4A 3ODYX 2QOOA 3WZEA 5K4IA 4APCA 4J7BA 4BTKA 4CNHA 4O7TA 1ZWSA 5L8JA 1YKRA 3DK6A 3MH1A 2OG8A 3I1AA 4FICA 4XUFA 5E92A 1IEPA 3SD0A 2XM8A 2OF4A 4IC7A 4O7WA 2C1AA 1H0WA 3DB8A 4WHZA 3I5NA 5DH3A 5A4EA 4ACGA 4NWMA 3L8SA 4OTFA 4OT6A 4RWLA 4XRJA 3RWPA 4XMOA 1ZLTA 2PY3A 2LGCA 3D15A 3EH9A 4GIHA 5HKMA 3NMUF 3HA6A 3RP9A 3FLWA 1T46A 3Q53A 3EFJA 1APME 4ORKA 3R01A 3R28A 3LFAA 4AU8A 4PNKA 3EKNA 4U0IA 2C6LA 2WMQA 3V5JA 3V01A 1YOJA 4ACDA 4ZMFA 5IA0A 2I0EA 3DBEA 3O50A 2B55A 2UW3A 2BUJA 3BLQA 3A7HA 3MBLA 3NUUA 3OOMA 4ZTMA 3FDNA 2BFYA 4GT3A 3HP2A 3T9IA 3LCKA 3PXQA 3ORZA 5IZFA 2VGOA 3TV4A 2ZJWA 2CPKE 4ZXTA 2OXDA 5EI2A 4EK5A 4QMNA 2HY0A 3BWFA 3NCZA 3ZEPA 4JIAA 3HLLA 5C4KA 1IR3A 4M13A 3U8WA 4CFXA 1R1WA 3HMOA 3BHVA 4M14A 2CGVA 4ZJJA 4BBFA 1HOWA 3UIUA 3LFBA 2FA2A 3Q2MA 2CGWA 2ITXA 4IQ6A 2GS2A 4PV0A 3CE3A 3DZOA 3H9OA 3KXMA 4FF8A 4DLIA 4ZTHA 4JNWA 3EN6A 2NP8A 3A61A 4MTAA 5EQEA 2WQOA 1KE6A 4A07A 3QQLA 4LV8A 2V7AA 1IA8A 2WFYA 4FODA 3V5PA 5AIKA 4JR7A 3D2IA 4GL9A 1UNLA 4ANQA 3EQDA 4LMUA 5HICA 4PP9A 1H26A 4NU1A 5ANOA 4QMXA 4L7SA 1AQ1A 3QUEA 1GY3A 4J53A 4QMZA 3ZO4A 4R1YA 3SQQA 4QMWA 3EMGA 1UU3A 4BICA 4EK8A 4EORA 4O7YA 4RIXB 3GI3A 2VX3A 3LFCA 5JT2A 3FMLA 3TJCA 4CFFA 2XJ0A 4UWCA 4CYJA 3QGWA 1P4FA 3PPKA 3PA3A 1IRKA 2XKDA 3OZ6A 4NIFA 4F0IA 2YIYA 3AC8A 4C2WA 4F9AA 5J5TA 3VWAA 4D2RA 1AGWA 4D0XA 5GIPE 1SZMA 4G1WA 3OG7A 4UBAA 3C51A 3NUPA 4IAYA 5CALA 4NM0A 3A4PA 2OSCA 3D83A 2WMSA 2I40A 3KRJA 3PG1A 4FSYA 4KIKA 4QOXA 3MFSA 2YERA 4FT7A 4JBOA 4JDIA 4WRGA 5JSMA 1STCE 4L3PA 5CT0A 3SOAA 2C3JA 3QTXA 3GVUA 1M14A 2Y6OA 5FM2A 3AGLA 4BN1A 3HAMA 3RINA 4Y8DA 5HQ0A 3PDTA 5DGZA 3QCQA 4Y73A 1W0XC 5FDXA 3BGQA 5FG8A 2F7EE 4A9SA 4R5YA 4FL2A 1H00A 2O65A 5AMNA 1FBNA 3VUTA 4E1ZA 5HESA 4OT5A 5ANDA 4DF3A 4L3JA 1XKKA 2XKFA 1SMHA 4J96A 5DPVA 5EK7A 4GMYA 2BRNA 1WCCA 1OL5A 5E7RA 4DEGA 3PZEA 4KD1A 3I81A 2QVSE 1DAYA 3E7VA 1U4DA 2YDJA 3N4UA 2XH5A 5TKDA 2C5XA 2WNTA 3U87A 2PULA 3SVVA 2H96A 2W5BA 1OL1A 3OY3A 2W05A 4IW0A 4M97A 5FQDC 4Y5HA 2GHLA 4QP4A 5KKRB 5AUWA 4FKGA 5DLSA 4BVUA 4WBOA 4F6UA 4I5PA 4YGAA 4LI5A 3JVSA 4K0YA 3AC3A 3CKXA 3M1SA 2IWIA 3W2OA 1ZZ2A 3EQIA 5B2KA 5HIDA 2BHEA 3K3IA 4HVHA 4PPBA 2X4ZA 3KQ7A 4BKJA 3E64A 3QD0A 4R6VA 5DG5A 4HGTA 4BYIA 2C5OA 2VTRA 4Y85A 3ZLWA 3GNIB 4UB7A 3VBXA 5H9BA 5HZNA 4L68A 5A4QA 2RKUA 4CGAA 3RNIA 3G2FA 3C4CA 3I5ZA 3R8MA 4ZTNA 5LJJA 3EJ1A 4FUXA 2OXXA 4WG4A 4FV7A 4RX7A 1GAGA 3D5WA 4WG5A 4RFMA 2E9UA 4C38A 3ORLA 4C8BA 1KUTA 2ITQA 2PVYA 2RFNA 4B7TA 4IX3A 4DGOA 3HV7A 