5HDBB

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 114
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5hdbB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5hdbB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5hdbB03
3TXAA 5KYXA 4CN8A 5E6RA 3TVYA 3IJEB 1M2VA 3K71A 3EG9A 4JDUA 4MMZA 2I91A 4WK4B 2NUTB 1L5GA 1T0PA 1BHO1 4F1JA 4WK2B 2UZYB 3EGXA 3EH2A 2XGGA 2VDQB 3K6SB 4UM9B 1IJKA 4MMYA 3T3MB 1AOXA 1PD1A 2NUPB 5HJ2A 1JEYB 4C2AA 5LN1A 3HI6A 2M32A 4Z7QB 2ADFA 3EG9B 3EFOB 1ZOOA 4O02A 1DGQA 4M76B 4C29A 1CQPA 1MF7A 1JLMA 1N3YA 2IUEA 3FCUB 5ES4B 5KYUA 4MMYB 1JV2B 1OAKA 2NUPA 4IXDA 3ZDXB 2WW8A 4G1EA 3ZQKA 1RD4A 5KYWA 3OKWA 4XW2A 1L5GB 3M6FA 1PD0A 1M10A 3ZE1B 3N2NA 3AL9A 1RTKA 5KYYB 3OL2A 3PPXA 5E6RB 2VDKB 2ICAA 5BV8A 3AL8B 3GXBA 4F1KA 3FCSB 3ZDYB 1QC5A 1XDGA 2WINI 4C2BA 1U0OC 1M1XB 1FE8A 1PT6A 3T3PB 1SHTX 3F74A 3ZE0B 3K72B 4G1MB 1MJNA 4GZ8A 5E6UB 1YVRA 1JV2A 3EGDB 3ZDZB 2VDPB 2VDRB 3K72A 4G1MA 1V7PC 2XWJI 4O3UB 2I6QA 4NEHB 1M2OA 3Q3GE 2VDMB 1T6BY 1YVPA 1U8CA 2P26A 3HXQA 4HQKA 3EOAI 3VI4B 1IDN1 2P28A 4FX5A 5KYNA 3FCSA 1SQ0A 1N9ZA 3V4PB 3NIGB 4WJKB 3OL2B 1XDDA 4WK0B 1JEQB 1MQ9A 1Q0PA 4PN7A 5KYYA 4CN9A 1OLZA 1LFAA 1PCXA 3ZE2B 3V4VB 1UEXC 3EGDA 3PPYA 3K6SA 1JEYA 1MQ8B 3QA3E 5HDBB 2NVOA 5KYXB 4UM9D 1ATZA 1AUQA 2XWBF 2NUTA 1SSLA 4MMZB 1U8CB 1IDOA 5E6SB 3EFOA 1JEQA 3NIDB 1YUKA 3OKYB 1NA5A 3BN3A 4HQFA 4MMXB 4HQLA 3NIFB 3VI3B 1IJBA 1QCYA 2QTVA 4Z7OB 3BQNB 3F78A 3PPVA 4A0QA 4WFQA 4DMUB 3EGXB 4BJ3A 4IGIA 1MQAA 3EOBI 2VC2B 3K71B 3IJEA 3NVQA 1M2VB 1ZOPA 3RAGA 3IBSA 4UM8B 4CNBA 2VDNB 1AO3A 1FNSA 1QC5B 3TCXB 4HQOA 2ODQA 1DZIA 2ODPA 4NENA 4FWWA 1SHUX 3TW0A 1TYEB 5E6SA 1M1UA 4HQNA 2X5NA 3HXOA 2VDLB 1BHQ1 1ZONA 1SHYB 4Z7NB 1RRKA 1U0NA 3AL8A 3BQMB 1MHPA 5HGJA 5E6UA 4JX0A 1CK4A 2B2XA 3AFCA 3PPWA 5KYUB 3EH1A 4IHKA 3E2MA 2VDOB 4MMXA 1XUOA 4K3JB 2O7NA 4O02B 2I6SA 4NENB 1M1XA 4G1EB 4O3TB 5KYWB 1RS0A
chains in the Genus database with same CATH superfamily
2BIFA 2A38A 5JPDA 3LPDA 4DHLA 3D08A 2H1RA 1LE9A 3CWCA 3QUZB 3LSOB 4ZMOA 4PC3A 1A9XB 1U21A 2P3SA 1USWA 5J12B 3QJZA 5IT2L 4JQXC 3QZWB 5LN1A 3B9KC 4ND2A 2BBOA 4XUGB 4D7AA 4MLDA 3D6MA 5FWXA 4M7OA 4JNCA 1Y82A 2Q3EA 4TN9A 1BWQA 1RP1A 3WHLA 3HV0A 2WOYA 2N46A 3LX6A 3L5HA 1CC1S 2NYZA 3P0RA 3QE4A 3SR3A 1FZTA 4BZ2L 4GY4A 1XT5A 4LFHD 2I2DA 3OCJA 1ZCAA 3DURB 3RARA 2VWEE 4QPCA 5J4HA 2C4NA 1Y3CE 2DCUA 2CCGA 2PR4L 5DZOA 4KKBD 4BK4A 5KSAC 3VWKB 1Q0XH 3KZ8A 4RGOL 4KRYA 1XPRA 4WFHD 2H5JA 3DTNA 2E48A 2GCOB 3I1JA 1L6ZA 1P1KA 5E94A 1NVXQ 4CV2A 4LXUA 3D7KA 5BMFH 2XT1B 2JFCA 4KC0A 5K39A 5IUCA 5HTKA 4PJHA 3V9AA 1G16A 3BAXA 4U3JA 3VM6A 4O4HB 2F19H 1UANA 4UQ2A 1V4NA 4MGKR 1U8LB 1IEXA 3DAGA 5C97A 4LW8A 3JTTB 1YI1A 3DLTA 1Z8HA 3P3UA 2TYSB 3PWVB 1GA2A 1AI1L 2WFZA 5CGBA 2I25N 2JGRA 1IHPA 3TG8A 3HG4A 4PD4K 1BHSA 4OATA 3GT6A 4RVSA 2FG5A 4YWHA 4WENB 2FP3A 3Q8LA 1P33A 5FA4A 4B27A 4TULL 3D5TA 3DUSA 2OSLB 1IUOA 1L8QA 5JC1A 3M70A 5ITFB 3D69A 1USUA 4EY6A 3VR5H 4W4OA 3TZKA 1E5YA 4H7FA 3P2JA 4B31A 3RIGA 1QFYA 3NBXX 1V8ZA 4I55B 1N5DA 2ZQKA 1A5FH 4BFFA 3ULVH 4M1OA 4R98A 2XEXA 1JPUA 3AL9A 1PQZA 2GBIA 4QWWD 2OKMA 2QV7A 2VPPA 4R0LA 4M1CD 1T36A 4A67A 1QTIA 1XTZA 1I7LA 1W0WB 5C0GA 1G7IA 3PRKE 5E9JA 1N2EA 2JXMB 1G20E 1UOKA 2IOYA 3BL8A 1NF8A 4CXMA 1XZEA 3ZGYA 5J0BA 1MABB 5BZZA 3EPPA 3O4JA 1V8DA 4QOGA 4UUQA 5CEEA 4U1SB 4XB7A 1S1CA 3ZWVA 4EAAA 1W0KA 2CIIA 4KMRA 4GQPH 2J12B 1MOPA 1J1PH 4PCTA 2FSSA 1QZ3A 2WY3B 4G5RA 1JDAA 1M0TA 2NU8B 3HNTH 5ALGA 5KNDH 2NN3C 2BGRA 5DEFB 3ER8A 1F6BA 3R5FA 4MARA 4XX1A 4ZGGA 4NVRA 3PQ4A 3V7UA 3WKPA 4K9JA 2D6FA 4ZCTA 1W9XA 4XNXH 2QRVA 4RYLA 1WVGA 2VEOA 3IAUA 5JMWA 4HMOA 3MNVA 4QOEA 2VXQA 3N7AA 1NJ8A 1WE5A 5BQDA 3KJFA 3VB9A 2ENSA 3CLSC 1A4RA 2H4EA 2AVFA 2GB4A 1CYEA 3W4JA 1F8XA 3RIAK 1TM2A 3QUQA 4MEJA 3MFFA 4Z5XA 3PUYA 4UC0A 1OT5A 1ADFA 4QRRA 1R33A 3IDZA 1WP4A 3DFFA 2BOCA 3K4PA 4AURA 1E6OL 2IEIA 4JCOA 4KO7A 2D00A 4LMQI 4M9OA 4XAKE 1N7GA 3HDGA 3WGZA 4AM8A 5EMJA 4QGGA 2VDJA 5I6MA 3WAJA 3KQWA 1W29A 2HFJA 4ABTA 5DLEA 3K6FA 4Y6SA 1DLFL 5JVDA 1TLFA 2IDJA 2O1SA 1FSGA 4HD9A 4YP6A 3AHGA 4IP0A 1S7CA 5J47A 4M36A 3SF0A 3DAOA 3PDWA 3KYCA 3BJLA 5IM7A 2D8KA 8MHTA 5LNK1 2VDPH 2ZR7A 1X77A 5CLWA 1FUKA 3RDTC 5HDQA 3O8NA 3ZHXA 2NRDA 1SHXA 4B7UA 4MJ4A 4H17A 5T3XH 3DULA 5FBWB 4GAGL 1ZD2P 5DJDB 3A67H 1R00A 3LNDA 1KLFA 2YY7A 1Q3TA 4HWZA 4L3WA 1XEXB 3A3NA 4BVEA 5I7SA 3VFNA 2WSLA 1R6VA 3BP7B 3QULB 4PR0A 3O1JC 3C97A 3RIKA 4A5OA 4PB0H 4QU9A 4M8KA 3DMDA 4WY7L 4R9HA 1W15A 2UZAA 2GZMA 4X63A 1M6WA 3MRIA 1C9NA 3R6WA 3NRQA 4B80A 4R7XA 1Y80A 3AGVA 5F1OA 3F7PC 4LLDB 2NX2A 2DICA 1QFMA 1QYCA 3WLHA 1E77A 2C5HA 1BX2A 3FT3A 1ST3A 1M1XA 3CYFA 1POWA 2HJKB 1I3LA 1SM3L 4W1QA 5HYJD 1RP7A 1XQ6A 3S1SA 2XVMA 2MSDB 4J0FA 4AIXA 3VDAA 4DHEA 2UWEB 4YO7A 4Z0BH 1MAWA 4R0LC 4M6ML 2B3RA 3K6KA 4M0DA 1OGPA 1KBGH 4XNUH 4TYQA 4Y16D 3TPUB 2ECKA 2K7FA 3AT8A 2WSSA 2D74A 1NVDA 4PJXB 4HLEA 4MLIA 4YHPB 5MN5A 4G1FA 3E1KA 2AUMA 1BVNT 5ILGA 3FB4A 3PEUA 1W52X 1NEZB 2Q2QA 5D1XE 1XRSB 2H7YA 4PRYA 4BMOB 4MQSB 2C5FA 4ZT5A 3BCHA 3WK5A 2IHUA 