5HD7A

Dissecting therapeutic resistance to erk inhibition rat mutant sch772984 in complex with (3r)-1-(2-oxo-2-{4-[4-(pyrimidin-2-yl)phenyl]piperazin-1-yl}ethyl)-n-[3-(pyridin-4-yl)-2h-indazol-5-yl]pyrrolidine-3-carboxamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
347
structure length
347
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFDLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Dissecting Therapeutic Resistance to ERK Inhibition.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 115
structure length 347
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hd7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hd7A01
4H39A 1LP4A 4IH8A 1OIUA 4AZSA 4NWMA 1J1CA 4BDFA 4JR3A 4FF8A 3HECA 4AOIA 3K54A 4YZDA 2OF2A 1A48A 4XBRA 3B2TA 2QQ7A 5TKDA 4U0IA 4YPSA 1ATPE 2OIBA 4OLIA 4TYIA 2C6DA 5CALA 1H08A 1KE5A 3R83A 2WMSA 2YISA 3D0EA 4IVBA 4LM5A 4AP7A 3S0OA 2OWBA 3QZHA 4RIWB 3TT0A 3ZZWA 5EM7A 4MXXA 4FKPA 3D15A 2VWIA 2CKOA 4IDTA 2B7AA 2QU5A 2VO0A 2O2UA 2OH0E 2OJGA 3SD0A 3F3WA 5BX0A 4ZK5A 2YITA 4DEAA 3LM0A 4O7RA 3BGPA 2BVAA 4UWYA 4YTIA 5AV0A 1PXPA 2OKRA 3FMJA 3C1XA 3Q96A 5IEVA 5FM2A 4FEWA 2JFMA 3TM0A 5EM6A 2YDJA 3CGOA 4FTQA 4IE9A 4PDSA 5CT7A 4QYYA 5DWRA 2JEDA 3LCOA 2GFSA 2BROA 3LCKA 4LGGA 1OUYA 3D83A 3ORLA 4RC3A 4L53A 5HE3A 4CLIA 2A1AB 1KSWA 4JI9A 3VS7A 1OL5A 3REPA 1OKZA 2CGUA 3M2WA 4B0GA 5CZHA 1IAJA 2W5AA 1X8BA 3TUDA 3BCEA 1YOMA 4LI5A 4XH6A 5CU3A 1A9UA 4GYGA 2YCFA 4ZP5A 4QPSA 3S3IA 2CN5A 5HX6A 4QYFA 2UZNA 4E7WA 2OJFE 4FTOA 3PJ8A 2VTLA 3Q9ZA 3IOKA 4AAAA 3E3PA 4JBVA 4B8LA 2BRBA 4WHZA 4CNHA 3MY5A 5GINE 1FBNA 3FEGA 2WTJA 2F9GA 4MD9E 2XMYA 3V5LA 3DU8A 3DB6A 4HZRA 4FV0A 4WA9A 2IJMA 4C3FA 2G2FA 2BHEA 2Z2WA 3DK3A 3BZ3A 2WKMA 4DCEA 4RIYB 2PY3A 3GQLA 3NX8A 5LVMA 4NJ3A 1SMHA 3LOKA 2BRNA 3A2CA 1YHWA 2FUMA 2ZDUA 4ZSAA 3RZFA 3RP9A 3AD6A 5DR9A 5L8KA 2YAKA 3MGYA 3PZHA 4AE9A 3P86A 4XLIA 3CS9A 1OBGA 3AC8A 4AW1A 5C26A 2BKZA 2YM8A 2ITWA 1AD5A 1YKRA 3F9NA 3OWPA 4M66A 4GKHA 2ZB0A 3QTWA 4NCTC 3M11A 1BX6A 5EI2A 2F7EE 3VAPA 4NJDA 3GOKA 3R7GA 4IAAA 3W16A 5FUTA 4WBBB 4AS0A 4EJNA 3W2OA 3FV8A 3CQWA 5AM7A 3ITZA 2F2UA 3RNIA 5IUGA 5DHJA 4F08A 4YNOA 3F3TA 4R3PA 3SQQA 2ESMA 4I1ZA 4ASXA 2ITVA 4FUXA 4HPUE 5KBRA 2GDOA 4CG8A 3LCSA 1XWSA 3H3CA 4E3CA 4R1VA 4ZIMA 3PZEA 5HLNA 5CNOA 1OVEA 2W1ZA 5FRIA 1NVRA 4LV8A 3I4BA 4M8TA 4UMQA 5BYLA 4KNBA 5L2TA 2IWIA 4MXOA 4KABA 4FG8A 4FL3A 2XB7A 3BU6A 4RWIA 5IA5A 4FL1A 1KOAA 3I6UA 4RIXA 1XH4A 3CJFA 4KBAA 2E9NA 1Q8ZA 2RFDA 4FOCA 4HVIA 4CZUA 3GB2A 4G16A 4XG8A 4JNWA 4AX8A 1YXSA 3HP5A 3QX2A 4JAIA 2PMNX 4LQMA 3PXZA 2Z7QA 5A4TA 4JQ8A 1WBVA 5I9XA 4QTCA 4I0RA 4NCTA 5JFXA 5M57A 1U46A 3RVGA 2ZB1A 3NUNA 3Q4CA 4RSSA 2AYPA 2C3IB 5KCVA 4F7JA 3UP2A 5BMMA 5AP0A 5LMAA 4YMJA 1WBPA 3EFLA 2QO9A 3QL8A 4BIDA 4G34A 5EOLA 5CI6A 4AGUA 4O7VA 3E93A 1XH8A 2IW9A 4EEVA 5C03A 3WILA 4CKJA 5EH0A 5E8ZA 3RTPA 2QOQA 3EB0A 2ZMCA 1J7UA 4C4EA 2B9JA 3FL4A 1H8FA 2R7BA 4DFLA 4DFNA 4Z16A 3F2RA 2C30A 4G9RA 3LCDA 2VX1A 3DBDA 4CFNA 2HK5A 2OH4A 3LAUA 3GU6A 3SA0A 3QHWA 2Z7RA 3RAHA 3UOKA 4GT3A 2CNQA 2ITPA 4MCVA 4YU2A 3CKXA 2HWOA 4I5HA 5EG3A 2X8IA 2GCDA 3CY2A 3DTWA 5HTCA 3C4XA 4YO4A 3V3VA 4DF3A 2PMOX 3A7GA 4DGNA 4M68A 4BDJA 1M17A 4H1JA 4HGTA 2WAJA 5CANA 4BCJA 2ZV2A 3PFQA 3FXWA 2QOOA 2QR7A 4Y73A 3N4TA 4BN1A 3CP9A 2DWBA 1P5EA 3BKBA 4FV7A 5LOHA 3GU5A 4IWQA 4DITA 4ZOGA 2R3MA 3KK8A 3H9RA 3EZVA 3BYUA 4XEYA 1WBSA 4JLCA 2GFCA 5A14A 4DG2E 3FZRA 2JC6A 3NNUA 5DR6A 5FXQA 1IRKA 3QALE 4TYHB 2YAAA 3IW7A 4H36A 2Y4IC 1JSVA 5EKOA 4EUUA 1UV5A 4YUQA 2X2KA 3OWKA 1KV1A 4HVSA 4ZTNA 2GQGA 4ZMFA 5L4QA 2JIIA 4RZWA 4FIGA 3OXTA 5F95A 3EYGA 5EYKA 2WMAA 3DA6A 4LYNA 3MDYA 3R04A 3H4JA 3ZXTA 3HV4A 3EFJA 4J95A 4EZ3A 2ONLC 4I41A 2FSOX 1H0VA 5FTQA 2UW0A 1BUHA 4W4YA 4FVQA 3IECA 5HCYA 1OIQA 4K9YA 1YWRA 3T9TA 2XYUA 4RZVA 1KUTA 4FZ6A 3QAME 2VD5A 4IDVA 3L9MA 1TQIA 3Q52A 4MXCA 3HUCA 3SXRA 4E1ZA 1BL6A 4IXPA 1JNKA 3AOXA 4GFMA 4YPDA 3FL5A 1Z9XA 1GIHA 4JOAA 5EHLA 3SKCA 1ZYCA 2RFSA 4PPCA 4RLKA 4XX9A 4BHNA 3PPZA 5C8KA 1EH4A 3ORNA 1CTPE 1B6CB 3DBCA 4LL0A 4W4XA 2QOHA 3R2YA 1UU8A 1MQ4A 4FKQA 3G2FA 2Q0NA 4FK3A 4RX7A 4KUJA 4EH2A 3SRVA 3GCQA 2FSLX 4I93A 3EHAA 4R7IA 3UC3A 2OBJA 3P79A 2VWBA 1OECA 4FEQA 3VIDA 2QONA 4TYGA 4FKWA 5BUEA 5E9EA 4YLKA 3EN4A 5BVNA 4DE4A 1FINA 4HVHA 5IDNA 3CTQA 4D58A 1DAYA 5BMSA 1FGIA 3BU5A 4K18A 3VUHA 4BDHA 1IR3A 3QLFA 4ZZOA 4FTAA 1ZOGA 4MYGA 2R3PA 4LFIA 1V0BA 4U44A 4A4OA 2WZJA 3VRZA 4E4NA 4EK6A 4FA2A 2IZRA 2ONLA 3TKHA 3R1YA 4RJ8A 4ACCA 3RALA 3FY2A 3QRKA 1CSNA 3QX4A 4YJPA 2GQSA 5IQFA 4KS8A 3PE2A 4XP2A 4IZ5A 5FD2A 4RIOA 3ZBXA 5ANGA 4EH5A 1KE7A 1UWHA 2WU7A 2E9PA 3A8WA 3MWUA 3U4WA 3NUAA 4S2ZA 1UU7A 2WHBA 1YQJA 2C4GA 4Y85A 3C0HA 4U40A 2G1TA 3CE3A 3NGAA 2JGZA 2BZKB 4I6QA 1XQZA 4OTGA 3DKCA 3FQEA 4TWCA 1OITA 3FI3A 4RWJA 3LLTA 2J9MA 2CPKE 3RMFA 3FC1X 4NM5A 4AZEA 1ZY5A 3CJGA 4QP8A 2GS7A 2FH9A 2GS2A 3VBVA 4B99A 4F7SA 3GEQA 3MY0A 4PNIA 4CTCA 3KVWA 2EUFB 2Z8CA 2FYSA 3LHJA 3HV6A 5GJGA 2UVZA 2XRWA 2C69A 3P23A 4MD8E 5T3QA 4D2VA 2YZLA 4XNEA 3K5UA 5BVDA 1IASA 3PRFA 3KRJA 4XMOA 3JY0A 1UVRA 1XKKA 2IVVA 5HCXA 3TJCA 5JZJA 2C6KA 