5HDBB

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5hdbB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5hdbB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5hdbB03
1JEYA 1MQ8B 2VDKB 4MMZA 3K72A 1SHYB 1DZIA 3EGXA 1UEXC 2I6SA 3EFOA 3ZQKA 2ICAA 3ZDZB 1MQAA 4NEHB 2VDOB 4Z7QB 3AFCA 1IJBA 4HQNA 3OKWA 1RRKA 3ZE0B 5BV8A 1T6BY 2WINI 3FCSA 3EOAI 1LFAA 5KYUB 4C2BA 2VDLB 1OLZA 4G1MB 4HQFA 2IUEA 4WK4B 4IHKA 3K6SA 2VDQB 1PT6A 2UZYB 3AL8B 3HXOA 3TCXB 2NUTB 1JEQB 2ADFA 3EG9B 3AL8A 4UM9D 1JLMA 3T3PB 1M2OA 1QCYA 2O7NA 3BQMB 4M76B 1MJNA 3K71B 3ZDYB 3EG9A 4WK0B 4WK2B 1MHPA 4O02B 5ES4B 4UM9B 1BHQ1 3K71A 2ODQA 4MMYB 1FNSA 5E6RB 3T3MB 3F74A 3ZE2B 1ZONA 5HJ2A 4CN9A 4GZ8A 4IGIA 3GXBA 4O02A 5E6UB 3OL2B 1DGQA 4MMYA 4Z7OB 5E6RA 3TVYA 1QC5B 3BQNB 3FCUB 1IDN1 1U0NA 3NIDB 3OL2A 2I6QA 3Q3GE 5E6UA 4FWWA 5KYXB 1XDGA 2VC2B 1QC5A 5KYUA 1TYEB 4BJ3A 4G1MA 1AUQA 1NA5A 4HQKA 3NIGB 2VDPB 4C29A 2NUPB 4FX5A 4PN7A 2XWBF 1T0PA 4XW2A 1YUKA 1RD4A 1N9ZA 4JX0A 4MMXB 2NUTA 1JEQA 3E2MA 4A0QA 4DMUB 2NUPA 5KYYB 3ZE1B 1ATZA 3PPYA 2NVOA 3N2NA 1YVPA 5HGJA 4MMXA 3PPXA 2B2XA 1M2VB 1MQ9A 1ZOOA 5KYYA 3TW0A 1N3YA 2M32A 2WW8A 3EOBI 3BN3A 4K3JB 1M10A 1PD0A 2X5NA 4HQOA 3EH1A 5E6SB 1M2VA 4WJKB 3NIFB 1YVRA 4CNBA 4WFQA 1SQ0A 5KYNA 2XWJI 4F1KA 5LN1A 5HDBB 1OAKA 5E6SA 5KYWB 1JEYB 4G1EB 3K72B 1MF7A 3EGDB 3IBSA 4HQLA 1U8CB 3V4PB 4Z7NB 1SSLA 1Q0PA 5KYXA 1M1XB 3HXQA 2P26A 4O3TB 5KYWA 4G1EA 1PCXA 3FCSB 2VDNB 1AO3A 3EGDA 4CN8A 4C2AA 1U8CA 1M1XA 3RAGA 4F1JA 3M6FA 4JDUA 3V4VB 3F78A 3K6SB 2P28A 3IJEB 1RS0A 1SHTX 4IXDA 3VI3B 1ZOPA 3PPVA 3HI6A 2QTVA 2VDRB 3NVQA 4O3UB 3IJEA 1V7PC 3TXAA 4UM8B 1AOXA 1JV2B 1XDDA 3QA3E 2VDMB 1L5GB 3ZDXB 4NENB 3AL9A 1PD1A 2I91A 1RTKA 1IJKA 1CK4A 1XUOA 1SHUX 2ODPA 1BHO1 1M1UA 2XGGA 3VI4B 1IDOA 1JV2A 4MMZB 3EFOB 3EH2A 3EGXB 1L5GA 1U0OC 4NENA 3OKYB 1FE8A 3PPWA 1CQPA
chains in the Genus database with same CATH superfamily
4Q4LA 5GV7A 1FP5A 1NG1A 3UGEA 3BZEB 5GOTA 1ASQA 3I3EA 4NFHA 4MJIB 5H59A 3UWDA 6AT1A 1MH5B 1MHCB 3DSFH 3IRVA 4BNVA 2A99A 4D0BB 3TIXB 3HZMB 3WHLA 3KQMA 5B12A 4OSUH 4ERNA 2R9VA 3GDWA 2Y36L 4XUEA 4AAYA 2H18A 5DX1A 5C4MA 3MNVA 4IS6B 2X42A 5M7EA 5E6RB 1J11A 3VDQA 3DGEC 3JASB 4FS8A 3S0JA 3ITNA 1IRXA 4AEIL 4WGKA 4X24A 1KYDA 4ZZ1A 3OJDA 3KPSB 1EHKB 3HWSA 3B7GA 4Z7WF 5IHZB 2TSBA 3MW8A 1TU3A 1KLFB 4AH2B 1TVKB 1KTLA 4QCIB 2XUDA 1X5HA 5KZCD 4JLSA 1Y34E 4IJMA 5EV7A 2HJLA 4OV6F 2A74A 4QUHA 3WK9A 3T09A 4TTTS 1S2DA 4L4VB 4N0RA 2VPZA 4J7RA 3VR5H 1OB5A 3S70A 5I7AA 2XHEA 3BVUA 3WEXA 1E42A 2VSQA 5D1XA 3A1FA 3FQNB 5HIMA 2H6OA 3D0RA 1FCJA 5A9RA 4ZYWA 1I8KA 3L0IB 4QXWA 2J6EH 3KETA 3PPVA 2IDCA 2WAQA 1TM3E 3GFFA 3P1JA 2PQ6A 3OZCA 1HR0B 3GGOA 3ND8A 1EZUA 4NX0A 3ENQA 4NYLA 3TEMA 1UATA 1KQOA 3I6BA 5T5FL 5B1BB 3VE0A 3JV6A 4B7CA 3W9DB 5I7EA 3NPSB 3SPGA 4PHTA 3H5VA 4XZ4A 3IV7A 1LNUB 3H7AA 1DRVA 5KBKA 1CR4A 2XUKA 1XMSA 4MZRA 3Q98A 2MIIA 3T7CA 2ZS7A 4FKHA 4U1SA 1S6NA 2J73A 4YDIL 1QG0A 2A88A 2QZPA 5KJEA 4EB0A 1IOLA 1OIXA 1T91A 3MLRL 1ES9A 3WGQA 2XIJA 3VXME 3L7AA 5HMLA 2BOVA 4YXKH 4PI0A 1D5ZA 4LTDA 4ITVA 3VOSA 4MJ2A 4GZ8A 1MAUA 2ZSJA 4XNYH 4Y4HB 4LBVA 3U30C 1JFSA 3F3MA 3CX7A 4Q14A 4M6WA 1SGKA 4IRJC 4R8KA 2DD8H 4RZHA 4AVKA 1NQBA 3GL9A 2Y2TA 4N6GA 4FA7B 2N3JA 2CXRA 3HUUA 3TVMD 4ELME 2OD2A 2VLRE 1CJVC 5DUBA 4L2LA 5JPNA 1UWVA 3BMVA 1KIQA 2JH9A 2P0EA 3TD9A 1CIDA 3KXLA 1CFQA 1GGUA 3OC6A 3QQ5A 4KYUA 2PR2A 1Q84A 2Y77A 1KO1A 2A6DA 1VI5A 2DWYA 5EERA 2ZI7A 1VMIA 2IHYA 4OR1A 2HMAA 4HN4B 1ESNA 4G6FD 4QASA 3VU3A 2PGAA 1FA9A 1OK0A 3HDYA 2QT9A 2JFYA 4MKTA 1CFJA 2EKBA 1J9EA 2CXSA 1GG8A 1WULS 2Y1KA 4Y18A 4LASH 5CP7A 4J1QA 4QRRD 4KMMA 2XBTA 4J0FA 1ZINA 3MJ9A 4X9GA 1N5IA 4PJ5D 2G1JA 3ZCSA 4KIUA 3HMXH 3VH1A 3KJQA 5KYTA 4CR6A 4AY5A 1QOKA 3MLWL 5EF1A 4I50B 3Q1SL 3ZTTA 3QUXA 3B8SA 4ZSOA 2FJHB 2NY6B 3IHLA 4LGVA 3HQ4O 2WYIA 2DBZA 3PNLA 1YLBB 1COWA 3LKQB 3CVIL 4RYLA 4LYEA 3QFDB 3IETA 1XO8A 1EVJA 1MFEL 4FMDF 5AOJA 4WK2B 3KT8A 3V5DA 2P67A 3LQ1A 2IV2X 1XEXA 4DJTA 1ONQA 1TGVA 2EINB 4GG8B 4V1DE 1Z07A 5FNVB 2RQEA 3ORFA 4S35A 5DHTA 4NQVA 2XWSA 4FIDA 2XKAA 5ANMB 5IW1B 1PVOA 4LDQA 5DJ8A 1OGAE 1YD7A 1KFAH 3HPJB 1MC8A 4OZHF 3DOCA 1C14A 3PWPA 1GGHA 5JW5B 4B3HA 4HSQA 2Y06L 4J27A 2X2EA 3VXUA 2AQKA 3CLUD 5CLXA 3R7BA 3N6YA 3ASWA 1KB5B 4YSDA 3PDGA 3MLZH 4JZKA 2JVUA 1N4DA 4KQKA 5IF0B 1U2CA 1WU8A 4GUDA 3I76A 2QV7A 4DWVA 1JPFB 4ZNEA 1U1GA 3NH7H 1TPZA 2ADIB 2M6LA 1XQ9A 2XBZA 2BM3A 2B1RA 3VUAA 2HKAA 5LWYL 3GZJA 1TTRA 4PWEA 3RY4A 3ZOAA 4R6XA 5HPMB 2HMVA 3ZIAD 2XI9A 2R0ZL 4MRCA 2VBCA 3S7GA 3TM5A 3LSTA 5IKMA 4W9JC 2X9WA 4FW8A 4GI9A 2GN6A 3E4DA 3SY0A 1ZI8A 4X6LA 1P9MA 1J7VR 1ILWA 1ZVQA 2K87A 5E4JA 4R1QA 1ZIPA 4WV1A 5FECA 1NMQA 2QTCA 5TDNA 3OLIA 1FFXA 3AONB 5BW8A 4XX5A 1JNHA 1KVQA 1PWXA 1VSQA 4EKGA 4PGDB 5FXCH 1KDYA 4TN1A 1GY1A 3BORA 5E95B 1KYZA 2QL7A 3U4KA 3UOAB 5HI4D 4BB9A 2J0UA 2YN4A 1AGDB 3CMOL 3GPCA 4PYJA 4OGWA 3A47A 3KT0A 4HLEA 3QCVH 5AZUA 1Y5LA 2WOOA 2BI8A 5ED0A 2AV7B 4ODXB 4AWBA 4ALAL 1QF9A 2VDJA 3OM9A 2HFEA 2J1ZA 1HE2A 3K2BA 3PEYA 4XXDB 2ZWYA 1MGOA 2G36A 3FH7A 3P27A 4DCCA 