4FKQA 3F7ZA 4KBCA 1XH7A 3UGCA 5IDNA 3P23A 4CCUA 2UZLA 2O5KA 3DBFA 4UXQA 3AGMA 4UZHA 4BCJA 4FL1A 4I3ZA 4TWOA 3W8QA 4ZP5A 5J1WA 4BTMA 3AMAA 2C6TA 3O8TA 3QCSA 4EOJA 3CBLA 2J9MA 2ZDUA 2ZV8A 1XH8A 5IEYA 2Y4IC 4O22A 2UZTA 4IANA 1OPJA 2XK4A 3RAIA 4EOMA 3T3UA 1PXKA 4IB1A 1CKPA 4IJPA 4OR5A 3C0GA 5GINE 2J90A 2BCJA 5EHYA 3QZIA 3D7TB 3A7IA 4AW1A 3PY3A 4TN6A 2J0LA 3SXFA 4CZUA 4E4XA 1WBWA 4GCJA 5AV1A 2WMTA 3QKMA 2PZYA 4BCIA 1U46A 2YIRA 3EOCA 5A54A 5F95A 3N51A 4O0TA 3ZEWA 2R3MA 2WQBA 3QKLA 4J99A 3O17A 3QRTA 4FTOA 1J3HA 4V05A 4YZ9A 4CQEA 2GNHA 4AT5A 1ZOGA 3E63A 2Z7SA 2IN6A 1JSVA 2WU6A 4HYIA 4OGRA 4QTDA 5T6KA 2NNWB 3R7UA 5K0XA 3ZLXA 3LFDA 5AP6A 3OUNB 1JBPE 3IW7A 2X6DA 2YIQA 3LFFA 4IC8A 3EZVA 3AC5A 3TKIA 2X8EA 2XBJA 4E4LA 3FQHA 4L3LA 4PX6A 4B99A 4I92A 4HVIA 3MGYA 1PXNA 3MWUA 4TYJA 4IAZA 1XR1A 3PSCA 3S2PA 1BI7A 4CKRA 1SVHA 2X39A 4FOBA 2C6OA 3NNWA 3PYYA 2W5AA 4HPTE 2WIHA 1ZYJA 3JY9A 4MNFA 2FSLX 2WZJA 3ANQA 3MY1A 5AP5A 3L9LA 3CXWA 4QMSA 4OTPA 4XHKB 2OK1A 2UW6A 4F7JA 3EYHA 4L7FA 3VRZA 2XIZA 4AZEA 3A99A 5AV2A 5HTCA 3IDCA 4S30A 4QD6A 4RIWB 5ANEA 4DBNA 3VJOA 3MY0A 4GUBA 5JKGA 1YI3A 4FSQA 4XG7A 3MH2A 4GK3A 2XVDA 3RAWA 4BBMA 4PTGA 4APPA 2E9NA 2OO8X 4I6FA 3II5A 5E8SA 2IZRA 4K1BA 3FMJA 5BQ0A 1OPKA 4EH5A 2ITUA 5LWMA 4KIOA 1WBTA 4YPSA 3QA0A 4C4EA 3D2KA 1A06A 5M53A 3RGFA 4O7SA 4IB0A 3QLFA 5FBNC 1F0QA 4FIEA 4U45A 4OTQA 5J9ZA 4EK4A 2PMOX 1KOBA 1H1SA 3IS5A 2CGUA 3JXWA 4ITHA 3R7EA 1RDQE 1XQZA 2C6KA 2HK5A 2QOFA 3C4EA 3VULA 3ZDUA 4EHEA 2PVNA 4FL3A 4UYAA 4AOIA 5AEPA 4JI9A 4I0RA 4OTDA 4AE9A 4BDDA 5CAOA 1F5QA 3TTJA 3QTIA 4DN5A 3BI6A 4FZ7A 2HY81 4TYIA 2C0TA 3H30A 2OJFE 2GFCA 2X6EA 4E26A 3LMIA 5IQEA 4LMNA 4JX3A 1JWHA 4BCGA 3GFWA 4YJOA 4ACMA 5HNIX 1NVQA 4F0GA 3FLNC 2AC5A 5HU9A 1U54B 4V0GB 4A9UA 4AGWA 3BYSA 4RJ8A 3I0OA 1TVOA 1PKDA 4F9CA 3HV5A 3T3VA 4ANLA 3D7ZA 5LVMA 4HZSA 1R0PA 3IKAA 4W4WA 5JEBA 4D4SA 4O83A 4GVJA 3C9WA 2YM6A 3GU7A 1XBCA 3RPOA 4BIBA 4D9UA 5FDPA 1BUHA 2YJSA 4YP8A 4R7IA 3ERKA 5I3OA 4EEVA 1K9AA 3BZ3A 2BIYA 3L9NA 5C8NA 2W1ZA 2RF9A 4HW7A 4FV2A 4JT3A 2R3QA 3TZ7A 2IO6A 2KTYA 4RZVA 3OW4A 2WXVA 4LL5A 2XK8A 5AA9A 4I20A 2WB8A 1DI8A 3C5IA 5FUTA 4MAOA 4MXYA 4QMMA 2C4GA 2OF2A 4TYHB 3TXOA 4O0XA 3KULA 3KRWA 4N4SA 4FK6A 2VTNA 4FMQA 2WMXA 4Y46A 3IECA 4IFGA 4ZOGA 4FSUA 5KMNA 4X2GA 2WU7A 3FLZA 1RQQA 4TNBA 3QRJA 2O8YA 3W8LA 4LM5A 3QTRA 3KREA 1BI8A 2DUVA 4MWHA 5IISA 3GFEA 5ETAA 3IQ7A 3RI1A 3DKGA 4H3BA 4F9BA 1QPEA 2I1MA 2JGZA 2QU6A 5CU3A 4ID7A 3POOA 4FR4A 3DXNA 4FSZA 