4P9HH 1TJHH 1Y6NR 4A0FA 3MLEA 1X14A 3EWNA 1XU9A 2AJDA 1JECA 3KMDA 4OK6A 3AB3A 4MNGA 1Y1RA 3PDCA 3DKKA 2PWBA 4Y2SA 5DZNA 3T3OA 5TDOB 1DIBA 2XYBA 3ZIDA 5L7TA 4Z7VB 3NJGA 4LPUA 4U7JA 5JBNA 2JLBA 4D0DB 1J1XL 1SF3A 2ZSAA 4WD3A 3T4YB 3VFWA 5KAPA 4YO0B 4QYAA 4HCRH 4AVKA 2EO7A 4OVVA 4X6BB 4QEGA 2OCXA 5EF2A 1GU7A 5IHWA 4FIDA 5LBSL 2RI0A 3OF5A 1J11A 2XNDD 4M1QA 3QORA 5JYEA 4K28A 3P4UA 4U2EA 5E0FA 2GT9A 2L7UA 1IXRC 2OK7A 1YEKH 3HVUA 1THGA 3RE1A 4X6EA 2DWDB 4M0CA 1OAZH 1YR9A 5KCZA 3MINA 1E42A 5A2LH 2XRAL 3DI2B 4A66A 4HIEA 2CDFA 1OM9A 1NVBA 4JO2H 4BA0A 2YKGA 1WBZA 4J0KA 5IROA 3EX7C 4MVBD 1B14A 3EZFA 5TD4A 3RS4A 5IQOA 2NPIA 4K94H 1OPXA 1A8JH 1UBOS 4AQ1B 1JYWA 1K8XB 3KPPB 2AQIA 4HEHA 1X94A 3VQ2C 5MEOA 1VE7A 1WDTA 1XLTA 2ZU0C 4B4VA 1DBPA 1KERA 1QTNA 1VLQA 5HHOE 1UXJA 4XE0A 4HD8A 4MPTA 1AC6A 1Z38A 3CLWA 3UEQA 5AALA 1UM5L 2Z92A 5E03A 5EUCA 4XC1H 1DQLL 3N5CA 2PT6A 3ZY6A 4BFXA 4PJ5E 3AL2A 4YE0A 5F35A 2FWMX 4CT5A 2D5IA 2CHEA 1CICC 3GRVA 5EQDA 1J9CT 3WO1A 4EZBA 4ZCPA 1MV8A 1VADB 3IPCA 2DQJL 3WYEA 3L84A 3L3JB 1J00A 1GL6A 2DG2A 3K4QA 1L9MA 1JBJA 4DMHA 4UASA 4KI5E 1M2EA 1SEVA 2EX0A 1G2IA 4JJKA 4V39A 4XAWH 4AICA 3I8OA 2QTAA 4G0XA 2IAMC 1PTJC 5HPMB 3MV7A 5BSRA 4EATA 1KO5A 3X1NA 3T0GA 3TBTA 1XLVA 4R4JA 2EVJA 5I75C 4MV9A 2FQGA 3ZW3A 2XTLA 2D1TA 3R7LA 4QVIA 3QGVA 2PX4A 4LSRH 5IN5A 4V1DD 5DRTA 1I7ZB 1IIKA 4FOLA 1GDHA 1WSAA 4FKEA 4WKGA 4WJ5B 4W9HC 3RHFA 1BVRA 3GW8A 2ASVA 1FSKC 4QDTA 4B3HA 2IUUA 1G4MA 2EC9T 4M8VA 2ANCA 3NP3A 5ALCL 5KTRA 3E7FA 1FZKB 4DNOA 5MHSD 2CAKA 3CCHB 4NZMA 4DCCA 5GRJL 1XF4A 3FCOA 4G8GD 1E0AA 5BSGA 3O6KH 2MJWA 2C4VA 5B37A 4BINA 5HIIA 4IU2A 5UKDA 3Q3IA 4D9RE 5E9QA 1MIHA 5CDFA 2QQLH 2Z09A 3DDFA 1AX9A 2BNRD 4AV5A 4ARAA 1G3RA 1JK9B 1W30A 1NBWB 1FAIH 3UJIH 1ZI6A 2JFQA 4ZN6A 4CN1A 1UM4L 1E5TA 3SOPA 1QVWA 1ZPDA 4U0JA 5CD9A 3ORQA 1JGEB 4R4BB 3HZRA 3MRBA 4WJKB 4JB0A 3FO9A 5HZGA 1NBVL 2JB5L 4AQAB 1Z6ZA 4ZARA 1EK6A 5NULA 1BFVH 3ARTA 5F21B 4RIEA 4E7OA 5DQ9B 1DPGA 4BH7B 1UH4A 1CS4C 1USKA 3VSCA 1E20A 3MMZA 3BICA 2F6RA 3C8ZA 3HE7B 1R19A 1G59A 1ZDSA 4PV8B 4P84A 2VT0A 4HQ0A 1TEVA 1GIAA 1BCSA 1P2BA 3L95B 3P7MA 3UEZA 4RGVA 1QHQA 1T5DX 3N2IA 4GMXA 4UIKH 3SM3A 5E8OB 1S3KH 3V8BA 3FUUA 5TJ9A 5K0TA 3L3JA 3GI8H 4ZS7L 1NQWA 3LLCA 2LP4Y 1C4OA 3A4YA 1YEWA 5AKYA 2D4HA 3DPSA 3PITA 4RFOL 1DTWB 3U37A 1F1DA 2AFHB 3ZEIA 1TDQA 4RFNB 1EFPA 3F1LA 2GN0A 3BAWA 2J4WH 1QZNA 3EC1A 4HPJB 4QPNA 4KRPC 4ZYVA 2ODAA 4Z2YA 5COBA 2WINB 1NZFA 2QN8A 3KOYA 1FDRA 3D6UA 2OMEA 2UVEA 2VUOA 4HQRA 2QWXA 3HB0A 3GX1A 5DHRA 2Y7LA 2WCGA 2W91A 3A6PC 1U91A 3AU9A 4MDHA 1D2GA 1M0EA 2WHQA 4LSUH 2AFIE 1I8IA 3R9KA 2VZUA 3QVLA 1JH8A 5BMFL 1II4E 2ESVB 1E28B 1USIA 4EF5A 1VPVA 2PKQP 5I9BA 2VQ3A 1V05A 4BUQA 1XZ0B 1MQ9A 1UWCA 1UOWA 5E8NB 1XDZA 3BP5B 4IIEA 4PG5A 2K6YA 1E7SA 3V33A 1GNSA 1L8OA 4PZ0A 5G1OA 4GQRA 6FABH 4NZTH 2CDNA 4FVTA 4UUNA 4RD0A 1XR8A 3R7WA 2WIIB 3P40A 3QO0B 3ZXIA 5JCJD 1A7RH 1S3GA 1BFTA 3DVSX 1MO5A 3QTTA 5EE9A 3T99A 1SKQA 3QLJA 3FNFA 1A2YB 1I1CA 3UAYA 4HZAA 3RVUC 2YFNA 4POUB 3TM5A 4LSVH 1LEIB 4B44A 1P4BH 4N0UA 5TDOA 2AHIA 3M46A 4QFDA 1UB5B 4RZKA 2G9VA 4B3DA 3QEKA 3CSYB 3Q5YA 5AVTB 3QZUA 4JFHD 4X6DB 5C52B 5H80A 3V79C 4NS0A 3CNQS 2NU6B 2C9SA 1AGBB 4DP7X 3BMQB 3PL5A 3GJFB 5CFPA 3ERXA 4OHWA 3DEFA 4QO1B 2X70B 4XXDA 1H8ED 4RKFA 3FFOA 4R26L 4UT7L 2W9EL 3JZAA 4OQLA 4RD1A 3A21A 2QTFA 4I7ZC 3M5DA 3ZIAA 2NXZC 4XBEL 1P5UA 2AS5M 3IRZA 5AW1B 4DXDA 4NZFA 2PUQT 2JMRA 1KJ8A 1YDMA 2D54A 5KQLA 1JHTA 3HU1A 5JHMA 1QK5A 2LTAA 1ZIOA 3UV6A 5KB3A 5FV4A 2VZSA 1SCIA 2JA1A 1QE0A 1Z82A 1ISHA 3SEPA 4I50B 3CZFA 2VC2L 4AQYB 4KQ1A 2HJFB 4Y19B 4GOKA 5I6XB 1ORQB 5LG6A 1L7DA 2B4YA 3FXAA 4G5OA 5H4GA 3ANTA 3B9BA 4G42A 3FAWA 4ESOA 3CZSA 2IKQA 4PICA 1JP5A 5JQWA 4E11A 2E87A 4EJ6A 3OJVC 4LYJA 1CZ8H 5LA6F 2KC0A 2R60A 1MAUA 2JJVA 1PZ5A 3ACBA 2ECOA 1ZHLA 1DFBL 3ZUGA 4MQ7A 2Z5VA 4HIIA 3JATA 2W37A 4S1DC 3ZJYA 2EDHA 1TG8A 2QTVB 4NNXB 5DNUA 3GPEA 4FYRA 4H0IA 3X2FA 1JXJA 1UQSB 2CLRA 3I1IA 5HHPA 1G3IA 1ID8A 3I5MA 2Q7YB 2G7MC 1CUUA 1I7PA 1DOHA 3T1YB 1RK7A 1HHKB 1RZ8B 2X44D 2PSEA 3DGFC 1KYIA 2YXWA 2W5UA 4X0KA 2WUEA 1RZGA 4KSCA 1EE1A 1KYUA 1V1RB 2PSHA 4J91A 5JLAA 3TI9A 2HQBA 1EG2A 3COOA 4GAYA 1F11A 4UBNA 3KSRA 5AI8A 3HKEA 4JBYA 4AXWA 3Q40A 1U2EA 4KVZA 4TUJB 2APBA 2EECA 5JR1L 4I66A 2NVUA 4EDXB 2CT8A 4IRZA 1UB5A 2VAPA 3ZOZA 4RL4A 2HIHA 4X66B 1E9VA 3OQIB 1YS4A 3KV3O 4XIGS 4XGZB 3E7DA 2VDMB 2PTTB 2P26A 4GNKB 1HLPA 2Y1DA 5AVRB 1ZYUA 5IBLD 2BH2A 1MI5B 1ADQL 3SF8B 3UZEA 3GJ3A 4L2IA 3H6AA 1JF1B 4JKNA 3STBA 1RLMA 4WOBA 2NZXA 4RFVA 2MCG1 1SOWA 1ECFA 3HPRA 3VGGA 4LC0A 4ERXA 1IC7L 5ALIA 5DWPA 1J7KA 3IAM1 2VDNH 1EJ2A 3GZNA 3M7IA 4JLPA 5ES3A 3ZV3A 2FR8A 3EJSA 4HH9B 3ZCUA 2Q76B 5AK5A 1UATA 2ZWMA 2YJQA 3CSFA 3N39C 1HXYB 5IMLA 2AYXA 2PGNA 2I4LA 4KXNA 5GRXG 2Z8ZA 3DYMA 2HHCA 5AQ0A 3BQUB 1Z66A 2OMWB 3CK0H 5KQSA 2A6IA 3RABA 3BXGA 5IUKC 1K8RA 4MTLA 4DSZA 4D9BA 1EVIA 4ZQTA 5BN5B 5KW9L 1VIWA 3NA9H 3AAZA 3L17A 1NM5A 4ZTOH 3EFOB 2IALA 1LU9A 3DCNA 1NCWH 2NT1A 4AMKL 3R19A 4NM8H 4F9EA 4JT8A 3ZRSA 4IGKA 1BXGB 1T66C 3HAEA 3CUWA 1ZT7B 