3R7OA 5DT4A 1V1KA 4YLLA 3G9NA 3PG1A 3I79A 4AACA 1ZZLA 4ORKA 4RPVA 3T3VA 3OF0A 4YTCA 5E1SA 5CEKA 2NP8A 4R8QA 5AWMA 4Z55A 5GZ8A 4FV4A 4AQCA 4D2SA 3C50A 3C7QA 3H0ZA 4ASZA 3N4VA 4ZZMA 4D55A 3H9FA 4O0VA 2YACA 4X2GA 4ENYA 2CMWA 4MXZA 3SDJA 4B7TA 3FLWA 4B9DA 5FEQA 1W82A 2YWVA 2C68A 4Q9SA 2ZJWA 4PY1A 3MJ2A 4QT1A 4AG8A 4ASEA 5HO7A 3DBEA 3EH9A 5DA3A 4FKTA 2A2AA 5K0XA 4C0TA 4ZY4A 3NAYA 5I3OA 5I9VA 5T68A 2QHNA 4BI2A 2RIOA 3CTJA 4WNMA 1RE8A 2YLEA 3BI6A 5A3XA 2QNJA 5C8MA 4FIEA 5IUIA 4JR7A 3LFCA 4A06A 3VUKA 4WNPA 5HG8A 3F3VA 2ERKA 3EL8A 4J53A 4O96A 5DOSA 3UTOA 5HI2A 2R0IA 4GIHA 1DI8A 4USDA 4IB5A 4NFNA 3KFAA 3EN6A 3L1SA 3DBFA 3COMA 5AX9A 4BYJA 3E8DA 4JRVA 4HZSA 3OEZA 4QYGA 2CJMA 3GQIA 4H3BA 1PXJA 3KA0A 3R7IA 3HV3A 5KZIA 2ITQA 5BUJA 3GNIB 3EJ1A 2W5HA 3PLSA 2CKQA 4C3RA 4KIKB 2Z02A 2QCSA 1MRUA 4Y5QA 2RFNA 4OTHA 5CVFA 4E5AX 3FXXA 2BDFA 4EQUA 2J7TA 4QYHA 1YWNA 4QQ5A 4BB4A 5K4JA 4C2WA 1I09A 1DS5A 5DRDA 1P4FA 4R7HA 1ZRZA 5L6OA 2WB8A 4N57A 3TUCA 2V55A 2YFXA 4I20A 3PP1A 4J8MA 5E1EA 3U8WA 2IW8A 3FQHA 4IZ7A 2W99B 3MI9A 4FZ7A 2ZVAA 4QP7A 2XVDA 3KULA 3FKNA 4FOBA 4C37A 1UU9A 4FTLA 3TJDA 5KNJA 3WE8A 1QPEA 5BQ0A 5LVLA 3ZUUA 3SG8A 3MYGA 4EHGA 5M07A 2VTJA 3L8XA 4FT5A 4F6UA 5E91A 1Q24A 4KD1A 3KRLA 4PP7A 4FV9A 1Q99A 5A4EA 5JMSA 4ZTSA 1KV2A 4FEVA 3E8NA 3NIEA 4B8MA 2UUEA 3QBNA 1GIJA 3I5ZA 4BDEA 4QMZA 5AR8A 5C9CA 3ZFMA 4BF2A 1SVGA 2GMXA 5AMNA 3MH0A 3QZIA 5HNGA 3R0TA 3MVLA 1R0EA 3ZM9A 3OG7A 5AIKA 4H1MA 5EYDA 5FP5A 5HVJA 4X6RA 1ZYJA 4JAJA 4JG6A 4RFYA 4GUBA 2O0UA 2BZIB 1YXXA 4EOIA 2QO2A 5K4IA 4AN2A 3OFMA 4F9YA 5TF9A 4O82A 5AP1A 4YO6A 4LOPA 4O0YA 3I81A 4NT4A 4QP1A 3NNXA 3FZSA 3L8VA 3NCGA 2C6IA 4BKZA 4F6WA 2X9FA 3QU0A 3DXPA 5J87A 2PWLA 3BHTA 5HBJA 1TVOA 2QC6A 3BQCA 4QP6A 4YTFA 2NNWB 4FT3A 4G5JA 2ACXA 2YCRA 5A54A 1H07A 4KS7A 4XG4A 4HGSA 3GT8A 4WT6A 2HY0A 5DEYA 5EK7A 5IQEA 2OIQA 2X7FA 2DUVA 4GCJA 1ZYSA 1REJA 5I9YA 2CCHA 3F3UA 2C0TA 4YJUA 2YEXA 4FT7A 1OGUA 3O7LB 4ZJJA 5HTBA 4D4RA 4I5PA 5AP4A 3NYXA 4GK4A 4X6QC 3VQUA 4NIFA 4EYMA 3O2MA 4ALUA 4PTCA 2Q83A 4FV3A 3R71A 4TY1A 4DH5A 2I0HA 2WMTA 3MY1A 2H8HA 3HV5A 3RAWA 4F0GA 3NNVA 4IAYA 3C5IA 2XKCA 4BBMA 4BRXA 1KE9A 3U6HA 3KXXA 2DYLA 2IW6A 1O6KA 3HL7A 3U9NA 3QTZA 5HE1A 3UIUA 3V6RA 5IG1A 2W1HA 2OO8X 3IKAA 5CAVA 3HMOA 4EH7A 4C59A 5HIDA 2J5FA 3P08A 4LRKA 3QD0A 3VBYA 3AT4A 2P0CA 4FSYA 2YABA 3EN9A 4Y83A 2FO0A 3P0MA 1ZYLA 3WZEA 4C36A 2HIWA 3CLYA 1NVQA 2V5QA 5K5XA 4RC4A 4RJ4A 4OTRA 3TZ8A 2PPQA 5GHVA 1H1PA 2OU7A 4NW6A 1GNGA 1CKJA 3MS9A 4D4SA 4RMZA 5D41A 4AOJA 1ZZ2A 3ZRLA 1YVJA 4OUCA 4U41A 2X7OA 3VS5A 2WU6A 3R73A 3E87A 3O8TA 3BHHA 3BWJA 4E8AA 5JT2A 3MIAA 3QXOA 4TW9A 2PZ5A 3OP5A 3BE2A 5CEOA 4IVCA 4CZTA 2PVFA 3LM5A 4GT5A 1HCLA 3UNJA 2ZV7A 3Q4UA 4DTAA 4EQCA 4ZTQA 4AZWA 2R5TA 1BKXA 3GCUA 3TZ9A 3QQGA 2CKEA 5JQ8A 2HZNA 2X6EA 4GJ3A 2VNYA 4DC2A 3TIZA 2GTNA 4CMUA 5HG5A 1YI4A 5KMMA 3PXKA 2XH5A 3LJ0A 5ANIA 3MA3A 4EOKA 4CT1A 4J7BA 2YIRA 3FJQE 1GZKA 3HMIA 4IZAA 2R0UA 5J5TA 3AMBA 1JKTA 3QQHA 4FNXA 4R7BA 2WOUA 3THBA 2WIPA 4IANA 5EYMA 1YXUA 3DGKA 4H58A 2OXYA 2O8YA 4FMQA 4X2JA 2B0QA 3PXFA 3UOLA 4FSUA 2HELA 3HNGA 4AT5A 4AXAA 2C6EA 3KKVA 3KCFA 3UE4A 4P2KA 5IQIA 4J1RA 5JRSA 2WTIA 2IVSA 3PXYA 4AN3A 4PMSA 2PZYA 2QLUA 2FGIA 1YRPA 2PE1A 3MTFA 4JIAA 2Y0AA 3BYMA 1LEZA 3MIYA 2VTRA 3G0EA 4J97A 4XCUA 3VF8A 4AE6A 3ROYA 5GIOE 4U79A 4DAWA 4KIQA 2VNWA 3L9LA 2XJ1A 3V5JA 4QTEA 5M51A 2OZOA 2XYNA 3EKKA 3EN7A 3MB6A 3W55A 4HGLA 1AQ1A 4DLIA 3KRXA 2Y7JA 3EYHA 3U4UA 3WZKA 2YM5A 3VJNA 4BYIA 4EWQA 3T9IA 3ZUTA 2YIYA 4WG3A 5F94A 5LMBA 3G33A 3Q5ZA 3EQPA 3MA6A 2OFUA 4AF3A 3CPCA 1L3RE 1VEBA 3JXWA 1OKVA 3GFWA 3PA4A 1JQHA 4JBQA 2X39A 1NY3A 4FKIA 4KBKA 4O6EA 2E2BA 4RFZA 3IGOA 2C0IA 3BIZA 4TWOA 5CNNA 2BCJA 3TNPC 3VHEA 2BHHA 1WVYA 4DEHA 3G6GA 4BWPA 3ZSIA 4QMUA 4QTDA 4BIEA 3U51A 2EXMA 5EOBA 3UQGA 3RKBA 4F1OA 5DVRA 2H96A 2WFYA 3DTCA 4V0GB 2GQRA 3ZLXA 2XIRA 2YERA 4BCNA 5EW8A 1XR1A 4E4MA 2XIYA 4OTQA 2XNGA 4O0SA 5DT3A 4ZJVA 5AP2A 4ALWA 2A19B 4NYEA 4DEGA 5B7VA 4Q5EA 5B2KA 3TV6A 3MB7A 4YGAA 4FTJA 2ZMDA 3BGZA 5F1ZA 3BBWA 3CTHA 4U9AA 4EH8A 4TPTA 1Q8UA 3BELA 5BVWA 5J1WA 3LPBA 4O27B 3W2PA 2WNTA 5K3YA 4C4JA 2GTMA 5FDXA 3ZO4A 1E1XA 4ZS4A 4ZLOA 1G8AA 3IW6A 4EZ5A 2Y8OA 2ZM4A 1URCA 2WMRA 3Q6WA 3KN6A 4IC8A 3FYKX 4IJ9A 1Z57A 1JAMA 3VS3A 1BL7A 5ANKA 5EM5A 3EQHA 4F0IA 4EHVA 2QODA 5ACBC 1JBPE 4AGCA 3FMKA 3ZLYA 3TUBA 2P55A 3ANRA 3OW4A 2GSFA 2OJJA 2UZUE 4JG7A 4PDOA 4M0ZA 2XF0A 1SYKA 3ZRMA 2R3FA 4CFUA 2PUNA 1R3CA 5ETFA 3V5TA 2GNLA 4RJ6A 2EVAA 3VW6A 4L52A 2XIXA 2OK1A 3HYHA 4AGDA 3QTXA 3PY1A 5AUZA 4WRSA 2QOBA 3UVPA 2R3OA 4EOPA 4P5ZA 3Q5IA 3FI4A 4G3CA 5CSHA 2ZYBA 4TNDA 3NAXA 1QL6A 4IFCA 2VU3A 3IOPA 4I0TA 4U81A 3PY0A 3R7YA 5HNIX 2UZWE 1NT2A 4MD7E 4QTAA 4QMMA 4EK8A 3JY9A 4RQVA 2C6MA 2QR8A 4B4LA 4YJRA 3TV4A 4XP3A 3ZEWA 2WMUA 4QQJA 4OAVB 3NVMB 2XBJA 2I40A 4KA3A 3B8QA 2XK9A 3LFQA 5HZNA 2VX3A 1IAHA 4IBMA 4AW2A 2XNBA 2HAKA 3A60A 3K3IA 3V5WA 4BBEA 2YA9A 3ZDUA 4O7ZA 4F6SA 4FIFA 3CY3A 5H3QA 1LPUA 2BIYA 2W1DA 3BHUA 4HYHA 1YXVA 2W1CA 4QMLA 4R1YA 4PQNA 4UZDA 3TZMA 3Q2MA 3DK6A 3H0YA 4P4CA 1TKIA 4G1WA 4UYAA 3ZS5A 4O7SA 5C4KA 3ZC6A 4BCPA 3C4ZA 4NFMA 