5DR9A 1R3CA 2IW8A 5AUXA 5IF1A 3VBQA 3WARA 3GC0A 2WTJA 3DKOA 1QL6A 2X1NA 3OW3A 4U44A 5IMEA 4X21A 1U59A 4YSJA 4USEA 3CEKA 3G0EA 5J5SA 1YVJA 1XH5A 1J7UA 5CLPA 2GQSA 4LV5A 3VUDA 4CFWA 3WF5A 2A0CX 2WELA 4R78A 1OUYA 5IMXA 2G1TA 5IUHA 2J50A 5AADA 3MPAA 4XV2A 3PIZA 3SXRA 4FTMA 3EKKA 4UN0C 5HLWA 4M68A 1H1PA 2XRWA 4I5CA 4IAKA 4DEDA 4DEHA 5IU2A 1OKVA 5HD7A 3C4XA 4Q5HA 3V8SA 2F2CB 1W98A 5CX9A 5CF5A 5FTOA 3LJ0A 4ZSLA 4WUAA 4YTHA 3UVPA 4S31A 2GFSA 4GIIA 3FMDA 4C36A 5C26A 2G01A 4XG8A 3COMA 2OJJA 4TY1A 2W99B 2O2UA 4MWIA 5LVOA 5EYCA 4XOYA 3GCVA 3QYWA 3NIEA 3K5UA 4FEUA 4P5ZA 1X8BA 3SW7A 5C1QB 5HE3A 3Q4UA 5C4LA 5FTGA 4DHFA 2WOUA 3FKNA 3F61A 4S32A 4AGUA 3ZMMA 4YJNA 5A3XA 4CKJA 3DJ5A 4L46A 2ZV7A 1IAHA 3WZDA 3B8QA 4PDOA 3OTUA 4N70A 4YTFA 3F82A 1JLUE 4C3FA 2EB2A 2RG6A 1GOLA 2XK7A 4O21A 5FLFA 4A9RA 3MTLA 4YHTA 2XCKA 4GUEA 2Z02A 2J0KA 4CV9A 2WOTA 3Q04A 2YM8A 4QO9A 4G6OA 4R5SA 5ANIA 2PPQA 3R8PA 2VO6A 4RA4A 3FMEA 3IW6A 2JEDA 4G9RA 3HMNA 2UZUE 3PVBA 3QALE 4FUYA 4O0WA 4WD5A 1LP4A 3KL8A 4FTRA 3SHEA 4XP0A 4RIXA 3E7OA 3ANRA 3SW4A 3EB0A 4GS6A 5CEIA 3CJGA 1UWJA 1CM8A 3S3IA 4A9TA 4I93A 4XLIA 3KN5A 4XYFA 5EI6A 3GGFA 5M08A 3W55A 3PIXA 2YN8A 4JDHA 5KHXA 4BHNA 3R9HA 3K54A
chains in the Genus database with same CATH superfamily
3RPVA 3OHTA 2ETKA 2ZM1A 3QX4A 4DH1A 4ENYA 3TTIA 2A2AA 4HVGA 2J6MA 4RLLA 4MX9A 2W4KA 1MUOA 2V7OA 2VUWA 5J7BA 3PIYA 4LQMA 4JRVA 3RPYA 4OTRA 1WVXA 1H1QA 3TWJA 2JITA 3C13A 4FKOA 5DA3A 4AAAA 2YHVA 4BR3A 2IJMA 1CDKA 2R3HA 3R1QA 4NEUA 4BY9E 5T3QA 4Y83A 1B38A 4H36A 3MJ2A 2UZEA 3BLHA 5JQ8A 5HO8A 3CD3A 2EUFB 4MKCA 2PVHA 3UQFA 1OM1A 4QP9A 3V8WA 5IQCA 3KEXA 2CHLA 4FOCA 4ITJA 5T68A 4UWBA 4BIEA 4YZBA 4C57A 1I44A 5M51A 3NLBA 1A9UA 2W1EA 2X8DA 3OWPA 3UOJA 4KB8A 4O4CA 4ZSAA 5BMSA 5CF8A 5IUGA 3DFAA 5KMMA 4GT5A 3R30A 5CU0A 2AEGA 3O51A 3ZUUA 1NW1A 3QQGA 4NW5A 5C8MA 3LQ8A 5HBJA 4QMPA 3FYJX 1V0BA 3LVPA 5EOBA 3IW4A 4E6DA 3TN8A 1ZMWA 4D1XA 4ZS0A 3UIXA 3C1XA 1PXIA 3MTFA 4AP7A 4C3PA 3HUCA 2CCIA 4E8AA 3NS9A 3LM5A 4RIOA 4BZNA 3V5QA 4R3CA 4HVSA 4L44A 4FG8A 4PY1A 5JMSA 3DXPA 2R7IA 5L6OA 2J2IB 1ERKA 5IA2A 4G34A 3NUSA 5FEQA 4FVPA 2UUEA 4ACCA 3L8VA 4JG7A 4IDVA 2X2KA 4HNIA 1G8AA 4JLCA 2A27A 4PNIA 3ORMA 2DWBA 3F88A 3IO7A 1B39A 5EW9A 3QRIA 1SNUA 4XBRA 3G90X 5IPJA 3TEIA 2XNOA 3FI8A 5B7VA 4DG0E 4F63A 2VTHA 3K5VA 2YITA 4JRNA 4WSQA 3VS6A 4ZZNA 3QFVA 3FZTA 4O0YA 1ZOHA 2YA9A 3OWJA 4LRKA 5M44A 1QPDA 3FL4A 3RKBA 5CQWA 3OD6X 3RPSA 4E6AA 5DMZA 4RC3A 5LXMA 3TIYA 4O1PA 4D2TA 3O8PA 