5ARCA 2ZD0A 3SDAD 1ZKMA 2XN1A 4F3YA 1F58L 1LI4A 2DX7A 5AZ2H 5JIBA 3Q7SA 4ZQCB 4CU7A 3PIDA 3SWWA 3B6MA 1DAPA 5SY4A 1XLTC 2G75A 3NNSA 2C2MA 4AEFA 4ZYXA 3K80A 1X8JA 3N2ZB 1CJUC 4BBWA 2BGGA 3EBIA 1HE4A 1MH9A 1ZD1A 3N8HA 5D4JA 4M7JL 2AJYL 4KZ0A 2CLLB 4PREB 1BS2A 1A4XA 3QDGD 3ZHOA 1JHKH 1UG9A 2NNLD 1UBSB 3T41A 2X0NA 4OD0A 2J6WA 1EA9C 1O4VA 4XVRA 2AEEA 2X4IA 3C08H 2IW1A 5L3SA 1Q1NA 2DQFA 1MY5A 1SB9A 3SGJA 2YR3A 1HE8A 5T1KD 1NSYA 2JI1A 2V0NA 4ZPJA 5JPCA 2D0GA 3IR5A 1YZKA 2UUDK 3OQIA 4RY9A 3QRFM 4HN2A 3B9KD 1VCOA 5F9AC 3WHKA 1H0SA 3K5IA 1NC3A 1PSDA 4RABA 1TJXA 1PW3A 3SQBB 1ZC4A 3F04A 5K59E 5D3KA 4DP6X 4K7PH 2W9DL 2DQUL 3QUSA 1MFBH 3V32A 2H32A 2JLSA 1L4MA 4JA2A 4HMEA 2VHTA 3K35A 3TQTA 1LC0A 1SN0A 5F7KC 4PR5B 3V3TA 3X3FH 2Z35A 1PPIA 2JI9A 3SQWA 4OCZA 1BCRB 1IAIH 4C0SA 1SD2A 2VJYA 5A3IC 3A4NA 3BDAA 2MJLA 2ODTX 5PNTA 4MYCA 1HCVA 3NAQA 1HRDA 5CD5D 1CULC 2PKDA 4AQOA 1ZV5A 1Z4LA 4QBGB 1L5OA 1T8WA 3M1YA 1ZQ1A 1G9TA 5TV2A 1LWOA 1X7XB 3LC1O 4G5FA 4QTZA 1HSOA 2EIDA 4BSWB 4ZFQA 3LEYL 5A2AA 3KWTA 4U6HB 4KQFA 4Q02A 5F5XA 2CLKB 3FWYA 3ROXA 1HIML 3IN2A 3WGVB 1I3NA 1LE9B 2ABWA 2PCPB 1CEEA 1PG5A 2DF8A 3VI4E 2XF2A 3B5HA 1W19A 3CZ9A 1FGNH 4R3WA 2XCMC 2V3CC 5FXCH 2OXIA 3ETSA 3FSOA 4PJ8D 4IIJA 3U7FB 3GWZA 4I1UA 3S5ZA 1DKLA 2RAVA 4MI9A 5DTRA 2VDNB 3N85H 1WHSB 5LWQA 1DUZB 3FPYA 4L4SA 3DUFA 2BINA 4RTRA 1NNEA 3EYOA 5AVSB 1B8VA 2PQ2A 3BJZA 5GGRA 1X1EA 2L82A 3IFOA 3CEPB 3QUBA 4HWBL 3K70D 4KUGA 1K1EA 2AMVA 4EFMA 4KKRA 1GT6A 2PPLA 4HNUA 4ZVOA 5HBGA 4RGNC 1IC4H 2O59A 3GL9A 1HEIA 3TT3L 5E1QA 3AXTA 1UZ6E 2W58A 4QEZA 4P2CG 3PBKA 4ZAFA 4G8FA 4EB6B 4JG5A 3ER9A 2ZIAA 3DQQA 5B39G 4XUDA 1X4XA 3MRSA 2H0QA 3SIKA 4H4NA 3B6ZA 2QI9F 3BF8A 5KNBD 4LEEA 1IY1A 4PX2A 4OGQC 5AM1A 1E1QA 3PWPD 2BC4A 1Z0UA 3K73O 4R90H 3PF8A 4S1PA 4MO9A 2QRUA 3KC2A 1PHPA 4IX9A 4MVCA 3T4YA 3VFWB 1SPBS 3QRGL 5KNDA 4X4YA 5BNIA 1NDGA 1LH0A 2ZYRA 1KYQA 1UWLA 4ADSG 2XRFA 2PLAA 4NFCA 4BE5A 5SX4I 3D3KA 3RPIB 3FD8A 2EVFA 4Z7WB 1RZQA 5J1SB 1C8KA 1KDVA 1HHJB 1AH1A 4XOAA 3WLRA 4JB9L 3LPWA 3BI9X 3W11D 3A4EA 4RNRA 3PG5A 3OKAA 4MUIA 3O4FA 1CYGA 3IAGC 2ZVDA 1H3PL 4X44A 5HSGA 2CBTA 4Z7WA 4PJCF 2Q86A 1PGJA 3UYRL 1W73A 1SHLA 2WPDA 3DBXB 1SJ9A 4HT1H 4ZI7F 4OZFG 4KBYA 2ZONA 3OZTA 4HZUA 3TYFA 4HUKB 1ZLYA 3UENA 3UK1A 4BOYA 5G0WA 3DG9A 4DLRA 5L4SA 4NLHA 4QRTA 5E8DH 5IZ7A 2X14A 1A8PA 2P8LB 5DEIA 1SOQA 5FNZA 1SXJA 3WL3A 1T5XA 1KPUA 3FG9A 4KHTL 4P2OD 1J8YF 3EXFB 2P0EA 2O3TA 1FZOB 3A1SA 4A04A 1GLGA 3TTSA 5A9SB 4CEIB 2DBYA 1SG6A 2J20A 3AUUA 4NMHA 4OV5A 3KYMA 3NQ41 2P5EE 4H15A 2GBAA 4Z78A 2FSEA 5JMTA 4NQDA 3DFMA 5KI6A 1OP9A 4TLEA 2VLIA 3DAPA 4BMNA 4WI0B 4GC5A 3CQ9A 1T6BY 5FOBA 4R0MA 2FO4A 4K07A 4Q82A 4DTIA 1HWHB 3HCCA 3QFGA 1MC1A 4Y7OC 3KYNB 4DWHA 2AG1A 3K9QO 5H4HA 4CEJB 4WFHE 4GG8A 4RMVA 4ONOA 4X7TB 2AI3A 4OQZA 3EFDL 4TL6A 4JY6B 4L8CB 1W80A 1IGCL 3ELUA 4W9DC 3IBGA 4I9WE 4ENVA 2FF5A 1Q0LA 1KN2H 2I62A 1ZS8A 1EM8A 1UK8A 1ZHLB 3ZY2A 2OTWA 1JHUA 1D0SA 2J9ZB 2EKSB 2NNWB 3SQOA 1GNPA 4FWWA 4CM9D 3CEJA 3NSCA 2CB0A 4L8DA 1AZRA 4QO7A 4N26A 1AGDB 3QQ4A 3MRNB 4LAJH 3AVUA 3FH5A 5DO2C 4D8OA 1YE5A 2UWEE 2RONA 1S9YA 3GHBL 2BX5A 4NV3A 2ZR0A 2JFHA 4WZ9A 5G5DB 3DHJA 1A4KB 1BIHA 4MXDA 2VAXA 4NO0B 1T5XB 3QIBC 4CKZA 3HE6C 1SD5A 1KTBA 1ZK2A 1TA4A 1MCPH 4QNNA 5HKBA 1CF8H 1GUYA 1PJZA 3EJZC 4DV1B 5DX0A 4ZANA 4RXTA 3TF5A 5I71B 3I9JA 3AVYA 4OQYA 4ABUA 1KH1A 3R0ZA 2GVYA 1QZXA 1TLLA 2ZRQA 1QHXA 4G4IA 4G0PA 1PK7A 3PFWO 3B37A 3WLWC 4IILA 1X70A 3L7BA 2DR0A 4O3FA 1E64A 2YOFA 2I4MA 2W6NA 1T2QH 1SUFA 5JBQA 4O02H 1JRHH 4U39A 2O6PA 1Z37A 5CH3A 1J87A 4JPKL 5IROD 1ZLVH 1RC0A 1ZTXL 1TYAE 3UJ6A 4DQKA 3KOZA 5TE6H 1ADYA 3N2KA 2ODWA 3EVTA 3AFMA 3U9LA 4X7SH 3I2JA 2L17A 5IVXA 2KWIA 4IGFA 3C8KA 3KTAB 5GINE 1RXEA 3N3BC 5A3SA 4ONFL 3T4UA 1UOLA 4R9UC 1HDGO 1UD3A 3DLCA 3QIWA 1OEZW 3QXVA 1PW7A 5A6MA 3F6LA 4YBZA 4HBCH 4P46A 3I4FA 3NCJH 1SHUX 5JJBA 5BOPA 4BVHA 5BW6B 4FQXD 5KKNB 4FG6C 2R96A 3OMIB 3EVNA 4EM6A 3GPIA 3VDBA 3ODGA 3FO1A 1QLEB 3LRHA 1I7NA 3CNBA 3A1CA 5ELMA 4BNHA 1E61A 1VA9A 1JRHI 2ZBDA 5J5VA 3G6DL 2ZCKL 3HRHA 3BSGA 4IXNA 4QUIA 5ALVA 2VXVL 1MWAA 1B7GO 1QLHA 3H2ZA 2R8XA 4OD1L 3T1OA 4AVYA 3EULA 4APQC 2RTTA 2NY2B 2HT3C 5DK2A 5K9QI 4JBGA 5GRJH 2VPZA 2JZOA 2FMXA 1YT5A 4D7PA 2WNHA 3POCA 3IYLW 4RLSA 3RVNA 5GS0D 2GHQA 1MAAA 1E3JA 5D4HA 4UE2A 1L8LA 3HCOA 3ONVA 1A6UH 5I17B 3MB5A 3DA0A 3EODA 4PRKA 1LM8V 2OFQA 4FA7B 2AXQA 4Z3TA 1QSEB 4XPBH 3RBGA 5CMLA 2AKYA 4MROA 4KQ4H 1W85A 4DGVL 2HQ1A 3MJ7A 1HQDA 2FJUB 2R44A 4KQ9A 1RKBA 1A7OH 5IM4F 1KI4A 5D7NA 3D31A 3CZLA 3QU5A 4GRMB 2R7NA 4JO4H 3LPPA 4LARH 4NFSA 4YROA 4W5JA 1IT9H 1CDCA 2ATEA 4WSKA 3VMNA 2FH5B 1FFOB 4R2GC 3MCZA 2DWXA 1QGZA 4P9HL 3QK0A 5EVJA 3MYZA 4A26A 3INNA 3KM0A 3IJEA 2KMWA 1SXIA 5DK4A 5I7EA 2EUWA 3KZVA 1FWXA 3GXFA 4PU2A 2E9IA 2Q6OA 1JPFA 4V0SA 1CBVH 3W2HA 5HE9A 2O30A 1FFDA 2WHRA 3QNWA 3BJRA 2QZQA 5I4IA 1TQCC 1KY3A 5DI8B 1EHIA 2JCYA 3DMGA 2VO8A 3M7OA 5DJ2B 1JU9A 4B9JA 1ZIYA 3LA6A 1N78A 1KEGL 2OZNA 3K71A 2YQ3A 5T3XD 4QOKB 2XWCA 3OXRB 4Y4HA 4M62L 2EIJB 3FUXA 4O02A 4NESA 1WTCA 4BL5A 1J5OH 3SLRA 1V7MH 