5HDBB

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 114
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5hdbB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5hdbB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5hdbB03
1YUKA 4M76B 1JEQB 3EG9A 3K72A 3OKYB 1IJKA 1L5GA 3K6SB 4O3TB 1CK4A 3IBSA 1M2OA 4HQLA 4HQOA 5E6RA 4MMZA 4NENA 1RD4A 2VDMB 4MMXA 2XWBF 5KYUA 3PPYA 1DZIA 3HXQA 1PT6A 3AL9A 4CN8A 1U0NA 3OL2A 1T0PA 1U8CB 1XUOA 2NVOA 4HQFA 1JEYB 1Q0PA 1UEXC 1MF7A 4XW2A 3ZE2B 3EH1A 5KYNA 1RS0A 2WW8A 1AO3A 1OAKA 1IDOA 4WJKB 4Z7OB 1M10A 3E2MA 3K71B 1AUQA 4O02B 2M32A 5KYXB 4HQKA 5LN1A 3IJEB 1QC5A 5HGJA 4UM9D 4G1MA 4G1EB 3OKWA 2NUPA 2P26A 3V4PB 3ZDXB 3EH2A 3EGXA 5KYYA 1ATZA 1NA5A 3EFOB 1M1XB 1V7PC 2QTVA 1JEQA 2WINI 3K6SA 3BQNB 5ES4B 3TW0A 1ZONA 3TVYA 4IXDA 1CQPA 1IDN1 5BV8A 1MQ9A 3AL8A 2VDKB 1MQAA 1JV2B 1SHTX 5E6UA 4DMUB 1M2VB 3EGDB 1JEYA 4IHKA 4CN9A 1M1UA 5KYWB 4C2AA 3BN3A 2UZYB 3VI4B 1T6BY 2VDNB 2ADFA 5HDBB 3K71A 3EG9B 4C2BA 4PN7A 1LFAA 1L5GB 5E6RB 3ZDZB 1SHUX 4UM9B 1JLMA 3FCSA 2NUTA 2VC2B 1FNSA 3PPVA 3NIFB 4G1EA 1U0OC 4MMXB 4Z7QB 4K3JB 2ODPA 1SQ0A 4WFQA 4HQNA 4GZ8A 3Q3GE 1YVPA 1MJNA 1PD1A 3OL2B 4FWWA 3EFOA 1M1XA 3EOBI 4C29A 5HJ2A 1XDGA 2I91A 3ZDYB 1BHO1 1FE8A 1RTKA 4F1JA 4BJ3A 4MMYB 4WK4B 1AOXA 5E6SB 4IGIA 2O7NA 3TXAA 2I6QA 4WK2B 1U8CA 3GXBA 2VDQB 1YVRA 1QC5B 1M2VA 1RRKA 4G1MB 3T3MB 1ZOPA 4O3UB 1MQ8B 2NUPB 3NVQA 3BQMB 3F74A 4FX5A 5KYWA 1N3YA 1QCYA 1IJBA 2ICAA 2VDPB 3ZE0B 2P28A 3T3PB 3TCXB 3K72B 1PCXA 4O02A 1TYEB 1N9ZA 5KYXA 4MMZB 1MHPA 4NENB 3IJEA 3NIGB 3ZE1B 4F1KA 3VI3B 5KYUB 2B2XA 1SSLA 3HI6A 3V4VB 3QA3E 2IUEA 3AL8B 1SHYB 3F78A 3N2NA 5E6UB 2VDLB 3M6FA 3PPXA 3PPWA 1DGQA 3FCUB 4UM8B 2XWJI 3HXOA 1BHQ1 2I6SA 4Z7NB 4MMYA 2X5NA 5E6SA 1OLZA 4NEHB 1JV2A 2ODQA 3RAGA 4CNBA 1PD0A 1ZOOA 3FCSB 4WK0B 2NUTB 3EGDA 2VDRB 2VDOB 3ZQKA 3AFCA 4A0QA 2XGGA 3EGXB 1XDDA 3EOAI 5KYYB 4JX0A 3NIDB 4JDUA
chains in the Genus database with same CATH superfamily
3G7TA 1ADCA 1YY9D 3MGTB 1YKFA 1UJBA 1ZD4A 2BEVA 2MQ0A 3VVWA 2AJXH 1Q83A 2EZUA 2DBYA 1P7YA 1PW5A 1XHHA 5HYQB 3KQVA 4JUFA 3VBEA 3KB1A 4M46A 4F9FA 1ZVJA 4DLUA 1DQQA 1JG6A 1T9GR 4XO4A 1ZLSL 1NAML 2JLQA 4CKEB 2I29A 2QT6A 2QSCL 4LWOA 2C8KA 4DC0A 4Q93A 1P3JA 4KMSA 2QRGA 3PWVB 4PI0A 4HNUA 2J9FB 4R83A 3T4AA 1NLFA 2X1MA 1E3SA 3G2OA 1U1DA 4JR0A 1HN1A 2NXCA 4OFQA 1M2OB 3E8XA 2R00A 2QLLA 4MB0A 1G7QB 1EDHA 3O4FA 4QTHA 3N39C 1PGRB 4KY1L 1NXWA 2CNNA 3QKIA 5E6IB 1ZMYA 1MGPA 4NMXB 2JIZD 3ESOA 5A9SA 3DUFB 3QVWA 3RFUA 