5F9EA 1FGKA 4ANOA 3VUMA 3MIAA 5HGIA 3D5VA 3P5KA 3MFUA 3Q9XA 3MS9A 4RIYB 4KS7A 1BX6A 3QRKA 5HG8A 5KMKA 2VNYA 3EQBA 1PY5A 3UG2A 3NPCA 3BE2A 1GZKA 2R3RA 4GV1A 5ETIA 5GZ9A 3R83A 4E5AX 5HBEA 1G8KA 1IAJA 3PVGA 3UZRA 5CVHA 3BU6A 1Y6BA 3ACJA 2PMIA 3CPCA 4O1OA 4S2ZA 4C37A 4XG3A 1B6CB 4YSMA 3HP5A 2PYWA 4ALWA 2BZKB 2XNGA 3D9VA 3OP5A 5DN3A 2XNEA 3R8UA 2X7OA 1ZYCA 1WBVA 3HRFA 4QPSA 2JKQA 2F4JA 3D7TA 3GU4A 4ALVA 4EH7A 4FTUA 1BLXA 3H4JA 4WNMA 2PL0A 4EQMA 3KMMA 3ATSA 1J1CA 2BALA 2J5FA 3P7CA 2XJ2A 4Y5QA 4DGLC 3KK8A 4AGCA 3IGGA 4OW8A 4IH8A 5HO7A 3OY1A 2RL5A 4EZ5A 3RCJA 3F3TA 3KXZA 2CLXA 3R1YA 3LFQA 4JOAA 3D94A 4FYNA 4UWYA 4HYUA 4BC6A 4BWPA 2AC3A 1PMEA 4GKIA 1UVRA 1WZYA 3NYXA 5BVEA 4IX4A 1R39A 3A7FA 3BE9A 2Q0NA 2P4IA 2P3GX 2YM5A 3QYZA 3R21A 4L67A 5C8KA 4CFNA 4TXCA 5G6VA 4N6ZA 2YZAA 2VTJA 3BYVA 4V01A 4UZDA 5ANKA 4PMPA 5KX8A 2VN9A 5L3AA 2BRMA 4PPAA 5TR6A 4RZWA 3PVWA 3R1SA 3FYKX 4BDKA 2CCHA 2QNJA 2JDRA 2QG5A 2PK9A 2YCFA 3HV3A 3ORPA 3P78A 4TZRA 4BHZA 4BZDA 2QD9A 4U5JA 2Y6MA 5BMMA 5KE0A 3RJCA 3DA6A 3E3BX 4I94A 4U41A 5J95A 4CRSA 4RX5A 5EM6A 3GUBA 4HGEA 3JYAA 3QC9A 5CTPA 1RJBA 3UOLA 3BV2A 1FMOE 4JS8A 2OIQA 3R00A 5HHWA 4FTJA 1OKZA 5AJQA 3PE1A 3F5XA 4X2FA 5M56A 5FRIA 3BCEA 5KKRC 4EK6A 4NKAA 3SG8A 5ACKA 4OTWA 5K5NA 5AV3A 5BVWA 1LEZA 4AN2A 2OZAB 4B4LA 4CZTA 5J1VA 4DFLA 2ZB1A 3L8XA 1V1KA 4BDIA 3W2CA 1UNHA 4F6SA 4NFNA 4YHFA 4FKRA 3HUBA 2ITTA 2Y0AA 2VO3A 2X9EA 4FNZA 2PVMA 3FZOA 2J4ZA 4E20A 3CTJA 1OBGA 4JG6A 5FXQA 4C58A 4D0WA 5B2LA 4J8NA 3WZJA 1J1BA 4BCOA 2ZOQA 4IFCA 4QP8A 4KBAA 3G51A 4FVRA 2X0QA 3GB2A 4YJPA 4C02A 4DG3E 3EYGA 4B6LA 1OL6A 4QQJA 5EKNA 2RFDA 5IH6A 4WOVA 4L8MA 1H8FA 3QAME 3SKCA 4Z7GA 4QT1A 3CY3A 4ZZOA 3R71A 2WQEA 4KRCA 4JG8A 2X7FA 4GG7A 5M09A 3LLTA 4QNYA 2UVXA 1U54A 4V0GA 3F2AA 4QYYA 5KBQA 4FV0A 5DE2A 3ZRLA 4JBVA 4CMUA 5A6NA 4HGLA 4LOOA 4U6RA 5IEVA 4AF3A 3RWQA 5JGDA 2Z7LA 3ORTA 4MBLA 1W2CA 4USDA 4R1VA 4E7WA 3GU5A 1BKXA 3KIOC 5DOSA 4HNFA 1H28A 2O64A 5K0KA 4DFZE 3NX8A 4R3RA 2OICA 3FHIA 1XH6A 3ORIA 5FP5A 2X0PA 4QRCA 2XS0A 3UIMA 2XAOA 3FMHA 3RALA 1JQHA 5B0XA 1YWRA 1CTPE 3LCTA 5FM3A 2WMAA 3W33A 3DK3A 2VD5A 4CD0A 5A9UA 5F20A 5TO8A 2Y4PA 3SX9A 4QMVA 3EL8A 3LAUA 3MI9A 4QMTA 3OXIA 4TYHA 1MRUA 4WO5A 4TWNA 3W32A 3EQFA 3ORKA 4CMTA 3PG3A 4F65A 3UMWA 4LG4A 4D1SA 4Y72A 2QCSA 1XH9A 4AXEA 4C3RA 3DPKA 3NW7A 3QWKA 4GK4A 5HI2A 3OS3A 3UYSA 1ZAOA 2QO7A 1H24A 4YC6A 4CFVA 2RFEA 4F7SA 4E5WA 4DEEA 2R0UA 3VBWA 3PJ3A 4XEYA 5CF6A 2HWOA 5DNRA 4QMLA 5A4LA 4I6LA 3G9LX 