3T08A 3NEJA 5LQCA 3TOXA 4G6KL 4IBQA 4XHQA 1C50A 3PRJA 4LAFA 3V9CA 1T0NA 2PIDA 3DDHA 4Y5VB 5F1OB 3ONDA 3JAWA 4RACA 4F9GA 3NJ4A 5BW5A 3VAZA 3C7AA 5I16A 2EDEA 4FRWA 5A9TA 4PV9A 5ALWA 1CGWA 13PKA 4G09A 5FYJL 3WGIA 1Z4JA 4GOSA 1V5JA 4F2FA 4K5NA 2C8LA 5D87A 4LEOB 3L1EA 1QI4A 1E2DA 3ZHTA 3FCEA 4N8VG 3N6YA 2WLSA 5FOBB 3LNGA 1IAKA 1NJ9B 1ZT4A 1TJYA 3I4CA 2QL7A 2YVAA 4OPMA 1Z0AA 4ER5A 3N70A 2GETA 4KZKA 1IY0A 3T0FA 2CK0L 1KHHA 1X87A 2LDBA 3HAEB 3G89A 4ODUB 3TNJA 4OCRH 3V6ZB 2WQUA 2DULA 4XVUD 4Z7QE 3M4NA 1VIDA 1H3VA 4C01A 1X7TA 3H4MA 3P4OA 3OC6A 4F7EB 3LPFA 4DESA 1T1SA 3T3MB 1U65A 4FOTA 2VPYA 3K0AA 2IYLD 4MV8A 5HIMA 5AJYA 1RERA 4R97B 2BDNH 5B1BB 4X45A 3LKNB 2N1BA 3KQTA 4NJEA 2PSSA 3WEOA 3LN4B 3LDHA 4PSKA 3QJSB 1YH3A 1W0KD 1EZLA 2PTUA 5FORA 5HHXL 2NQDA 1O0BA 1FZQA 3NTXA 4HYTA 1A7PH 1L7BA 4RISL 1FGVH 2OAQ1 3DSNA 1JVBA 2F1EA 2PQ6A 1T8PA 2P1YA 1OK0A 3FTUA 3SBEA 4MRCA 1YKFA 3L3OA 8ATCA 1TCVA 2NPOA 1DV2A 1IJNA 3EH3B 1SLUA 3O3DA 4YBHA 1ZM7A 3W57A 2GFBA 2YQZA 5CSBA 1VPTA 4JXJA 2OULB 3ESZA 4LGRB 3PR3A 2LAAA 1II8B 3GO1L 4QUOA 2DY2A 2FEDC 1WDWB 1C8LA 3QDMB 4GSDL 2Q1YA 2YAFA 2R68A 2PTTA 3LGAA 3T5GA 1NKRA 1OL0A 4LPVA 1F1BA 3RX8A 4P2OB 4JEMA 3OLXA 3N42F 4BAZA 3RSHA 1M34B 3CSPA 1SQ2N 4MVJI 5GMOA 4WZBA 3L8GA 3MRQA 4ECEA 4F20A 2KYIA 3PA8A 4WQOA 1JR3A 3UFBA 3QX3A 1MIEH 4P7JA 4OG2A 4BNGA 4R2HA 3AS1A 3TZHA 5F78A 4NWIA 3DMYA 1UQRA 3V7MA 3JQ6A 1RVFH 1WFIA 1BOGB 2W4QA 1TQVA 5BR1A 2OL3A 2XNCA 4GGOA 5HNKA 2V4ZA 3U4MA 3GPCA 1YAZA 4XP6L 4H7PA 1V1RA 4HAUA 1K8IA 2NTFA 3RTEA 1JHDA 1OAUL 1NLFA 3UTTB 4YDMA 1WPRA 1J23A 1AJ7H 3WKDA 4MS4A 1ZGLM 4JP1A 1JR3D 4TMFA 5FPQA 4N0MA 1QV6A 5DRWB 1IKFL 3OB8A 4OUDA 4PJGF 3RASA 2ZSIA 4C6SA 4BEWA 2HQOA 3L9RB 4ALAC 2VABB 3KAJA 1N2CB 1O0CA 3ENNA 1MXHA 1RMFH 1I2BA 2AFHA 4AUJA 2DQJH 2ODNA 4U7WA 3EAFA 5CZVL 1YY9C 5HGDB 4J1SA 2F19L 3ABKB 4Q56A 4Z3KA 5JROA 2ZYSA 4UFPA 3H8VA 6PFKA 3M6LA 4YHOH 5KVFH 3G02A 1XWIA 4FGKA 4E4RA 4PZEA 4R3NA 5E2UH 5B2EA 3U26A 4JMXA 4DN6A 5A5FA 5LB4A 2H6OA 1U58A 2BNRE 1LWRA 2XDYA 2PH7A 1MHTA 3H9HB 2W8BA 3H6KA 3TBHA 1F6DA 4J3WA 4MRRA 2XNKA 1UKZA 4DVBB 1Y3BE 3E82A 3ATEA 5KQPA 2RALA 3IQZA 2QTGA 4IJKA 4MP8A 1B76A 5E9WA 1R0XA 4BQBA 4FFNA 3OJ0A 2XWTA 5DD0L 4S2EA 1V8BA 4PR5A 1QHPA 4HRYA 4IBWA 5HHOA 1BGXT 4FG0A 5F64A 2FUEA 5DQDH 3DZDA 4QGBA 4FQ7A 3S35H 1ADGA 3HI6A 1TKWB 5JW4M 1OAOA 2JKVA 2UY7B 3BRWA 1QP7A 4YOKA 3TX2A 1PX8A 1T1WB 4NM8L 1OBVA 5C07D 4KIWA 4F27A 2Z3FA 2IITA 2PPDA 2OXHB 4A92A 4NOJA 3R3ZA 4KVCH 3OPVA 4NSNA 4C4XA 3A1DA 2YS6A 4TQ8A 4BFKA 4JYMA 1BQRA 4WLCA 5DM4A 2BDTA 3SNHA 4TLMB 3VFSA 3OM1A 5BYAA 4X4XB 5MHTA 3BN3B 2HSDA 1MVFA 4ZALA 2F53E 3STVA 2FEAA 3PPEA 4HJTA 1S3RA 3LLVA 4U05A 5HDBE 2AXHA 3WGNA 2E7LC 4LRNH 1KY4A 5E9DD 2XBZA 1LEGB 3I45A 4L8WB 4PGCA 3TLCA 3KLDA 5TMEA 4KBPA 3ESMA 2JARA 2ZI4A 1DBAL 2Q6WB 4D97A 1PKOA 3F58H 1QZ1A 2QADC 1OGTB 2Q3DA 1GJWA 3SJVD 4S2UA 3PHQA 2VZEA 5TE7H 1HZLA 2X1QA 2BDEA 2DHRA 3GNLA 3NBAA 4XXCC 2NLOA 2ONJA 4Y6QA 2CXHA 2AMLA 4WXRA 2PV0A 3T7IA 4YIQA 5A4JA 4JQZA 2IC2A 2RGNA 3HJHA 3P4OB 4JT2A 4TMKA 4G8GE 3B7PA 2OQVA 3T5BA 1FV1A 4HDCA 4PSPA 2MMXA 5HFNA 1PD6A 1U36A 1V7QA 2VJMA 5AVZB 4JFED 2P9FA 1M2HA 1VM6A 3ETEA 5DD6A 3IFLL 3PWUA 3DJZA 1MHPL 2NU9B 3L0YA 4YBLB 3RM3A 1PR2A 3NWBA 2ZXCA 5DWUL 2O61B 3RVDA 4YSDA 4BK5A 1E7WA 2VT6A 5KJCA 3R5XA 4LEOA 2YJ6A 4DGIH 3CTTA 1M05B 1BEUB 2EYUA 5ICXB 1WPQA 2NZ9C 4Q9NA 4ZP1A 1ZT1A 2J88H 1X5XA 5A6LA 4GO6B 4L2YA 2C9DA 5FS5A 1LDBA 2D7TH 4QQKA 4XCFH 3L6FB 3IPYA 3LXXA 2GABA 4R1UA 1ONQA 5CEZH 1NRJB 2F6AA 2I32A 3WHE1 1LDNA 4P4KA 5ACZA 2QTNA 4LKOA 3QLEA 4ZPVA 4L22A 4QJ4B 1BN7A 1D8TA 1URIA 2O2XA 1LGVA 1M76A 1W94A 5DCCA 2HKHL 4B95C 3VOAA 2ZP1A 2XKNA 1ETJA 2GAJA 3ENZA 3N85L 4TLBA 3T3GA 1D5MA 4FZ8H 2J3KA 2ZAYA 2IP2A 3EK2A 4EA9A 4ZQKA 3LIUA 2HYMA 3EH1A 1P17A 2OX5A 4JKKA 4KKXB 3F2VA 3V3KA 1X2EA 4ZZ2A 4O9HL 5DJ6B 3IVKB 2YJTD 3AGQA 5CN3A 2R29A 5D4IA 3H4VA 4CG3A 3FOZA 1ZD6A 2V9ZA 3EXG2 1C81A 4BELD 1C7SA 5AUMA 5ANMB 1Q7GA 4WWKC 1B9KA 2B5IC 4RJKA 4UAGA 5FPSA 1VLMA 3KOOA 5EPEA 4L51A 4PSAA 3RX7A 1IQDA 3PWLA 4L3EA 2XY4A 1R5IB 1M33A 3CTMA 2UAGA 2Y2YA 1XR3A 2KQMA 5DHTA 5KEZA 4BP1A 2OHOA 4UNVA 4R90L 3WBFA 3H6GA 4A10A 3WUWG 1A27A 3F6YA 3T35A 4QREA 5P21A 2PMCA 1WXXA 4A3SA 5K51A 2Z9BA 4PRHE 2QM8A 4PZLA 3L93A 1D1SA 1UZ8B 1P19A 5JNRA 4E70A 3TQIA 3L9RA 4FYXA 1V45E 4PPYA 1I30A 1N32B 4G5GA 1IZJA 5AI0A 3TNNB 3KHTA 3T4EA 3OWEA 1X0XA 4PJ5B 4K71B 5DBGA 1D9KB 1FPMA 3WYDA 1XCBA 5KJ7E 4PVCA 4BNNA 3KWWB 2P5SA 1CUOA 3HKDA 2G1AA 4ZX6A 1TNNA 4JDVB 1FFEA 3MBKA 2P43B 2CUTA 3QUGA 1UADC 1JT2A 2ECFA 3LLMA 5AW5B 4AV4A 4PCAA 4P35A 4PGGA 5LZ9A 4C2TA 2IIJA 3MGTA 3B2PA 4HH8A 2LIPA 1LBHA 2ZCZA 3TYXA 4L4VE 4GKJB 4DDHA 4E51A 4CADA 1M2OB 3JZMA 2R4SL 4Q3BA 3PTAA 3QDAA 1MW3A 4PZ9A 5HJ2A 2R8BA 3P26A 2WC1A 5BW4A 1K85A 4M76B 1UBEA 2Z9CA 1J8HB 1E8MA 3V8VA 2C7QA 3F6BX 1KZYA 4FGLA 2KT6A 1J5CA 2XT0A 4PW0A 2HBYA 1UM8A 4N2OA 3ED1A 4U1JA 2XYPA 1NX6A 3TOPA 4QNPF 4IRXA 2CKBH 3FQTA 1PVDA 2DQGL 4B5KA 5GV7A 3IGUA 4KUHA 4PF1A 1OW3B 3DLPX 3EVBA 3BHIA 1M6OB 1NQ5A 4FTDA 1VKZA 3BUSA 2DWCA 3UVEA 1M5RA 