2DUWA 1SDAB 3M34A 3ZEAA 4A37A 4IQGA 3WGOA 4TQ8A 3PA6A 1X7HA 4A04A 3V7UA 4XCNA 1W87A 3M07A 5KJRL 5LP6B 1FFHA 5EJ6A 5EPEA 4DN3L 4JFWA 1H2ZA 3RSHA 3P9LA 5C07D 3SJ7A 1OLZA 3GNMH 4UQIM 1RLJA 3QSGA 5D3ZA 4KFSA 3KQHA 3FCBA 3KC2A 4ZD6A 2E6UX 3CZ9A 3C6LD 1DLIA 1WDWB 1CF9A 2GDZA 1FDLH 5D7JC 3C7CB 3UJJL 4ZCQA 5FWNA 1I9JL 1O8CA 4Z7OF 1RYBA 3HB0A 2X1PA 3U40A 5JJLA 1I8IB 5KEZA 3B9PA 3WNJA 2DC1A 2Y06H 4HH3C 1IWBB 4Q4AB 2QZSA 5FO7B 3B43A 3SOZA 3E1GA 2IAAC 4DGYL 3L4WA 3B2MA 2PMZA 1C14A 4U7WA 2XSKA 3QDMD 3V7MA 3HR6A 3KRTA 2VLKA 1QG2A 1U7WA 3RSQA 2EW1A 3HB4X 3U9PL 4HSAC 3C08H 3DX6A 5K9KA 5T67A 5EOCH 2H18A 3KPYA 2PCFB 2XT1B 1JDVA 2XQYK 1OT4A 2BHYA 3OV6A 1VZ2A 3HADA 4C7KA 2F15A 4WGVB 4RA9B 2ATPA 5K3FB 3VR5D 4W5NA 1JXKA 4PGGA 4QY8A 5EHFA 2VCEA 3FF1A 4PJ7F 3ZZ0A 4CLRA 3U4EA 1T3TA 3QHPA 3A6BH 3RY6C 4P08A 2BP7A 2Q2OA 4TZTA 1NMAH 3QSKB 2AXPA 4I50B 5GJWC 1B0WA 5DBIA 1KAOA 3AVEA 5BR1A 1Z0IA 1UXOA 3FB7B 4B31A 1QD0A 5J2UB 2XVXA 4TSCL 3IP8A 4MVWA 5FLVA 5EA2A 1EFXD 5GGSA 4UQDA 3EISA 3GJRA 3CURA 1SEVA 4GAFB 3AM4A 2CCVA 3MREB 1O6BA 5IEJA 2Y4SA 4I4WA 1BRMA 3F7VA 5IQ9A 4XCEB 2Z4QB 1JFVA 3PU7A 1YQDA 5HHXL 3DHYA 4XWOD 3U7JA 1JFHA 1G6VK 3FAKA 4BNTA 1KXJA 1DEEB 3OA2A 3FHOA 3AG4B 1BA3A 4S24A 4GQPH 5CTAA 4Q52A 3SZMA 5HIMA 4H20H 2SKDA 4FTVA 3U49A 4HJIA 2F61A 3S35L 3CPLB 2XMBA 3ECBA 1NX6A 3OPYB 1ZCAA 4UUQA 4BNJA 2FRGP 3DHUA 2LE9A 3TW8A 1TGYA 4CDGA 3KGSA 1BSVA 1S8DB 3DVAB 1OGAA 4X8OA 1MIHA 3IFOB 4RVHA 2XPCA 1AMOA 2V5YA 4ZJUA 2EBUA 3NGBB 5HM6A 4XOUA 3O2VL 3DDSA 1L7DA 2OGTA 2RGCA 3HC7A 1CFNA 2V55B 1B8UA 3HUJF 4JKWA 1KGDA 4B7ZA 3IHLA 3KCPB 1RQRA 1YZVA 4G7RB 4CL0A 1O96B 1XR8A 4EECA 4YRMA 3FQUB 5JMOC 2OSVA 1BFUA 1X9QA 4CUCA 2DKNA 4Y1RA 3IBGA 1Z3GH 5MHSE 1KH1A 1KTDB 1USWA 4QOSA 1SVIA 4XYBA 4FCAA 2Y7MA 3EO0A 1QFUL 3RSFA 5CKGA 4PLCA 3V3TA 5ANRB 2RKBA 4OCNC 3AG1B 4OLWH 5LAPA 4HZIA 1VADB 4WWKC 3DFIA 4BC0A 1Z82A 3A32A 2H32B 2FJFB 3G5ZB 1H19A 3CCHA 1QWNA 4WNAA 5TC4A 2ONCA 3QJYA 3U1SH 4KFUA 2ID7A 4YPVA 2YZMA 1KPGA 1UA7A 4K5PA 4AJNA 2G5BB 4ZJYA 2MOVA 3L9WA 1WD8A 4DA0A 4CIDA 2XN9E 4ODHH 1CUZA 2PJRA 3P9CA 4RANA 3FFAA 4HB0A 3SEZA 1C1DB 3N2KA 4TT3D 5CVDA 1T1SA 2BZ1A 4MW1A 5EU3B 2PTTA 4JIGA 2JLUA 2CJSA 2HLPA 3L9BA 4Z8FL 3P3TA 2B98A 4OV5A 4APXA 4L4ZA 3VOBA 2ARKA 4N2DA 3V4UL 1R16A 1B23P 3CMGA 2CBGA 4BO1A 1IUPA 4J4PC 3DEAA 5D1QC 3WGLA 3H2YA 1S4QA 1CYGA 4JW3A 4D3FA 3CJJA 3U4AA 3SG0A 1QWOA 4TKMA 3IJSA 3RSCA 4MZ2A 2H85A 5EDSA 4YJ2F 3D3VA 1E8WA 3MUGB 2CG9X 1OV6A 4CVZA 5B7FA 2L42A 4AMZA 1CQKA 4J29A 3HWWA 