3ZLYA 4KINA 4AW5A 5I0BA 2GMXA 4O7RA 2VNWA 4DAWA 3A2CA 2XK3A 2OIDA 5I9UA 2GDOA 3ORXA 4DEIA 4FV5A 4AT4A 4EL9A 3Q6UA 4TPTA 4FTCA 4F09A 4BRXA 1FVRA 3ENHA 5I9VA 1OL2A 2GHGA 1Y8GA 5L2IA 1G5SA 4EH6A 3R9RA 2X81A 3AD6A 3P86A 4I4FA 4JIKA 3FQSA 4P2KA 4YBJA 3W2PA 4F0FA 4U8ZA 4YTCA 3QBNA 2JIIA 5HEZA 5D10A 3RM7A 4XG4A 4G6LA 4NYEA 3KXHA 5DWRA 4K77A 4EK3A 3WF6A 1K2PA 3V3VA 1IG1A 2WTVA 3FPQA 1Q4LA 2QC6A 2QOQA 2IVTA 3IW5A 5E4HA 3DLZA 5AR8A 4EOOA 4BI0A 3CQUA 3AXWA 1Y57A 3VS1A 4LRMA 3TDWA 4W4XA 3TZ9A 2O0UA 3JS2A 4DTAA 2VTTA 3CP9A 4FTQA 4FKIA 2HENA 1OKWA 3IOPA 2P0CA 4L45A 4YZCA 3R9OA 3TT0A 1OIUA 1YDTE 4FZDB 2E2BA 3ROYA 4DINA 3NW6A 5CSPA 4DFNA 3COKA 2ERZE 1L3RE 1NA7A 2IW6A 3EQCA 4I5MA 4G3DA 3KCKA 3KMUA 3CS9A 4IHPA 4DBXA 4G2FA 1T45A 2UW5A 3AQVA 2PU8A 2X8IA 2VTIA 2X9FA 4QQCA 4O81A 5M57A 2GQGA 4JQ7A 3QD3A 3W18A 5FD2A 4CVAA 1WFCA 1Q97A 4AQCA 3D0EA 4ZSEA 1YXXA 2W4JA 2I0VA 3MA3A 1JSUA 5HG9A 5JRQA 4DYMA 2QHMA 4M15A 4TL0A 3FMNA 4FYOA 3FKLA 2PUNA 4LRJA 4RFYA 3ZU7A 2YABA 2Q0BA 2ZMCA 3EHAA 3HMMA 1KV2A 4FNXA 5I9ZA 4RQKA 4Q5EA 4DFUA 3RMFA 5HNBA 5GIOE 1R78A 4UY9A 4EH2A 4FKJA 5D7VA 1OIQA 4FZFB 3CTHA 4N0SA 3KCFA 3H0ZA 4AZWA 4RIWA 4FNYA 2XP2A 4ZTSA 2JKMA 4MBIA 4EWHA 3ZFMA 3PA5A 4A06A 4DEBA 4MCVA 2JIUA 5EFQA 2YAKA 3E62A 1ZXEA 4WNKA 3PPZA 3BHTA 3ZRMA 4BTJA 4KKGA 3GU8A 5HOAA 2HCKA 4J97A 3LCDA 1YHSA 2VWXA 4MK0A 3ZBXA 2YEXA 2UVZA 3KXNA 2HELA 2I0HA 5KZIA 5AA8A 4C61A 1PYXA 4WT6A 4D58A 5EM8A 3RTPA 1KV1A 2WMWA 3KC3A 4A4LA 4NKSA 4DHJA 5DI1A 5HE0A 2UVYA 4ZZMA 3B8RA 3V6RA 3JR1A 1IA9A 4EC9A 2WMBA 5D1JA 4GH2A 2F7ZE 3FV8A 4USFA 3RM6A 4IM3A 4E6CA 4NH1A 3TV7A 4DHZA 2HW6A 2QO9A 3PXZA 5A14A 1XWSA 3DNEA 4DTBA 3COIA 2CN5A 1GJOA 3KRRA 5E8TA 1J7LA 3QKKA 3IOKA 3JVRA 3DT1A 3BELA 2P55A 1Y91A 4QP6A 3ALNA 4RLKA 3FE3A 4FKPA 3WYYA 3FI3A 2VZ6A 3KGAA 4LOQA 2PMNX 3ENMA 4YO6A 3ZUTA 1IASA 2HZIA 4EI4A 4H58A 2BKZA 3FZ1A 4QYGA 4FTTA 3OC1A 4WIHA 3AT4A 5IKWA 3LFNA 3AD4A 4NSTA 3PWDA 5EM5A 1URCA 5C9CA 2QR7A 2HW7A 4DT9A 4MUQA 3K3JA 2HAKA 3F5GA 3OXZA 3VNTA 2C1BA 1H25A 1L8TA 2BFXA 2XEZA 3CJFA 3GT8A 3Q3BA 4D55A 4RFZA 2G9XA 4OBOA 3R7IA 5CEOA 1M2RA 1VJYA 2IZTA 3W0PA 3VS7A 4CCBA 4RMZA 4YLKA 5L8LA 4R3PA 3VO3A 5HTBA 4NJDA 3QA8A 4A7CA 3O96A 5HIBA 3TZ8A 4FVQA 3ZO1A 4FEXA 3BEAA 3FLSA 4NK9A 1OIRA 1Q99A 1PMNA 1JAMA 4RJ4A 3VHEA 3UQGA 1SVEA 4GJ2A 4ASXA 5LMKA 5HE1A 3W2RA 5J79A 3I7CA 3W10A 4RIYA 2ESMA 4F7NA 4PMSA 5BUJA 2DQ7X 2YM4A 4RVKA 2ITZA 3VONA 3MPTA 2CKEA 4RC2A 2BVAA 1UU8A 2EXCX 4TW9A 2ETRA 4QTAA 4W9WA 4EOQA 