1IC7H 3JV4B 1ITCA 1P6XA 4ZQFA 2CB0A 5THXA 1SULA 2V9RA 1D8TA 3MD9A 1V43A 3KLDA 5WRFA 3VPFA 4MYWB 1V0JA 4DT1B 3L3IB 3ZQWA 1MHTA 3KGUA 2ARJB 3HFJA 1A3ZA 3OJFA 3NIGF 1U92B 2FXIA 3M88A 4JREC 3IT0A 2GETA 4A39A 2UYHA 4B45A 2PWYA 3MT8A 4MO9A 3O6FD 5IB4A 4M6ML 3UIZA 3N0XA 1RMFL 3V42A 4TLMB 5AVQA 2QMKA 3R40A 2J88H 3EWIA 1NMEA 1TSRA 2BNRB 3CXHK 3DDHA 4WSJA 2GYVA 3UABA 2FQ1A 1MB0A 4N82A 4FZEL 2JFNA 5G3ZA 2IODA 2F9FA 5IDVA 3M5CA 3FVRA 4M9SA 3ER8A 2E86A 2VHYA 2IUEA 1VHJA 1UFUA 3FB8A 3V7NA 3KEDA 4LRUA 3UP6A 3A0UA 2YMLA 5KTEL 1KEGH 3N40F 1KGJA 2YWHA 1G1CA 3E18A 3RIAK 3W8RA 3BEOA 8ADHA 5U4QA 1E5BA 1L4UA 1UD6A 2H4XA 3DH0A 1YEDA 3LH9A 5B53A 4NKMA 5ITVA 5FYKU 1LPNA 3LXCA 1NCDL 3EZ2A 3TQQA 2D7NA 3N0RA 4D4KA 2QP3A 2XQKA 4DCTA 1WVZA 1Z45A 4GBED 1KXVC 5EN2A 3TSAA 4B1FA 3I5MA 2GABA 5DIZA 4UTAH 1RU9H 1E1CA 1WUNT 3EZ9A 1MB4A 2B1OA 1KAGA 2X5NA 4OUOA 3PD7A 4ZW6A 4HS6A 2ZUCA 1UT8A 4P2AA 3QVLA 3F85A 4O2BB 3JQGA 4EBQL 6PCYA 2D2OA 4EFMA 1XF4A 2RGRA 4IRUB 5LBIA 4CKEA 1RRCA 4S0XA 1X87A 4KQFA 1SY6A 4E41D 1OV8A 3HJRA 3FMGA 5ALEA 1IC4L 3PJLA 2GMWA 4KU4A 3KPYA 1NLBH 3RPEA 2QTVA 4RJTA 4IFEA 1S7CA 3WXVL 4M9ZA 2QTGA 3TSYA 3JAKB 2VATA 2PZKA 4TULL 3DZFA 2ZAIA 1YBVA 2VHUA 1CUBA 4JO8A 4DQAA 4HXEB 2OXHA 2EHDA 3K6FA 3IQIX 4AL8L 3KPWA 1NJ1A 1Z5YD 5KS2A 1WW2A 1UVQA 5CW1A 1R8JA 3RW9A 3QUSA 5B36A 3RIHA 1GILA 2YJ3A 4MXQD 1JDNA 1R64A 3FO2B 4WBNA 1FIGH 3EOTH 1S9VB 3SC3A 3MM4A 4ONHB 1U4SA 1YY8B 3T5DA 4OFPA 1A7NL 2P2GA 1OROA 4O25A 3UJIL 2NY0B 2D9QB 1E8DA 3C3YA 5D4HA 2CXHA 1IEVA 1JZDC 1XZCA 2OXIA 3PQFA 1SDDA 2EXWD 1GA6A 2NTYC 4BWTA 1SUCA 3ARGC 2I60L 3GUFA 1J5CA 2G5TA 4P5KA 1CGYA 3GUYA 1PY0A 3FCBA 1ODLA 1DPFA 4CMCA 2IPLA 4BVBA 1IOWA 5DKFA 4RANA 3C7DB 4DJJA 3GINA 1SXCA 5D9SB 2DIBA 1ZTXE 4LLUA 2VNAA 2H0PA 3A8TA 1M6NA 4PJBB 1FNGB 4JDTH 3QZBA 1Y37A 5LYJF 3EGDA 4U7DA 4QGHA 5CK5A 2N1KA 1NCHA 2WVJA 2RHMA 2V6GA 5EPOA 5SWZB 5D71L 2H1LM 2DIAA 3UJ3X 3KHOA 2H17A 3EUUA 3MYZA 1MIHA 1VE7A 3LCRA 4WHTB 3PHIA 3KXKA 5I45A 1C80A 5JXAH 3PNKA 2YQ2A 2KPNA 4PYGA 2DQCH 4CL8A 4MJ6B 1XCXA 3S2CA 3UJJL 3BQUA 3RHTA 3E3OA 3GMNB 3FBKA 3CNLA 4NFBA 5I66B 1SVUA 1XRRA 4F11A 4I0PB 2G2RB 4BVFA 1M6OB 2H0RA 3LHAA 3O4RA 1LI4A 3EUAA 5E2VL 3U9UA 2C4FU 3DZDA 2IV7A 2EDTA 2EFJA 1MLBB 2Y68A 4KRFA 5EWMB 4PRZA 2VXUL 4LRIC 3LVRE 3G9UA 4XOAA 4EIBA 1U8EA 5FLXA 3ARWA 5AOMA 2PYFA 4XPGL 3HCNA 3PA6A 4FOTA 1TFPA 4X99B 1QX4A 1IGFH 2YXWA 3F83A 3FSVA 4Z2AA 4FTVA 2C3WA 1NMSA 4NNXA 5DS1A 1EAPA 3Q1LA 5J9PA 2VYVA 1C12A 1YDPB 2JFHA 4E36A 3NSCA 3TH3T 1PYDA 1W5FA 2PMCA 3BGFB 3H4VA 4B27A 2WUCL 2EKJA 3ZW8A 43C9B 4N2FA 3D6NB 1OAJA 1E2DA 2UVFA 4ZEWA 4RDQG 3RWMB 2DLNA 3NM6B 2EX1A 3IL2A 1SVCP 1MB9A 2QUBA 1IVLA 4YONB 2O3SA 2AK4A 2O1SA 5EUBA 5E6ID 1VJSA 3P4NA 4PGEB 1XEFA 2F8IA 1MQAA 1KH2A 2VWGA 3QA3B 5IT4A 1MAAA 3M17B 5FW6A 5BW6B 3KEGA 1IZ8A 1C29B 1W5EA 2PAFA 2PUCA 1ENZA 1DQQA 4Y19E 5GZOC 4HUMB 1UFQA 1OU0A 3OJXA 3AWIA 2EDJA 3NDRA 3SDAB 4U1IA 3C60A 2BM9A 3I39X 3OHPA 5IC5A 4W6WB 4HLUA 3GG9A 3TO2B 2IAMD 4Z7OB 3LT4A 2B1HL 2C9MA 3BK7A 3TWYA 4P1ZA 3B7PA 1P1BA 4DUZB 5IOKA 3K0YA 2FZKA 5EINA 3ABLB 2A35A 3DFIA 4IRMA 4MUAA 1DLIA 4BNUA 1NYTA 4G4IA 3C6KA 4JHWH 4RESA 2AUMA 3OAZH 2E8YA 5F0PB 2DB3A 1XHLA 2BJHA 4ND4A 3F6LA 4RD2A 2Q2VA 5DGIA 2XC8A 2IVZA 1JSZA 3A6BH 1AGCB 1JZ8A 4O4LF 3VU0A 1JZ4A 4NX2A 2GHQA 4OFYA 2J31A 1LPSA 1FO0A 3UMVA 1I3RA 3MBWB 2PQ0A 5GGTA 2I0FA 2W98A 3CVHH 1L5GB 3LN5B 4NGHL 5DMIL 1YS4A 3QBVA 3NX4A 4CQLB 1C0LA 4QGGA 2Y99A 4UUAA 1IQ0A 1KI6B 4J3JA 1UEXC 4OCZA 4UOW0 2IGLA 1Z7GA 3D12B 4LPKA 1B14A 1ZGLP 2WHVA 3PCYA 1PT6A 2XTMA 4G36A 4Q0XL 5L51A 2IMNA 2Z92A 4C58B 3D3NA 2PV0A 3I52A 1MZPA 1DJWA 3REWB 3ZI0A 1AKMA 4XLZA 2Y1YA 1T3HA 4L4SA 2DJIA 1ZJ5A 4BHTA 3MAWA 5INDB 4PRIA 3A1CA 2BCKB 3RL2A 2W95A 2GY7B 3WMQA 4H1VA 4Y2OB 1VBFA 3K2IA 4DS3A 2CPUA 3C87A 3HA2A 4M5YL 3I12A 4S04A 3IUMA 1XKQA 3CO5A 3K0HA 1OSZB 1ZIDA 1Z75A 4YRFA 5DS2A 4AJIA 3PV6B 2KLRA 4F5ZA 5HQJA 1YEHH 3QM1A 4LLQB 3ICVA 2OORC 3HS3A 2BSAA 2H4HA 3TM6A 1T83A 5FWXA 4D43A 3OXSA 4XEUA 2B5IB 3HDGA 4BY9E 5IUCA 2H54A 3JD3A 3LUPA 1E2FA 2MSEB 2YVAA 3RWIA 3OKDA 2PGIA 1EVIA 1DRJA 2MEJB 2AMYA 5DNYB 1HG0A 4RZXA 4HK3J 5C34B 2ETVA 4CLRB 5CHNA 3EDMA 3T71A 2XRFA 4ZPJA 2EDKA 1JILA 2V7QA 2JFPA 2AJCA 1O6TA 3RTQC 4ZVKA 4QYAA 2E56A 3FHTA 3KAJA 1DQKA 3A67H 2IXTA 5HJ5A 5E9DA 1D6EA 3INUH 4XZUB 4TN5A 1I6MA 2J09A 4U6XB 1ZRSA 5C0BD 3I9PA 1LW6E 3FSGD 5K3DA 3AKDA 4W70A 3FB1A 1ZHNA 3I9FA 1G5HA 3TSWA 4PO8A 3IDYB 4RNDB 4RVHA 3R76A 3DVGA 3RUDA 2K4AA 1Q0HA 4KXWA 3K5PA 5CNIA 3W2HA 3DO3A 2OR3A 2X44D 4LP8A 4DMHA 1Z9PA 3LA6A 3ZX1A 4N7RA 3O3AA 4TLEA 4V03A 2ZNXA 2DX7A 4F21A 3L17A 3QNMA 4QT5A 4YN3A 1GGJA 2XPYA 4FXLA 2VJXA 1WDMA 1MCWM 5I5RA 2B98A 3BRFA 2ROYA 4M4RA 2OYRA 1ACCA 3A4IA 4JPWH 1NBYB 5IULC 4FEMA 3SOZA 5EOTB 4YRQA 1USQA 4R4BA 3VX4A 1DC8A 4TYPA 4URYR 2XMQA 5DLQC 4F2MA 1ITBB 3QHQA 2XZZA 4A6YL 1ZRHA 2LXNA 3DHWC 1TQDA 2BGUA 3ZG6A 4D9LL 1DO8A 2QSZA 2AW5A 2FJGB 1Z2PX 2FX9L 2PP7A 1W8DA 4LSSH 1HMPA 4IDNA 5C0CB 1LSUA 3P3YA 2W43A 5MFZA 3AREB 5FA6A 3K2MC 1MFDL 1JTOA 4KI0A 4UTPA 2JJUA 1WXEA 4M87A 3WHE0 