1NJSA 3JZYA 2AXHA 3LXXA 2OA9A 3ZWMA 3I5AA 2I78A 1Z4QA 1V3LA 1NAKH 3HS8A 2Y1FA 5TF1H 1T20B 4KKAD 2XUHA 3OH8A 2BCGY 1S7XA 2IKSA 1YQTA 3O84A 1NH6A 3QIUA 2QG9A 5AVRA 4ZOCA 2IBSA 1YEEL 4RKQA 3CUPB 1J07A 1A9XB 3MLBA 2YVAA 1KIUA 1MO6A 2V9ZA 1Y3HA 1MC8A 2W6ZA 5ILGA 4JI6B 4CT0A 2YMMA 1YEDA 2V8BA 4DLZA 2FJUA 3MYRA 4AIIA 3J81A 1N6LA 4UOEA 3A3PA 4G9DA 3R7WA 4AULA 5T1LA 1YHNA 4F8PA 5BQDA 4P2QD 3I72A 3QIBB 1OB0A 5JW3L 2XXCB 3E9TA 2H4JA 4F3CA 3FAWA 2VDNH 4P5MA 1BZDA 4EUPB 4KQ9A 2BK8A 3RQIA 3WJ7A 2L7JA 3BLBA 1VKNA 1Z4IA 5FB3A 1TTPB 3ZBMA 4P4TA 1YR2A 2C0QA 2YY7A 3AXSA 3G04A 3L6FA 1I8LA 2IO5A 4Y5VA 3C09B 4Y2VA 2XN9B 4TVPL 3UN1A 2N0KA 3QXUA 3QA3A 4OQ4A 3V8MA 2E74C 4JO4L 1WDMA 4RTOA 2OPBA 5J2TF 1F3JB 3PP3H 1IGMH 4NKIH 3HUTA 4D80A 5F5NA 4FFRA 1FMLA 2LP4Y 1FVXA 4BWWA 1F2UB 4A1FA 5JHMA 2ZBPA 3OZ9H 4RE6A 3TA3C 4J0JA 2IH9A 5LNEA 3WN5C 2J0QA 1PDWA 5D9SA 5JYLA 3RYCA 4MHTA 3RNQB 2XJLA 4YASA 1I1HA 3KLQA 2YD0A 2GY5A 4G8IA 1KU0A 3H85A 3VWKC 1PF3A 3O11B 1XQ6A 3H9HA 4TSRA 4Y9GA 1GNTA 5EKXA 3RAFC 3VFUB 3DPUA 3BIBX 5EHXA 4PE5B 2P3QA 3INUH 5IKOA 1J9RA 2ODTX 3OF5A 4HSEA 3VX3A 4B2IA 2BP3A 5THXA 3TBSB 1KOFA 4ZGWA 1EXNA 4P3KA 3E6HA 4FOTA 3LI2A 3VO1A 1PZ5B 2ESVB 3WTXA 5DURB 2HA0A 3LPOA 1SBCA 1YNKL 4U0QB 1PQPA 3EYOB 1HL5A 4LBVA 2RK6A 3VFNA 5FYKE 1K3ZA 3DBIA 3ZE2B 2CD0A 3SFZA 1TYBE 4XNQB 1M7DA 2J2ZA 4ZO8A 3QVTA 3GVHA 4E5NA 4QDJA 4PPGA 3K9GA 3AROA 2VPZA 3LMJH 1JVBA 4TLSA 1DJLA 1XF1A 5EU5A 3I6YA 4I2XB 5BSRA 2AHOA 2W7TA 3WB9A 5KOJA 3O9WB 5ICGA 2Z98A 2XETA 1CDBA 4H15A 4APQD 3CCFA 3SE4A 1P1RA 3GKZA 4P3CL 4MR8A 4NR0A 3D4PA 3NTVA 4M1CC 5SWZB 3ANYB 3A1TA 1EGMB 2WLIA 5JIIA 1XU4A 1FBTA 3F49S 2P78A 4PAQA 4ZVSA 1BKDR 1IZJA 4ANUA 5I9IA 3HPJB 2YKKA 2MCFA 1YBMA 4GL4A 1IARB 4UAOB 3ML8A 3DX1A 4RWYL 2W9XA 2H7CA 3BWAA 1MUUA 3OT5A 4JLKA 4NCIA 4Z7OE 3S36H 4DH2A 2IVZA 4R4NC 4D99A 4M5YL 1JHUA 5CA1B 4R9UC 4HIXL 4HPXB 5ESVB 2PWFA 4PWZA 4R2HA 3WFDH 1YK1A 3P9XA 2IS1A 1EK1A 1CWVA 5DX8A 1PL7A 2WU8A 4QDGA 4Z51A 5KVDE 5C0OE 4H40A 1ZLEA 4TNFA 1A9TA 3LSOA 1UTDA 1ID8A 4Y0AA 5FOSA 5BV1A 3AFNA 2D06A 2AK3A 1TPXC 5EC2A 3BWYA 4QBIA 1OE3A 5AK6A 3S2IA 5FHAH 1S01A 1UFKA 5EUKB 1K0FA 2KLBA 4FJYA 1UJ6A 1XNJA 1VJ1A 1L1RA 4G37A 4MRCA 5IQOA 4OD1H 1J1OH 1DRKA 5DVMA 3JQPA 3K32A 3MQ4A 5JR3A 3HE6C 2WYVA 3B6IA 2F7RA 4LEIA 3QVVA 2G5PA 4OM0H 3MIZA 4KH9A 5HJ3B 3RUGB 3WLLA 1UB6B 1N3LA 5E08L 1ZIDA 4TUOB 1CHDA 1AS3A 1JDSA 1D5CA 3LQAC 3CBRA 3AWIA 3MBXH 1NGYB 3DM5A 3QHTC 4I1UA 3LVBA 4N6OA 3C87A 3V0HA 3ZWKA 1T80A 4GI6A 3V97A 4ERNA 3P73A 1O9WA 