3L3OB 1KMQA 3T6ZA 4QUDA 3VFVB 4GWLA 3PGJA 3L1KA 3JR3A 3MUY1 3N07A 3ICVA 2XUOA 4PTUA 3B8YA 1R4MB 4YMLA 1KKMA 4LSQL 4EKJA 2IBMA 2B4QA 4BJHB 5A3RA 1Z56C 5DZ9A 2FNBA 1G64A 3PKZA 1KWGA 3PPVA 1I7RB 4PJHF 2EKPA 4MWZA 3VPXA 5AB9A 2DIAA 1KN2L 4JGGA 1QQDA 3PHIA 3LDAA 3BD6A 3BEVB 2ZDGA 3CQPA 2I9LA 4OIIL 3GUUA 1G7RA 4NO2A 4MIEA 3TEZA 1GZUA 1JR4A 2XTJE 3O6FB 2Z30A 5B6IA 3WIHA 3BUIA 3QK7A 2ED7A 3RY6A 2Z8SA 2JB6B 5BQ7A 4KIFA 4P7KA 1ZUWA 2L04A 4LFHG 3DGGA 3ICWA 3F98A 3GFTA 1I24A 4OFBA 2AUTA 1M66A 3DIFB 1BAFH 2L0XA 2G3NA 3S0PA 4JUFA 2R6R1 5GONF 2PW2B 2DHQA 1KOLA 1KI2A 2UVQA 3GMOA 3LTEA 4D94A 3M3PA 3VH3A 2IVZA 3IVAA 2X8JB 2C04A 3VJ6B 3VRLE 4I19A 3SC2A 4EZKA 1E7RA 2OO7A 3P9RA 4E68A 3PG2A 4C7MA 3B53X 4YRNA 3H19A 2XQ0A 4NUGH 2XN9E 4B5EA 3MCVA 1YNTA 5C6TL 1UFKA 1C5CH 4BFBD 1YK1A 3OF6D 2I4IA 3IULA 3N0PB 4OREX 5FF6B 3HPJB 2GMWA 2ZK7A 2YVKA 2YWGA 5F6IB 1OTYA 3DONA 4CEIA 2OHXA 2QTZA 2PX6A 5EU6E 1HSBB 4HDSB 2J55A 3H3BC 3LS5H 4NBUA 1A25A 3LQQA 3GM0A 2Q6LA 3B9EA 3C43A 1PFQA 1UWGL 4O51B 5C2JB 3ULVC 1Z7BA 2E6JA 4QJ4A 3I6GA 1CI5A 3TCLA 4MGYR 2UYCA 3ZMNA 1NUFA 2O5ZH 4UWQB 2GA9A 4OFWA 2BMFA 4JKWA 2GX6A 3EVFA 4EFDA 1LO5A 2YAMA 1JHRA 3R9IA 1DXHA 3UABA 3HE7D 2I6TA 4HPYL 2R86A 1T7WA 4ZVUA 4AY4A 1QTYT 5HS6A 4NDZA 4JM4L 2I71A 4X98A 1XYVA 2IMMA 1XV5A 5AM2A 2CXPA 1SLWA 1TVKA 1Y89A 4WSOA 3PUHA 9PCYA 1JWLA 2YW9A 3A9SA 3F01A 3MBXL 2RQEA 3NSFA 4PJ8A 3C14C 4ABQA 4QY8A 4AJ9A 2FX7L 1UJ6A 1U2YA 3WEMA 4UEKA 2R1UA 3DIFA 2VCHA 4WLEA 1ASPA 4P22A 1C0LA 3AHCA 4ELKA 5EDSA 4QX6A 2J5XA 4LDOB 1AANA 1LE5A 4WZAB 2ZM5A 1GL7A 5H37H 3LUPA 4YEDA 2QDWA 1PJCA 1KMMA 2Z58A 4GT1A 2C00A 2KS6A 2QQ5A 4LFBB 3RSZA 3KXFD 4X1YA 1NINA 3COSA 5DTFA 1R6TA 5EDXA 4FFBA 2Y68A 4DM7A 4QRPE 1IC1A 4H0HB 2WP8J 3D3QA 3ARGC 1Y48E 2XE8A 2XFXB 5L2JA 3NJRA 4ZW6A 1FLNA 2JI4A 2ZKYA 2LLNA 4G5ZL 2C9RA 3PLRA 3V1UA 3Q8MA 1GA6A 2XCLA 4JAVC 1TMCB 1ZSDA 1N5YH 2CDFB 1BVZA 1N1EA 3QISA 1XVUA 1KF0A 4X5XA 1AG9A 4M8SA 1GPAA 2XLBA 1YDPB 4P2RE 3V55A 2YMPA 1CK0L 1QATA 3F62A 3BLPX 4DDKA 2X6QA 4O5LL 3FF7A 5IDWA 3VPAA 4OQPA 3E1ZA 1PQ4A 1Z5UA 4W7IA 3ETDA 5C37A 1CDJA 2O7RA 5MN4A 4JOQA 3H5TA 5C0AA 3HS9A 5HRUA 1SUHA 4GKOA 5L4FA 2WLZA 4OD3H 4I2XB 4DTGH 3EC7A 5DHMC 3L1GA 4PVDA 3ZTDC 4B2IA 4TM8A 2P6UA 4XQGA 4M9CA 4F8PA 2XWJA 1F4WH 2C5DC 3EDRA 5FBHA 4E22A 4DVJA 4UV7H 1NGZA 5B1HA 1J2EA 1JDSA 1ECYA 3Q7JA 1TD1A 3RGVC 5CGQB 4XR4A 3DK0A 3DLQR 2GD0A 2PX8A 4YJKA 3E58A 1YVLA 2O50A 4M54A 5LZ8A 1UPTA 4JG1H 5B3AA 3K0CC 4B9GA 2OMYA 3UZEC 3FDZA 2Q49A 2A74B 1F3JA 3UXHA 1YZGA 1HNZB 1L9PA 1EK0A 1B4RA 4HAFA 2QSCH 1NAMA 1XFAA 4HHEA 3DO4A 4ZQFA 1DZ3A 5E9DE 3UQZA 5FA3A 1CVIA 2DTXA 3AWIA 3DFUA 1KG0A 3NPSB 2VB5A 3JV0A 4Z0XA 5AXDA 4JKMA 1I0ZA 2YRBA 4NQCB 1AXTH 3U9PL 1V10A 1UPBA 1DL7H 2ZUWA 2XDHA 3WS3A 1ZS8B 4JI2B 1GTNA 1CBUA 1JA0A 4IQFA 1H5QA 3RILA 1XH3A 3D3WA 4UMSA 1PT7A 4NULA 4EZEA 4GZLA 2IP1A 1V6SA 1RBYA 3LECA 5T3UA 2FATL 2PW1A 2QMQA 4P2OC 1RLWA 2VSFA 4M5TA 5JAOA 2KBGA 3KEDA 2H1PL 1EFQA 1UM4H 4HJJH 3CD4A 3FFDA 4N8PA 4NEHB 4G6AD 3HFGA 4P2BA 5FD8A 5EG6C 3ARBA 4R69A 2MR5A 5AUMB 4J3BA 1FFWA 4H8WH 4WI0A 4DCPA 4PSVA 5JORB 5CHNB 2YDYA 3IEXA 2EEBA 3KDMA 2FSEB 2ZT5A 2POCA 5KVVA 3JALA 4C83B 4G9DB 2VLRA 3KWFA 4E6PA 2I4TA 2YRZA 4MWDA 5LR6A 2QR3A 2F8XC 1U42A 1QQAA 2J32A 3ZNQA 3PTZA 3L5WA 2C59A 1MFCL 1E4EA 2XXJA 2ADOA 1MSPA 1T1ZB 3IEMA 4JSRA 4R96A 5GZOA 4QRQA 3OPXA 1GZHC 1RUPL 1YZVA 1DXYA 2DZDA 2E18A 4R97C 3H0KA 1WYJA 4HJIA 1HYBA 3EUFA 3IBCA 1EWHA 1LDGA 2APFA 1IFXA 2ISQA 1YN6B 1QU3A 4RZ3A 4BLWA 4ZZ3A 4TMWA 2AOUA 3FRPG 4DO6A 2VBFA 4MNQE 2VLJE 2BMVA 2ZCVA 3KOMA 4W8OA 1AP2A 3GZNB 1QSVA 3ZGZA 4HEPG 1AKPA 3IBFA 4R2IA 1HT3A 3OJMB 4HUQB 1ZRHA 1YY8A 3WVNA 1JQLB 2EKLA 3Q6FA 4PYJA 4Z7OE 1RSZA 3UZUA 3UC5A 2IAND 4G9GA 1LQSR 4RFSB 4NBZB 5E7JA 3ND8A 3T1HB 3IPXA 3LAFA 3KKMA 3LXAA 4TF4A 3QO1A 5C6TH 1MFMA 4JU9A 2ZUTA 4G5YA 1UA7A 5DHUA 3JTBA 1NVAA 2NU8A 2C5GA 1DANU 1U04A 4REMA 2A0FA 4G70B 5ISZE 5T1DH 1RJEA 1OALA 3NZHH 4YY3B 3VMOA 4D0BA 2B83A 3ISWA 1PLCA 2GAZA 4YJ2F 3VSBA 2PS1A 4MQMA 1FFAA 4FOSA 4HPHA 1NL0H 4TUUA 1GYPA 1N1DA 2X76A 4IOKA 4U7KA 3K74B 3P3RA 2P9HA 3N1QC 5FJIA 3QNZA 4HIXH 3LRXA 4GVXA 1F42A 3Q85A 2FW1A 3EYSL 1RUQH 3CX8A 2JANA 1TVMA 1CD5A 3KZKA 3ML9A 4IFIA 5C09A 2E6KA 1QWSA 4GRLA 4RIRA 5TEWA 2QSUA 3GOHA 1C2TA 1Q74A 3EUEA 2PWFA 5BO0D 4RPIA 2HWWA 4PE5B 3C3WA 3BL5A 3CVIH 3EG9A 4PW4A 5AAPA 1OX6A 3JQ8B 2OHFA 1UACL 1GTFA 2CDAA 1F90H 3BULA 5J4VA 2YBRB 5FM5O 2CLHB 2BFGA 3OETA 4F93B 4KPUB 1Z39A 3RJOA 4IYRA 3A3KA 4ZU3A 4EBFA 3UIEA 3FT2B 1M71B 3RA7H 4OU3A 3ZC3A 2VSDA 2FJGA 2M8XA 5KS9A 4J1UB 4K6HA 2BP8A 4Q6BA 3JTTA 2QOEA 5E6UB 3WENA 4Q39A 3HABA 3S3SA 2GD6A 2GJSA 4FHEA 4JZYA 4UM7A 2I7CA 3M17A 1S46A 4BSWA 1W25A 5CTJA 1SOKA 2VLKD 1XYYA 4H1HA 1A22B 4PYHA 4QQRA 1QPBA 1CS0B 2L7EA 5C08D 1MCDA 3HHSA 1X8LA 3FA2A 1OXUA 5DLML 3E3QC 1OKKD 3MXTA 2ZOWA 2V97A 1QNZH 2WN3A 1PV1A 1AKJD 2E7MA 2J0UA 4KY2A 2EE9A 3O2DA 3S1LA 4E41A 4JI4B 2PLRA 3ILQC 2V65A 4KH1A 1OM3H 5LBGA 4RCYA 5DMJB 3GFQA 3RUIA 2OPCA 3PLAE 4ZO4A 3N41F 5D7JD 3RYFA 3R5SA 4P46D 1T03H 4NZ8A 3EAQA 3OVMA 3DHVA 4LRXA 