1VGEL 3BKMH 4OHUA 1KV7A 4Z6AT 4J7UA 3G2HA 4RLDA 1QIMA 4G5ZH 2QNRA 4P2OB 3K92A 2LU7A 1G4MA 5CLIA 2Y7QB 2O6EA 4BH7A 3JTSB 1BCIA 3VI4B 3ZKND 5DXFA 2ZRDA 3SQBB 1KBQA 1OA1A 3A6PC 3GA5A 4NQCB 3G0CA 4P6VF 4Q1BA 2WINI 3ARBC 3HY4A 1MPAL 2CXUA 3V5HA 4LVHB 2ATVA 4QFMA 5A3SA 2AG0A 1A96A 1UPUA 13PKA 3N2KB 4IIJB 3L4KA 3VYSB 3RFTA 4Z53A 4POZC 1LK3L 4JJ5A 1M7BA 2CALA 1E2EA 4M9PA 2AOVA 1NMBL 4LX0A 4JH0A 1G9NH 3GCDA 4ALKA 4MXVE 3G9VA 4CG3A 4HX2A 2C9CA 3DTNA 1R5OA 5B4MC 3V0EA 1QSGA 2XTJD 2IHVA 1P2BA 1TYAE 3SYOA 3BAXA 3ZDFA 4UBMA 4UQ3B 1HTWA 1G9ML 2VIIA 1G7MA 2NNFA 2K9FB 1L9XA 5GJTH 3L4VA 4Q6BA 4HIJB 3CSYA 1W0YT 1Q1JH 4GXVH 3E7XA 3MV8B 1PG7X 2VYRE 1EIBA 4G80A 4ICIA 3LBIA 1PJLA 1FDIA 4CKBB 1U4OA 3LS5L 4QDGA 1ZA6B 1WW3A 1WFTA 4AKOA 1I4LD 4TMFA 4HFMA 4KQGA 5L6MB 4MR9B 5HYFA 3IMSA 3A58B 5A1AA 5FUOH 4D9RE 1M1NA 4ONEA 3KWFA 4P3KA 1JT9A 3WTSA 3T9WA 3KOXA 3MTBA 5E94B 2PEYA 3RGVA 1WF5A 2WK1A 4QRUB 1CICA 3ZUCA 3E3MA 4UM8A 1V5IA 4MRRA 3FFCB 4ZYLA 1GAWA 4PFSA 4J3BA 5K4AA 5FT9A 1LV8A 4A5OA 3H65A 2D6FA 3SKVA 3AFNA 1MIOA 3CH8A 1YGYA 3FZNA 2Z0MA 1YUHA 4B6EA 3MRQB 3LUJA 1U65A 3QTTA 1XVLA 3VVCA 2WANA 1AHKA 2BFPA 3IDJA 3V6MA 4B4UA 1FC1A 3U6XA 4HW6A 1KZ9A 2XDWA 4HMOA 1EH9A 4AZ3A 5BS0E 4X3PA 2HWUA 3D85D 1YNOA 4G7VL 1UD5A 5C7LO 3IDXL 4BQCA 1DBAL 3ZYCA 1RAEA 2BCJQ 5BZDB 2ZPAA 4GO6B 3EXEB 3MUEA 4DDVA 2CFOA 1P62B 1LEIA 3E1F1 2ATIA 3GUZA 1FNBA 3W5VA 4QHUB 3SU8A 4TMPA 2XXAA 4XCCL 4NG5A 1NUNB 1JUFB 3T9FA 4Y9CA 3S96B 2VJ8A 1PZHA 3CW8X 5DBGA 4I4TF 5E2IA 4U1MB 2FT6A 4OQZA 1W8NA 3L5HA 4ZQKB 4B74A 5DXWA 1D6JA 3WQBA 3MNZA 3SCMB 1ZHLA 4YJHB 4JJ4A 2VDQH 3LUCA 2VUHB 4WHYH 4Q2ZB 2JSFA 2PYZA 3T0XA 3B6EA 5HYJD 3JQOB 3H0TB 3M89A 1HH9A 5AUNB 4FYWA 2JLLA 4QLWA 4F85A 4HUKB 4M7LL 4Q9KA 1A9SA 5A03A 5BJTB 1AXSB 4PR3A 3L6DA 3L45A 1T9GS 3K73O 1GCGA 3MPOA 2OZNA 1VKRA 1NCGA 3M0EA 3CNEA 3GEIA 3KQPA 4LNHA 4I6EA 1RZ3A 5IEKA 2X0JA 1YMMB 4Q9RL 4XCEB 5LQMA 5I9TA 2J3IA 2GCEA 2BDNL 1NOAA 1VE3A 3Q3GE 4LY0A 3P2OA 3IUBA 4WJZA 4X63A 2XVLA 3H8WA 1AQIA 4LBWA 1VAHA 1UOWA 3C09C 1Y0LA 1JHPA 4YLYA 1AACA 3WSWA 3IU3A 3BMQA 2G60L 4E31A 4X44A 1U4FA 5FM5M 4CQMB 1TNMA 3H6JA 1TJHH 3LZOA 3EOBB 3FKQA 1DTWB 5CT9A 2HDWA 3P54A 1A7RL 1OPXA 3RX8A 4RSMA 1NJGA 4JC5A 3MRDB 2DTDA 1G3RA 1XXHA 4CN8A 4UV4L 4HAGA 1K27A 1UMDB 1K1EA 4DSZA 1KVTA 4BIMA 1X44A 3QJHA 1SBSL 5D7KE 3I6SA 2OO7A 2EEDA 2VQDA 4AMVA 1UXMA 2ZKWA 4MJIE 5HZGA 4DRYA 2HSWA 3QPDA 4YCNA 4R2XA 4CODB 5CGMA 3GRBA 4M1WA 3RKPA 1MW2A 3K35A 2OG1A 4BUJA 3MS2A 3G5VA 5DFVD 5B3NA 3FDIA 3TDNA 2AGVA 4XP4H 3CSSA 4LDAA 3D50A 2BGGA 2NY5H 1OPGL 1T21B 3ZLVA 1IZ9A 3L3BA 3I9GL 1AGEB 5G5DA 3BD5A 3IAAA 5KVDH 5FBRB 2VXVL 2PLFA 1A71A 4RY8A 4WLVA 4UM9D 3ZDXF 2EIZB 4O4HA 4B7AA 5FV4A 3EF1A 4LF8B 3FQ2A 5AOKA 5C9JB 4ZX6A 4EJMA 3K1JA 3H11B 5T1DL 2C8KA 4M6OH 4NWUH 2NY3D 3SD5A 2V4LA 2WJAA 4QXVA 5F9WB 1Z9OA 3KCPB 3OLYA 3WLIA 4HF5H 3K94A 2ECQA 4O59O 4P4SB 2YQ5A 1KIPB 5TQ2A 4ER6A 2J9XB 2XUQA 5A2FA 3IUPA 2G17A 1KXHA 1NPYA 4LE0A 4TN9A 2Q20A 3L7FA 2C29D 3MWLA 4PANA 2WHPB 5ABAA 5K6AA 2Z56A 4ZAKD 1G38A 2X6CA 5EZSA 3QDJD 4RISL 3BJ91 3RX7A 4GBXD 1QTRA 1JHAA 5JNLA 3SGKA 3H2ZA 1J8HB 3RAFC 1XAIA 3V0WH 2Q2EB 3UTPD 4QO1A 4G70B 5ALBH 3S37L 1JHYA 4GSKA 1XN1A 1EK2A 1VL6A 2EYUA 1CY6A 2OXCA 1AP2A 3R9WA 1DO0A 1XL1A 1PMYA 1Y48E 1ZD5A 2H4WA 2YAHA 1Z22A 1LD3A 1QP0A 4YEDA 4IRXA 2EIDA 4QLOA 3K0AB 4ZCIA 1ONPA 3CPSA 3OHMB 2ICCA 2IYTA 5JMOC 3GLHA 5BQFA 4NMXB 3LNTA 5T41A 2E76C 5JAIA 4OHCA 2XACC 2NNRA 1SZPA 1MRSA 1GRNA 2ITEA 2PX3A 2WINA 1WDKA 5DI9A 3N9GH 3OE1A 3NRJA 4B6RA 5JDCC 3CCBA 3OMLA 3WGVA 4KDTA 4QA9A 2Q6OA 3OKKA 2Z57A 5JXGA 4ETYA 2LV4A 2IV9A 4IG4A 2QQQA 5G4LA 1T0MA 2Y7SA 5B38B 1ZLVH 4DV3B 4DLXA 1C30A 5AB9A 3LTNC 2VTDA 3FT3A 2FATL 1H4QA 1JDBB 2DH3A 1CLYH 2CUZA 3MXTA 4H15A 4PJDA 3GCZA 4LDOB 3UA3A 4UQ2A 3CRMA 4Q0MA 1F3DH 1I94B 1MHPH 1VSUA 2R1VB 1WCXA 1NW9B 4KAQL 1XGQA 2ZYTX 2FB4L 3LUGA 3NETA 4MZ3A 4RHFA 3M6FA 5IG7B 3C1TA 4ENPA 2YXFA 2Q8PA 1ZC3A 4MDYA 2BFAA 3SO3B 4GLRH 3RPIB 3KKQA 3RSZA 2V17H 2W37A 1A2OA 4HLNA 3MNWB 2MTAA 2X88A 1TEVA 1XZ0B 3HS8A 1UOPA 1JPSL 2PBLA 3T1OA 2AXGB 4KTGA 4XO9A 1ETZA 1TM5E 1RUAL 3BH4A 2ZPKH 1LK5A 3FQ4A 3SZOA 2X5KO 1CUEA 5FI3A 5EORH 3NN8A 1K8DA 4UFNA 3APMA 2OLKA 4RF2A 4HQ6A 1B16A 4I7ZC 4W6XB 2DQ6A 2W8BB 1KY7A 1KI9A 3I6QA 3G49A 4A37A 5ANME 4PC2A 5FFNA 5KVQA 2WQSA 5M94B 2WFAA 3PYXA 4IDDA 4AQDA 5ICCA 3GP3A 3HCOA 3C3PA 3QI9A 3BWMA 4ZWNA 4GH5A 3HHSB 3RVTD 2WO3B 3U46A 1YQVH 4F6RA 4H16A 4Q01A 1ZIAA 1P5ZB 1YEEL 5K9KA 3QXTA 1YO6A 1B74A 2HPAA 3NPSC 2QTLA 2Z6QA 2YA2A 2W90A 1LBTA 5DGCA 5BNIA 5JS6A 3GBEA 1FLDA 2GDZA 4GWGA 4TLBA 4UCXA 4DA4A 1FL9A 5BYAA 3BSWA 2WAYA 3WC4A 2FJUA 2NXZD 3LCUA 2Q0SA 3QAZB 4UQEA 4PYKA 4Q21A 1P2TA 4BNDB 1MIEH 2AQ3A 2HK6A 1DSSG 3BWVA 1UXHA 5EULV 5I73B 3T0WA 4Y4HC 2QTAA 1I1QB 4DEUA 5AVUA 3EVCA 5AW5A 2A57A 3B3IA 3VDCA 2DWSA 2I3AA 4ARIA 2FJPA 3K8ZA 3OZUA 4RH3A 1ZVJA 3O1IC 3KHKA 3S36L 4B79A 3FCXA 4MS8D 1DSFH 1Y3CE 3D2UA 1PL3A 4J2XA 4PGFA 6REQB 4AIOA 4LKCB 1EWTA 3DAYA 1W73A 4Q3EA 3CX4A 3OR6B 4KJZA 4EMUA 3QKSA 5JLAA 5A1JA 1N33B 2AJLI 4MEBA 3Q2VA 4RGQA 