3YASA 3EAQA 1PJ4A 1B0ZA 2VP3A 1GQOA 4KVAA 5BO0D 2Q3BA 4X6EA 1GZPB 3LUHA 1BQEA 2VYRE 2ZTSA 1EBPA 3U79A 5D6CA 2HSGA 3M1OA 5LM3A 1A7BA 2EEAA 4Y9FA 1M2FA 5ALDA 4DNOA 2EDHA 3V0VA 2FCBA 2O5VA 3WO4B 2ZPUA 3DMTA 4NQCE 3US1A 1TKWA 1OGTB 1T9AA 1XCWA 3GK8L 1J87A 2QL5A 2AEIT 3QUMA 4Z7OB 1E4VA 2X1HA 4EY6A 3HUJE 3X1GA 2OCYC 5J06A 3A0RB 1KIFA 4WKOA 4EPWA 1UPBA 2CFSA 5EGSA 2BTQA 4PYHA 3EGXA 5DO2C 1GL7A 2ZB7A 4KR7A 4BFTA 1Y9ZA 2IGLA 1HQRA 2DH2A 4CG0A 1ZP6A 2Y1LA 1XROA 1FCGA 5AVWA 1UQUA 1MG5A 4FNRA 5EB9A 3IP3A 2I6FA 3K2IA 1W2GA 2GXSA 1KFEB 4PN7A 3H2IA 1P74A 1SFDA 4G6MH 1OKKA 1R17A 4WO4D 2Q10A 3UAXA 3OJWA 4XAQA 2LHAA 4G0NA 1VE6A 1B0UA 4EDWL 1JE1A 1A1OA 2HPTA 1F18A 1J0CA 3WGVA 4YRPA 1VZ3A 3CIAA 1ZOIA 4TL9A 1ABBA 1YB7A 2AXFA 3R7QA 4HDIB 1TT6A 4FHJA 2A3NA 3JV0A 2X2YA 4XBPB 1D9KA 4M6WA 4YGVB 4P5TC 2C8NA 4PPNA 1IBDA 1CQXA 1JEEA 2FBJH 4EGCB 3HPQA 1Y7TA 5HYVA 2WBWB 3Q5OA 4UTAA 2BHTA 2WWWA 4RSYA 3HFMH 1I6WA 3I61A 5L7WA 1C81A 1AUOA 3L8ZA 4L5AA 2VKWA 1T04A 5K39B 4ITUA 2C99A 4DADA 2OV1A 3AVUA 3IFNL 1G6RA 2HBYA 1QZZA 3T1OA 3PFGA 4EEZA 1HNGA 1U0FA 4JBNA 3EZ8A 1NVTA 4PHCA 2XCMC 4W5HA 2NXZC 3P9WB 2FG7C 2QVLA 1G8YA 5D55A 3AGPA 3VFGH 5GIRA 2CK3A 1BW9B 4R8SA 3KVRA 3SY0B 5L4JA 4HJGB 3VMPA 1KI9A 5B2EA 3EE6A 5BMOA 1X5LA 1MVUB 2CUZA 4GI1A 3WV0A 3V6OA 1ZT1B 3HRIA 3CLTC 3ZTNL 3AVTA 1IQDA 3W34A 3L3KA 4JRXA 1N3NB 3BDAA 4AY4A 2QV0A 4HIHA 4DABA 2ZJ5A 4XTRD 1RKVA 4YV0A 3HUJB 2D5AA 3C24A 4BQNA 2W98A 1AXSA 2XV3A 4NV1A 1ZMBA 3L45A 1JWLA 1W9HA 4ZSOA 2EXTA 4U6YB 2IUSA 3H42L 4BE5A 2BGMA 3F58L 2YTZA 5FL3A 4UATA 2Q2QA 1SGKA 1PTJC 4OZFH 4YRSA 2PPCA 3B7YA 1O94D 4QGGA 3GAZA 3NKFA 4NENB 1HQ4B 1AE1A 5JW4R 1J0YA 2IPNA 3KDSE 4NNOA 3ZDAA 4Y4HA 1KP3A 2E5EA 3SICE 1SOMA 1E42A 3UMMA 4H8HA 4XXCC 4UYPA 2LR0A 2WJJA 4OH1A 4ODVL 2QS9A 3UF0A 1KVQA 3F7YA 4I3SL 1UJMA 3I01A 2EWWA 2JI4A 1R6XA 1BIIB 2ORIA 4LSSH 3P96A 3L41A 1P2SA 4HKTA 1J99A 1USGA 2VGLM 3NA9H 2H2AA 1YEGH 16PKA 1D2CA 4J27A 1TETL 3ZV7A 5ID0B 3BP4A 3U61B 1VENA 4IKIA 3SEAA 3R0QA 3BRDA 3BD4A 3QEBZ 3TLMA 4WFGD 4I4NA 3JTSB 4CM5A 3OFND 4JDEA 3ZXAC 1INDL 3OX4A 1P7CA 1AI1H 4I0PD 1J8HD 2NRDA 3TFKC 2D1FA 2OAQ1 4Y2OA 1YMMD 4F7CA 4JV5B 1BJ8A 4L3CA 3CRRA 2DWXA 4MA1C 5JO5B 3QXVA 1DC5A 1T7ZA 3EG5A 3IXLA 4EG7A 8AT1A 1IQWH 5DK4A 3LPDA 1OAXL 1MW9X 4NHUA 4XGQA 3S4SG 3KBEA 1EFHA 2ZOTA 4AQ8A 3SKYA 1XEFA 3KPJA 2HWUA 1ZGLP 1ANUA 1S46A 5DM70 2IH1B 3NHYA 5LMZA 1W8OA 4RYLA 1JMVA 2P67A 1MHHB 2I03A 1MJ8H 1N1DA 1D2HA 4CQLB 3MNVA 2PU7A 2ZUCA 4YPJA 1F3RB 5B3LA 4ZVMA 4J3OH 1BBDH 