3ZHPC 3HA8A 1K3AA 3C4CA 3QUEA 4WG5A 4RJ3A 4ZZNA 4IVAA 4DH1A 4I4FA 3NEWA 3ZEPA 2QOCA 1J7IA 3GFEA 2ZM1A 5AAFA 4KRDA 2C5OA 2I0YA 4TXCA 3FMNA 3OCBA 5TOZA 4BCIA 4EOJA 2J0KA 3NUUA 3L8PA 3Q4TA 3KY2A 3OCSA 4GG7A 4RIWA 4S32A 4X21A 4YSMA 4E73A 5BVFA 3COHA 3AC1A 3W1FA 3Q9WA 4A9RA 1WAKA 3QQLA 2YM3A 3R9HA 3ORIA 4MNFA 5FTOA 2UW5A 2HZIA 1ZY4A 1H1QA 2C1AA 4EH9A 4CVAA 1B39A 5CTPA 4TNBA 5DPVA 1M14A 4L44A 4MH7A 1WCCA 4DFZE 4FKOA 5E92A 3RPRA 2JDVA 2HXQA 2JKKA 3NW5A 4RIXB 3ZH8A 4BDBA 5HG7A 1S9IA 3KN5A 4EL9A 2PUPA 5M4UA 3C9WA 3C13A 2YZAA 3LFDA 4NTSA 5J95A 2F7ZE 4RVKA 3I7BA 3GU4A 1YI3A 2B54A 5AIRA 3SAYA 4GV1A 4Q5HA 5C1QB 2GNHA 4PMMA 1ZOEA 2BUJA 2H6DA 3FMLA 3C0IA 3KXMA 4NTTA 3ZC5A 3NW6A 4X3FC 4UN0C 3SVVA 4DEIA 3E88A 3W2QA 2B9HA 4AFEA 3PSBA 1JKKA 4I5CA 5AUWA 4O0TA 4P7EA 1PMUA 3F69A 4KAOA 4ACDA 4DH8A 4O0UA 3R63A 2PUUA 4PX6A 2G2IA 4TRLA 3GC7A 2XCHA 3JS2A 4J99A 5IMXA 4RIYA 4RVMA 4KINA 5TO8A 5AR2A 2X2LA 5IA3A 1NXKA 3FSKA 3ALNA 4PMPA 4RX5A 3BEGA 1Q3DA 3AG9A 2YJRA 4MWIA 4F64A 3QD2B 3CBLA 3Q9YA 3OTVA 2ITYA 1ZYDA 4J96A 4YURA 3NVKI 1O6YA 3F5XA 3RCJA 2QHMA 1YI6A 5M4CA 3JUHA 5ANJA 2PULA 4S30A 2LGCA 4D1SA 4ZMEA 3D5VA 1QMZA 5DN3A 2QOFA 3OCGA 4E5BA 4I24A 4CKRA 4FKRA 4FSNA 5A4QA 5KMJA 3IS5A 3RZBA 3SGCA 1LR4A 3TEIA 4AZVA 3PIYA 3D9VA 4GK2A 2QKRA 4Z3VA 1F0QA 2W1EA 4RQKA 2XUUA 4X3FA 4IAIA 3RHXA 4AZFA 3QYWA 4OTWA 5HG9A 4WUAA 3KF4A 3Q04A 4C33A 1WFCA 2XK4A 3DNDA 4ONAA 5KMKA 3BYOA 3NYNA 4FG7A 1G8SA 3DDPA 4H05A 2R3NA 1XBCA 3OY3A 3BPRA 1GOLA 5C27A 3TCPA 4GMYA 4BCKA 5LVOA 4EC9A 1OPLA 4FIHA 1JSUA 4AW0A 4HVGA 2WO6A 3QKKA 3HRFA 4IX6A 5DI1A 4HGEA 3TNQB 1GZ8A 1H1RA 4XV9A 2G01A 3IDPA 3UJGA 4FSWA 3QD3A 3TXOA 4TN6A 5HKMA 3Q9XA 3RAIA 1PW2A 3LQ5A 2UW6A 2PMIA 5HESA 4H3PA 1O6LA 4F65A 3KGAA 4MK0A 1H25A 2O65A 3MVMA 5LARA 2W17A 2BTSA 3LXNA 4M67A 4NKSA 5AUTA 2XNPA 4G9CA 4OBQA 4XP0A 3EMGA 1U54B 4GVJA 3GI3A 4EJ7A 4IQ6A 2WQEA 4O86A 1FGKA 2R3QA 5AV4A 2OI4X 1STCE 2JDOA 5BPYA 1GY3A 2FB8A 2OIDA 3D7TB 2OXDA 2C6LA 3VBTA 4R3RA 5AAGA 5D1JA 4HNIA 2JIUA 3ATSA 4X7QA 3LJ1A 4RT7A 3ZO1A 1XO2B 4QMWA 3SRVB 3FLNC 1PXOA 5HBHA 3RAKA 3UZTA 3A7HA 3LFEA 1YOJA 2Y4IB 3C4EA 4UV0A 4EUTA 3A4OX 4YSJA 4XJ0A 2VTTA 4HCUA 1P14A 2XK3A 3EQIA 5EM8A 4RJ7A 1JSTA 3LFBA 4C61A 5KUPA 3U87A 3AMAA 3BBTB 2DQ7X 1IEPA 4WRGA 5FM3A 5FEEA 3HRCA 3ZO3A 5T6KA 3OD6X 3LXPA 3BWFA 2WQNA 3FZ1A 3KL8A 2B55A 3U6IA 3CKWA 5LVPA 5DH3A 1ZXEA 2RF9A 5KE0A 5EQEA 3KMWA 2UW4A 4NZWB 4A7CA 4CEGA 4D9TA 4M15A 4CV8A 4Y8DA 4KSQA 3UZPA 3PJ3A 4WG4A 2XK6A 4NM0A 4E6AA 1PRYA 2J50A 4YLJA 1H26A 3VUIA 4BY9E 2OZAB 5FWKK 5FXSA 2J51A 3MPMA 3RPOA 3P5KA 3NCZA 3VQHA 4ZXTA 1OKYA 1J1BA 3LQ3A 1IA8A 1APME 3DAKA 3DXNA 4WIHA 4YZ9A 1VZOA 3Q3BA 4GEOA 3R8LA 3C51A 4AGWA 3QTUA 1FOTA 2HENA 1MUOA 4WD5A 3UIXA 3IW8A 2RFEA 4ZTLA 2VTPA 5IA1A 2NRYA 4FTNA 4KKHA 4ACMA 3L8SA 1CM8A 4DFXE 3PYYA 3TG1A 4QTBA 5AUVA 4JDHA 3FY0A 4QQCA 4TYEA 4C57A 2HZ0A 1PHKA 4GL9A 4P90A 1OKWA 3RK7A 3M42A 4MQ1A 1PYXA 5ANEA 3HUBA 2WTVA 4OTPA 3A99A 3ZXZA 3WBLA 4YZBA 3UO6A 2C0OA 3OC1A 4U42A 5HLWA 3II5A 3UGCA 4O81A 4CG9A 3F6XA 5IQGA 4AT3A 4XG6A 2GS6A 1OBDA 4BWKA 1KOBA 3H10A 5KMIA 4L3LA 5L8JA 4PV0A 4F09A 4JBOA 4D28A 3WZUA 4KKGA 4BZDA 4DFBA 3GU8A 3QQUA 3S4QA 4YC8A 4JL9A 3FBVA 5GIPE 2XEYA 4EC8A 4X2NA 5I3RA 4QMSA 4D0WA 1FPUA 3KMUA 3I60A 2F57A 3LFFA 4CXAA 4TWPA 5ETCA 4ERWA 2XKFA 2YM6A 3HKOA 5CQUA 4FNWA 1ND4A 4MAOA 1OIRA 3A7FA 2YDIA 1ZWSA 3EQFA 3FHRA 3ORTA 3OW3A 5HOAA 3VJOA 3DDQA 2W4OA 1PF8A 5HD4A 2VTHA 2WMWA 5DE2A 1Q61A 4HJOA 4CYJA 3KXHA 4U8ZA 5LVNA 2WQMA 3ORZA 3POOA 5L2IA 1VR2A 5L3AA 5CAUA 4GKIA 4DA5A 4BDDA 4O0WA 4AA0A 4UMRA 4D5KA 5EHYA 3R30A 3OVVA 1CDKA 1ERKA 4B6LA 4CGAA 3QYZA 3RK5A 3HMPA 3ETAA 4E6DA 5HTIA 3FXZA 3FMEA 4UY9A 5KO1A 4RJ5A 2E9VA 4ARKA 4JDKA 2IVUA 4P5QA 1R0PA 2YWPA 3DJ5A 2QI8A 3MFTA 5DT0A 3W8QA 3SW7A 4FT0A 4L68A 1W8CA 3BGQA 4J52A 5E8TA 3R8PA 5K9IA 5EW3A 2JITA 4ZJIA 5J79A 3I0OA 3V5QA 5CYIA 4E20A 3Q4ZA 2VO7A 4QP4A 3OBJA 1YHVA 2VWXA 4ITHA 3TWJA 3KB7A 3VUDA 4FEXA 1RQQA 3C4FA 4W9WA 3RGFA 3DCVA 4ZSGA 4FICA 3BE9A 4OW8A 3F88A 2B1PA 2XJ2A 3R8UA 3VW8A 2WTKC 4DH3A 1HOWA 1YDRE 4TTHB 4GG5A 4AZTA 4HNFA 4II5A 4J71A 5EI6A 2YM4A 3VBWA 4ZLZA 2H9VA 3TTJA 2CNUA 2BILB 3LZBA 3PDTA 4GU9A 3DPKA 4FL2A 4M69B 4BL1A 1ZARA 4QO9A 3KRWA 3QC4A 3ROCA 4NL0A 3FZPA 2XJ0A 3FKLA 2IPXA 3KULB 2B53A 4F4PA 3VS2A 4W8DA 4YZMA 2RL5A 4S33A 4DCAA 2VTIA 3NZ0A 4QRCA 3DNEA 4N70A 4MTAA 4BCQA 4Z9LA 5HCZA 4L6QA 1OI9A 5E8VA 3ENMA 5HO8A 2BAQA 2WQOA 4IAFA 5CEMA 3ELJA 3IDCA 3FDNA 3MFRA 1YDSE 2CDZA 1H00A 1XH9A 2P4IA 5HICA 3VO3A 4E6QA 5CEPA 1Q62A 2BRHA 2YLFA 3V6SA 3PWYA 4C2VA 1FQ1B 3GBZA 3TL8A 3WF8A 5JEBA 5B2LA 1GIIA 3KF7A 4FYOA 4OTIA 4IC7A 3DJ6A 2R9SA 3FWQA 4HCTA 4QPAA 1R1WA 3CXWA 2W4JA 2XCKA 3ENHA 5H8GA 2UW8A 4EONA 3AD4A 5FQDC 4FVRA 3QCYA 3OTUA 1ZOHA 3DAJA 3OT8A 1M7QA 2WEVA 4JBPA 2XKDA 2PVRA 4PDYA 4ZY6A 3FHIA 4M14A 4M12A 2R3RA 4X0MA 2W5BA 4AA4A 3FZTA 3DT1A 2ZM3A 4ZLYA 5LWNA 3O23A 3KRRA 4BDIA 2PVKA 2HOGA 3G15A 4PPBA 2I7QA 2R3GA 4NUSA 1QCFA 5KBQA 2V22A 1H1WA 5E8UA 4DTKA 1ZLTA 5CF5A 3QZGA 1TQMA 4UBAA 2XP2A 4C35A 2GPHA 3MVJA 2GNJA 2CGVA 5AP6A 3FPMA 3GUBA 2P33A 3R8MA 1JPAA 1AGWA 3TKUA 4IMYA 4N6YA 