5EF3A 1HOCA 1ROCA 5LUAA 4IINA 3L95B 4CEJB 4BVKA 3H05A 3ZE2B 3ROLB 1QFUH 5JCJA 4WI0B 2H3XC 3WXWL 4P0DA 1XG5A 4C87A 4AURA 1IULA 2J43A 4JXXA 4DDHA 1ZV5A 1ZJBA 3ORQA 2HFKA 3ZV5A 2VT7A 1U31A 3BW9A 4Y2LA 5B6JA 3QYMA 4UQ9A 2WF8A 1TQ2A 4CG2A 2NY6C 4KR3A 1WBXB 4HG4K 1FQWA 1L7BA 2EZTA 2QVBA 1C4KA 5IMOB 2OULB 3I3BA 3HNPA 3PVZA 2YV4A 1VRVA 3TLGB 1GPMA 2F62A 4FG4A 3IQFA 1N7HA 1HEYA 1XZEA 4D3CL 5J2UB 5IABA 1N0WA 2JLXA 5EP1A 2ZJ2A 1A6UL 5J6HA 1RP7A 3U7IA 1B4JH 3NC4A 4MD5A 4J5VA 1FUEA 1P1ZA 5B1HA 3OB8A 4D0RA 4IGEA 5EU7C 4NZRH 2HMSA 3H2JA 2K0RA 1N34B 4HKXB 3PJFA 1J42A 2IS6A 1T0NB 4A27A 3BIKB 2N4IA 3ABQB 3EUWA 3A10A 2CR6A 4H26B 1PJCA 1DVRA 3Q8KA 4IGBA 5A6MA 1OHZA 1MX5A 2HMUA 3ULVL 3CW9A 1F5NA 2ZB2A 4ZMOA 4DOHB 1A65A 3QPXH 5J4HA 5ALRA 3FUKA 1YEIL 3GLZA 1U8IA 3ATBA 1EVUA 2V65A 2XETA 1RM0A 4UQPA 2HC9A 2X1HA 3BFWA 3H6AA 2IH9A 5CD9A 5CEJA 1PNRA 2FBOJ 2ESVA 1QVOA 4Z0BH 2C1EA 2YWGA 1L5QA 5AI9A 2BFVL 1Y8CA 4GNRA 4XQCA 5IFLA 4AKSA 1H0DA 3ZZLA 2Z31A 5H0IA 1H66A 1N6UA 1WO8A 3D9QX 1LEKA 4PLJD 3HAEG 4TROA 4K94L 2R56H 1UPFA 3HCCA 4OHKA 3LQ2A 5FO2A 2AABH 2MH4A 1QIDA 3RVUD 4BNMA 2V2TB 1LD9A 4PRDA 3EO0A 1O58A 3ENEA 2F67A 5F1NB 4HUTA 2IYYA 3ORJA 5BSHA 1UKVY 3BWBA 1QQ5A 5AKSA 3QUZD 2H08A 5CVJA 1VLVA 2ZE7A 2F53D 2PLTA 2B25A 4AK1A 1R5NA 2X19A 1QBBA 4KXQA 2UZ1A 4FC6A 4CIWA 3ME0A 2VO5A 4MPRA 4MYDA 4TTSA 5DJYB 4GUOA 1SQMA 3QVWA 5DSXA 2NU6B 3BSSA 1S5PA 2DQFB 5ESAB 1C16A 1QO0A 2JE8A 1XEWY 2XUHA 2X6VA 3VC2A 3DV0B 1IGTB 3WHKA 1JV2A 4LLWB 2AN4A 1ZSDB 3D3KA 2H2SC 1AMXA 1XIVA 1RVFL 4UUQA 3JQ8B 4WZZA 2VUOA 1F2QA 3UENA 3BB1A 1CETA 2WXLA 1P0CA 2PLWA 4C07A 2X4UA 1ZGLB 1FWXA 2R68A 2J8UF 4OLFA 4YMTA 2AK1H 4BLQA 1IGYA 1YCHA 3CRQA 2BFOA 5I6XC 4OMUA 2EJVA 2HMTA 2HX1A 3UO8B 2XVMA 2DGDA 3L7JA 4A6YA 2Y5QA 1NPTO 4OQ1A 2FEAA 3VXRE 1T6YA 5CFRA 1M9SA 3ZSTA 2RB5A 2C8VA 1I7UB 3DK0A 3NT4A 4EW1A 1UBRS 4EHAA 1C1EL 4GY4A 3V52H 4EDFA 1FRNA 4FYQA 3M5DA 4GGMX 3WLRA 4X4XB 2J56A 3ISYA 4OFVA 2I07A 2G5RA 1QSEB 1XN4A 4HLCA 4P0QB 4PJBE 2W0FA 5GIRB 1HE8B 4I08A 2YWXA 4WWKB 3OLWA 2V33A 4JC8A 3BGWA 4F8OA 4DG8A 4UIMA 4MV3A 2F9BT 1YN7B 4JK0D 3TO4A 4BJ6A 2WLLB 5GZ6A 1IC0A 2YMQA 3CDYA 2P6MA 4KCGA 2FMHA 4LVUA 3TOPA 3EW3B 5F1OA 1AV6A 3B9KB 2PKYX 3CDFA 2OFXA 1I7DA 1MVYA 5DB4A 5ETJA 4KXLA 3UFBA 4YJFB 4TVPD 4KKBD 5HZMA 1RYYA 4O5LH 5IB5B 1L7IH 4LRNL 1UMCB 3OU6A 2OTUB 2AMLA 2Q07A 3WIUA 4L37A 2MCFA 1E67A 4U7SA 3CJQA 1Z0NA 4OCYH 5A0VA 4AJ1A 1PFOA 1YMVA 3NWPA 1XYGA 3K2UH 1T7VA 5ICGA 1R24B 1G1OA 1C1DB 4MLZA 2G8LA 4YPGA 1BYUA 4TYYA 1SOQA 4RBPH 3A1EA 5JO5B 1MG0A 2W9DL 2FR8A 3G08A 4HUJA 1QEXA 2X0EA 4Z7VB 2JXMA 1K0UA 1HKFA 2L17A 5HFNA 3SZ6A 1XU4A 3UC5A 1PTZA 3PL6D 5HYSA 4BFRA 1CQJA 3ZE0F 4G43B 2OTWA 1PBNA 3EOAA 4HQRA 4LDNA 4RMSA 1VZIA 1HEHC 1TZMA 2WWMC 5EGSA 1E79D 1LP9B 1EO7A 4N47A 2IFFL 1HORA 2Q3LA 3SDYH 3IMVA 3ENVA 4FA6A 5DSTA 1E3TA 1NE7A 1U1FA 3IT2A 3LY5A 2AF4C 2NZUG 4NH0A 1WAAE 1GYQA 1T3ZA 1JWMA 1PJRA 2NZYA 3EHEA 5DBOA 1RFDH 4F5CA 3DXYA 3N44B 4XHJC 3GH3A 1K7SN 1U63A 4BLRA 5IPFA 1N32B 1RXCA 1B8VA 1MI5B 5BNTA 1AR2A 3MA7B 1RSYA 4XB3A 2H9IA 1FFNB 2QI9F 2V1UA 3N0TA 4NERA 4KUGA 3R8XA 2RJNA 1DWUA 2A2QT 3Q3CA 3QA3E 1KY5A 5FHBL 3KAPA 3G88A 1NCTA 1PHRA 2WFLA 4YPVA 1P6FA 4KK9C 3GC3A 3WP0A 1A6WH 3OKYA 2DQIH 2PGJA 4TNVF 5C80A 5KJCA 4HDMB 1OY1A 2H5LA 1L2TA 1EM8B 3F3HA 4DP4X 3MUHL 1DUZA 2Q4EA 3HP7A 1RKBA 2BCMA 3IXTB 3QZOA 1KELL 2R2EA 2CHVA 3SEAA 1LLCA 2I99A 3H4IA 2UY7B 1U6AH 2M2IA 2YOAA 3KVVA 5K20A 4I3RL 3ODGA 2WCSA 4PZLA 1L6XA 1JG1A 1TT6A 2E4UA 1FG9C 3PYCA 2GA9A 3FWPA 4BFIB 3AX6A 2Z93B 4ZMWA 1L5OA 5JNUA 5SY6A 4N54A 2IY7A 3O0LA 4ZODA 3AU9A 4JVUA 2CCWA 1JK9A 2VAAB 4Y0AA 1WAPA 1Z5LA 4BDTA 4L51A 3BAEL 3H84A 2OD9A 4M7ZC 5JNTA 4OGKA 3TCKA 5MFPA 1SZDA 1HE4A 2WQWA 1JXKA 2AOTB 4I0PC 4B3CA 3UKJA 1RIVH 3POHA 2OTPA 1GRCA 3SF8A 1NT4A 2BSRB 3KLPX 5D3QA 1IEWA 4HQLA 2HRPH 5ICUA 3X2SA 4GQAA 3JTTA 2AFIB 3H0EA 3KEFA 4DEVA 5TS2A 3FO0H 3QXAA 4O2AF 5EWLA 2E18A 4UKDA 4BP1A 3EOYG 3UW1A 3HC2A 1N5LA 2OMZA 4MQ5A 4C5BA 4GR5A 1TPYA 4URWR 4X1KA 2NYUA 2XQFA 3ADPA 4U6HB 5L2KE 2V7VA 5J56B 3VVLA 1ZV2A 1H2WA 3KOOA 5EZ6B 4DPMA 3DWTA 1I7RA 4IX9A 1FYWA 1LBSA 3BGFC 3U80A 2ZXGA 4MR8A 3SXUB 5SX4I 1YS7A 5AHRA 2CIKB 4TUKL 1FDUA 2XE4A 4J0QA 2FJFB 2W80C 1EA7A 3WIBA 3DTXB 2XBDA 5AW7A 1CFSB 2PR9A 4MLIA 1LBIA 2O7SA 3KELA 4G37A 1S7XA 3S6JA 5MN5A 3WNCA 2IV8A 4TQ9A 5KQRA 4WLEA 3UA4A 3HUDA 3L77A 3CZLA 1WKBA 3WL8A 3RFZB 4M1KA 4EGAA 3R7AA 5FPKA 3MAGA 3K9CA 3NTQA 5BSRA 4EUPA 4CEHB 2NRDA 1PLKA 4ZXPA 3TTWA 4C14A 3FTEA 4LK2A 3JWNH 1FGNH 5HHOD 4O29A 1ZGGA 3ZWNA 3NHMA 3VMNA 1UZ8A 4MJHA 2BVPA 1X2BA 1FZMA 3LPLA 1GUBA 2IQ9H 4KK6D 2RJMA 5DRNA 1IQDB 3ZI4A 3O21A 4J3OC 4RGNE 3EGSB 1F4YL 5L4IA 4Z77A 2PGXA 3SDAC 2ZUQB 3KS0H 3OWHA 2PWBA 1G64A 4E5KA 4CKYA 3FZEA 4BBJA 3MRLB 3HZYA 2PX5A 2HFFB 5TE6H 2RG7A 3ECBB 2R0WL 3LJKA 1J1UA 2QZJA 4F3YA 2V45A 4K9DA 1P7CA 3EVTA 3ORYA 5GAJA 1R19A 1MVFA 3I09A 3U6BA 1ZOSA 1BCSB 2B1AH 2HSGA 3ESRA 1LI5A 4JPVH 1OALA 5DUPH 1XALA 4KKRA 1S8OA 2XNHA 3WKPA 3JV5A 4NQEA 3ELYA 2P2ZA 2YY7A 5KYUB 1KAOA 3HLYA 4N2BA 1CN4A 1GRQA 4WI6A 