5I4NA 3O0GA 4AXAA 2JAMA 4NM5A 2B4SB 3Q4CA 3U6JA 4IACA 5LVNA 4RG0A 4J98A 5IQAA 4U97A 3DDQA 3ZZWA 3NNVA 4I6HA 1JKLA 3MVMA 2QOLA 3CKWA 5L2QA 4OTIA 4BDGA 5I3RA 5JQ5A 1RW8A 2WAJA 2OJGA 2XIYA 1U5RA 3LQ3A 3OCSA 3WYXA 3S95A 4WBBB 2WIPA 4ZY4A 3P79A 4DDGA 2VWIA 4I5HA 1CSNA 3PJ8A 3CQWA 4FTIA 1FVTA 4W4YA 4X3JA 3ZH8A 1NXKA 1O6YA 3R0TA 1KSWA 5LCJA 3OWLA 3GCQA 1ST4A 2XB7A 3KU2A 3IGOA 4BZOA 3E8EA 2X7GA 4LGHA 2BMCA 4FKUA 4AUAA 1H4LA 3NUYA 4QQ5A 4ZJVA 4CTCA 3KN6A 4HZRA 5IH4A 2OFUA 3UOKA 4G9CA 3VN9A 5IQDA 4DFBA 2YLEA 2ZV2A 1NVRA 4IAAA 4DGNA 2BZJA 3QD4A 4IVBA 4MVFA 4G17A 2BROA 4RX8A 1XBBA 4F9YA 3MFTA 4NZWB 4WNOA 2GS7A 1ZYLA 3A62A 3LJ2A 4L01A 4BB4A 3U9CA 5CSVA 1OB3A 3AG9A 3RK9A 2J0IA 2XRUA 5JFVA 3E93A 3TNIA 3ET7A 2GPHA 3GU6A 3BU5A 3MB7A 5AUUA 4J71A 5DBXA 4K6ZA 2WMUA 3W2SA 3RAHA 4RJ3A 3GENA 1BYGA 4E5BA 4ZLOA 1JKKA 2W4OA 2WEVA 2CNQA 3VF9A 4O2PA 4UMPA 3ZSIA 2YCRA 3MV5A 1UKHA 2REIA 3NWWA 4ONAA 4ZIMA 4QYHA 4XCUA 2EVAA 3DQWA 3ZZEA 5IEXA 2YWVA 4ASDA 2OZAA 5HCZA 1CMKE 5BVOA 4IXPA 2UZDA 2JAVA 3IW8A 1ZYSA 3NNUA 4DGMA 2C69A 2R5TA 3PJ2A 2C5YA 3EN5A 3R1NA 3JPVA 5M4UA 4HCUA 3V5TA 4EQCA 4FIGA 4ZSJA 5AR2A 3PP1A 5AP2A 4FG9A 3I6UA 2OIBA 4TYGA 3C4ZA 4OLIA 1G8SA 1ND4A 4JMQA 4G31A 4GW8A 5AUZA 3WF9A 2C6DA 4EOIA 4F64A 4I6BA 3S0OA 4YTIA 4AT3A 4RGJA 1QCFA 4BI1A 1Q24A 4KABA 3ZRKA 3CC6A 3CTQA 3HRBA 3W0QA 3ACKA 4MXCA 1KE7A 3Q96A 2C3KA 2Y8OA 5KMIA 4CT2A 5AFVA 2QO2A 5AAGA 3NSZA 1FGIA 2VTAA 4TWCA 1PYEA 3EN9A 4YJUA 4H39A 1DAWA 2EWAA 2HZ4A 3VC4A 4QTEA 5LMKC 1WBPA 4FIIA 4FSRA 1S9JA 3PRIA 4FV6A 4O0UA 1GIHA 3FZRA 4UEUA 3UYTA 4F70A 1OL7A 3MYGA 4XV9A 3BWJA 1VYZA 3R2BA 2VTQA 5CS6A 5HVJA 4QMYA 2XALA 4KKEA 5CEMA 1XBAA 4V04A 3A60A 5C27A 4BKZA 1S9IA 2UZNA 4LGDA 4L43A 3KVXA 3TZMA 5BPYA 5HORA 2G2IA 4IWPA 5EOLA 1Y8YA 2VO0A 2IW9A 1OMWA 4B9DA 1YXTA 2IVVA 4ASEA 4W4VA 4M84A 4UMRA 3ZM9A 4CEGA 3QTQA 4I6QA 5K4JA 3C5UA 4EUTA 1WMKA 4CTBA 3Q9WA 4OAUC 4FT9A 5KBRA 4GU6A 2PTKA 3GC8A 3UPZA 5E91A 2OKRA 1GIJA 3FXXA 2XJ1A 4FT0A 4ZTRA 5AV0A 4D2SA 1NT2A 3RCDA 4ANMA 4BL1A 1YDSE 2H34A 4W8EA 1UA2A 3Q4TA 2PHKA 2YDKA 4YJTA 5AM6A 5EM7A 2QQ7A 5CAPA 4GT4A 1Z5MA 2VTSA 5IH5A 3EN4A 4KBKA 4OTGA 4UMQA 2WTWA 4U40A 4NTSA 3QLGA 4TTHB 2UW8A 3UO5A 4WSYA 3SG9A 5C01A 4CXAA 3BYUA 4D2VA 2A4LA 4LUDA 5KO1A 1WAKA 2WMRA 4D4YA 1Q62A 4IX6A 4A4XA 5JFSA 5FEDA 1H07A 3O8UA 2Q83A 2V5QA 5JFXA 1P2AA 2ITOA 4WUNA 1KE9A 5M06A 4P7EA 5CZIA 3QZHA 3THBA 5HG7A 3PLAE 5M07A 5CI7A 4J8MA 5CENA 4M67A 3P7BA 4EOPA 4U9AA 2W5HA 5TE0A 4UMUA 5KMOA 2EB3A 