4WKPA 1VPDA 4K9QA 2QG4A 3ZYCA 1FNHA 5B39A 1G5TA 3N9GL 2PBLA 4DAOA 3CVJA 1TZJA 2WBJB 4BB9A 1V3KA 4K7PY 2OTPA 4LPCA 4RM3A 1MPAH 3TWCL 4O4JF 4U1NB 5K2MA 1R0WA 3KSUA 2BFFA 1ID2A 1KI9A 3U6XS 2HCRA 1AB6A 4HB2A 2WSKA 4L72A 4QMEA 2BFWA 2RIKA 5ESAA 1HCZA 2MNJB 1QGUA 1CICB 3MJ8A 3TYGL 4LDJA 4S04A 4AMWA 4G80A 3JWJA 4OCXH 2Z0UA 3RWFA 4OD2A 5T33H 1DRJA 3MRCB 2KX7A 2O06A 2FW8A 3RHWF 3RU7A 2HQSA 3OEYA 5FI1B 2HZHA 2J4FA 4UTBL 2OHJA 1IKNC 4UINL 4WBXC 1H94A 2BNQD 4AK9A 5IBTH 1RPTA 1X92A 3EY4A 1JZ4A 1P80A 1B0ZA 4DUXA 3VNBA 3FY4A 2N3JA 4V2BA 2CJYA 3RIXA 3EVDA 2XT6A 1MVUA 1VIMA 4PGEB 2HU7A 4BRSA 1EFXB 2LTQB 2PRKA 2OSWA 2VPIA 1M1NB 1A2BA 2JF1A 5C2BL 5BURA 3F7KA 2GAZB 3AU8A 3RTDA 3EZ2A 2NNXA 2HT4D 1EZ4A 1J97A 2RGUA 3DE1X 3SS9X 4HCJA 1R6UA 4E2XA 3IPFA 4MNQB 2B1JA 3U7QA 4OI4A 5KZCD 2C7RA 4X1IB 1Z2CA 4V2IA 4O0LA 1E5VA 2AXJA 3BP4B 3B6KA 2OC4A 3PNQA 4DRXA 2I4RA 5AKLA 4WERA 4LASH 4I50F 5TFSL 1AD9A 3EXHA 4TXLA 3SJUA 1AIZA 4TTAA 1ZAYA 2ILTA 3PE3A 3B9QA 4I6EA 1UKYA 4R8WL 2J48A 1H5BC 1JOIA 3RYCB 1U28A 3CH5A 2A9MH 2BM9A 2PWYA 4CU2A 3LX4A 1G7SA 2OYPA 3T3NA 3DMHA 3O8CA 3Q0TA 5EYPA 4M6NL 1CN4A 5IKMA 1G8KA 4HKJA 5EZ5A 3SIWA 3CB2A 4CMBA 2ZOTA 5A3ID 1DEHA 2OO5C 3G82C 5BZWB 5AVRA 1P31A 1B6RA 3I73A 5CLIA 4AZ0B 3O41A 3U3RA 4NBRA 2YZNA 3B6EA 3KQHA 5ALOA 3PQYD 1JR3E 5KVEE 5TQ0A 2WRZA 1T1ZA 1KJVA 5F9DC 1T2FA 1W4AA 5FLEX 1GL9B 3GUFA 4DW2L 4B6PA 4JZNB 4JJ6A 3HC4L 3W5DA 3CY6A 2YHSA 2QBYB 1SF5A 4MKGA 4YT8A 3EO0B 3UP6A 3H3FA 2VUSA 4OAWB 1MFNA 2QVFB 2KKQA 3WDJA 1JXMA 3I30X 3B9RA 3PNYA 1IAKB 1SOUA 1JIBA 5ID0A 4KYUA 2BSEA 4V1CA 4ZZKA 1BDMA 4J03A 4OHZA 1QO9A 4PVMA 4G0ZA 4H4EA 3TXAA 5IHZA 4H1LA 5IHBA 5DSXA 1DSYA 5IMKB 4L4UA 2QLTA 4JFEA 3WTCA 2EYRB 5CB6A 2JQMA 4K7PL 4X7BA 4K9LA 1YL7A 2KDYA 2IAMA 3C09C 2P6PA 1I1AC 1Y6ZA 3FPCA 1Z9MA 1OZHA 4BMCA 3QHFL 5BQPA 1MQ8A 2AITA 2J31A 4HMPA 1KK1A 4MR9A 4BGIA 4XN7A 3JYLA 2PX0A 3D6FA 3QEAZ 1L4IA 4WKZA 9MHTA 1ZRUA 2J9GA 1M5TA 1IRAY 2JI3A 1HI9A 4Y5XC 3RODA 4EG6A 1ZHKB 3X44A 3HKBA 1HHHA 4DA9A 3CZPA 2RBGA 3I62A 4N2GA 4Z0HO 4B6ZA 3B3QA 3EVEA 5FYKE 1U8UA 2FYYB 3L3DA 2XGOA 1JHVA 4XYBA 5E9DA 4HRVA 4WK6A 4LCIH 3Q1LA 4CLOA 1JL3A 4RL6A 2R4QA 3VX4A 3REVB 1M8PA 3SQLA 3QG6B 4J6IA 4GG6E 4JM0A 2WUGA 2NSHA 2YCBA 2GJ9A 1ISPA 1OPGH 5IBUB 3BFOA 3BDBA 4H7DA 3OZVA 3S27A 2CJWB 2ZJZA 5WRFA 2M1KA 1S7UB 3GJEB 4IDCA 2W2KA 4XPAL 5CLLA 4LLQA 3RGWS 2ID9A 3ZWQA 4LZKA 3QFSA 2GSIA 3QZOA 3LEVL 5FXMA 1SHSA 3OAZK 2CJWA 4HLJA 1NX9A 4IHAA 4N0CD 1NWHA 1FUEA 1CFVL 3F5SA 1Q0HA 4LCUB 5B3SB 4JJOA 4CUCA 1U3DA 3LUAA 5KJRL 3TZQA 5LN4A 4PYQA 3C5ZA 2FPUA 4CGTA 4LJYA 5DMIH 2GY5A 2IEBA 4NJMB 1F90L 4R6XA 4FW9A 2RKWA 4IKEA 2VWQA 1CR9H 4O4IA 3GYBA 3BZWA 1I7UA 4KE7A 5F89A 4WAFA 2CM6A 1V4BA 1XD9A 5TMPA 4NAHA 4TMXA 5FO1A 3U0WL 4D46A 5EP4A 4MNGB 2M6SA 4JP3A 1QBAA 3MBXH 3KXIA 3W3ZB 3MRPB 4JJAA 4KFSA 1KCRL 1J8DA 4P80A 2P47B 2R5WA 3FU9A 4C14A 1UK6A 1N4AA 4GX2A 3KHOA 1MIML 1NC2A 1OKEA 3MTDA 5L4LA 4L15A 1JEYA 4ZD6A 2BHZA 4LLWB 1MQ8B 4ZV9A 1SU6A 2WWKT 3GHYA 4J9VA 3QUML 3JV4A 3A6OA 1SJHA 1W16A 2AZTA 4BNIA 3IDIA 1X7ZA 4ELMA 3IJ7A 3F7YA 4RSVA 5GZND 3GBEA 4WI8A 1Q16A 5T8KC 1E3ZA 1JFFA 4CNBA 3BWXA 1GTSA 1FMLA 3E15A 1L9OA 1EA7A 5GGVY 4F72A 2CUAA 1V2GA 5DRXA 4GWKA 4XOEA 4L8LA 1QSGA 4EAEA 1J5EB 1IGMH 3GWJA 3AR8A 1TM4E 1UWGH 1MEEA 4JB8A 3TIEB 1P1FA 1XH2A 1EVJA 4HK4A 4OZ4B 4C54A 2PE5A 2P28B 5DX1A 2WBJA 3EO0A 3RKDD 4YJDA 4BO9A 1K8ZB 2D7JA 1XTLA 1P2SA 1NCGA 3PC2A 3ARZA 1XBRA 3TIFA 1FFCA 5ILOA 1MF7A 3LGSA 4NZJA 4WAUA 5CDUA 2VO5A 5CAYB 1NJFA 4GM4A 3IDUA 1D7DA 4XW2A 3KVNA 4IMIB 1YHNA 3MS7A 1EIWA 3UJJH 2PCFA 2A9BA 5H16A 1VECA 5KOIA 4CLRA 2GQ0A 3D8SA 4OR1A 1FTNA 4C6RA 4BNDA 1LK2A 4XP4H 5LC1A 3OOEA 3ZT7A 2ORIA 3H4IA 3ECBB 1ADQH 4E5MA 4TM9A 4GYJA 1ZV2A 3WLAA 4YPFA 6REQA 2FQ1A 3U0VA 1PAZA 3JASA 1WFNA 5TVGA 4ZRGA 1TTPB 2HIGA 4C07A 4KVFA 2WXHA 2EDWA 4HAWA 2HF2A 1T5KA 4I5FA 4MUFA 2Y5QA 5AM0A 2UYLA 3DX0A 3CEAA 2OTWB 2WWNA 4Q4JA 3UN1A 3LXMA 1JCVA 3P1JA 1NMEA 2C8KA 3P4NB 5EC8A 3R4CA 4Z7IA 4L05A 2XHEA 5FOSA 3S8FB 2ZYTX 4YXFA 4EG0A 2LV8A 5EN4A 3TBTB 5HR5A 1P5FA 5IF0B 4MGHA 4J4TA 2YC1B 4NBWA 4I48A 4RTPA 3AI7A 1BEYL 1MHHB 3RC1A 3C24A 1CRZA 4N54A 1WZ1H 4CAGA 4XVUA 4JG9A 2HK7A 5B36A 2QLJA 4EW1A 3NSYA 1Q57A 4IOIB 3QFCA 1T0IA 4EOGA 4D45A 1WZEA 2EDMA 1ILWA 1NCAH 4WTXA 1QHEA 4BFVA 4RZSA 4FMFA 5IT4A 4ZVQA 1P2FA 2I9TA 1LD3A 5EMMA 3H3PH 3HZHA 6YASA 3MDJA 7REQA 5KDDA 4LCIL 4MZDA 3L0PA 2ODIA 2EC5A 3K9FC 4WCVA 1O6ZA 2XMDA 3EXFA 4L4XA 5T6MA 1WCXA 4AVIA 2BFFB 3ZD7A 1SZDA 4AW7A 1UAAA 2I9PA 1BWSA 4ZDIA 1JALA 4QL3A 2EYSB 1G84A 3WRXA 4DREA 4B9YA 4N2IA 4TQHA 3KPPA 3VFOB 3LKOB 4WFQA 3VKVA 1A0QH 4RAVB 5CPBA 1AC5A 1IZZA 4ROTA 4PRHB 1XZDA 2NY4C 3JYOA 3NJIA 4YVNA 1LFDB 3LIZA 4BZWA 1L3NA 2Q76A 4HPOH 1YA6A 5D1ZI 3E1GA 2Y23A 4GSUA 4ESVA 2YHIA 4NUPA 1AI1H 1QORA 4FQLH 3UHAA 3KYDB 2C1XA 4AMGA 3EDJA 3ASWA 4XTCS 5BYKA 1S8NA 1Q15A 1QI5A 1U8PA 4JSYA 4H1UA 2KBEA 1E2WA 2QT0A 4FCVA 1IOWA 2CMDA 4G8CA 3I6KA 3A4VA 2VNAA 4N9GB 1CPYA 4YXKH 2OM2A 1V7ML 1V55B 1UJ3C 3KB1A 4EMZA 2P4QA 1FDWA 521PA 2IWKA 4OF7A 3IE4A 4NNPL 5EWIL 4U1JB 1TEFA 