3DRQB 5AVZB 3SKJH 1N4XH 3D0OA 3PX2A 2XCRB 3EPHA 2QPEB 4WSOA 5J5EA 3ICWA 4DCMA 2AJZB 5E8EB 2V65A 4MS3A 5M34A 3V2GA 2XWBB 7PAZA 1P4RA 2L3BA 2BJHA 3C6BA 2EIZA 1T22B 3QIVA 4B9YA 4QPPA 1DUYB 3C16C 5ECDA 2QDWA 3L7EB 2Y3AA 1XCQA 2EGUA 5EWIL 3AZOA 4Z9KB 4JKYA 4M1YA 3VG9B 3GMLB 3KYCA 1G9MH 1U6AH 2GSIB 1Z9NA 5F9DC 1JAXA 4PM4A 1WUIS 4D81A 1BQ3A 4NQSA 4UNIA 1C4OA 2VABA 3RJOA 4KX7A 3DSFL 2MPVA 4A68A 4EZKA 4D42A 4JQIA 2WFAA 2IXGA 2C00A 3P3SA 1J0EA 4BNZA 4NZMA 4XQEA 4IWNA 4PR3A 4KZEH 3W5AA 4WLVA 1ZEAH 4KPYA 3I6SA 1B0GB 1RCTE 1TMKA 4MUFA 3L0CA 4F71A 2IH2A 4HT1L 3TK1A 1MJNA 2G3XA 2A74A 2IGTA 1LCIA 5J2TB 4M1DH 4BV2A 1G0DA 3MTQA 2R39A 3VJRA 3SC4A 1FL3B 2HPOA 1EEYA 4E9LA 5IFHL 1Y8RB 5K8CA 1AN0A 3R09A 4OJFL 1DVFA 1EAJA 2ODAA 1BEZA 2VZ1A 3AFGA 4BINA 1TJPB 2CLIB 1N5AA 1MRSA 2FDXA 4LJLA 4KKPA 4QWWC 4PS3A 5E7QA 5GZ6A 5B39B 3IRVA 3L7LA 3RYFB 2I5YH 1RJ9B 3VH8G 2P2ZA 1UK6A 4JVLA 4RTLA 1WXWA 1K1EA 2B1RA 4M76B 4LOAA 3SGKC 4IDJH 4XO8A 3D3JA 3EA5A 5I6OA 1PT6A 2Z95A 4L07A 3QR1A 3TESA 3ADPA 1MIEH 2EUVA 1ZHNB 4LSRH 1BE6A 2Y5QA 1AY1H 3UA4A 2OAEA 4UTVA 3FO2B 3FVWA 1YDPA 1IBLB 3V4FA 2JLBA 4N2KA 1OZFA 1YQ9A 4W5TA 1DQML 2KX7A 4M98A 4A1RA 2DY0A 1SKYE 1C9KA 3UGKA 4DCPA 2VR6A 4GRWF 4CBZA 3BZDA 4G01B 4MVJG 1RSYA 1QRDA 4R1UA 4KKCD 3H3KA 3WGQA 3PIDA 2OCXA 5DWUL 5ENVA 3T1VA 2EYSB 1NSFA 1MY5A 3QVUA 3PWSA 4QOKE 3PHHA 2G9NA 2Y1KA 1PK8A 3KPMB 2YKLL 5BUAA 4RDQF 2HUNA 4C4BA 4HS3A 5GIOE 3LQAH 1H4SA 3L95B 3DFMA 4RVCA 4PJ9C 2ICAA 1A2QA 5KYKA 3VXNB 1S7SB 3FO9B 1AZCA 2A6DB 2YPLD 1ETJA 4JRLA 4FEMA 2YSTA 2J7LA 2NY1D 3Q5TA 1VHPA 3BD3A 4HH1A 5C80A 4JFFD 1AGFA 3T77A 1SY6L 5TEVA 2QRVB 4AMUA 5J11B 4XMPH 1CXZA 4YDIL 4BCXA 3F3SA 1MR3F 1HIML 1SWWA 4M88A 1AHHA 4WUUD 3RC8A 5DNYB 3BG5A 3JQOB 1JHVA 2QGCA 3SIKA 2J85A 2RHJA 3LKZA 5F52A 1CFTA 1S3GA 2B20A 3O4HA 2QDXA 2IUYA 1ZIOA 1VB3A 5D6DC 2QSZA 1PYWA 4TV9F 4L3EE 3NETA 2W9DH 2BH2A 2J5LB 2E27H 4M38A 3UJ9A 4JRYD 5C8DA 3DX9B 3ONWA 4HQQL 1G21B 4ZXBC 3KJEA 1E3JA 1P1ZA 4AY6A 4HZAA 3THYB 1FOEB 3EXJA 1FFCA 5JRZA 1IHUA 2BI4A 1TYAE 4U3SA 3JALB 2VXTL 4KRNA 2QTFA 2AJYL 4F56A 3TUZC 1XMWA 2FEJA 2DQHH 1SKYB 4A6PA 2ZTUA 4Q3NA 2CNZA 1I7TB 1BQRA 1P7ZA 4HB3A 5E99L 3SQOA 4MUHA 3IVCA 5DHVB 2OQIA 1E2HA 1SMKA 4OFPA 4UILL 3RAJH 3O1LA 4AYWA 2ICEB 4BKLA 3QEUB 3K6DA 5ICYA 2O3QA 4QOKB 4BX8A 4GX1A 2HD4A 3MT7A 3QIWB 2DHRA 1JYXA 3OF6D 3ZTWA 2NQDA 2H41A 1C3VA 1EJ8A 2W2XA 3JUZA 1KKLA 3UYRH 3RASA 1RUML 1WMBA 3IU3A 3CH1B 4GIOA 2MQ3A 1XIVA 1VLQA 2BIQA 3R7RA 3NFNA 4K6CA 2BWJA 3TOPA 1N77A 3DLCA 4M9QA 