2C6EA 3DKFA 3MVJA 5LQFA 3UDTA 4B8MA 3QXOA 2VTPA 2OWBA 2C3LA 3DQXA 4QMUA 3UIBA 3ITZA 2UW4A 4MD8E 3OROA 4AW0A 4F08A 4ERKA 3MESA 2RSVA 3ORNA 2BAKA 3QZFA 1SM2A 1WBSA 3D4QA 3DTCA 3KVWA 4IE9A 4F1OA 4S33A 4QQTA 5CF4A 1VLRA 4C62A 4U7ZA 4D1ZA 1JNKA 4FT5A 4QP1A 4XP3A 4RVLA 5LARA 3FBVA 5BUIA 3QTZA 5ETFA 1FOTA 3DAKA 1ZY4A 4AW2A 3A7JA 1ST0A 4R8QA 1KE8A 4PWNA 4A9YA 4I1ZA 5BNJA 3O7LD 1TFFA 4EH3A 5FWKK 1VZOA 4W9XA 4GJ3A 4FIFA 2QOKA 5AWMA 4GK2A 2JIVA 4IZYA 4X2NA 4J95A 5IQFA 4DEAA 1P4OA 3UVRA 3GCPA 3W16A 3VS0A 3P1AA 3AMYA 3ZXZA 4KS8A 3AMBA 3HMIA 3LXLA 4K18A 3P08A 3SV0A 3VUIA 1P5EA 2GHMA 1K3AA 1OGUA 1UWHA 4ITIA 4I23A 2FSOX 5AP3A 1ZRZA 2PVRA 3DZQA 3LW0A 4G5PA 4CMOA 3TV6A 1MRYA 4C4GA 2YCSA 3UC3A 2ZV9A 4QTBA 3DLSA 4X7QA 5F94A 4O0SA 3BQCA 4I24A 4FV9A 4WKQA 3KFAA 4Q2AA 5CSXA 2FH9A 2CKQA 1YXUA 2PE0A 3VVHA 3PJ1A 3HMPA 4IBMA 3Q6WA 5LMBA 5JGBA 2XYNA 1MP8A 3QCYA 2QLUA 3R63A 2ITNA 2WHBA 2C47A 3FEGA 3G5DA 4G3GA 3NAYA 3P7AA 4XRLA 5TT7A 2C6IA 3OEZA 5KHWA 4MXZA 5D41A 4FTAA 5LOHA 4O7ZA 4QNAA 1F3MC 4MQ1A 4AN9A 3BYOA 4C35A 4FI1A 5JZNA 3FZPA 4XLVA 3QQKA 1WVWA 4ACHA 4BBEA 5IA4A 3AC1A 4QYEA 3H3CA 2VWUA 5J9YA 2CGXA 3M2WA 4EHVA 4GKHA 4AE6A 1XH4A 4MHAA 4DG2E 1W82A 5CASA 5CXHA 5BUEA 2ZM4A 4ASZA 5LVPA 2OJIA 1O9UA 2BKKA 3OCBA 1UNGA 3QHRA 3UQCA 2B1PA 5DHJA 3IPHA 1GZ8A 4L52A 3EZRA 3PE2A 4DGGA 3DK7A 2EU9A 4YZNA 5AR4A 5AAEA 5M55A 1PXMA 4BWXA 1ATPE 1MRVA 3QWJA 4IX5A 1QMZA 4ZSGA 3B2WA 2JDVA 1V0OA 2BDWA 2V0DA 3R7YA 4D4VA 3ID6C 5H8BA 4EH8A 5H8EA 5CAVA 4YMJA 5HLPA 4UX9A 5CAUA 5E1EA 1VEBA 2F57A 2HXLA 5FXSA 1PXOA 4JXFA 1P14A 3O2MA 2VGPA 2NRUA 4BCMA 4JL9A 3QUPA 3UP7A 3E8DA 4PDSA 4G5JA 3G6GA 3C50A 4QPMA 3HGKA 3COHA 4NM7A 2WGJA 3TKHA 4UYNA 3ZCLA 4AN3A 2QLQA 3LPBA 3PSDA 4ZJIA 4D9TA 2F7XE 3DOGA 4BGGA 4AZSA 4EZ7A 2E9VA 2GTMA 2JC6A 2VX1A 3HKOA 3NVKI 5IA5A 4NFMA 2XM9A 1FINA 3FY0A 2LAVA 2VWVA 3ATTA 4F6WA 2PUPA 2BRBA 4BGHA 3VQUA 2PVKA 4NCTC 2CKPA 2R3LA 4XX9A 3UZTA 3SA0A 5E90A 1HCLA 4U3YA 4ARKA 4MNEB 5K5XA 3SLSA 4DFXE 4M69B 4OBPA 3ZO3A 2CKOA 4EBVA 3FKOA 3I79A 4K8AA 4GRBA 5LMAA 3TKUA 3A7GA 1ZARA 2YJRA 4UALA 1DS5A 2ZAZA 3E5AA 3Q4ZA 3ALOA 4EHGA 4DLJA 3G9NA 3FXWA 4RVTA 5JK3A 3DAJA 1WBNA 3W1FA 3ZOSA 3IDBA 3LXKA 4IAFA 4PPCA 4XOZA 4EWQA 5ICPA 3KK9A 4FZ6A 3S1HA 3UZPA 3ZDIA 5EDPA 5DYJA 3DCVA 4GFMA 4GU9A 3DY7A 1Q3DA 3GCUA 4FV3A 5CYIA 5A46A 2RGPA 5HU3A 2I7QA 3RHKA 4MXOA 5GHVA 4BCPA 3F9NA 3G6HA 5AP4A 4DITA 3MN3A 4CLJA 2NYAA 3F66A 4ALUA 3CCNA 2QOBA 4PF4A 4X3FB 3ZC6A 3N4VA 4YNEA 3REPA 5DT4A 2JFLA 3R7GA 