3FMMA 3MH2A 3E63A 3R28A 3VUGA 1K2PA 3UVRA 5DMZA 3DKFA 2UW9A 2GU8A 3NR9A 3U54A 3GVUA 5EFQA 3BU3A 5FP6A 5ANOA 3NMUF 2Y4PA 3PJ1A 3HX4A 2HCKA 3DY7A 4GJ2A 2I1MA 2E9OA 4O7LA 1RDQE 4D1XA 3CEKA 4ACGA 3LIJA 2X9EA 3PJ2A 4MNEB 5CT0A 3FLSA 3ZSGA 3QTSA 4DYMA 3ZLWA 2QOKA 3AGLA 3KK9A 2CNVA 4DT8A 5I4NA 4IFGA 1OL7A 3VS6A 4O7WA 2R7IA 4FUYA 4RA4A 4UMPA 4C8BA 2Y6OA 2IO6A 3G51A 5B0XA 5KMOA 3CSVA 3PXRA 3HRBA 3S95A 1DAWA 2W7XA 4G2FA 3UPZA 4EH3A 4O0XA 2XS0A 5F20A 3ZTXA 1PXNA 3OXZA 3TN8A 5I9WA 4EOSA 3LFAA 3WI6A 3D14A 3WYXA 4NM7A 2XNOA 3HMNA 3HV7A 3ORKA 3RWPA 4BICA 5I0BA 5K0KA 5HNBA 3R9RA 3DBQA 2BPMA 3PVGA 5H2UA 2WIHA 2PVMA 4I5MA 4Y5HA 3CCNA 4LL5A 1UNHA 3RBWA 5KHWA 4YC3A 1Q97A 3OBGA 4FSRA 4U80A 2ETRA 1GAGA 1WBTA 2QURA 2XK7A 2BDWA 4G3DA 4IX4A 5DG5A 4BBFA 3P7AA 2H34A 5LMKC 3A8XA 3DJ7A 2VTNA 2PHKA 4NSTA 2WEIA 2V62A 3R1QA 4L42A 3ORPA 2BRMA 4YZNA 3BX5A 3S2PA 3B8RA 2BZJA 3ZFYA 3JR1A 3IW5A 2C3JA 3MN3A 3F61A 4NW5A 5AR7A 4FODA 3MFSA 1CKIA 2BKKA 5JZNA 3FSFA 1UU3A 3FLZA 4RLLA 1GZNA 2OJIA 2I6LA 5KKRC 4G6LA 3I1AA 1W0XC 4W8EA 1SM2A 5I9UA 4G31A 5A6OA 5JQ5A 1UA2A 4CMOA 3V04A 1XBBA 1BYGA 5J7BA 2WMQA 4DN5A 4MF0A 1VYWA 4QOXA 5FEDA 1SVEA 5AV3A 2W9FB 5BVOA 4LOOA 4KB8A 3C5UA 4FX3A 4R3CA 4YHJA 1OUKA 4XYFA 4G3FA 3SV0A 5LCKA 3AT2A 4KIPA 2BIKB 3ALOA 1OPJA 5HQ0A 5C4LA 3IG7A 1WMKA 4TT7A 3BLQA 2IZTA 3MPAA 2XNEA 1OMWA 4UALA 2CSNA 3UZRA 4U6RA 5HIEA 4DFYA 5H8BA 2ERZE 2QOIA 4APPA 3AQVA 5L2SA 3P7CA 3UO4A 2BFXA 3CPBA 4S31A 5KX8A 1M2RA 4GW8A 2R3JA 2X2MA 4FNZA 4OBOA 4PL4A 5TE0A 5LMKA 1PKDA 1TQPA 1UKHA 4OGRA 4D2TA 4XG9A 2OGVA 2VRXA 3HVCA 1Y8GA 4D4YA 2OG8A 4FZFB 2WQBA 3CD3A 2R3LA 1U4DA 2B9IA 3DZOA 5LQFA 2CGWA 2R4BA 3MPTA 2IVTA 5JN2A 2GNFA 1R78A 4DBNA 4DG0E 3GCVA 3NYVA 4ANBA 1ZAOA 2PVYA 5CVGA 4MBLA 3IK3A 4CFVA 4ITJA 1JLUE 4OT5A 2CGXA 2HWPA 3E3BX 4ZAUA 2W05A 3A62A 1PXLA 3BRBA 4MBJA 5CI7A 2WGJA 4JVGA 5CX9A 5A46A 3PLAE 1J91A 3RM6A 2I0VA 2BDJA 4ZTMA 2AC3A 2X4FA 1H28A 3NRMA 4EK5A 4FV6A 2JKQA 3MTLA 5A4LA 3R21A 4U3ZA 2KULA 3QKLA 4BGQA 4ZEGA 3K5VA 2HXLA 4EOMA 3KC3A 1NW1A 5CU2A 3BLHA 3KMMA 3N51A 2RKUA 4GS6A 4L00A 4MVFA 3Q60A 3R9NA 3VBXA 3W32A 5GZAA 2O64A 5FDPA 4IWOA 4PNKA 2PSQA 2BAKA 2X4ZA 5CZIA 4FSQA 3UG1A 4F9BA 4MBIA 3FI8A 2B9FA 2C3KA 2WTCA 5BNJA 5IQHA 1OB3A 2F4JA 2YN8A 3ULZA 4LMUA 5CF6A 1MRYA 3ZM4A 1UWJA 1FMKA 4ZSJA 3GP0A 2UV2A 5EKNA 3DZQA 4O21A 4OT6A 4F1TA 3EQCA 5LJJA 4J98A 2XA4A 5AP7A 5JK3A 2ZV8A 5IA4A 2HY81 5EQYA 2C6OA 4RRVA 4CRLA 4QP2A 4LOQA 5AJQA 4CD0A 2PU8A 4X2FA 3ZONA 5B2MA 5BYYA 4WSQA 3V5PA 5TR6A 1JVPP 1M2QA 3CQEA 4CV9A 4HYIA 2W1FA 5FTGA 4BTMA 4MF1A 4BDAA 3BLRA 1Q8TA 3GC8A 4RC2A 3OMVA 2PVLA 2XBAA 3OUKA 4EOOA 4BCHA 4EZ7A 3L9PA 3FQSA 2IG7A 3OT3A 2OSCA 1DM2A 4K33A 3R7UA 1W7HA 2VTAA 4JG8A 4O1PA 2R3IA 5DNRA 4QMYA 2O63A 3I5NA 3BQRA 3AT3A 2NPQA 2Z7SA 3KU2A 3R2BA 3DV3A 5HVYA 5CXZA 1I44A 3UG2A 5FBOA 3ORXA 2G9XA 2NO3A 4K2RA 2XM8A 3TNIA 3LW0A 5IMEA 3Q32A 4GFOA 4RGJA 3RK9A 4M13A 3IQ7A 4QMTA 4AFJA 3COKA 1P4OA 4QMPA 3OROA 3F82A 3KXZA 1URWA 4IWPA 5HEZA 1YXTA 3BYSA 2JDSA 3EKNA 1BLXA 4FTRA 5AA8A 3T3UA 4OBPA 2LAVA 4JX3A 3G5DA 3F5UA 5CEQA 4EOQA 4U3YA 3D7ZA 1J7LA 3WARA 1JWHA 3WZJA 4D5HA 2R3KA 5CF4A 4UZHA 5IDPA 2XIKA 3TV7A 4L43A 2UW3A 5IH4A 5M44A 3RI1A 2WOTA 4CTBA 4QMQA 5IEXA 3G9LX 4QNAA 2VTMA 3DAEA 3ZOSA 4PPAA 4A9UA 5AUUA 3OXIA 4IIRA 4A9SA 3LMIA 1MP8A 2SRCA 4FK6A 3R8ZA 3SC1A 3NPCA 4EKLA 4EYJA 3C4WA 4CT2A 1LEWA 1J3HA 5AADA 4BVUA 3MESA 3TDWA 4U45A 3ZYAA 5IQDA 4I92A 2C6TA 3QCQA 3TZ7A 2EU9A 5EI8A 5J9YA 2JKMA 4IAKA 5GZ9A 5CLPA 5F4NA 3G6HA 3LXLA 4AA5A 3I0QA 3CIKA 3DXQA 1BI8A 3ID6C 3LKMA 2XM9A 3QQJA 2BAJA 3ZRKA 4FTUA 4N0SA 2VUWA 5IISA 1G5SA 5D11A 3UQCA 2UVYA 2J0IA 4JQEA 4O6LA 4RVTA 3KREA 4FEUA 5HVKA 4M84A 2UVXA 1YWVA 2YHVA 4G5PA 2QOLA 5AR5A 4EH4A 4WSYA 3LMGA 3PJCA 1B38A 4I94A 1O9UA 4WNOA 5A4CA 4IB0A 1W83A 3E8EA 4FKGA 3UIMA 4JX7A 4DINA 2G2HA 5A6NA 4OTFA 3W2CA 3ULIA 1WVXA 4O1OA 2JKOA 3R01A 2C1BA 4UXLA 3DLSA 4FKSA 1Y57A 4EK4A 4GU6A 3QTIA 4CCUA 4RX8A 1PMEA 2PVHA 4RVLA 2B52A 3HMMA 4D1ZA 2Y6MA 4WOVA 3VUMA 4UWBA 4Z7HA 3VS4A 4ZTRA 4DGOA 5BUIA 4DHFA 4V04A 2VGPA 3R9OA 3W2SA 1PMNA 4O2ZA 3E8CA 3P1AA 4YTHA 1PXIA 2XK8A 3PRIA 4A4LA 5CWZA 3FLYA 4I6FA 4ASDA 5KHXA 4HPTE 2X1NA 2R3HA 4PP9A 3IONA 4Y72A 3OCTA 3EQGA 5CY3A 3DFAA 3QCSA 4LV5A 3R02A 3SXSA 2BMCA 4C58A 4GT4A 1V0OA 2PVNA 3PVWA 3Q2JA 2XZSA 5AV2A 4FTMA 3M1SA 5EW9A 3NUXA 4K1BA 1W98A 2BZHB 4JXFA 4I0SA 3EOCA 4UMTA 4L9IA 3ZCLA 4TZRA 4BCMA 1PMVA 4ALVA 4ZY5A 1Y6BA 2JIVA 3HEGA 1BMKA 4UWCA 3RHKA 4IADA 4E93A 5M56A 3LXKA 5CSVA 2HYYA 3VBQA 4Y95A 2WTWA 5GJFA 4K6ZA 3E5AA 3VHKA 2ZDTA 3QZFA 5CENA 4M97A 2A27A 2X8DA 3R00A 4CZYB 3IW4A 3O8UA 3VF9A 3F3ZA 5AAEA 4ZS0A 2O5KA 5K5NA 4X3FB 5I5ZA 3NLBA 4AN9A 2C5VA 3PSCA 4I22A 5FLFA 5LWMA 4PF4A 4YJNA 2VWWA 4L7FA 3R8VA 4L46A 1REKA 4OTDA 3RWQA 3UOJA 5IPJA 4A07A 3K3JA 2PUIA 2XKEA 3ORMA 4ANLA 3F7WA 2R2PA 3U9CA 1FVVA 3NUYA 1JKSA 3OUNB 3L9NA 2CCIA 4C38A 1IA9A 3A4PA 4TWNA 4ERKA 3W2RA 3Q6UA 3GU7A 4XBUA 4O2PA 3VVHA 4E5WA 3P78A 3BHYA 4L67A 2VTSA 4GH2A 4LRMA 4C4IA 2P2HA 5L2WA 4F63A 4IHPA 2CKPA 3QQFA 5KZ0A 5IH6A 3WIGA 1ZMVA 1K9AA 2O3PA 3P7BA 5H9BA 3JPVA 4FBXA 5HU3A 3K2LA 5M4FA 