4ZYUA 4XP1H 5BRZE 3D7RA 2Y8EA 1F4HA 3I32A 2WLLB 4Q9KA 3A6ZA 1M2OA 2XPZA 2YFKA 4RSHA 1XPOA 4QPJC 2QMJA 4W7SA 3HZMA 4F9PA 3BBLA 1XVSA 3EHDA 3HUJF 1H2FA 4F5YA 1SOVA 2J5LB 2MHCA 1CR0A 1L9XA 1MGPA 2D3TA 1KYFA 5ILTL 4CKBA 5JU6A 1PGNA 4ZD3H 1QKZL 1CGVA 4K9SA 1D5IL 2E4WA 3P4MB 1QRNA 2G9RA 4HAYA 5BN3B 2CMRL 5ALEA 5FUZL 2H1VA 1UWKA 4XP6H 4JFAA 2R2HB 4FFZA 2AFHE 3LT4A 4PVBA 2FYTA 4LLAA 5DBHX 2GM4A 2Y1ZA 3BTUA 2ZETA 1ORHA 5E2VL 3H4TA 4JJ5A 3QQPA 1MO4A 1P91A 2WWOA 1X7QB 3TD6A 4Y2DB 4ER0A 1LO3H 5I5RA 1FQOA 2QGCA 1ZINA 1AQYA 3OJFA 3O6LL 1DSSG 4E46A 3DX9A 3V42A 3ZGVA 4DKJA 1UA3A 2RAUA 3ZLQC 4RTKA 3LQZB 3OFSA 2X4SA 4IIXA 1QMGA 4OQFA 5TFSH 3ZSSA 1FBTA 8FABA 3PQDA 1C0PA 1DLFH 3KGTA 4AGQA 4DANA 3N53A 1TU4A 2ESRA 3WYBA 1PR9A 1S6NA 5EB9A 4AO8A 4N6GA 5FUVA 1CLZH 1KRWA 3VXME 1WW2A 1O96B 4N0RA 1W72H 4CU8A 3GP8A 2CNWA 1TTTA 4DT1B 5L51A 1NGZB 3UC0L 1O8BA 3ONNA 4KQMA 3EYFB 1XK6A 2DM2A 3TPFA 2AD5A 2B39A 3GJFA 4NYJR 4B32A 5ERWB 3UT5A 5T33L 2AEWA 4Y0GA 3GIZL 2XTJD 1YASA 4ACPA 5IKCB 4TL4A 1VCNA 1YEDB 1TTGA 5D7IF 4JRYD 2V4MA 4RC9A 1XMSA 1TXKA 4QDZA 3RVKA 3TN7A 1FJ1A 1K5NA 2Q0XA 2O93L 5HI4D 1MRDL 1ZS2A 4CCSA 3I2CL 1ZWIA 3R3YA 1NI3A 3FOLB 4HNSA 3DEAA 3RWDA 3WELA 2Z65C 5C1OA 4IXWA 3L8EA 4HWEL 5DB4A 4YMHA 3VOTA 5EZPA 2FT7A 4GB9A 1GY2A 1W34A 4COKA 3T34A 3CFJA 4POYA 2EJUA 1N6QL 1R8QA 4M1CC 3GFBA 3ARGD 2XSZD 3LUKA 5EIBD 3EZ8A 3G9TA 1D2PA 3CX6A 3D85D 4OBXA 1Z16A 1MCFA 2ZJ7A 5L40A 2XWZA 4N85A 4N2MA 5CHNA 4CLDA 5HOQA 4IRMA 5AH0A 3NJKA 4DC9A 5DOZA 5H3LA 3NTLA 5L3QB 2QTMA 1CTMA 3ZXXA 5DEFA 1JL8A 2DKFA 5ECYA 1S9DA 1QUFA 3KLHD 4NJAL 4OGKA 1ZUD1 3UTPD 3GLGB 5KEIA 2ZSVB 4YCCA 4XMKH 3FBTA 2EFGA 1YV9A 3IKTA 2WINA 1KAOA 4B6EA 4QKQA 1VIYA 4Y2DA 1W6LA 4BKSC 4KRLB 4G8GA 3ZTJH 3GIVB 3VFTA 4B9AA 2E55A 3ZHCA 2WTOA 3RPEA 5CVUA 4GI6A 4IDOA 4EG1A 1YPZA 3OICA 1IE3A 4PONA 4FI3F 1H2YA 4OBBA 2XE4A 4E9LA 3I2CH 1EHCA 5DRNB 2J8UB 4LE1A 4A5SA 4KNVA 2W2TA 2MSPA 1DCFA 1BA3A 1CLYL 2XTAA 1RZJH 3KL4A 3PHSA 2HIMA 4KOAA 1O95D 3WK4A 1KJ2B 3V46A 3TCXB 4MWSA 2ZTHA 2E8ZA 3REQA 4UI2A 1AY1L 5B3NA 3B1KA 1HZJA 3QI9B 4MMXA 2GN9A 3OZGA 2R7LA 3SQOH 1J10A 4Z7JA 5FWNA 3EA4A 4AGNA 1FYHB 5C35A 2YNMD 2OAAA 1DO2A 1QHGA 1KZ4A 3S5LB 4XRCB 4AITA 1NWPA 4ZREA 4MYRA 4Q6IC 5K9KA 4NRZA 1FRZA 1VFPA 3P9ZA 2APTA 4E4YA 4PGDA 3P2DA 2R7MA 4IJ6A 3QWHA 5AYQA 3TVMD 3N8DA 3MLUL 4PAGA 5FCUL 4MV6A 2ODBA 3CHSA 3EYQD 3IOYA 3DZCA 1YQTA 2B4CC 5COQA 3DNPA 1ZSNA 5EOVA 1HKUA 3U3KA 4CMIB 3FH0A 3F74A 4EDXA 1ZESA 4LL9A 2OOKA 1N8ZB 4DADA 4S10A 1UXOA 4M7KH 4KDEA 4DKTA 1S2EA 1F11B 3VRLF 5D1XA 2QLMA 2RHGB 2VR7A 5ADHA 4XX1G 3G1UA 2PYEA 2YQ2A 3AH8A 1C2YA 3LG2A 4YSOA 2NU7B 1U8QB 2HG5A 1RFLA 4YBLC 4NOFA 2VUIB 4WWOA 2QYOA 1IBGL 2GLTA 1J9TA 2WM3A 2H0PA 5IVZB 4DM4A 1LO0H 5MI0B 1PJRA 4MD4A 1Z34A 5IBQA 3CRVA 3VJ6A 3ENKA 3GBNL 4HPOL 4GRWH 4KP7A 2K87A 2BT4A 3AKCA 5DD5L 2AOXA 2BPBA 2IV2X 3GUCA 5TQ0L 4CM1A 2YAQA 4UYPA 1BS9A 4NKIL 1HMPA 5ENZA 1AN0A 4QXWA 2H2SC 7CGTA 2NMVA 1IUZA 1PZDA 3GLIA 4PSUA 3E3QE 1QFWH 4XCEA 1LCIA 2VWEC 5KHOC 3KG5A 3L2LA 4Y2PA 1WFOA 3LY8A 4DEPB 1W75A 5C7XH 1R5WB 1WHOA 3EZ9A 2AAVA 3DI3B 2P9RA 5ETJA 3QJRB 1XAJA 4ZKDA 5H37A 4MB3A 1WZ1L 3HNSH 2HA0A 3W8EA 1DIGA 1AGCA 3G8CA 4X41A 2SKDA 4XARA 2YJLA 1E2QA 1VJ5A 3MAWA 2QUHA 4TWBA 1O6TA 4KGZA 1ETZB 4X95A 4CMEC 2X3CA 5JA8B 4C56A 1ZHHA 4KKLC 4MW6A 2VDRB 2JFGA 3FZYA 3OQ3B 2Q5FA 4I8DA 2H2GA 3SKVA 4IOMA 3GJQA 4LPSA 3VFMA 3H65A 3HLAA 1OLZA 1Y1QA 2X70A 4H6VA 2CN1A 1WBYB 4S0SD 3HPQA 3RX5A 1C5CL 3OFJA 1HEYA 1YQDA 2C3GA 2V2WB 3TQCA 2BNUA 2H11A 3PAYA 1J5HA 3O2WH 2YUWA 3G5AA 4JLWA 1B4TA 5ECWA 4AECA 1LEIA 1BF2A 1UEIA 3Q3GB 1NI4B 2HY7A 2JDID 1N59B 3UF0A 5EWLB 4RAUB 3N91A 3VNRA 4ZUUA 2AJZB 3UP1A 2PBFA 4HWRA 5CM2Z 1KJ2H 4LIQL 4W6YB 2MTPA 3SCMD 4PRDA 1OGAB 3KTOA 8ABPA 4KPEC 4QGYA 5DEGA 2ZSWA 5DJ0B 5EU6A 2NZ8A 4S1QH 2VDOB 2YPKB 2FWRA 1BXUA 2BJMH 4RADA 5H59A 1G1MA 1DVZA 1P4BL 3V7FA 2CRZA 2AANA 5D01A 3LQKA 4HS6A 1OWLA 2NZ2A 1GS6X 2TSYB 2V7BA 4WK2B 1RQXA 1VMAA 4KDTA 2DQTH 1BGVA 2Q2EB 1FN4B 3IP7A 2WWGA 4QRSA 4O59O 2HTKD 5E8NA 3KOUA 4ODSL 4YXKL 4UNPA 1ISMA 4HFUL 1NDHA 1BC5A 1R3IH 5KYKA 1U99A 2YHUA 2CXKA 4NATA 4BH8B 4F80A 4FZEL 2ACKA 3TRIA 1TETH 5AESA 4ALMA 3P77A 3FQXA 3QGMA 4AT6B 2VQ6A 2WM8A 3VC2A 3EO1A 3KQVA 2R8OA 5D5MA 1KVSA 2A9PA 4CIBA 3I2FA 1FHGA 2YINC 3WMRA 1K7YA 2RBEA 3ZXAC 5CFAA 4RLFA 4OI8A 2A5JA 3DIVA 3IWUA 2X13A 3N6VA 1OLSB 2YHBA 2VKXA 5CCKL 1T5TA 1O7SA 4E13A 3P1VA 3CC5A 3PGXA 1YECH 3CXUA 1CT8B 1S96A 1J0EA 4WCFC 2G0AA 4AC9A 4URFA 1LTKA 2X4QA 3WGGA 3QTBA 2MU1A 4D4GA 3S3CB 4FLFA 5IG2A 5C4IA 3GG9A 1J33A 1X19A 4OB5L 4JI1B 2NQCA 4R9VA 2IH9A 1G98A 3BCUA 1Y6GA 1AY1H 3AEQB 1KSGA 2XZTA 4OZIB 4AZ3A 4IBOA 4Z54A 1X7ZB 4U7PB 1WV7T 4Q9CA 3QXTA 2AOVA 1G7MA 2PWHA 2P40A 1UZGA 1JGVL 2YYYA 3JD0A 2CLZB 1ILSA 2EFEB 1N5YL 3F7QA 5IAJA 4URXR 1A95A 4KK6C 3CG8A 1VGEL 1F6AA 4UHJA 3KB6A 2C2WA 4TZKA 3LZOA 2IOMA 3RK0A 1UGNA 2WJ3A 4C88A 1QYWA 4W5QA 1FTWA 2GJ6B 4BFNA 1RD6A 3H7BB 5IEHA 4XIFA 3U9SA 2PTHA 1WZUA 2FN3A 3GARA 1E4OA 4C2BA 2J73A 3H13A 4PFKA 3HUJB 1HL4A 4IDLA 4KUCD 4G3YH 4QOJA 1D8AA 5C0EB 2GF2A 