4GYGA 4ZLYA 4U79A 4RX9A 5HCXA 4YUQA 1PKGA 4MH7A 2H9VA 5KCVA 2W9FB 2EXEA 2GNLA 1PMUA 4IVAA 2YM7A 4K9YA 4E6QA 4FKWA 5AUTA 4BDEA 2GNJA 2CNUA 5BYLA 1M17A 2FYSA 3MDYA 4O0RA 2WPAA 2EXMA 1YOMA 1OIYA 3EQRA 4K11A 3KB7A 4O6EA 3FWQA 2P33A 3T8OA 5CZHA 2GU8A 4FBXA 5DRBA 1FMKA 1TQMA 4FTKA 5DEWA 5H2UA 3BPRA 3E88A 4O96A 3B2TA 2XMYA 4QYFA 5D9HA 2DYLA 4AXDA 4G3EA 2QURA 3AC4A 4Q9SA 4HYHA 2RIOA 2C0OA 3LCOA 3H9RA 1ZYDA 3UVQA 2B9FA 3VHKA 5BVNA 2RG5A 5K3YA 3V6SA 4BF2A 3BQRA 3S00A 4ERWA 3DNDA 5HG5A 4KIQA 5J87A 2R3KA 3LLAA 4FK3A 4J52A 3ZHPC 3MH0A 2PUIA 1Q61A 2GCDA 5BVDA 3FC2A 3OFMA 4RC4A 2V22A 5ITAA 2W7XA 4G16A 4IB5A 2YWPA 3R02A 4BDCA 1PXPA 3ULIA 3CGOA 4IVDA 4CQGA 4YR8A 4R77A 4UMTA 2HYYA 2X2MA 2UW9A 4KSPA 5IA1A 2HXQA 2WD1A 3QC4A 4IM0A 5EHOA 3JY0A 1OPLA 5E8XA 2PVJA 4JBQA 4ENXA 2R7BA 2PZPA 3R8VA 5HX6A 4CZYB 3EWHA 2XNNA 3DV3A 3Q52A 5CNNA 1YI6A 3R8LA 1REJA 2R9SA 5L2TA 2VTOA 5ANGA 5HLNA 4RWIA 3UNJA 5AP0A 2BRHA 3DTWA 3DS6A 2B53A 4TT7A 4QMQA 1JVPP 2DS1A 2R3OA 2VAGA 2WTKC 3L9PA 3OBGA 3OUKA 4FKSA 4O4FA 3RVGA 2FSMX 2ETMA 3PP0A 4AA0A 2ONLC 2FVDA 2UW0A 4U80A 3LMHA 2JKKA 2UZWE 4E93A 2Z7RA 4R7HA 2QHNA 5EKOA 2XK9A 4AACA 5EQYA 1SNXA 4C0TA 4YBKA 4FX3A 4QDEA 2YIWA 1MQ4A 3QU0A 2VO7A 5JRSA 3Q9YA 1TKIA 3CGFA 2P2HA 2YFXA 4UV0A 4O7NA 3F3ZA 2BZHB 1TQIA 3VUHA 1LR4A 3GOPA 1E9HA 3VS3A 3SOCA 4IVCA 3U51A 3SDJA 2E9OA 4II5A 3LFEA 2JKOA 3OWKA 2JFMA 3RHXA 4BKYA 5KNJA 2QODA 5D12A 1M7QA 1VR2A 2GSFA 2XK6A 3LQ5A 3E8NA 4X6QC 1ZY5A 4EONA 4MF1A 4CV8A 2BRGA 1BL6A 2ERKA 2W1GA 3DJ6A 3UO6A 4FEQA 4E73A 3R2YA 3GOKA 2GTNA 3EFWA 1H08A 3R7VA 3VUGA 4ANNA 2XUUA 2JDOA 3HRCA 4JQ8A 1BMKA 4FIJA 2CJMA 2OU7A 4Z9LA 1URWA 2YISA 2J0MB 5IUIA 3ROCA 4ZAUA 5GZ8A 3O7LB 4CLIA 4JAJA 3V8TA 3ZSHA 3HYHA 2HZ0A 3DBQA 3F2NA 3FSKA 3FMMA 2W1FA 3QL8A 4IIRA 4WA9A 4XBUA 4HVDA 3EFLA 3N9XA 4XG6A 2XIRA 4FTNA 4FRFA 4RWKA 5FP6A 4BWKA 4L00A 2PZ5A 4G3CA 3UO4A 3WILA 3U4UA 3PXKA 2PSQA 4D2PA 2GNGA 1H01A 4DE4A 3NIZA 2C6MA 3P9JA 3UODA 2IPXA 1OECA 2BR1A 4C34A 4AXCA 3U6HA 2XAMA 2UZOA 4ZEGA 2BPMA 5TOZA 3UE4A 2PWLA 1GZNA 2R3IA 1M7NA 3V51A 2V62A 3I0QA 3PJCA 4XP2A 5AUYA 3VS5A 3WIKA 4I0SA 4Y95A 5E8YA 5D7AA 1YW2A 3NW5A 3SRVB 4JJRA 4KWPA 5CEQA 2C3IB 4AOJA 3DGKA 2B0QA 4KUJA 4QP7A 4FKTA 5EW3A 5FEEA 5TF9A 4KA3A 2YAAA 3FXZA 2QG7A 3ULZA 3HL7A 3F3VA 4BCQA 1V0PA 3E87A 2B52A 2OH4A 1PW2A 1QPCA 1XMMA 1YRPA 2ZB0A 3TDVA 3VF8A 3KKVA 2CLQA 4G3FA 2CMWA 3CQEA 1WVYA 3TI1A 1O6LA 3WBLA 4CFMA 3LMGA 4EOKA 4I22A 3VBYA 3ODZX 3QTUA 2A1AB 4NM3A 3U6IA 2JLDA 4FV8A