3S1HA 1Q4LA 1QPCA 5EQPA 3OZ6A 3PY3A 4FTIA 4RWLA 4D2PA 3HDNA 3R7EA 3UIBA 3FC2A 3QUDA 4OR5A 2C5YA 3FI2A 4YP8A 4QMOA 3EFKA 2A0CX 2HW6A 3LCTA 5G6VA 4GFGA 5AR3A 4IAZA 5M06A 4AOTA 5J8IA 4GVAA 4BDKA 1HCKA 3OWJA 4IACA 2JD5A 2J5EA 1H24A 4PRJA 3A7JA 1M52A 3QRJA 5DYJA 4N4SA 3LFSA 3QRIA 3EZRA 2PZRA 2UZVA 1KE8A 2X8EA 5JKGA 3SX9A 5JGBA 1H27A 3PXQA 4JDJA 2OICA 1M7NA 4K8AA 5M55A 3WZDA 3WIKA 3ZMMA 4YR8A 3QC9A 5HBEA 2EB3A 5CSXA 3V8SA 4BWXA 4JS8A 4CQGA 1SNUA 2GHGA 5IA0A 3R1SA 4I4EA 1P2AA 4AT4A 3JVSA 3IDBA 5DGZA 3IO7A 1BI7A 1PYEA 3RPYA 4D2WA 4KSPA 2UZDA 5AUYA 2I0EA 1XJDA 5AA9A 1Y8YA 1JKLA 5EHOA 4BTKA 4ACHA 3O0GA 2WPAA 1JOWB 4IB3A 4O22A 3LLAA 3VWAA 2V7OA 3QWJA 4I21A 5DRBA 4F0FA 5M4IA 2PYWA 4DG3E 2VX0A 4QD6A 4CQEA 4IB1A 3POZA 4LGHA 3FUPA 3ET7A 5J9ZA 4C34A 4EORA 5KMLA 3HAVA 4XHKB 2RGPA 5HGIA 3D4QA 3MBLA 4X2KA 5E8YA 5HU9A 2VO6A 1YDTE 2REIA 4BI1A 4LMNA 4FVPA 3MH1A 5J1VA 3FMDA 3O71A 2X7GA 4KKEA 5HE0A 3CD8A 3TI1A 1PXKA 2P3GX 3NUSA 1DI9A 5E90A 3RCDA 4PL3A 2GHMA 3WF6A 4M3QA 3GGFA 4PMTA 4C4HA 2FA2A 2FSTX 2VTOA 4L7SA 4C4GA 4IM0A 5JRQA 2QVSE 5D7AA 5BYZA 1E1VA 5IF1A 5D10A 4UB7A 3OS3A 4FV2A 1LUFA 4FTCA 5TT7A 3ERKA 4YJSA 4XG3A 3QA8A 3DS6A 5CSWA 3PA5A 1H1SA 1RW8A 4TYHA 1U54A 5HLPA 3LFNA 4U97A 4ITIA 4FTKA 4XLVA 4USFA 3SOAA 5DLSA 5C01A 3MH3A 4EOLA 3NIZA 1WVWA 4FGRA 3D7TA 4MEDA 1FVTA 3TIYA 5IEYA 3NUPA 3EL7A 1FMOE 4O38A 4FG9A 4Y46A 3WOWA 1OL1A 2XRUA 1WBOA 4BC6A 4CKIA 4I6BA 3V51A 5DIAA 4QMXA 4XOZA 3NNWA 5GNKA 5CASA 4FZAB 3SW4A 3KQ7A 3ZUVA 4BCOA 5ACKA 2ETMA 4ZTHA 2FSMX 5BVKA 4KWPA 1OZ1A 5JGAA 4NK9A 4BDCA 2YJSA 2BTRA 3DK7A 4HYSA 3VNTA 3ZU7A 5IQBA 3DQXA 4YBJA 4YJQA 3Q53A 3FYJX 3QUPA 3RNYA 1Z5MA 5AUXA 3SOCA 2PVJA 3N9XA 2VWZA 2JLDA 3HDMA 3N4UA 4IX3A 2WMBA 4UMUA 4ANSA 3PA3A 4AU8A 4DEEA 4BZOA 5CXHA 2EWAA 3ODYX 3HLLA 4D9UA 2W0JA 3DB8A 3NWWA 4EI4A 5ITAA 5CAOA 2OZAA 2JFLA 4KIOA 1Y91A 3HA6A 4FI1A 3MSSA 2QG5A 4DGGA 3SG9A 2UW7A 1OL2A 1XH5A 2W96B 3MVHA 4JQ7A 4XRJA 1FVRA 3RPSA 4BIBA 3FKOA 4DH7A 4F70A 1MQBA 2ZAZA 3F2NA 4U7ZA 4W4WA 4MQ2A 3LQ8A 3R1NA 4E26A 1R39A 3DKGA 5KMNA 3NSZA 1F3MC 4IJPA 2XIZA 5E8WA 4XV2A 3ZBFA 5G1XA 4DEDA 5CAPA 5C8NA 4MWHA 3F5PA 3AC5A 3BEAA 3LJ2A 1YOLA 2JBOA 2RG5A 3QXPA 3QA0A 2PZPA 2J6MA 3QCXA 3QQKA 4FT9A 5HE2A 5L8LA 2YIXA 2PTKA 2ITOA 4RX9A 4FTTA 4IEBA 3LE6A 1XH6A 4XUFA 4GIIA 2EXCX 1W84A 4FKLA 5CU0A 2UZOA 3PP0A 4RFMA 4FKUA 3DKOA 3WF5A 2A4LA 4QMVA 3TKIA 1Q41A 3PIZA 3KCKA 5J7HA 4FE2A 5ETIA 4BHZA 4UEUA 4HCVA 2V0DA 4EBWA 2VAGA 4XG7A 2Q0BA 2UZEA 3O50A 4RWKA 3V8WA 4I6HA 2ITUA 5IA2A 5CU4A 4CFWA 3A61A 4PDPA 4U43A 2Z60A 4ANQA 2J0JA 4CMTA 2PL0A 4R77A 3ACJA 4DGLC 1Q8YA 2QO7A 5JSMA 3UOHA 4HYUA 2J2IB 3BV3A 4GYIA 4LUEA 4BCFA 3KXNA 3EFWA 4RA5A 3UP7A 4APCA 4FIIA 4F9CA 2R64A 3FE3A 2OXXA 2Z7LA 2WTKB 3NS9A 5ETAA 3UBDA 2YIWA 5J5SA 4UX9A 2ITNA 3DOGA 3HZTA 4FR4A 5D12A 4DEBA 4F7LA 4UXQA 4WUNA 4FSZA 3FPQA 3OHTA 4GRBA 4ANOA 5IZFA 3A7IA 4PL5A 3UODA 4YHTA 4ZSLA 4C3PA 3QGWA 4K77A 3R7VA 3ZO2A 2WMVA 4FGBA 3OY1A 5FG8A 3QTRA 3AXWA 3EN5A 4L3PA 3W18A 3R22A 3AMYA 3S00A 2WXVA 2VWVA 3EQRA 4H3QA 5L6WL 3E7OA 3PPJA 5IQCA 1PY5A 4O0RA 4GSBA 4MKCA 3E7VA 5ICPA 3VRYA 2IZSA 4E6CA 5IUHA 3O8PA 4LG4A 2G15A 1WBWA 2CN8A 3ZZEA 5IH5A 3FMHA 3ODZX 2ZOQA 4C62A 1CMKE 1M2PA 4YHFA 4YJTA 3UYSA 5M53A 3PSDA 3CR0A 2ITZA 2X0GA 1U59A 4YNEA 2W1IA 2ITXA 3TACA 4AWIA 5HORA 4CCBA 5JFWA 3PWDA 3EQDA 3MV5A 3PVBA 4M69A 3UNZA 1T45A 2XNMA 5L2QA 2IN6A 3P4KA 2CLXA 2PZIA 3VS1A 3WYYA 4QMNA 3UMXA 2GHLA 3O17A 3D5UA 4FC0A 4MXAA 3LVPA 4QP3A 4EBVA 4ENXA 4QP9A 4Q9ZA 5A9UA 1PKGA 1VYZA 2J0LA 3EQBA 3T8OA 3MFUA 4O7TA 3BYVA 3O51A 4CLJA 4KBCA 4DLJA 4IX5A 2QG7A 5CSPA 4O84A 3EIDA 4BI0A 3QTQA 5CEIA 4XG2A 4NIFB 3GENA 4TYJA 5E8XA 4D2RA 4CFFA 4KIKA 4XOYA 4ANNA 5DEWA 5AFVA 2OFVA 2V7AA 3G0FA 5GJDA 3RJCA 1IG1A 2JDRA 4FKVA 2GNIA 4A9TA 4IM3A 4CYIA 2RSVA 5EDQA 4FZDB 3CC6A 3GXLA 3QF9A 3CQUA 3E92A 4GUEA 1XHAA 4W9XA 1GZOA 2CLQA 3ATTA 4AUAA 4FV1A 2PK9A 4LRJA 4HOKA 3D94A 4F99A 2KTYA 1SNXA 5AR4A 5L6PA 3QRTA 2BR1A 4QNYA 4O7NA 2QD9A 2QKWB 3QLGA 4G3GA 3UQFA 1GJOA 2E9UA 4I3ZA 4C4FA 4USEA 2HW7A 1QPJA 4GK3A 2W06A 2YDKA 4JDIA 3UDBA 3O7LD 4EHZA 4DT9A 3UVQA 3AC3A 4CRSA 2WTDA 5IQAA 3E64A 4EQMA 3IGGA 4W4VA 1OIYA 3KXGA 5JFSA 4IWDA 5EDPA 1PJKA 2DS1A 3VULA 1S9JA 2PE0A 4ZSEA 3RM7A 3WF7A 4MHAA 3QKMA 3VS0A 3AC4A 5CQWA 4JJRA 2CHLA 3R9DA 5LXMA 3C0GA 4IVDA 5J9LA 4FNYA 2FVDA 5CU6A 3TTIA 2JBPA 3QFVA 2C47A 3QGYA 4C02A 2OLCA 3UC4A 4XRLA 4D4VA 2BRGA 1XH7A 4ANMA 3SHEA 3VUTA 2RG6A 1H0WA 3KEXA 2XNNA 4E4LA 3W10A 3B2WA 4V01A 4DFUA 3EWHA 3HP2A 2HZ4A 5DBXA 4F7NA 5FBNC 2VZ6A 2XEZA 3JYAA 4YJVA 4A9YA 4BZNA 3DLZA 1Y6AA 4LGDA 3I7CA 4L45A 4WO5A 2WD1A 2UZLA 3FLQA 1YW2A 2AUHA 3PTGA 4FKJA 4L3JA 4QYEA 5E8SA 5HHWA 4J8NA 4BDGA 1G3NA 3H30A 4MNEA 4BGHA 5CAQA 2VO3A 2P2IA 4FSMA 4R5SA 4FV5A 1ZMUA 5JH6A 2EB2A 4MX9A 2YIQA 2C5NA 2YCQA 2OF4A 3BV2A 2OJ9A 2VGOA 3TNWA 2OW3A 1U5QA 1XBAA 4WBOA 4R78A 1NA7A 5IU2A 4EKKA 4F9AA 1A06A 4L01A 5KKRB 3CGFA 1UNLA 3WF9A 4BCGA 4BKYA 2WMXA 3NDMA 4NU1A 4RBLA 1V0PA 2J0MB 3D5XA 5EYCA 4QPMA 5FXRA 3PIXA 1NVSA 2W9ZB 1ZMWA 3BHVA 2BALA 4EK3A 3ZSHA 3GC9A 3W33A 4G3EA 3WE4A 2C5XA 4AW5A 3PG3A 4UYNA 2VWYA 3ZFXA 2VTQA 