2G5RA 2KH2B 3BRQA 2EO9A 1BFDA 3Q9NA 3ABLB 1IB0A 4I5DA 2H7VA 4C6HA 1OKKA 2OA9A 4OZFA 3K2UL 3OKLA 1JB1A 2I2AA 3Q9PA 3R44A 4P07A 1NEPA 4XNQA 2UYGA 2E7HA 4E7PA 3KPRA 4MXVF 1NSNH 2YSSB 3L6BA 1G8HA 2HPVA 3CLUC 4GW1A 1M2GA 3BGDA 3JVEA 4F3FB 1FSSA 1HZHH 3HKCA 4IKNA 3I28A 4F96A 1CLYH 1IG3A 3SDSA 3NRFA 2SCUA 4QC2A 3BMOB 1Y1TA 1Z68A 3IVGA 3KKPA 2ZIUB 1PN3A 1N8TA 2DLCX 2CYAA 3IC5A 4B75A 3QJXA 3SR0A 2D62A 3DNKA 2BNQE 2V33A 4Z53A 1L1FA 1UMBB 1EXUB 4TTTS 5ETUB 5IT0A 1QYDA 1TTBA 3MLRH 1KBOA 4D8WA 4XWYA 4MJHA 1ZIDA 1S7QB 4F15B 4ATNA 4ZYKB 2LTQC 1WH0A 4FFYA 2XVYA 5I73C 3HQ4O 4EUNA 4D9KA 3UWPA 2BBSA 2D0FA 1D03A 2PMEA 4V03A 3BFKA 4WHTB 3AW9A 3STWA 1JPTH 2WQXA 3WZMA 3WLIA 1RHQA 2EWMA 2F7IA 2N7AA 3AVTA 1BHJA 3H42L 1DQTA 4H2DA 4XO8A 4C89A 3EWAA 4BEJA 3B5GA 4HUWB 3MJDA 1LTHR 2J57A 1AKRA 4O25A 4B87A 1WGOA 4TROA 3UAWA 5J9PA 3V4OA 2XRYA 1LVEA 2OXGA 4S35A 3HNVH 4YPJA 4KX7A 2IY8A 3E8XA 1CD1A 1GG5A 3W0LB 1B0RA 4A6DA 4Y5VC 1CE1L 1NLDH 1TLKA 4YHKH 1CL7I 4EL0A 4YCNA 1H3GA 4FB5A 4Z7UB 5AW2A 2WFMA 3QPAA 2UXTA 3CIFA 1HDMB 3RR2A 3COPA 1MVNA 4JRXE 4XZUB 2QKYA 4GZMA 1SJVA 3RVOA 3MLRL 4F6LA 2D3NA 4DWWA 4HQOA 1P4UA 3RH0A 3HM9A 4RTQA 2HU2A 1N6KA 1TMYA 3KLBA 4WMLA 4FZVA 3C60D 1HNWB 3TZCA 3THSA 5G4MA 3ZIAD 4L1SA 3TEUA 1D9KC 3QMVA 3A1WA 2YVLA 1KQGA 1MQKL 2E56A 1C30A 2Z8RA 4OKNA 4Y2UA 2QN7A 5FYJD 5GGUB 4AZVA 4ETQA 5I1CH 1QFXA 4ZRNA 4WTQA 2GJ6A 3LNFA 3ISTA 1XZIA 4RPKA 4FGSA 5E3IA 4MVJD 5C3IA 2O5XL 3KYIB 3LI2A 5EHXA 3QPBA 2F0CA 4W9LC 4IDQA 4NRZB 3LYUA 3LFTA 5TEVA 1OFVA 3VHRA 2HJWA 2VOTA 1A6PA 3E70C 4XHJC 4YCJA 2PUTA 4LDLB 5CA0A 4QJIA 3ABMB 3DURA 3CSDA 1KSJA 3IRUA 3R0XA 4YFDB 1M0WA 2C4HA 2J44A 4PPTA 1JPFB 2FDCA 1QYXA 4HUMB 4URTB 3CNHA 5JXIA 1FQKA 3GKWH 3QBTB 2B25A 3R0JA 1YZNA 1IAQA 1C9JA 3ZT5A 1NM4A 1DKUA 1NBMA 4NO0A 3CNOA 5FLXA 2AV7B 2CEKA 3OM8A 3DV4B 1EAPA 4DG5A 2WUWE 4TT3A 3QENA 4J3OF 4PFJA 3SZOA 4GQ9H 5I1KH 4MWOA 3IV6A 3VU0A 5FM5M 4HDNA 1YWGO 1GU1A 4HH4A 2UWEA 5DVKA 1U8JA 2W07B 4B3VA 1UCFA 4HJGB 4YGXB 4K23L 1XX9C 4TV8F 5HYEA 3PWSA 1OD6A 1U92B 4OMDA 3P4LA 2NO4A 1ES0B 1SUCA 5A4IS 2DI8A 3BD4A 2QGDA 3V7YA 1J1IA 4QQFA 4NBLA 1QP4A 5D2NB 3BLBA 3DGEC 3FTEA 1XNQB 3FONB 1KC5L 3B1VA 1YC2A 2YWFA 2Q6KA 1ID1A 4U0KA 1NQXA 3S35X 1QOKA 2PG3A 2DTSA 1RYDA 3DPIA 1YR2A 1U8ZA 3FO2B 3UA4A 3QH3B 5DTJA 3UPRA 1L7NA 2J1YA 4ZDJA 1RZJL 1EGVB 2JKNA 2Z1MA 4BBZA 2JGEA 1O97C 2R6FA 3OBAA 1PDOA 2W2NA 2RH9B 2EFDB 5CFRA 4YRDA 3OXSB 4FOMA 4TNVK 2B5VA 4MVJH 5FRDA 4CVNA 3VXOA 1H3XA 3W1VA 2V5YA 2DY1A 4UOQA 3SOZA 4M62H 4RF3A 1XMEB 2WOJA 5ALZA 4P5RA 3PNMA 5A16B 2I3GA 4MWTA 3ZU4A 3CU1A 3FTQA 2WXPA 4E42B 4NJ9L 2DD8H 3VKFA 4BO6A 3ATFA 3KPNA 4G6JL 1Q1BA 2F1HA 3OY2A 1WZNA 4KL8S 3NRJA 1GC1L 5BV7A 3RWDB 1P9MC 3O21A 4NGHL 4RULA 3IH5A 4BU1A 4PN3A 1RK0B 2F1AA 3BXEA 5KS9E 2AVGA 4KXVA 1TF5A 1MPTA 1JU3A 3DUWA 4WACA 2DQ6A 1LKZA 1IM3B 1G7TA 2G36A 3TLGA 3S55A 5AZ2L 1TAHA 2AABL 1FFXB 1AT1A 3X17A 1OZTG 2PUDA 3SYKA 3G8BA 5CO1A 4YCMA 2OL3L 2X1OA 1QNZL 1KR5A 1RYNA 3T94A 1WUYA 2X9YA 1P5RA 4LCCC 1N8OE 4QELA 10MHA 1QBML 3M4XA 5SWSB 1X74A 1OM3L 1KY6A 3QEQB 2YGQA 1SOAA 4D3DA 3B78A 4U3SA 4O8ZA 2E4AA 4ZAKC 1QGED 1EK3A 3SDXF 5JR3A 4IH4A 1SFRA 3HY4A 5LO7A 3N44F 1QP8A 2NYUA 2V96A 1A7KA 2ZOOA 3QEHA 5D8JL 4N7BA 3HBNA 2GYSA 2BC4B 1XF2B 1U6AL 1T0MB 3CFNA 1VOTA 1DLIA 4WPGA 4HVAA 1SVWA 2JD0A 2R79A 1YGPA 4KX8A 3OO0A 1YAIA 2DPGA 5IK3A 1GTG1 2ZTMA 5A62A 2QX9A 4POZC 3GLIB 5EIIA 1W0WA 2P5YA 3REGA 5REQB 1XO1A 3JD4A 3ZV6A 4MCIA 3VKGA 1MOQA 2M6LA 2ZZMA 5AOKA 3Q8BA 3X3GH 3ZN6A 2EHJA 3FH7A 5TE4L 3WB2A 1MN4A 1G9NH 1Y6MR 3D2CA 2P8JA 1DE4B 3HHRB 5DK3A 1C29B 1FFRA 1ECCA 2QVKA 4U63A 4IM7A 1YB7A 1TJ3A 5IMKA 1OY1A 3UGQA 2QMZA 1H1DA 3IEVA 1P8AA 3EMBA 3H9JA 2Y9MB 1KXZA 5FW8A 1LI7A 1HNFA 1CU4L 2G71A 4DMUB 2ZWOA 3VXMA 2HAZA 2R0ZH 4C0QC 2X2FA 2PZJA 1N3NA 5KSZA 2EEXA 4Z77B 2FPIA 2PJRA 3P0IA 4PBRA 3LPNA 4R2LA 1BM7A 2QRHA 3SO5A 4BU0A 1VIVA 3TL6A 1EJOL 1W88A 2VSCA 2OCKA 1JPEA 4AE1A 5IFHL 1KPUB 1ZSVA 1BDYA 4DARA 4PLZA 4U3XA 2FETA 2ZX7A 2EH7H 3WNMA 1YJDC 3DL0A 4GNRA 1SRDA 4OJYA 3R9WA 3GLUA 1AS7A 1JLRA 3F3YA 5FUMA 2FQFA 4WOKA 5BS0A 3GVIA 3PHAA 4X24A 1CNEA 1I1AA 3UBGA 1QAQA 3HB3D 4QJBA 5IQ7H 3B3BA 3CX5K 2H06A 1YY8B 5KSWB 4HC1A 4PRZA 4LYHA 4KXXA 3MLTB 3KSMA 1DMRA 1FZMA 3KLKA 3COYA 1TQBB 4RD3A 5J2TA 3Q8XB 5H83A 3H99A 1K4YA 1BG6A 1KB5A 2LQRA 5GAJA 3V4VL 2FRVA 1A47A 3HCEA 3RAJA 3TS1A 1PNTA 2VCEA 3LN5A 3UIYA 3N5KA 3PXCX 2EDYA 4FYTA 5JPIA 3TMYA 3MFQA 3R5HA 4NQXB 3DTDA 3SPVA 2H1IA 1U8IB 3FHJA 1N5MA 1T1EA 3NDRA 1L9RA 2LD4A 3G6KA 3ADPA 2HLFD 4P99A 2EX4A 2FPKA 3OFNA 4K8RL 1QJCA 1VKHA 1II9A 2ZITA 4LSTL 1FW8A 2R1TB 3AROA 3DX7A 5EBWB 1I7TB 5DFVC 2QVZX 2HTLC 5E7IA 3ED5A 2B5IB 3RDPA 1V5GA 1NJ9A 2VTVA 3GBPA 4LKRA 3J81A 5DTIA 2GAOA 1F4YH 5LP6C 5ULLA 3D6HA 1U0RA 5B3LA 1XK7A 3TB4A 3IAS1 2J7PD 2CK3D 4CUKA 2O8BA 2N01B 4M8QB 1ORSB 4AYEC 3DHYA 2EC9U 1IMHC 1BQ5A 1X1TA 4EY8A 1E3DA 4CI9A 1BDIA 3WFJA 3DUFB 1EFXD 2VNJA 1CJCA 1Z5ZA 2F54A 3FOFC 2FRDC 4MUGA 1OB5A 2EDBA 2QDKA 5LNK6 4JRXD 3UNXA 3NZSA 4HAGA 3GTTA 4U2YA 3IUSA 3GDGA 1NU8A 3K6OA 2QRKA 2GKGA 2HD4A 5J6HA