4Z7UF 4HDOB 3RAEC 5L7YA 1YB7A 4AI7A 2EIEA 2ZWNA 4Y4KB 2WUVA 1CIUA 3MTAA 1ZEAL 4XXWC 4G5GA 5ECYA 4OV6B 5BPHA 3V10A 2BGRA 2GD0A 4KJWD 5HDWA 5CH5A 4YZFE 1Q6YA 2BMEA 4P2RE 5DZOA 4PB0L 2DCUA 3QJZA 1JVSA 4JFFE 2GM5A 2PNJA 2Q7YA 2YPKA 1MR3F 2A9RA 3VNSA 4C0HA 1NGXA 2HADA 1NYQA 2J9FB 4TS4A 2IHNA 5LDSA 1SVBA 1N1MA 1NW6A 1XV8A 4B76A 4EDHA 5L9DL 2JAPA 1Z63A 2PO6B 4MNQB 3JY6A 1BRTA 2ENSA 5D7LE 4DN4H 1XMXA 1A9XA 3FF8A 4FGSA 1B1AA 1Q9WA 2QF7A 3OCUA 1XRJA 3GI9H 1KDVA 3S6CA 3S8GB 1E4XH 5ICYB 3Q6GL 2ZRLA 3BHJA 1EXGA 4FP8L 1DAKA 4LUCA 5G02A 1PAMA 4G7YH 3HV0A 5J63A 2W4QA 1CF8L 1XCQB 3VPGA 1B3IA 2ZAYA 5TMDA 1GGNA 1U3HB 3VI4E 1NVVQ 3DRQB 1N9GA 3IODA 3DBLB 2YC1B 1JAYA 2JD0A 4PZEA 4NQCE 3COPA 4DJDC 1RVDA 4K8RL 2XRAL 4BFGA 2APTA 2AOUA 4FNLH 2IPKB 4QHKI 2AKRB 3QQDA 5DD1L 3MJEA 3Q9UA 3RWJB 3QNWA 5KSYA 3UY4A 4OCSH 2ZIEA 5LG1A 4XD7A 1RZGB 4DVRL 4Q9JA 1FH5H 2B5IC 3FQYA 2EZUA 4FFWA 3HK2A 3DX8A 1NXQA 2C99A 5K0LA 3NJ4A 2EDNA 2IS1A 3MV01 1GGBL 3FQUB 3KUKA 2WD7B 1TQHA 2Q86B 4K9JA 3JWIA 5E38A 4F2GA 4GQRA 3FSZA 4WU5B 1JG6A 1CE6A 4M9UA 4WW2A 3VOBA 2BFFB 3LSOB 3PGLA 4OB5L 1J8KA 3HB1A 3FRJA 3GWZA 3THWB 1IATA 4NDMA 3EY9A 3VU9A 2XHNA 1AF4A 2H9AA 4N9GB 3ESAA 3NA9L 3TU6A 5DQJB 2X4IA 1GV0A 2BM0A 2QS9A 5DI8B 4EFKA 1BKSB 1BLNB 5L7TA 4U6NA 1YACA 4TVPH 4YV7A 1KPGA 4N5EC 3D7RA 2O5ZL 4JO2H 4JFAA 1KDIA 4JZJB 4L5FE 1U8PA 2AD5A 4LVNB 2Z9DA 3K72B 4QWWC 5JAHA 5F3DA 2X7XA 4ADJA 3K6DA 3ZWCA 3U7HB 2IEYA 4HLZG 3QNFA 1E4VA 1CT8B 3FFCE 4NOKA 4MUGA 4JQSA 5CD5D 4N3UA 1XFAA 2CMRH 5TLSA 2H1OA 2Z2ZA 4LAQH 1ZRUA 2AJSL 3RURA 4XCYB 3CX5K 1UAYA 1CZOA 3DO6A 2Z83A 4X80H 4HG2A 6PFKA 4BH8A 2CO6B 4GEKA 4CLOA 5T5NF 3BC1A 2A9CA 2FW8A 3LNHA 4OZHB 2E55A 1PG5A 4HQFA 4F7WA 1R18A 1L9KA 9ATCA 1EYZA 2XCQA 5KAPA 4RDXA 1Z0IA 1QHSA 1M7DA 3BSZL 4XB8A 4Q7MB 3FTGB 1GC1L 2XJKA 5JCOA 5DD5H 5B6PA 3PXXA 3F5MA 5IW6B 4YFDB 1GYPA 2A5LA 25C8H 3MAAC 4R7ZA 3SVLA 3RK1A 1J1PL 4P2OC 5DEIA 4BEJA 3GIVA 1YH3A 1GGTA 2OBGA 4B3XA 3L04A 2ERJC 1JD7A 5CT6A 2CRZA 3RIMA 1FP2A 2OPHA 3OQ6A 2GVDC 4MMXB 4AKEA 1DEHA 1LFDB 4PN3A 4QNNA 2Q1EA 3OZLA 4ZZFA 4MKRA 2A4EA 4LVHC 1Z5UA 4OM7A 4AX4A 4HJ1A 3V5KA 1OF2A 3NDYE 4C3UA 1DN0B 1KCSH 2C82A 1TCCA 1E1NA 5K2MA 1CW2B 4JFPA 4PFKA 4Q6YA 1ECBA 5J57B 1H93A 5DC2A 2Q8AH 3ZXAC 3K46A 5HD8C 2WNHA 1QACA 3ARPA 4QXTB 3EIEA 5I1JH 3TIFA 1SKYE 2SICE 1ICIA 1CFBA 3E9DA 2E4XA 3GZNB 4EB6A 4YDSA 5A02A 4QQKA 4ZPVB 2QBYA 2V3EA 2WZAA 1TKRA 7REQA 5B1KA 1XV5A 3GOQA 3WUWA 4IMJB 5DNAA 4YMUA 4AG4L 4MLCA 4TNVK 4CQJA 3BAKA 1IBRA 5KJRH 4R9VA 4LCUA 4EAAA 3EQZA 3GNQA 2DT8A 2LCIA 4RIRA 4JWKA 2G7ZA 3SJVB 3OZXA 4G42B 4B4WA 4DSNA 4UT9A 3B2DC 1AB5A 2OHIA 5EAIA 1JIJA 3DIDA 4M3NA 1RUKL 5F5LA 3B8YA 3MGTA 4OAPA 2O72A 2Y4OA 2LTAA 3ARDA 3CZQA 1FORH 3SBWC 5L4FA 3KJEA 3ZY3A 4DCSA 1T1YA 3OTGA 4BO9A 3NIGB 2B35A 5DURD 5A16B 1Y9ZA 1TO1E 4WXEA 1ORSB 1V7NH 3GKWL 5LXVA 4KIWA 1CQWA 4W8OA 1FAIH 1WCV1 1EQUA 4G6KL 5A5EA 4BDVB 2DN7A 3KWWA 2JGIA 2FJSA 5GHWH 3TL3A 3JPYA 4ZMAT 4BE5A 5GGSA 2OBYA 3QZWA 1OP5H 5BWBA 5F7EL 4PLCA 2HPVA 2GFIA 3RVXD 3OF3A 4DQOH 3GHYA 2C7GA 1ZV9A 3WE6A 4OD2B 1UQTA 2WVGA 4EUPG 3H9SE 4ONFL 3W3AA 5KJ6A 4BXSV 3TLXA 4JBNA 5IEBA 1RJYB 2VA8A 3MCAA 5KMGB 2Q0QA 4DH2A 4DLNA 3SYQA 5EUOA 4TMYA 5ISZA 1IIRA 5I2IB 1T5TA 1L7TH 4F3KA 5GGRY 2F68X 4XBGB 2H51A 4ZCQA 1HEIA 3ZBUA 2WXPA 1AZTA 2V7HA 1JN6A 2AT1A 2HXYA 3AHIA 2BUAA 4FM9A 4L3EE 1XD2A 4LL1A 2F2TA 3IOBA 5LCVL 1G7QA 3LY7A 1N0VC 4G4SP 1NGPH 3B7UX 1U11A 1ZJ4A 2L0DA 4XB2A 1BXGB 1E5VA 4NAJA 4APQB 5JSZA 1MCNA 5KVEL 5FGBC 2YVLA 1SZNA 1OFGA 5IVOA 4KV5E 3L0CA 4UVGA 1UJ3B 1FY2A 3H1FA 4NNJA 2OZVA 4JSRA 1NC4A 4Y2JA 1RAFA 3VYOA 1O87A 1LSJA 4H1HA 3A14A 1RXYA 1M7IA 4GMFA 2CDGB 3ZKQD 4PNEA 5F3FA 1EWVA 4PSAA 4Y0NA 3JZIA 3GAMA 1ZLEA 4QXUL 5LR6A 4X6DF 1JB9A 5A04A 2YSTA 3B34A 5EXXA 4GFXA 5JW4R 1OU4A 1XXLA 4YRZA 2DMCA 1OGTB 1Z12A 2BLFA 4WW1B 1JYNA 2GCPA 4BMCA 3OZAA 3KYAA 1D7BA 1RIIA 2ORED 5EZOL 3C8KB 4BWWA 5D6CB 3CVBA 3HL4A 4RGOH 3VYWA 3UBFA 2R6HA 3OSKA 2JEOA 2HF7A 2LVBA 2P7IA 3VHXB 1WZ2A 5LN8A 1WFOA 2XVBA 1A9BB 1KJ9A 3VDMA 3UHFA 5AI0A 5EZIL 4B2PA 5C1DA 1KPVB 4PJCB 4M53A 1NJ9B 4FQXA 4N87A 3JU3A 1DL7L 3N2EA 5HBBA 2ID5A 5IJ9A 5LYJB 4D79A 4WNAB 4JJ8A 3UMCA 5EU6A 1MWOA 3ROOA 5FBKA 1MABB 1N59B 5CCEA 4PQGA 1KYYA 1HKLH 3V1UA 4ZKDA 1FVCA 2FMTA 2G5BA 3GIZL 3I0ZA 4EI5B 2JKTM 3MA0A 2GZSA 4G8FA 4QXOA 2P28A 2QHLA 1DQLL 5F9WC 4Y5YB 4QU5A 4L29A 3H9ZA 3ILDA 3ETJA 5AOCA 2B20A 2D7QA 4AQ8A 1RXLA 2DKFA 3WB0A 3TYFA 3FETA 5AUMA 1G8PA 2JHPA 2HWYA 5K8UA 1A14L 5JOPD 3DYVA 4I4WA 2HF2A 1A1MB 1PS0A 2I2CA 3QRGL 3T7IA 5C3TA 1NJFA 1LDPH 2B3TA 3RYCA 3ZU2A 3UJTH 1HDIA 4U0KA 1SJEA 3X3GL 1EFXD 3A25A 2EQAA 4BWYA 3U9WA 1P75A 1LTXA 1YQEA 4JEHA 1V11A 4O51B 3WYRA 3GUVA 1YPZF 2BEJA 4GRLD 4OT1L 3FYTA 4RSYA 2WMPA 4Y1RB 1XSEA 4WSOA 4BGDA 2PKQP 4BO6A 1A1NB 4XE0A 5DUML 1T0PB 3RYHA 2BFMA 4NCC1 3JZDA 1ECCA 1C08B 4PS4H 5I9BA 3IUSA 4LOJA 1MPXA 2BEUA 2Q0HA 1Q22A 2A67A 3PCRB 1CFNA 2XN9D 1JJ7A 3B9AA 4H59A 3GSXA 3PGMA 1KNOB 4W63A 5C52B 3PB3A 1RWPA 4ODTH 2VWHA 3MELA 2ZXQA 3F7MA 1AMNA 5LQSA 1VKJA 3AT9A 4DQKA 1KN2L 4DA6A 2BRQA 