3F5GA 4DGMA 1SVHA 5JGDA 1VJYA 1OPKA 3QRUA 4NH1A 4PUZA 4Q2AA 4BR3A 3UO5A 2UZTA 2W4KA 4IW0A 3HGKA 5HX8A 3RPVA 2B4SB 3GCPA 3IPHA 4N6ZA 4M7IA 2AC5A 2J90A 4JRNA 4PWNA 3FAAA 4DTBA 2WELA 3PPKA 1KWPA 4FYNA 4O83A 4R5YA 1RJBA 3H9OA 4CSVA 3ZDIA 3UPXA 1Q5KA 1Q3WA 5M08A 4YBKA 2QLQA 2IZUA 2JDTA 3V01A 3KVXA 2F49A 2GNGA 4F1MA 4IM2A 4PTEA 4FV8A 2ITTA 3MJ1A 1H4LA 3P9JA 3OOMA 3E62A 3GC0A 4EHEA 1WZYA 2ZV9A 3GOPA 3ACKA 3PUPA 3OEFX 2JAMA 4NKAA 3TNHA 3NW7A 1UNGA 1PXMA 4E4XA 3U6JA 5HIBA 4FSTA 4NEUA 5M09A 1E9HA 1YHSA 4K11A 1U5RA 3F2AA 3AD5A 4CFMA 3OOGA 3F66A 2Y9QA 4M0YA 4TKSA 5AP5A 5LCJA 4CFXA 3UNKA 4DBXA 3SLSA 4U5JA 4FIJA 4G6NA 4XV3A 3UMWA 3DQWA 3W8LA 3RINA 4O7YA 4Z7GA 1Q8WA 3ANQA 3FZOA 3O96A 2W1GA 4F9WA 3F7ZA 3HAMA 4S34A 3TDVA 3D2IA 1MRVA 4YC6A 1L8TA 5DFPA 3SXFA 3VN9A 1SZMA 5F9EA 4KRCA 1UKIA 5BVEA 3QD4A 4IZYA 4C7TA 3DFCB 5EDRA 3OWLA 2F7XE 5HO6A 4A4XA 3AGMA 5FGKA 1QPDA 4BFMA 4RG0A 2F2CB 4G6OA 5AV1A 2NRUA 3PVUA 4X3JA 2QU6A 2VWUA 3QWKA 3R6XA 4R6VA 5AEPA 2J4ZA 4O91A 4OAUC 4HW7A 3QHRA 5H8EA 3UYTA 5ANDA 4TL0A 2YM7A 4XV1A 2JAVA 3JVRA 3NYOA 2EXEA 2X81A 4K0YA 1F5QA 1H01A 5E7RA 2PMLX 3AC2A 1OM1A 4WKQA 5JFVA 5E4HA 1CKPA 4MXYA 2VV9A 4PTGA 5CVHA 4HVDA 5D9HA 3G90X 4BTFA 4BGGA 2BFYA 4QQTA 5D7VA 2YCSA 4NM3A 4V05A 4LUDA 5AM6A 5AX3A 4EH6A 3D5WA 4EWHA 5HD7A 5CF8A 1KE6A 2PE2A 3D2KA 5IKWA 4WNKA 2ETKA 3U55A 4I23A 1WBNA 4XS2A 2X6DA 4L8MA 4BKJA 5DR2A 2VN9A 4BTJA 5I9ZA 3MW1A 1OL6A 4ID7A 3V8TA 3I6WA 3PE1A 3COIA 4JIKA 1T46A 4G17A 2UZBA 4YJOA 4YZCA 3ZLSA 4D0XA 3VC4A 5AP3A 4JT3A 3GCSA 3LMHA 2C3LA 5CS6A 4V0GA
chains in the Genus database with same CATH superfamily
4H39A 1LP4A 4IH8A 1OIUA 4AZSA 4NWMA 1J1CA 4BDFA 4JR3A 4FF8A 3HECA 4AOIA 3K54A 4YZDA 2OF2A 1A48A 4XBRA 3B2TA 2QQ7A 5TKDA 4U0IA 4YPSA 1ATPE 2OIBA 4OLIA 4TYIA 2C6DA 5CALA 1H08A 1KE5A 3R83A 2WMSA 2YISA 3D0EA 4IVBA 4LM5A 4AP7A 3S0OA 2OWBA 3QZHA 4RIWB 3TT0A 3ZZWA 5EM7A 4MXXA 3NFFB 4FKPA 3D15A 2VWIA 2CKOA 4IDTA 2B7AA 2QU5A 2VO0A 2O2UA 2OH0E 2OJGA 3SD0A 3F3WA 5BX0A 4ZK5A 2YITA 4DEAA 3LM0A 4O7RA 3BGPA 2BVAA 4UWYA 4YTIA 5AV0A 1PXPA 2OKRA 3FMJA 3C1XA 3Q96A 5IEVA 5FM2A 4FEWA 2JFMA 3TM0A 5EM6A 2YDJA 3CGOA 4FTQA 4IE9A 4PDSA 5CT7A 4QYYA 5DWRA 2JEDA 3LCOA 2GFSA 2BROA 3LCKA 4LGGA 1OUYA 3D83A 3ORLA 4RC3A 4L53A 5HE3A 4CLIA 2A1AB 1KSWA 4JI9A 3VS7A 1OL5A 3REPA 1OKZA 2CGUA 3M2WA 4B0GA 5CZHA 1IAJA 2W5AA 1X8BA 3TUDA 3BCEA 1YOMA 4LI5A 4XH6A 5CU3A 1A9UA 4GYGA 2YCFA 4ZP5A 4QPSA 3S3IA 2CN5A 5HX6A 4QYFA 3W0QA 2UZNA 4E7WA 2OJFE 4FTOA 3PJ8A 2VTLA 3Q9ZA 3IOKA 3TYKA 4AAAA 3E3PA 4JBVA 4B8LA 2BRBA 4WHZA 4CNHA 3MY5A 5GINE 1FBNA 3FEGA 2WTJA 2F9GA 4MD9E 2XMYA 3V5LA 3DU8A 3DB6A 4HZRA 4FV0A 4WA9A 2IJMA 4C3FA 2G2FA 2BHEA 2Z2WA 1W2DA 3DK3A 3BZ3A 2WKMA 4DCEA 4RIYB 2PY3A 3GQLA 3NX8A 5LVMA 4NJ3A 1SMHA 3LOKA 2BRNA 3A2CA 1YHWA 2FUMA 2ZDUA 4ZSAA 3RZFA 3RP9A 3AD6A 5DR9A 5L8KA 2YAKA 3MGYA 3PZHA 4AE9A 3P86A 4XLIA 3CS9A 1OBGA 3AC8A 4AW1A 5C26A 2BKZA 2YM8A 2ITWA 1AD5A 1YKRA 3F9NA 3OWPA 4M66A 4GKHA 2ZB0A 3QTWA 4NCTC 3M11A 1BX6A 5EI2A 2F7EE 3VAPA 4NJDA 3GOKA 3R7GA 4IAAA 3W16A 5FUTA 4WBBB 4AS0A 4EJNA 3W2OA 3FV8A 3CQWA 5AM7A 3ITZA 2F2UA 3RNIA 5IUGA 5DHJA 4F08A 4YNOA 3F3TA 4R3PA 3SQQA 2ESMA 4I1ZA 4ASXA 2ITVA 4FUXA 4HPUE 5KBRA 2GDOA 4CG8A 3LCSA 1XWSA 3H3CA 4E3CA 5BV3A 4R1VA 4ZIMA 3PZEA 5HLNA 5CNOA 1OVEA 2W1ZA 5FRIA 1NVRA 4LV8A 3I4BA 4M8TA 4UMQA 5BYLA 4KNBA 5L2TA 2IWIA 4MXOA 4KABA 4FG8A 4FL3A 2XB7A 3BU6A 4RWIA 5IA5A 4FL1A 1KOAA 3I6UA 4RIXA 1XH4A 3CJFA 4KBAA 2E9NA 1Q8ZA 2RFDA 4FOCA 4HVIA 4CZUA 4QDEA 3GB2A 4G16A 4XG8A 4JNWA 4AX8A 1YXSA 3HP5A 3QX2A 4JAIA 2PMNX 4LQMA 3PXZA 2Z7QA 5A4TA 4JQ8A 1WBVA 5I9XA 4QTCA 4I0RA 4NCTA 5JFXA 5M57A 1U46A 3RVGA 2ZB1A 3NUNA 3Q4CA 4RSSA 2AYPA 2C3IB 5KCVA 4F7JA 3UP2A 5BMMA 5AP0A 5LMAA 4YMJA 1WBPA 3EFLA 2QO9A 3QL8A 4BIDA 4G34A 5EOLA 5CI6A 4AGUA 4O7VA 3E93A 1XH8A 2IW9A 4EEVA 5C03A 3WILA 4CKJA 5EH0A 5E8ZA 3RTPA 2QOQA 3EB0A 2ZMCA 1J7UA 4C4EA 2B9JA 3FL4A 1H8FA 2R7BA 4DFLA 4DFNA 4Z16A 3F2RA 2C30A 4G9RA 3LCDA 2VX1A 3AKKA 3W0RA 3DBDA 4CFNA 2HK5A 2OH4A 3LAUA 3GU6A 3SA0A 3QHWA 2Z7RA 3RAHA 3UOKA 4GT3A 2CNQA 2ITPA 4MCVA 4YU2A 3CKXA 2HWOA 4I5HA 1G8JA 5EG3A 2X8IA 2GCDA 3CY2A 3DTWA 5HTCA 3C4XA 4YO4A 3V3VA 4DF3A 2PMOX 3A7GA 4DGNA 4M68A 4BDJA 1M17A 4H1JA 4HGTA 2WAJA 5CANA 4BCJA 2ZV2A 3PFQA 3FXWA 2QOOA 2QR7A 4Y73A 3N4TA 4BN1A 3CP9A 2DWBA 1P5EA 3BKBA 4FV7A 5LOHA 3KIOC 3GU5A 4IWQA 4DITA 4ZOGA 2R3MA 3KK8A 3H9RA 3EZVA 3BYUA 4XEYA 1WBSA 4JLCA 2GFCA 5A14A 4DG2E 3FZRA 2JC6A 3NNUA 5DR6A 5FXQA 1IRKA 3QALE 4TYHB 2YAAA 3IW7A 4H36A 2Y4IC 1JSVA 5EKOA 4EUUA 1UV5A 4YUQA 2X2KA 3OWKA 1KV1A 4HVSA 4ZTNA 2GQGA 4ZMFA 5L4QA 2JIIA 4RZWA 4FIGA 3OXTA 5F95A 3EYGA 5EYKA 2WMAA 3DA6A 4LYNA 3MDYA 3R04A 3H4JA 3ZXTA 3HV4A 3EFJA 4J95A 4EZ3A 2ONLC 4I41A 2FSOX 1H0VA 5FTQA 2UW0A 1BUHA 4W4YA 4FVQA 3IECA 5HCYA 1OIQA 4K9YA 1YWRA 3T9TA 2XYUA 4RZVA 1KUTA 4FZ6A 3QAME 2VD5A 4IDVA 3L9MA 1TQIA 3Q52A 4MXCA 3HUCA 3SXRA 4E1ZA 1BL6A 4IXPA 1JNKA 3AOXA 4GFMA 4YPDA 4AXFA 3FL5A 1Z9XA 1GIHA 4JOAA 5EHLA 3SKCA 1ZYCA 2RFSA 4PPCA 4RLKA 4XX9A 4BHNA 3PPZA 5C8KA 1EH4A 3ORNA 1CTPE 1B6CB 3DBCA 4LL0A 4W4XA 2QOHA 3R2YA 1UU8A 1MQ4A 4FKQA 3G2FA 