5LU8A 5KWJA 2AK4E 4CSZA 3UACA 4AAYA 1U58A 5E38A 1IGTA 3TO4B 4PTTB 2Z2YA 1I1AB 5DRTA 1NBMD 3NCJH 4P86A 5HI3D 2IIQA 4ZAFA 5DGQA 2IW3A 1HAUA 2CLKB 3R3YA 4R2GC 3PV0A 3TG8A 1CCWA 1ODCA 2JLVA 4BP8A 3FFCE 5AOVA 2PCLA 2XZOA 2WGNB 3MRRB 1D2AA 4TLUA 2QSUA 3NOXA 4E09A 2MSCB 4X4XB 1G7MA 1JGVL 5C71A 4ZAKD 3VE0B 4W9HC 4NHEA 1DADA 1R8YA 3T9FA 4E2YA 1W72L 2GPYA 4G7VL 1M74A 3CVVA 3AR7A 3H8SA 5J5CA 3AYZB 2OSLB 3SE8H 1PR2A 3L1JA 1MHPA 2WICA 2Q7YA 4X8HA 3IDJA 1KPVA 1GJUA 1L9PA 4LF3A 1MAJA 2OMYB 2P5WA 1ZUD1 4E1BA 3Q3CA 5CGZA 3HE7B 4WY7L 5EKDA 2RE8A 5IC4A 1GUBA 5KJ6A 2DIEA 1RRFA 2B2XH 2EJVA 5DI3B 3G82C 1ECCA 12E8H 1NUSA 3BUDA 3KJHA 2PXYC 5JR1L 2XTJE 1S3KL 3QDGB 1HE3A 1W49A 4FFWC 4Z1OA 1ZD6A 3COSA 1U8CB 2OXHA 1MPXA 1VBMA 4BFYA 3G0BA 3KXFD 3ORYA 5CLLA 3G89A 3WK6A 5FI3A 4M9OA 1TJGL 5IVOA 5KSAD 5ADUS 2R5WA 4MWSA 2BBWA 1WSBA 4CTKA 3QJ5A 4N9OB 3BAYA 3IUQA 3CLSC 5EE1A 2X44D 5JHLH 1Z4LA 3FPEA 1EFVB 2OECA 1UA3A 4K7JA 1L0PA 3VYPA 1VBNA 3DOUA 4GAGL 2E4YA 3WGUB 1HZHH 3J7AC 4PGFA 4YQXH 4Q05A 5IZ7A 3KG5A 1P2TA 3H19A 2CYBA 2D7DA 2DYPA 2CYCA 3AG5A 4D3XA 2AK4B 2XDQA 1N4AA 3WIIL 2VRAA 1BA9A 4PLZA 2X0JA 3UMRA 3AETB 1YZ3A 5I3ZA 5B6JA 1NCDH 4AFNA 3QUYA 3JQ8A 4X62B 1R9GA 5TK2A 4GFDA 4YJKA 2QUAA 1W5AA 2VT0A 2F53D 2G2PA 1UKAA 3VZDA 1VPOL 4WUKL 3AKZA 2VDPB 3ONDA 3RVUC 5C46F 1VIAA 3P52A 3KBOA 4RS4A 1E64A 3FFCB 3PVSA 5JXEA 3X12A 5HHPA 3LZFL 4QRUA 5DD5H 3WKCA 4B4UA 2BM9A 4LE2A 4RZXA 3RC2A 2DM4A 3TT1L 4EI8A 4N20A 3SDDD 1X5ZA 3OI7A 4O4HF 4PI2A 3EOAI 3TZVD 2WC1A 2VITA 2PQMA 4EPXA 1TSHA 5CCHE 3UJNA 3BKYL 8FABA 2JTYA 2LU7A 1AHWA 2D2XA 3OD5A 1O57A 4TLMB 1TTFA 2C5BA 3U83A 3EIQA 3L3GB 5AM0A 1Z0SA 1SU8A 2FYVA 3PLRA 2CM5A 2D0GA 4BP3A 5LQRA 4AQDA 1DP4A 4RZIA 2E8ZA 3F4KA 1KVUA 2ZSVA 4IHAA 4QUOA 3KEDA 3DMMB 1H0HA 1GRRA 4NXMB 1N6IA 2XTJB 1L5HB 4U3JB 2EVGA 3MS4A 3CJRA 5IEKB 3IXMA 2YC2C 1M6OA 4LDJA 3UOGA 4UMVA 2Q7XA 1JZQA 4Q9NA 2PUWA 4IMPA 2PPEA 3VFRB 1E28A 4Z4EA 1NBYA 5I8CB 3ZT6A 3ZTCC 1XCOA 4FMFA 4ZMYA 4F04A 2IPKB 3BVDB 4GDMA 2HKFL 1VCMA 1LDGA 5DI8A 3ASOB 3EHBB 1GARA 2C2HA 4BFGA 2WXMA 3D18B 3PWJA 2O6FA 5F96H 2P5ED 1CLCA 5A4JA 4ENPA 3H2ZA 1E9CA 1BX2A 3OLGA 1ONPA 4HKZA 3CN0A 2NY5C 5B7PA 4PVMA 1JG7A 5ISZB 4HWBA 1M1YE 4YRIA 4OIMA 3GSNA 1QABA 4BZQA 4XPBH 2DJUA 2GEUA 5D7IE 1MAWA 4CGYA 4ZALA 2CKBB 1MQSA 3GJZA 4MKTA 4J75A 4CJ0A 3HBZA 4CC4A 4I8IA 2WU1A 2WVAA 3SWWA 4Q3BA 4CEHB 2PLAA 4GRWE 4AEHL 5LCVL 1HYQA 4J3FA 2V6JA 1SMOA 4MW5A 1SOXA 3LXUX 2XIQA 2E87A 1QOKA 3D0LA 1ZKAA 3MG9A 3MJ8A 4PC2A 1QGUB 3U0VA 4KJYB 