5DN9A 5TGBB 3WV0A 2WV3A 1KC1A 2ZICA 1SOXA 3NJFA 3OKMB 3DWIA 3TNLA 3TO5A 2AJUH 5JASA 3MFFB 3OF5A 3W9YA 5ETUA 3UWKA 1ZXXA 5DYTA 3FYIB 2GW5A 1S9KC 5JWOA 4CZ2A 2DF8A 4AZ0B 1Z74A 2OAEA 3AUWB 2YRFA 5IYZF 4QTTB 1OFTA 2PGNA 3ARFD 4QX6A 3K7EA 1ZM9A 3H3JA 4GI7A 1BVNP 1CLZH 5CBPB 5EO1B 2HT2D 2V8OA 3ZYIA 3ZDQA 1SOUA 4PLKD 2IC5A 4QODA 1PSDA 1I1HA 3Q10A 2REBA 5HS6A 2ORYA 1JV5A 1XZMA 1IHUA 2R1WB 1T1WB 5EE1A 2P78A 1SHSA 3ZE2E 3KPQB 1L8QA 1RJFA 1I9RH 4M7OA 1QEWB 4KVAA 1A77A 4TYUA 4L2YA 1RYFA 4XA8A 2R0LH 1O08A 4FXGA 2AXHA 2R44A 1CGSH 4ZTOH 5BNXD 3BAFA 3SO3C 2V7TA 5H02A 1ROWA 1NM5A 3DM9B 1NR7A 2CLKB 5IWCA 3A6JA 4W93A 1E18A 4O4LB 3I02B 2CLLB 2TSAA 4LCBA 2NUAB 4JQIL 5IWAB 1NWOA 4KW7A 2BY1A 1Z8FA 1FFBA 1QOQB 4S10A 3VNQA 3BN3B 4DKDC 5JY1A 2AJTA 3M6LA 3V4UL 1EVKA 1ZOOA 2FCRA 5FI5A 1D5CA 2VP3A 1UIRA 3V0VB 5FLVA 3OIDA 2C9UA 3W2TA 1AVAA 3GMMA 2A33A 3FDZB 1S8DB 2VEOA 3ZQ4A 1US8A 2GD6A 5ARDA 3UPRB 3D07A 4OHZA 3EQ6A 2K2QB 2GYUA 2FEEL 1DHTA 2Q10A 3CHQA 3VJ6A 3CTPA 2P90A 5CEXB 3DGGB 3O6LH 2UAGA 3HBQA 3NNNA 3OE4A 2M8XA 4YCBA 4HPOL 2FUG1 3IDIA 4K81B 4ZCPA 4I1OA 4GG6F 2H32B 1HHHB 3FRHA 5KSAD 4OI8A 1IXYA 3VWJB 5I8ZA 3KPNA 2G82A 3O4FA 1KIUA 2B9AA 3QAZC 2R0QC 5BQXA 4JJHA 1FFPB 4MXWL 1FQKA 3WEMA 3LQYA 3ZCRA 4RMVA 3KHQA 5TT0A 2H16A 3QZWG 5T6MA 2IH2A 3BFKA 3R3WA 3WRXA 1HHJB 1G7SA 1JI1A 1G1AA 4HGZA 4ND8A 1QUNA 1G2QA 4TKWA 3TH4T 4DFIA 4F8QA 5HHMB 1FNMA 3D34A 4H5SA 3K09C 3T1WA 2P80D 4H2CA 4BJHB 1OW0A 5FWAA 4ZMBA 4PN7A 4CJ1A 3T7AA 3U62A 1N7GA 3VNRA 1MW0A 2L7JA 4FFNA 3PFFA 3CVUA 1E0AA 1LYQA 2O5YL 4NO0B 2NN3C 3KJ6L 1RE1A 4II7A 4RS4A 5DT1H 4CBZA 3L3DB 1AS2A 2YD4A 4AYDC 5I6LA 4BRWA 1OSYA 3DX9B 3V1LA 4FZJA 1MTOA 5DNVA 3BWXA 3QG6A 3QQPA 4O4YH 5JRJA 3LX9A 3K53A 3KPLA 4LGMA 2W5UA 3SDDB 4HJSA 4LZPA 4JUCA 5FX3A 1F8XA 2OY0A 2GHIA 1BA3A 1AIFB 5DTFA 4GQ9L 1CD5A 4Q66C 3CS3A 2DYKA 1SQSA 5CU7A 3WFCL 1PD1A 3MJ6A 4KQ4L 3R41A 5AD0B 2Y4NA 5C2UB 2CCJA 5FDYA 3JZ7A 5IBTH 1NEPA 3OT4A 2CR0A 3C97A 4MVYA 5I47A 4Z95L 3M4JA 2VMDA 5J11B 2JFBA 1BEZA 3M1YA 4OK6A 1I1FA 2IHJA 2ZB3A 1WXIA 4KFSA 3A1UA 1WU7A 2FECI 2X6UA 1F2UA 3FN0H 2AEPL 4D9QE 4AECA 5EGNA 3FYSA 3AEYA 1PFKA 1M72A 3K4DA 4FJYA 1JDPA 1TYJA 3D0VA 3RX5A 2H4ZA 1FL5B 3QBDA 5G40A 1DKNA 2O2XA 1R0AL 2IC2A 3D8BA 1AQYA 5ITFA 2FWIA 3FONA 3OL2B 2ALWA 1TQVA 2VTFA 3K9HA 3EGVA 3TQIA 2PYEE 3DC0A 4XP6H 4Z99A 1E4EA 3VM6A 3LFHA 2FEOA 2XWBF 4MZXA 5ENZA 3JQAA 3NIBA 5FDFA 1G9SA 2P8SA 1CS4C 3FFDA 3NG5A 1V7CA 4J16C 3ESOA 3LNEA 1OF0A 2PY6A 4CMHB 4MPTA 1ZKMA 2KQUA 1FE8H 1XK7A 3KOMA 4W7SA 5A6SA 4UTCA 3EIFA 3QDMD 1OARH 3H9GA 3MLXL 4Z4FA 1OLSB 5GS0C 3GW8A 5DI3A 5BMVB 2P26A 1JA0A 2Q76B 3M33A 4YRKA 4NOJA 1CMOA 5HHVH 4RLQA 1NW8A 1JHTB 2WIJA 5MEPB 4RETA 4ZYTA 1FYTB 4DNOA 3IP7A 4P9HC 2R2BB 3DMMB 5DASA 4FYKA 2UUDK 3KJHA 5AVSB 3TZVB 3QO0A 1SZJG 5BRJA 3HKCB 3NHYA 3KB8A 1GR7A 4RF3A 4S1TA 5JNVA 3GRWL 4ZVTA 4RQQB 4ESKA 1MAHA 5ADOH 1QIGA 1R6AA 3QFJE 3DONA 3NI2A 4PGBB 4Z7VE 3JQ7A 1EO8L 5C08B 3WNPA 4CDRA 4N26A 3NGXA 3VKFA 1SCIA 5E2UH 3UG5A 1RIFA 1WUKS 3WHIA 1FL3A 2BEWA 5JADA 4JY6B 1YY9D 1RL1A 1BF8A 5IUJC 4MUIA 1FOEB 4A55A 1DG9A 4RL4A 1LP9E 1BOGA 2C1XA 1TA9A 1NCWH 4BB6A 3UCEA 3LAWA 1LQSR 3GMPB 4YBZA 1HILB 1FU4A 3PJGA 3ZE6A 3O9WA 5A9SB 1PKOA 1Z29A 4HWBA 1EG2A 2BEVB 1LO4L 3BZDA 1OIOA 3AR3A 2TMKA 1RJLA 1J5XA 1LDBA 4HXFB 4K7PH 2UDPA 3TF5A 4PPGA 2IU3A 4JOCA 3P3TA 4PV8A 3VGAC 2C7UB 4CIBA 4JANA 4YSCA 2RACA 3SDCD 3D1LA 5D51S 4LBAA 4PJAA 4EGQA 3L3HB 4LSMA 3GS4A 2BFDB 4UT6A 4OSPA 1KEEB 1VKOA 5EF0A 3E6FA 3U3XA 4KPEC 3TKLA 4JFOB 1HZLA 4HX9A 1OWLA 3KSZO 4QUAA 4ROSA 1JA1A 3AMVA 5A3QA 4G3YL 3NACH 1RZVA 3QUXD 3NEJA 3JT2A 3MLEA 4HA1A 3PGFH 3E2IA 4GVLA 3BSZA 4X6EA 3GDBA 3WMRA 2R0KH 1RZJL 4WWKC 3UZQB 1G7RA 3QUYB 4XLTA 4F37F 2FMIA 3HFML 2QVLA 5IN4A 4EI8A 5BN5B 1O9ZA 2MMCA 4FWIB 4P59H 2PJZA 3EGWA 1P2UA 4FT4A 2ZJAA 3C6LA 4FABH 4LP4A 1VJ0A 2DPMA 5CD3B 1HYSD 1G21B 2GJ9A 3E1KA 3KPRB 1NLFA 3WTXA 3NDJA 4O5OA 4JPSA 1U8YA 3TN0A 5LKNA 2YD0A 4YBHA 3PWPD 1T9AA 2APSA 3FRUA 3BK1A 1FUNA 4DP2X 5BZWB 3VXUD 1DFBL 2OHVA 4MOWA 5IESL 1OR8A 1A02N 5AM4A 4I4TB 4NKOA 3DBXA 1CPYA 4G7RB 4BZQA 4NIYE 3NT5A 2B2NA 2NUTA 4KO6A 2VBIA 1Z33A 1LF0A 4IBVA 1E40A 2XRYA 4HDIB 3OKNB 3FOMB 3E23A 4JRYA 2UUOA 1U8LA 5TH2B 1DQSA 1KTDA 3ZKXB 2AFIE 2GRJA 5AHWA 2P6RA 1KENH 1S2GA 1D2EA 4JASB 4JO4L 3M1AA 1M1YA 2FQWA 4GT1A 1BOOA 4K7JA 3G5ZA 1HZZC 1T1RA 4RZ3A 2OMBA 3FYCA 4DG5A 2E6PA 3R5KA 2I80A 2FLWA 1JN0A 2NU8A 3Q7SA 5L6YL 3D7PA 2QRZA 4PBXA 3MJFA 1CBUA 2V96A 3CU1A 4GPIB 4ZFZB 3DL7A 4TL4A 4EP1A 1U1EA 4S05A 2HA6A 4ZU3A 4CMIA 1Q19A 1Q9OA 5LIPA 5GGUA 5J3HC 1HHGA 3RUGE 3PE3A 3BXEA 4C7MA 3AHFA 5ILTL 3WIDA 4NF2A 5FWQA 2VAXA 4P84A 4IDPA 1JQJC 1W4LA 1O5TA 4LDEB 4IU2B 3Q7QA 1WS7A 1L1FA 1DLHA 1TMOA 4F8NA 2QQNL 2AXPA 3NRBA 3TAXA 1P53A 2DAVA 3TK1A 1XF9A 2GAFA 4D8PB 1UXIA 4OJKA 1XTTA 3CCFA 3OG6B 1I4FB 3RJQB 3KBFA 3V4PL 2YPLA 4ICWA 4S1SH 2Z58A 1K8ZB 2J0QA 1B0GA 3DVQX 2AE2A 3IAQA 4AJLA 5JTWA 3QXWA 4KVFA 1YI0A 1FZKB 3UBXA 5JA9A 3C74A 3GG2A 3ZWPA 1TZGH 2YA1A 4OGZA 2BUBA 1UF9A 5INTA 4YL4A 2NYRA 4K6CA 1WUTA 1M3IA 1V54B 3OE7D 