2Q0NA 4FK3A 4RX7A 4KUJA 4EH2A 3SRVA 3GCQA 2FSLX 4I93A 3EHAA 4R7IA 3UC3A 2OBJA 3P79A 2VWBA 1OECA 4FEQA 3VIDA 2QONA 4TYGA 4FKWA 5BUEA 5E9EA 4YLKA 3EN4A 5BVNA 4DE4A 1FINA 4HVHA 5IDNA 3CTQA 4D58A 1DAYA 5BMSA 1FGIA 3BU5A 4K18A 3VUHA 4BDHA 1IR3A 3QLFA 4ZZOA 4FTAA 1ZOGA 4MYGA 2R3PA 4LFIA 1V0BA 4U44A 4A4OA 2WZJA 3VRZA 4E4NA 4EK6A 4FA2A 2IZRA 2ONLA 3TKHA 3R1YA 4RJ8A 4ACCA 3RALA 3FY2A 3QRKA 1CSNA 3QX4A 4YJPA 2GQSA 5IQFA 4KS8A 3PE2A 4XP2A 4IZ5A 5FD2A 4RIOA 3ZBXA 5ANGA 4EH5A 1KE7A 1UWHA 2WU7A 2E9PA 3A8WA 3MWUA 3U4WA 3NUAA 4S2ZA 1UU7A 2X0OA 2WHBA 1YQJA 2C4GA 4Y85A 3C0HA 4U40A 2G1TA 3CE3A 3NGAA 2JGZA 2BZKB 4I6QA 1XQZA 4OTGA 3DKCA 3FQEA 4TWCA 1OITA 3FI3A 4RWJA 3LLTA 2J9MA 2CPKE 3RMFA 3FC1X 4NM5A 4AZEA 1ZY5A 3CJGA 4QP8A 2GS7A 2FH9A 2GS2A 3VBVA 4B99A 4F7SA 3GEQA 3MY0A 4PNIA 4CTCA 3KVWA 2EUFB 2Z8CA 2FYSA 3LHJA 3HV6A 3PFYA 5GJGA 2UVZA 2XRWA 2C69A 3P23A 4MD8E 5T3QA 4D2VA 2XANA 2YZLA 4XNEA 3K5UA 5BVDA 1IASA 3PRFA 3KRJA 4XMOA 3JY0A 1UVRA 1XKKA 2IVVA 5HCXA 3TJCA 5JZJA 2C6KA 3R7OA 5DT4A 2IF8A 1V1KA 4YLLA 3G9NA 3PG1A 3I79A 4AACA 1ZZLA 4ORKA 4RPVA 3T3VA 3OF0A 4YTCA 5E1SA 5CEKA 2NP8A 4R8QA 5AWMA 4Z55A 5GZ8A 4FV4A 4AQCA 4D2SA 3C50A 3C7QA 3H0ZA 4ASZA 3N4VA 4ZZMA 4D55A 3H9FA 4O0VA 2YACA 4X2GA 4ENYA 2CMWA 4MXZA 3SDJA 4B7TA 3FLWA 4B9DA 5FEQA 1W82A 2YWVA 2C68A 4Q9SA 2ZJWA 4PY1A 3MJ2A 4QT1A 4AG8A 4ASEA 5HO7A 3DBEA 3EH9A 5DA3A 4FKTA 2A2AA 5K0XA 4C0TA 4ZY4A 3NAYA 5I3OA 5I9VA 5T68A 2QHNA 4BI2A 2RIOA 3CTJA 4WNMA 1RE8A 2YLEA 3BI6A 5A3XA 2QNJA 5C8MA 4FIEA 5IUIA 4JR7A 3LFCA 4A06A 3VUKA 4WNPA 5HG8A 3F3VA 2ERKA 3EL8A 4J53A 4O96A 5DOSA 3UTOA 5HI2A 2R0IA 4GIHA 1DI8A 4USDA 4IB5A 4NFNA 3KFAA 3EN6A 3L1SA 3DBFA 3COMA 5AX9A 4BYJA 3E8DA 4JRVA 4HZSA 3OEZA 4QYGA 2CJMA 3GQIA 4H3BA 1PXJA 3KA0A 3R7IA 3HV3A 5KZIA 2ITQA 5BUJA 3GNIB 3EJ1A 2W5HA 3PLSA 2CKQA 4C3RA 4KIKB 2Z02A 4AQKA 2QCSA 1MRUA 4Y5QA 2RFNA 4OTHA 5CVFA 4E5AX 3FXXA 2NYAA 2BDFA 4EQUA 2J7TA 4QYHA 1YWNA 4QQ5A 4BB4A 5K4JA 4C2WA 1I09A 1DS5A 5DRDA 1P4FA 4R7HA 1ZRZA 5L6OA 2WB8A 4N57A 3TUCA 2V55A 2YFXA 4I20A 3PP1A 4J8MA 5E1EA 3U8WA 2IW8A 3FQHA 4IZ7A 2W99B 3MI9A 4FZ7A 2ZVAA 4QP7A 2XVDA 3KULA 3FKNA 4FOBA 4C37A 1UU9A 4FTLA 3TJDA 5KNJA 3WE8A 1QPEA 5BQ0A 5LVLA 3ZUUA 3SG8A 3MYGA 4EHGA 2XARA 5M07A 2VTJA 3L8XA 4FT5A 4F6UA 5E91A 1Q24A 4KD1A 3KRLA 4PP7A 4FV9A 1Q99A 5A4EA 5JMSA 4ZTSA 1KV2A 4FEVA 3E8NA 3NIEA 4B8MA 2UUEA 3QBNA 1GIJA 3I5ZA 4BDEA 4QMZA 5AR8A 5C9CA 3ZFMA 4BF2A 1SVGA 2GMXA 2X0PA 3MH0A 5AMNA 3QZIA 5HNGA 3R0TA 3MVLA 1R0EA 3ZM9A 3OG7A 4DDIA 5AIKA 4H1MA 5EYDA 5FP5A 5HVJA 4X6RA 1ZYJA 4JAJA 4JG6A 4RFYA 4GUBA 2O0UA 2BZIB 1YXXA 4EOIA 2QO2A 5K4IA 4AN2A 3OFMA 4F9YA 5TF9A 4O82A 5AP1A 4YO6A 4LOPA 4O0YA 3I81A 4NT4A 4QP1A 3NNXA 3W0NA 3FZSA 3L8VA 3NCGA 2C6IA 4BKZA 4F6WA 2X9FA 3QU0A 3DXPA 5J87A 2PWLA 3BHTA 5HBJA 1TVOA 2QC6A 3BQCA 3NFGB 4O4FA 4QP6A 4YTFA 2NNWB 4FT3A 4G5JA 2ACXA 2YCRA 5A54A 1H07A 4KS7A 4XG4A 4HGSA 3GT8A 4WT6A 2HY0A 5DEYA 5EK7A 1OGYA 5IQEA 2OIQA 1TFFA 2X7FA 2DUVA 4GCJA 1ZYSA 1REJA 5I9YA 2CCHA 3F3UA 2C0TA 4YJUA 2YEXA 4FT7A 1OGUA 3O7LB 4ZJJA 5HTBA 4D4RA 4I5PA 5AP4A 3NYXA 4GK4A 4X6QC 3VQUA 4NIFA 4EYMA 4BJJA 3O2MA 2XALA 4ALUA 4PTCA 2Q83A 4FV3A 3R71A 4TY1A 4DH5A 2I0HA 2WMTA 3MY1A 2H8HA 3HV5A 3RAWA 4F0GA 3NNVA 4IAYA 3C5IA 2XKCA 4BBMA 4BRXA 1KE9A 3U6HA 3KXXA 2DYLA 2IW6A 1O6KA 3HL7A 3U9NA 3QTZA 5HE1A 3UIUA 3V6RA 5IG1A 2W1HA 2OO8X 3IKAA 5CAVA 3HMOA 4EH7A 4C59A 5HIDA 2J5FA 3P08A 4LRKA 3QD0A 3VBYA 3AT4A 2P0CA 4FSYA 2YABA 3EN9A 4Y83A 2FO0A 3P0MA 1ZYLA 3P5JC 3WZEA 4C36A 2HIWA 3TMOA 3CLYA 1NVQA 2V5QA 5K5XA 4RC4A 4RJ4A 4OTRA 3TZ8A 2PPQA 5GHVA 1H1PA 2OU7A 4NW6A 1GNGA 1CKJA 3MS9A 4D4SA 4RMZA 5D41A 4AOJA 1ZZ2A 3ZRLA 1YVJA 4OUCA 4U41A 2X7OA 3VS5A 2WU6A 3R73A 3E87A 3O8TA 3BHHA 3BWJA 4E8AA 5JT2A 3MIAA 3QXOA 4TW9A 2PZ5A 3OP5A 3BE2A 5CEOA 4IVCA 4CZTA 2PVFA 3LM5A 4GT5A 1HCLA 3UNJA 2ZV7A 3Q4UA 4DTAA 4EQCA 4ZTQA 4AZWA 2R5TA 1BKXA 3GCUA 3TZ9A 3QQGA 2CKEA 5JQ8A 2HZNA 2X6EA 4GJ3A 2VNYA 4DC2A 3TIZA 2GTNA 4CMUA 5HG5A 1YI4A 5KMMA 3PXKA 2XH5A 3LJ0A 5ANIA 3MA3A 4EOKA 4CT1A 4J7BA 2YIRA 3FJQE 1GZKA 3HMIA 4IZAA 2R0UA 5J5TA 3AMBA 1JKTA 3QQHA 4FNXA 4R7BA 2WOUA 3THBA 2WIPA 4IANA 5EYMA 1YXUA 3DGKA 4H58A 2OXYA 2O8YA 4FMQA 4X2JA 2B0QA 3PXFA 3UOLA 4FSUA 2HELA 3HNGA 4AT5A 4AXAA 2C6EA 3KKVA 3KCFA 3UE4A 4P2KA 5IQIA 4J1RA 5JRSA 2WTIA 2IVSA 3PXYA 4AN3A 4PMSA 2PZYA 2QLUA 2FGIA 1YRPA 2PE1A 3MTFA 4JIAA 2Y0AA 3BYMA 1LEZA 3MIYA 2VTRA 3G0EA 4J97A 4XCUA 3VF8A 4AE6A 3ROYA 5GIOE 4U79A 4DAWA 4KIQA 2VNWA 3L9LA 2XJ1A 3V5JA 4QTEA 5M51A 2OZOA 2XYNA 3EKKA 3EN7A 3MB6A 3W55A 4HGLA 1AQ1A 4DLIA 4QEBA 3KRXA 2Y7JA 3EYHA 3U4UA 3WZKA 2YM5A 3VJNA 4BYIA 4EWQA 3T9IA 3ZUTA 2YIYA 4WG3A 5F94A 5LMBA 3G33A 3Q5ZA 3EQPA 3MA6A 2OFUA 4AF3A 3CPCA 1L3RE 1VEBA 3JXWA 1OKVA 3GFWA 3PA4A 1JQHA 4JBQA 2X39A 1NY3A 4FKIA 4KBKA 4O6EA 4MUQA 3UDTA 2E2BA 4RFZA 3IGOA 2C0IA 3BIZA 4TWOA 5CNNA 2BCJA 3TNPC 3VHEA 2BHHA 2XAMA 1WVYA 4DEHA 3G6GA 4BWPA 3ZSIA 4QMUA 4QTDA 4BIEA 3U51A 2EXMA 5EOBA 3UQGA 3RKBA 4F1OA 5DVRA 2H96A 2WFYA 3DTCA 4V0GB 2GQRA 3ZLXA 2XIRA 2YERA 4BCNA 5EW8A 1XR1A 4E4MA 2XIYA 4OTQA 2XNGA 4O0SA 5DT3A 4ZJVA 5AP2A 4ALWA 2A19B 4NYEA 2ZFYA 