1Q8MA 1MWAH 1UZAA 2IOQA 3HJGA 5FW7A 4IRSB 4LRNL 1ATIA 5HDWA 3CFBB 3NC1C 4WHDA 3F1KA 4IIVA 1GUZA 3AF6A 4OYYA 1IXSB 4ZQIA 1EVTC 3HC3L 5I1GH 3OHXB 3BT7A 4B75A 2XBLA 1JBEA 3Q3GE 3ARRA 3A1SA 5JIKA 1B8PA 1AYOA 3PLYA 2QW1A 1PX2A 2F7IA 3PT9A 1HG1A 3HVNA 2NO5A 2LW3A 2QVYX 5CJ5A 2EVFA 4JPKH 2CVZA 1NZJA 1E3IA 4P4RB 2HLNA 1E8MA 6YASA 3BC9A 1BE8A 3H6HA 4MAYA 3FUJA 1UD6A 3OQVA 4MLSA 4Y2GA 4XHQA 1KEGH 3GJ6A 3QQ3A 3TF7C 3ZZQA 2ADOA 1QDLB 5G4KA 5T5FH 4Y16C 1L7NA 4ARIA 5DRZA 4JY5H 1TQUA 3N75A 4YT4A 1ZJAA 3M8OL 1YJCA 2OV2A 4MDFA 3A9TA 1S7QA 4ACTA 4U1MA 3O3EB 3SC3A 1Y3FE 3S5UA 3HHPA 3ADKA 4ZVTA 3ZXIA 4TNVF 2CJFA 2VWEC 5C2BL 1I8UA 2JHPA 4YLQT 2YMTA 3ZCTA 2VOJA 1XAHA 3ZS8A 1CULC 5AI9A 4ESOA 4LXGA 1W35A 1PR1A 3ON5A 4PRPB 3E2MA 4TSKA 4DKFH 3TXYA 3WNIA 4Q9BA 3AOEA 3WNDA 1M1YB 1VEOA 1MKFA 1GA6A 3EJYC 3IBYA 5D7IB 3P2KA 3TBKA 3OLEA 4JZKA 3V7AE 2QHRL 2X9LA 3RS9A 1R6BX 4AYTA 1UKCA 4G7YL 2HSZA 4NUMA 4GRWB 1ZGLM 5HYEA 2WTUA 2VEDA 4IJVA 1E77A 1XMJA 5TB5A 3D4GA 1ZS8B 3G85A 1AZTA 1P5VA 4L50A 4WO0A 1HDRA 3MO1B 4CSSA 6PFKA 2RI6A 4N0CD 4IMLB 3BJRA 3DC7A 2C7UA 2J08A 1GXSA 3FD8A 2YYZA 1BECA 4MJID 3WXVH 2PH7A 1VGKB 4FKKA 4L0ZA 5IVXB 5I73B 1QJ4A 1TF2A 3GN2A 1AO7D 5KVFH 2HAZA 1JLKA 1X5MA 1XTTA 1UACH 2JBAB 1SY7A 4WI6A 5CDGA 1F2XK 3SZUA 4N6GA 3MLTA 2G77B 5D4HA 1RURH 4XAWL 4PW0A 4LLVA 1Z15A 4DDVA 5FAKA 3VNZA 1AG0A 4R5XA 5JOPD 4DF3A 5KZCB 1MOSA 1U8QA 2DFKB 1NGZB 4HH8A 1FNDA 4JP5A 3WEBA 1FSPA 1UOWA 3UAWA 4UQ9A 1BGXL 2JIXA 5DM2A 1CF8L 4C6TA 1A8HA 2J48A 4XNMA 3MWDA 4OPMA 2WTAA 2HVBA 1UXSB 3TRJA 3ZJ5A 2D1QA 1JPEA 5TT1A 1JFSA 3B13B 4K8OA 4QUBA 3NEPX 2NLOA 3EDFA 2R65A 4JN2A 2OMKA 3JAMA 3P9MA 5CGTA 3DHEA 4NJEB 3NCWA 3P2MA 3UFIA 3ZDEA 4HDKA 5MEPA 2R1UA 3X2QB 3TFBA 3H16A 1NXVA 2XRAL 4JPIA 1U8OB 4L05A 2RGRA 5GGRB 4ZHQA 2TRYA 2KS0A 4BO0A 1PLAA 1Z3RA 2V7EA 1KXQE 4ZFFA 3BH8A 4JGUA 2WM9B 1RM5A 4U4IA 2H6OA 3KEGA 4PONA 2H7WA 3MNZA 3O0RH 1WF6A 3CUUA 3USCS 1C3EA 4BMXA 5D1ZA 4CG1A 4N25A 4CEJA 4KRMB 1A82A 5BNZA 5CW2A 1Q9OA 4S1WA 4D9KA 1KLFA 4XPFH 3EYWA 3UWOA 3B2NA 3GLEA 1YC2A 1JNJA 1Z26A 2H00A 4KKBC 1H8OA 3JD0A 4PJGF 2VDMH 5EMYA 4MXWH 2IEDA 4JITA 4JGJA 2A9ML 3FFTA 3MUFA 2I69A 2OYKA 4FKHA 1BMWA 4GVXA 1IVNA 4OF8A 1LNSA 3BJEA 4FN4A 2WZCA 4PY7A 2F1EA 4PWGA 2BSXA 4J90A 4B4WA 1P4IH 4R26L 4GUCA 3E3AA 4FNMA 3QWIA 4DLYA 2JLRA 4FDUA 4C22A 2QE7D 4M22A 4TTRA 1K7CA 3AFHA 4RVUA 4KHTL 5L88H 2EJBA 1ILUA 1QVWA 5C0IB 1CE8B 3GBNH 3WJLC 2HTEA 1C1YA 4UNNA 2HRCA 2F58L 4JO8A 4BLOA 2V03A 2IYSA 4HRYA 5PNTA 3KBBA 4DCTA 1U3HB 1RXCA 