2EVHA 4CW1B 3BDBA 3VX0A 4E9WA 3JATA 4BECA 3G9TA 1GO2A 1LS6A 2JCVA 5FH9A 4MUJA 1UP7A 4C43A 5IIEA 4LVOA 1ZY2A 4PBTA 1YYML 2R2HB 3LOQA 2WQAA 2L3BA 4Q3AA 4XTCS 2AXQA 5B4UA 2G9NA 3ZD8A 2NW3A 1NDGA 4PJGE 1C3XA 2AXFB 1E28A 3DYMA 2H2WA 4ZD3L 4NE9A 1I85A 2VJNA 2DMBA 2L7UA 2H7CA 1RACA 3LZLA 3ZDXB 2P1YA 2QV2A 2YUIA 1HL7A 4ESVA 3UJ9A 2YZ1A 2OMWA 3MRMA 4KMTL 5HJ7A 4E4YA 3WKQA 4GG1A 2IWKA 3S2IA 1XEDA 1RUPH 2KLBA 3ROQA 5F0LB 5AAMC 5LCVA 4AY4A 4UOZA 2XUZA 2VLKA 5DHYA 4F4UA 3HMQA 4OH2A 2JFXA 4C4AA 3H3BC 4MQXD 5CEYB 5G0WA 1HINL 1KP3A 5F7WC 1JCKA 4ZS7H 1V3QE 2K8MA 3VFMB 1CR2A 2B8TA 1PV2A 2ZTSA 1U8AA 2FFJA 4EZIA 2GDJA 4KU1A 1RNLA 4O2FB 5BZZA 2IEGA 1QYGH 2ZI5A 5ALQA 4E6PA 3ZWWA 3WLAA 1KIRB 4RPCA 5TF0A 1K2VN 1KYFA 2PV7A 4XMKH 1N36B 2FW0A 4JAMB 1BHSA 4PU0A 3F7VB 1AFVL 3X43A 3X3HA 1DKQA 2ZW9A 1WD7A 4JFSA 2VK8A 2QWXA 3EPPA 3CH6A 4XNMA 4EDWL 2OW6A 2IDFA 1M6YA 3RF7A 3AUSA 5JI2E 4OI7A 5ALLA 5K9JH 4B9YA 3C08L 2RAPA 4TRRA 3RFZC 3QT2A 5FWNA 3BZFA 5KSVB 3FYUA 2P5WB 3DEKA 4NTZA 2GEEA 3RVRA 3BXXA 2DCMA 1QZTA 4AJKA 5IMLB 1GZQB 2ITDB 2IUUA 2ZBQA 1I9JH 1IGIL 2XT9A 3ETNA 1JMXA 2PT9A 3GRVA 5FYLD 2YOCA 4LJLA 4TLKA 5KOHB 4Y1GA 3WYAA 2H47C 2O5EA 3IA7A 4X9FA 3PU6A 3C75A 4Z7NF 1PKQA 2W88A 4M5SA 2VKWA 5LAXA 4RO0A 3GARA 4CM9A 3A6CL 2DKSA 2QRQA 2FFAA 4BDSA 4AGPA 2IY8A 2HV8A 1K6EA 4GXUN 4J0DA 2QYHA 2F19L 4ND7A 1R3JB 5G1NA 1F7VA 1WG3A 1HU8A 1TYZA 4KQ2A 4AJOA 5CFAA 2CLMB 4AKPA 3JAMA 2CIIA 5IVXA 1G9XA 1Q20A 5JNYB 4NN6B 1JPNA 5D2CA 4IIEA 4FN5A 5C8VA 2WU4A 3RT1A 2N75A 4YHPB 3T4AB 5T5FA 3U6XS 1Z6PA 4NZTL 1A7OH 2X4OB 2WB7A 5BSVA 2J4WH 4PLHA 5HIKA 4C3ZA 5DOVA 4QY8B 2IOMA 1NQXA 3JWDL 3QNZA 4OKVA 4BIKA 1GZHA 3RY6A 3L07A 5ICSA 3T3MF 1OAYL 3GVCA 5CLFA 5BVPL 2FO8A 3MBEB 4Q3KA 4M21A 1U8MB 4QDUA 9LDBA 5LNEA 4FCCA 2HHJA 5AXBA 4U2FA 1E1MA 1SXQA 4XDHA 4LK3A 3ULUD 1E3JA 4Y7OC 2ENUA 2FR0A 4FYXA 4WD3A 4DR4B 3MV11 1TU2B 2A7BA 2Q3EA 4O02L 1Q94A 2ZUFA 4LNRB 1RJCA 3IT1A 3LQQA 5EE3A 3CUKA 3RNQA 4PG2C 3E3QE 3JD1A 3R3HA 5EJ7A 2C58A 2JCCA 4QRHA 3MKKA 1D6SA 1WTCA 2A9NH 2G3NA 1LE9A 1KC5L 2MWCA 2PO6C 5BR8B 2Z64C 3UGQA 5I19L 2QSYA 3ZLBA 1OFUA 2N46A 3BL5A 1BVYF 3CZSA 1H3UA 5DK0B 1NASA 1ZH8A 4DCVA 4XPTH 3WDLA 3BMNB 1QLRA 1GOGA 4JKWA 5AVYB 3VX3A 4KZ0A 1HZHH 1VB5A 3BGMA 5I18H 1TM7E 4QO8A 1U3HC 3HBAA 3L0ZA 3DP7A 1MVOA 4LK4A 1GZ3A 2P49B 4X92A 3O4LE 3MGOB 5CKGA 2WLIA 4FTVD 4B7UA 3ARSA 4N0YH 1C5CH 2BHYA 5E9WA 5CINH 4AVIA 2XZDA 5D1HA 1CSEE 4P5TB 3GELA 2OA0A 3H2KA 4P3DA 4WI3A 2BGJA 2GYSA 5EEWA 4LPYA 1HZKA 1E0SA 5GGQH 5G4KB 4DEPB 2VR3A 1ZLXA 5CLGA 4ONGL 2R7EB 2DQMA 1N3YA 1DYZA 4XOBA 4BFZA 3KZ8A 3WLWD 3MJ9H 4HCJA 3IVGA 4TSAL 4KXVA 2KZKA 3CVJA 1H2YA 1ZKAA 2PXAA 3USZA 5T7BA 4Z76B 2GN1A 5TRTA 1R7RA 5BPFA 5KSWB 3E22B 2DHDA 4XWWA 4KH2A 1E63A 2P8MA 1DZ0A 1RZKC 1T89A 2AK4D 1C3OB 3C5ZB 1XGTA 1RJ9A 4KKCC 1Z5ZA 1BGXT 1EH5A 3QXHA 1Y7TA 3L01A 4MCZA 2AJZB 1ZNXA 5A6LA 4S1DC 4FQ2L 3O3NB 5F2NA 1PCSA 5B3SB 4OZIE 1U2TA 3LXRA 5KREA 4NKRA 3P2KA 2WP8J 1IUOA 3B3AA 3LMJL 4F37K 1NCCL 2J59A 3C60D 4JZJC 4DV2B 5LXTA 4G5RA 4CMGA 2VQTA 4LVNC 5D2NA 3MLAA 1XIWA 5D87A 1DB3A 4OFIA 4MR7A 1AHWB 4GT0A 4N7BA 1N4XL 3WK8A 4Y2SA 4PG9B 1H8EA 3UTSE 3CJRA 1XYVA 3S8YA 3RGGA 4JOSA 1TK3A 1K85A 3ZHNA 1EFDN 1NT2A 3WYFA 4G5QA 3WL3A 1OJ7A 4ZT1A 1E4WH 3K0WA 1TIPA 3F2LA 1MW9X 2W8CA 2YRZA 2X4LA 3NHFA 3IAS6 3SE9L 1NW5A 1Z6GA 4MCYA 3E3QC 2P3OA 2QADD 2HA0A 2AEQH 2FEDC 5IAOA 5EO0B 3DDFA 2C9VA 3SN6A 1F1DA 1IBSA 2V9UA 3L2LA 1MCCA 5T1MA 1WXQA 4NI5A 2I2WA 3M6VA 1BHGA 5IVZB 1IILE 4OFYD 4P86A 5LXGH 4BO4A 3A9WA 2X4NB 1T20A 1SEBB 4K3VA 2VUUA 4J3WA 3MV9B 1OWOA 2V6HA 5GSVA 3S35H 2B59A 4IIFA 1DXYA 2VAJA 2IPAB 1IQWL 2IOOA 3LQZA 1U3JA 2FWSA 1TL7C 3K6SB 1JWUA 4WFGE 4V3CA 4WA8A 3VO8A 1IKNA 4E7OA 4PX2A 2VK1A 3UBXG 3T52A 5D5QA 3G2QA 4FKBA 2X5XA 3BD6A 1DZBA 4Z1MA 4S11A 3TT3L 4CKXA 2FY8A 4PSDA 3NBAA 1DARA 2ICAA 3ZU6A 4CGTA 3MXVL 2V3FA 3QSKB 3ZV7A 4EPRA 2XE7A 3GSOA 4WO4D 3HEAA 5BW5A 1G20E 1C9DB 1WMEA 5FUVA 1QIJA 4MQ4A 3C6QA 5CHEA 1UJBA 4PRID 1ZIBA 2RAVA 3C6SA 3ASNB 4BPRA 5C35A 2VHCA 2WHQA 4NKQB 4XGZB 4EF6A 3AG4B 3APCA 2OHOA 4ID3A 1C3JA 4BFVA 3EJYD 1H5BB 2FSSA 4K2UL 3AETB 4JLPA 1ARZA 1EQWA 5ILGA 4IOFD 1NRJB 3S27A 3GLKA 4H1LA 4ZGWA 4UMVA 1E9QB 2W07B 3LSYA 4C0XA 1JRLA 3V7AE 1IM2A 4D82A 4BKSC 4U1JB 6FABL 1KB9K 1VGKA 4JN6B 4DGYL 1XNGA 2XKNB 2OFOA 3EFHA 4MUBA 5CA1A 5EMHA 2VDKL 4X7RA 1PG7W 2CLCX 1ODCA 1V6AA 4MV5A 2VUIB 2ERCA 2WLTA 1ZQ1A 5GISH 4DVBA 2P6OA 5E8DL 3RF6A 2V7QD 3STVA 5IJKA 4HSGA 3B6ZA 2QRVB 4WLCA 4Z18A 5CJXA 3QUML 5E9DD 4E5MA 1AGNA 2HHHB 1VZ3A 2DT5A 4IM7A 5I15L 3D05A 1QGAA 4QOEA 2BFCA 2GF2A 5EMYA 1AO7A 5F3BB 3DROB 3OKPA 3P9KA 2VF4X 4HUUA 4YHHB 1SEQL 3ASOB 5D70L 1GPOL 2B4AA 3TJHD 2P2DA 3THYA 3KPSE 3TQOA 1MCEA 4WTZA 4A7GF 4X61A 5EQFA 1FGVH 3OV6A 4XEHA 3HXMA 3I8SA 2G5UA 4L4VE 3TJEH 1K89A 1MIML 4PJCE 4PTTA 1NFIB 3COVA 4IFBA 4RABA 4I2VA 5JDIC 5C8XA 2XLBA 4HS8H 1I0ZA 1WV7T 1PEYA 4E12A 1UBLS 5EQDA 3V9EA 5I16B 1WPCA 1AKWA 4Z4QA 1Y5NA 7ABPA 4ENUA 5I3ZA 5D2LA 1SY6H 3K74B 2F3RA 3P11H 1LILA 2BBTA 2NO5A 3FMGH 3EVEA 4CSPA 1EIZA 4CSZA 1WR8A 1Z5VA 2HSZA 