4DEGA 5B7VA 4Q5EA 5B2KA 3TV6A 3MB7A 4YGAA 4FTJA 2ZMDA 3BGZA 5F1ZA 3BBWA 3CTHA 4U9AA 4EH8A 4TPTA 1Q8UA 3BELA 5BVWA 5J1WA 3LPBA 4O27B 3W2PA 2WNTA 5K3YA 4C4JA 2GTMA 5FDXA 3ZO4A 1E1XA 4ZS4A 4ZLOA 1G8AA 3IW6A 4EZ5A 2Y8OA 2ZM4A 1URCA 2WMRA 3Q6WA 3KN6A 4IC8A 3FYKX 4AXDA 4IJ9A 1Z57A 1JAMA 3VS3A 1BL7A 5ANKA 5EM5A 3EQHA 4F0IA 4EHVA 2QODA 5ACBC 1JBPE 4AGCA 3FMKA 3ZLYA 3TUBA 2P55A 3ANRA 3OW4A 2GSFA 2OJJA 2UZUE 4JG7A 4PDOA 4M0ZA 2XF0A 1SYKA 3ZRMA 2R3FA 4CFUA 2PUNA 4AXEA 1R3CA 5ETFA 3V5TA 2GNLA 4RJ6A 2EVAA 3VW6A 4L52A 2XIXA 2OK1A 3HYHA 4AGDA 3QTXA 3PY1A 5AUZA 4WRSA 2QOBA 3UVPA 2R3OA 4EOPA 4P5ZA 3Q5IA 3FI4A 4G3CA 5CSHA 2ZYBA 4TNDA 3NAXA 1QL6A 4IFCA 4DHJA 2VU3A 3IOPA 4I0TA 4U81A 3PY0A 3R7YA 5HNIX 2UZWE 1NT2A 4MD7E 4QTAA 4QMMA 4EK8A 3JY9A 4RQVA 2C6MA 2QR8A 4B4LA 4YJRA 3TV4A 4XP3A 3ZEWA 2WMUA 4QQJA 4OAVB 3NVMB 2XBJA 2I40A 4KA3A 3B8QA 2XK9A 3LFQA 5HZNA 2VX3A 1IAHA 4IBMA 4AW2A 2XNBA 2HAKA 3A60A 3K3IA 3V5WA 4BBEA 2YA9A 3ZDUA 4O7ZA 4F6SA 4FIFA 3CY3A 5H3QA 1LPUA 2BIYA 2W1DA 3BHUA 4HYHA 1YXVA 2W1CA 4QMLA 4R1YA 4PQNA 4UZDA 3TZMA 3Q2MA 3DK6A 3H0YA 4P4CA 1TKIA 3W0MA 4G1WA 4UYAA 3ZS5A 4O7SA 5C4KA 3ZC6A 4BCPA 3C4ZA 4NFMA 3ZHPC 3HA8A 1K3AA 3C4CA 3QUEA 4WG5A 4RJ3A 4ZZNA 4IVAA 4DH1A 4I4FA 3BL7A 3NEWA 3ZEPA 2QOCA 1J7IA 3GFEA 2ZM1A 5AAFA 4KRDA 2C5OA 2I0YA 4TXCA 3FMNA 3OCBA 5TOZA 4BCIA 4EOJA 2J0KA 3NUUA 3L8PA 3Q4TA 3UDZA 3KY2A 3OCSA 4GG7A 4RIWA 4S32A 4X21A 4YSMA 4E73A 5BVFA 3COHA 3AC1A 3W1FA 3Q9WA 4A9RA 1WAKA 3QQLA 2YM3A 3R9HA 3ORIA 4MNFA 5FTOA 2UW5A 2HZIA 1ZY4A 1H1QA 2C1AA 4EH9A 4CVAA 1B39A 5CTPA 4TNBA 5DPVA 1M14A 4L44A 4MH7A 1WCCA 4DFZE 4FKOA 5E92A 3RPRA 2JDVA 2HXQA 2JKKA 3NW5A 4RIXB 3ZH8A 4BDBA 5HG7A 1S9IA 3KN5A 4EL9A 2PUPA 5M4UA 3C9WA 3C13A 2YZAA 3LFDA 4NTSA 5J95A 2F7ZE 4RVKA 3I7BA 3GU4A 1YI3A 2B54A 5AIRA 3SAYA 4GV1A 4Q5HA 5C1QB 2GNHA 4PMMA 1ZOEA 2BUJA 2H6DA 3FMLA 3C0IA 3KXMA 4NTTA 3ZC5A 3NW6A 4X3FC 4UN0C 3SVVA 4DEIA 3E88A 3W2QA 2B9HA 4AFEA 3PSBA 1JKKA 3O5AA 4I5CA 5AUWA 4O0TA 4P7EA 1PMUA 3F69A 4KAOA 4ACDA 4DH8A 4O0UA 3R63A 2PUUA 4PX6A 2G2IA 4TRLA 3GC7A 2XCHA 3JS2A 4J99A 5IMXA 4RIYA 4RVMA 4KINA 5TO8A 5AR2A 2X2LA 5IA3A 1NXKA 3FSKA 3ALNA 4PMPA 4RX5A 3BEGA 1Q3DA 3AG9A 2YJRA 4MWIA 4F64A 3QD2B 3CBLA 3Q9YA 3OTVA 2ITYA 1ZYDA 4J96A 4YURA 3NVKI 1O6YA 3F5XA 3RCJA 2QHMA 1YI6A 5M4CA 3JUHA 5ANJA 2PULA 4S30A 2LGCA 4D1SA 4ZMEA 3D5VA 1QMZA 5DN3A 2QOFA 3OCGA 4E5BA 4I24A 4CKRA 4FKRA 4FSNA 5A4QA 5KMJA 3IS5A 3RZBA 3SGCA 1LR4A 3TEIA 4AZVA 3PIYA 3D9VA 4GK2A 2QKRA 4Z3VA 1F0QA 2W1EA 4RQKA 2XUUA 4X3FA 4IAIA 3RHXA 4AZFA 3QYWA 4OTWA 5HG9A 4WUAA 3KF4A 3Q04A 4C33A 1WFCA 2XK4A 3DNDA 4ONAA 5KMKA 3BYOA 3NYNA 4FG7A 1G8SA 3DDPA 4H05A 2R3NA 1XBCA 3OY3A 3BPRA 1GOLA 5C27A 3TCPA 4GMYA 4BCKA 5LVOA 4EC9A 1OPLA 4FIHA 1JSUA 4AW0A 4HVGA 2WO6A 3QKKA 3HRFA 4IX6A 5DI1A 4HGEA 3TNQB 1GZ8A 1H1RA 1VLRA 4XV9A 2G01A 3IDPA 3UJGA 4FSWA 3QD3A 3TXOA 4TN6A 5HKMA 3Q9XA 3RAIA 1PW2A 3LQ5A 2UW6A 2PMIA 5HESA 4H3PA 1O6LA 4F65A 3KGAA 4MK0A 1H25A 2O65A 3MVMA 5LARA 2W17A 2BTSA 3LXNA 4M67A 4NKSA 5AUTA 2XNPA 4G9CA 4OBQA 4XP0A 3EMGA 1U54B 4GVJA 3GI3A 4EJ7A 4IQ6A 2WQEA 4O86A 1FGKA 2R3QA 5AV4A 2OI4X 1STCE 2JDOA 5BPYA 1GY3A 2FB8A 2OIDA 3D7TB 2OXDA 2C6LA 3VBTA 4R3RA 5AAGA 5D1JA 4HNIA 2JIUA 3ATSA 4X7QA 3LJ1A 4RT7A 3ZO1A 1XO2B 4QMWA 3SRVB 3FLNC 1PXOA 5HBHA 3RAKA 3UZTA 3A7HA 3LFEA 1YOJA 2Y4IB 3C4EA 4UV0A 4EUTA 3A4OX 4YSJA 4XJ0A 2VTTA 4HCUA 1P14A 2XK3A 3EQIA 5EM8A 4RJ7A 1JSTA 3LFBA 4C61A 5KUPA 3U87A 3AMAA 3BBTB 2DQ7X 1IEPA 4WRGA 5FM3A 5FEEA 3HRCA 3ZO3A 5T6KA 3OD6X 3LXPA 3BWFA 2WQNA 3FZ1A 3KL8A 2B55A 3U6IA 3CKWA 5LVPA 5DH3A 1ZXEA 2RF9A 5KE0A 5EQEA 3KMWA 2UW4A 4NZWB 4A7CA 4CEGA 4D9TA 4M15A 4CV8A 4Y8DA 4KSQA 3UZPA 3PJ3A 4WG4A 2XK6A 4NM0A 4E6AA 1PRYA 2J50A 4YLJA 1H26A 3VUIA 4BY9E 2OZAB 5FWKK 5FXSA 2J51A 3MPMA 3RPOA 3P5KA 3NCZA 3VQHA 4ZXTA 1OKYA 1J1BA 3LQ3A 1IA8A 1APME 3DAKA 3DXNA 4WIHA 4YZ9A 1VZOA 3Q3BA 4GEOA 3R8LA 3C51A 4AGWA 3QTUA 1FOTA 2HENA 1MUOA 4WD5A 3UIXA 3IW8A 2RFEA 4ZTLA 2VTPA 5IA1A 2NRYA 4FTNA 4KKHA 4ACMA 3L8SA 1CM8A 4DFXE 3PYYA 3TG1A 4QTBA 5AUVA 4JDHA 3FY0A 4QQCA 4TYEA 4C57A 2HZ0A 4LV7A 1PHKA 4GL9A 4P90A 1OKWA 3RK7A 3M42A 4MQ1A 1PYXA 5ANEA 3HUBA 2WTVA 4OTPA 3A99A 3ZXZA 3WBLA 4YZBA 3UO6A 2C0OA 3OC1A 4U42A 5HLWA 3II5A 3UGCA 4O81A 4CG9A 3F6XA 5IQGA 4AT3A 4XG6A 2GS6A 1OBDA 4BWKA 1KOBA 3H10A 5KMIA 4L3LA 5L8JA 4PV0A 4F09A 4JBOA 4D28A 3WZUA 4KKGA 4BZDA 4DFBA 3GU8A 3QQUA 3S4QA 4YC8A 4JL9A 3FBVA 5GIPE 2XEYA 4EC8A 4X2NA 5I3RA 4QMSA 4D0WA 1FPUA 3KMUA 3I60A 2F57A 3LFFA 4CXAA 4TWPA 5ETCA 4ERWA 2XKFA 2YM6A 3HKOA 5CQUA 4FNWA 1ND4A 4MAOA 1OIRA 3A7FA 2YDIA 1ZWSA 3EQFA 3FHRA 3ORTA 3OW3A 5HOAA 3VJOA 3DDQA 2W4OA 1PF8A 5HD4A 2VTHA 2WMWA 5DE2A 1Q61A 4HJOA 4CYJA 3KXHA 4U8ZA 5LVNA 2WQMA 3ORZA 3POOA 5L2IA 1VR2A 5L3AA 5CAUA 4GKIA 4DA5A 4BDDA 4O0WA 4AA0A 4UMRA 4D5KA 5EHYA 3R30A 3OVVA 1CDKA 1ERKA 4B6LA 4CGAA 3QYZA 3RK5A 3HMPA 3ETAA 4E6DA 5HTIA 3FXZA 3FMEA 4UY9A 5KO1A 4RJ5A 2E9VA 4ARKA 4JDKA 2IVUA 4P5QA 1R0PA 2YWPA 3DJ5A 2QI8A 3MFTA 5DT0A 3W8QA 3SW7A 4FT0A 4L68A 1W8CA 3BGQA 4J52A 5E8TA 3R8PA 5K9IA 5EW3A 2JITA 4ZJIA 5J79A 3I0OA 3V5QA 5CYIA 4E20A 3Q4ZA 2VO7A 4QP4A 3OBJA