4DBVO 2QGFA 5MERA 2IQIA 2CLRA 4P93A 3KC2A 5GGXA 3RDTB 5CIPH 3KKPA 3T6QC 2XIDA 1T9CA 3LKSA 2FEXA 1DQDL 2VXTH 1NW3A 1MFVA 2YHBA 4G0XA 5J9FA 3O8XA 4X95A 1Q91A 3PI7A 2WNKA 5FYLH 4DGVH 5EIEA 2J21A 2X9YA 4N2NA 4IXDA 3GRWA 1X1AA 1B0WA 5KG9B 2I4IA 3I3SR 3OZVA 3JYNA 3ICPA 3G6JF 4ZTPH 1E7YA 4XX0B 2IZOA 1HIML 5IQ7L 1KSFX 4L4UA 4APQC 3HRZA 4AEFA 4EA8A 2CGRL 3C3CA 3OE5A 2CNZA 2ITCB 1IL1A 4F7TB 4UNVA 4ZALA 1KYOJ 1Z2DA 1PTKA 2PS9A 2Y6UA 3TYGH 4LMQE 3ZE0B 1UJ3C 2WAMA 3W82A 3LPMA 4MNHA 5LZ5A 3IFLH 1CEQA 1E2NA 3TAHA 5ILOA 2QN6A 3IVRA 2Y3AA 4FG2A 3JWOL 4BXOA 4N2HA 4NQSA 2A1WL 4S3MA 2YVKA 1F9EA 4QKQA 1I30A 5DJ6B 1DEDA 4P5PA 4J0GA 2RE8A 1KFBB 3CZMA 3I05A 1G5RA 3CHOA 2AI0H 3IU4H 2NAPA 2FDCA 2ZBRA 4FNRA 2KI5A 4NQDB 4MVJM 3EBOA 4ZDKA 3PNWA 4I3FA 4A0GA 4I89A 2ZYHA 3HKFA 4OM0H 1Y4ZA 3HP1A 4X5PA 4JCMA 3WTBA 3O8OB 3DC7A 3GMRB 4XWTA 3X1XA 3I9KA 3QWRD 4HVCA 5KN5B 3ULUH 1B6GA 3WLMA 2YEZA 4OX9Y 4Z8FH 3DLPX 4LWZA 1W581 4Z4GA 2H11A 4TV8A 5L4LA 4AFNA 1WTLA 2ODBA 4BB5A 2BZDA 1WB4A 2VM4A 1YTLA 1KGYE 3ZOZA 1LEHA 5HVWA 1FFQA 4N5MA 5KQPA 2WDPA 3NVKI 1YS9A 2Q29A 3GJFB 4YTEA 1Z28A 1C7QA 4URHA 4YROA 5I28A 2QROA 3CN7A 5KSBB 4KNWA 5DU7A 3V4RA 1EBAA 2ZBFA 3FD8A 3QR2A 3BCRA 1QF7A 4B4OA 3EF0A 3KEMA 3QIBB 4JU9A 4PZDA 5DZVA 3ND5A 2PS3A 2HN9A 2FPRA 4FNUA 2BJMH 4OIIH 3C0KA 3KYOB 4JG0H 5EU7E 3TECE 1QMPA 3A4VA 3L06A 3EOAI 4WUUB 1P0PA 2WXFA 3DE3X 3C3DA 3NC0C 1DT3A 3KM0A 5KTNA 3PG2A 2RHOA 4F6LA 1F0NA 4RFEB 2XCTB 1T5KA 1OSEA 4PY7A 1BLIA 4M1ZA 4HB3A 3QHFH 2AG8A 1JGLH 1T2QL 4MW2A 4R1NA 3HZHA 4KKAC 2W4IA 5J4KA 1EJ6A 3OFJA 3AEKA 1HAWA 3TOVA 2UVPB 5BQ3A 1UANA 4JQOA 3QU7A 3QFSA 2QSCH 4GYWA 2ED7A 1XCWA 2HRDA 2VYNA 4ZJPA 4ICXA 1OP3H 3LN4B 3EUFA 3BH8A 2F58H 3DPBB 3A6DA 3F4LA 4M8QB 5E51A 4A0SA 3N40P 1THCA 1JGEB 4X7SL 3NIFB 2AD1A 5KYNA 4C56B 5E4AA 2OXEA 1JPUA 2YZ8A 4MTCA 4J0JA 4FQJH 4DYVA 4KH0A 3HXQA 1ZT4B 1CG9B 2X1OA 3X1JA 1PJ8A 1VYTA 2OGTA 2QVGA 3Q9NA 2Y4SA 1OTSC 3P2JA 1CZ8H 2GTWB 1XCGB 4P06A 4XBEL 3H3KA 5IHUL 2E5FA 1KAMA 2FH5B 4GLFA 5I7UA 4EKYA 5BQDA 1FTGA 2BGTA 1AAJA 2Z8ZA 4AWXA 3O2WL 4NJ9H 2ZP8A 1TVBA 3AEUB 4W9GC 2G7MC 1CS0B 2EKPA 3N7UA 1TECE 2BVTA 4I66A 1IN1A 4G89A 1M05B 2K70A 1PFGA 4L0PB 3PXUA 4RORA 4QOKA 3WFDL 3RIXA 5JH7B 1ZGAA 4HAZA 4QTFA 1QFMA 1R4MA 3WKCA 2WBKA 1ZH2A 5C3IA 4ORGB 1W72B 2NP6A 1EBPA 1PY9A 4YSTA 1AXRA 3MRIB 2NO0A 4P83A 4Y5XA 4AM0B 1E4YA 4BJ3A 2ZXUA 3MC0A 3VXTA 3W6OA 3ACBA 5F89B 1HY3A 3L7NA 3T4YA 1I10A 4YV2A 3U1SL 5F9OL 5GGTH 2P5TB 2BNRE 3ZL2A 5EU3A 1FDLH 5GRUH 5GZNC 2QVYX 3QLEA 4PJIA 5TPWL 3VHLB 3BXNA 4ARBA 4POUB 4A7UA 3MAJA 4KDEA 1E2IA 3IRUA 4QWMA 4UUNA 2BRRL 5D7NA 2AQPA 5D6NA 1F60A 5FHAL 1OYWA 4MYUA 2H1LA 3H75A 3T6VA 5H3LA 3FU6A 3ONVA 4P3OA 5AYUL 2VZEA 3GLGA 3MA9L 2EH7H 4H1LG 2KC0A 4N0UA 4U7PB 4MAFA 4EOGA 1LO2H 1Z2KA 1HYEA 4K2HA 4NM4H 2QLFA 3FAWA 5E24E 1PYOA 2GJZB 1S2IA 1E32A 1JTVA 5H4ZA 2LWIA 3UWPA 1DC6A 1RI5A 3PY9A 1KLUB 1DQML 1FX0A 1X8LA 1MX1A 2ZOLB 2VTBB 1OXMA 1S4MA 4BQSA 5I0WA 3UMYA 3BB4A 3WKNA 4ISVB 2J20A 5ADHA 5ALGA 5CX4A 3RZCA 2VXSH 5L8KB 3OOYA 2QAJA 4BKLA 2XMCA 1N7MH 4E68A 4WEBL 3UMGA 3ABMB 1OT1A 1SCJA 3F0TA 4IDLA 2BVQA 3MBXL 1YNSA 2DP4E 3WIOA 2AMFA 2FP4A 3G6DH 1KTRL 1WOMA 4GKSA 4WTZG 1SURA 1KY2A 5D1QA 4MCAA 3ZGXA 3VWJC 1KSJA 4BEVA 4GAGL 2OECA 3D6MA 2B30A 4QYMA 2IYAA 4RAUB 2DQZA 4D9JA 3H4FA 3N50A 4MWGA 3WV4A 3RFXA 4NJAL 3S1AA 2FXVA 1NWHA 4PXAA 2IHUA 1G6RH 2HLPA 5GGVY 3HFGA 4OLAA 1U8QA 4AG6A 2R69H 1P2VA 3AVQA 1OCWH 3KEQA 4DP9X 2GLXA 2KPOA 3KL4A 2BP7A 1QI4A 4V24A 1U0RA 2FMKA 3EIQA 1KVRA 1GS8A 3G5WA 4RD1A 1QSFA 1LJMA 1NMAH 3OR7A 4ZK8A 3H8NA 4U9HS 1RXUA 5I8OL 1FJ1B 1Q16A 1RPZA 4U3HA 2MCAA 4AYWA 1L3NA 2OVFA 4GI3A 2A6PA 3OZRA 3RU7A 1WXGA 5K2OA 5BQ5A 4WUTA 4URXR 2V5UA 2HM7A 4A1RA 1ENPA 3HE3A 3LEYH 3SDDC 4C4TA 3PJEA 4PG6A 4YB8A 1CE1H 4FG6C 3O93A 3QJFB 4GMKA 3W06A 4IEFB 4J4PA 4ZXBB 3FW1A 2HKHL 2R7NA 2CUKA 4PGCB 5SWZE 4L9DA 4U6TA 1N8TA 3CLHA 5EC2B 4F4CA 5J11C 3LKPA 1KMHA 4JP8A 4OHOA 5LDUA 3L81A 3SKUD 1E2ZA 5K03A 3CRW1 4CFZA 4AOFA 1VMAA 2F7QA 3G17A 4AENA 1IJ9A 1GY2A 1D9KA 4K0OA 3LH5A 1THAA 4TVOA 3T5CA 4YPOA 3H2SA 3CUWA 3PFKA 3WXMA 4P4KB 1YRBA 1L6PA 1RJWA 3L3JA 1NIAA 2HAEA 3ZK9A 1DL5A 1C8QA 5AUPB 1GTMA 3QXGA 4CTNA 6NULA 4I2XA 1G66A 1H2XA 3Q5TA 4OK5A 4UZUA 1UT5A 3GYGA 4N90E 1JEAA 4XI5C 2YYSA 4KIFA 3W5IA 1JQ3A 2Y5EA 4BUCA 5KCMA 3G2JA 5F23A 3ZHTA 3A06A 4LOAA 1II4E 5JQGF 2BHSA 3ML1A 4QRQA 4JVSB 4EVRA 4JBYA 2IW1A 4CMHC 1R3LB 3KPRE 4JKPH 4KE9A 1AOZA 3HMWL 2WT4A 2YMTA 4K9LA 4PJHA 3JRNA 2YAOA 3QI9D 1M74A 2JJWA 1X5FA 2I4TA 3IVMA 5AK5A 1MCPH 2BWJA 3Q8LA 3BXOA 5CLQA 1O4VA 1FMTA 3AJEA 1F97A 4P2CG 3HG3A 2FQFA 4JCWA 4BC1A 4IBWA 2B78A 4XIYA 2PMBA 5AI5A 4YYZA 2LLGA 5KBDA 4JFYB 3DMMC 3QWOB 5EZLA 1FG2B 3SK0A 3C2AL 1GGIH 1MY5A 4YAQB 4BO0A 3TZVC 4R7DB 1YJDH 3FDJA 3BGDA 8ABPA 1XXDC 3IBEA 2CFSA 5B4TA 2NY0C 4H0IA 1D0SA 2EBWA 4IQHA 1OIWA 2QZZA 1YRWA 1P2FA 3G5YA 4WI8A 1WUIS 3ZH9B 3TD6A 1J90A 5C07A 4HKJA 2BOLA 3LPFA 2BOCA 2GEKA 4GP4B 1X5YA 3LLMA 5CDHA 2BKVA 3H7BA 4RBNA 2JBAB 1ZK2A 1WBDA 1DIAA 3DRTA 3MRGA 2JJ2A 5J5CA 1A4XA 1BXAA 1TMKA 4KHPB 3D2UD