2NUPA 1GUYA 3CSDA 1W36C 4L0DA 1WB6A 5K3AA 4UU9A 2ZYRA 3OR6B 3QP3A 1SN0A 1I7UA 1RLMA 5EE3A 3L3DB 5K4HA 1P7HL 4HWKA 3FCEA 3F6LA 2FUCA 5HGAB 3MRFA 1YZHA 2KLHA 3GF4A 4YMLA 3QXAA 2PRYA 4MA3B 3BEVB 1YDMA 5HYJD 4UM8A 4N26A 3E82A 4LY9A 4F3TA 1XJ5A 2ZI9A 4MQ4A 3RUHA 4WDIB 4P2RE 2Q21A 4XPTH 1DSFH 3MJ7B 2ZANA 1G7JA 1UDBA 4MW4A 2DAPA 1EZUA 3GDGA 1Z9OA 2J1KA 2JK5A 3HR5A 1J1ZA 4ND4A 1XCGB 1J2TA 4K6HA 3GHEH 4JKKA 3G7SA 3IQDB 2Z0UA 3U4HA 3GXDA 5ISMA 3ASZA 4HI0E 1OCWH 3QDJE 4JRFA 2QMEA 4CDMA 4IXTA 5AZ2L 1FB5A 5L7YA 2QPUA 3NUZA 1AKJD 4KYTA 5JCZA 2IP2A 4MJ6A 2XZCH 3DBRA 3SY6A 5KOHA 5DTJA 4PYLA 3MJ9A 3ULUL 5AKKA 4JN6B 1GGBH 2JGJA 3V9CA 3N7AA 2R2HB 2YZGA 2DQEH 4JLOA 5I9NA 1Z5LA 3LEVH 1YYCA 1JPFB 4NZUL 4X4YB 2ZAMA 3CFJB 4UQ3B 4GSDL 4JZJC 2CMHA 1PZNA 4RFEA 1C2YA 2J25A 2J6EL 3RGBA 1CDYA 2EJTA 1TDQA 1OYVA 3C60C 3STHA 4FNTA 2EDYA 5ITFB 1D1SA 3C6QA 2D7TH 3VKVA 2OWDA 2GZ2A 3AEZA 4Z3IA 5ALVA 3V4VL 2VH1A 4DYDA 4G7QB 1OTTC 3H55A 1T8TA 4L3VA 3LZPA 4O9HH 3VAAA 3NJLA 4RFSA 2XN0A 2V5VA 2AC4A 4EN3A 2QLFA 3RJQB 4A39A 3MRSA 4NYIQ 2BGUA 3BEWA 1FFNB 1WW2A 4CF5A 1UT9A 5B3JA 2BISA 2FJGA 3F65A 1Z5GA 4MB2A 5JNVA 4AKSA 1IM9A 3UTTE 4H26A 1G42A 1V8BA 4P9MH 5LN4A 3V4PA 4M1KA 5G5DA 3ZDCA 5LQMA 1FP2A 3MHTA 1FL9A 5LUBA 1KBGL 4RTKA 2CMRH 2CGZA 3IK2A 3UGEA 1KK2A 5E4JA 3BXHA 3C0KA 4O58H 4RK1A 2RGWA 2EX4A 4POUB 3EAGA 3HS0B 1D4FA 4KWTA 5MERA 4MB4A 3EZ6A 1MUJA 2QJOA 4O4HB 3P71T 1H85A 4D9RD 3QDJB 2P24B 2QUZA 2V7HB 3SJVE 2QUJA 4TKUA 1U2SA 4JYPA 3A04A 1C16B 3KAJA 4JXZA 2FHSA 5JYCA 4NZTL 1X7ZB 3EBOA 4WEBH 1WBZA 2WVTA 3GXNA 2HNAA 3O92A 4ETYA 3R6TA 1SYSB 4TPRL 3E6AA 4J2HA 5EY5B 4MB6A 1Q0TA 3MXVH 2WBXA 4XMLH 2ZE0A 2ZRPA 4Y4KA 4JRWA 3RC3A 4OGGA 1YB4A 3IPAA 4HK0A 3Q85A 1QHPA 1GYWA 2GPAA 2AI0H 3L0PA 1OPGL 3K6OA 5MP6H 1WMDA 3AHEA 4CW7A 4HISA 4MQFA 4ZX3A 1R0KA 5AR1A 4KLRA 4G97A 3MQIA 4DUVA 3TTWA 4C4UA 4QJIA 5J1SC 2DHCA 1NICA 1QYXA 4IVPA 3AF5A 4ETWA 1Z6XA 4Z7VA 3PJNA 5JOEA 5K8TA 4UINH 5KO2A 2A4EA 5B1YA 4O02A 5DFVC 3RIMA 1FDTA 3HB5X 1FFYA 3D6HA 1Q1BA 4KQWA 4E5MA 4BNDA 5CU9A 1OP5H 3O7WA 2Z56A 2Y71A 4QFCA 2IF0A 3SGJA 4P7FA 3PJSA 3FU6A 3NFYA 3PSAA 1RYFA 3V1NA 2HN9A 1Z25A 4QHUA 1KVTA 5J3JA 5I2IB 1XD8A 4P7GA 3UTTB 4LOUD 3RV4A 4FLQA 3EC2A 3MCKB 2YICA 4F7WA 3GRFA 5EOQL 2M2DA 3TJHD 3ZX4A 4M0PA 1Q0XL 1LP9F 1JPSH 1JX6A 4JO5A 1S7TB 1IL0A 3SSOA 2PKQO 4K6KA 2QJWA 5EMMA 3CVXA 3QMWA 4G1EB 3GSXB 1XZFA 2JGMA 4ZVKA 3EFOB 4P36A 4P46B 2D2CC 2AJVH 1T7YA 4W5OA 1N5YL 3RVTC 3KDPA 4DO6A 3KSDO 3TONA 4G43B 2OCBA 4BFSA 4EPRA 4G8GB 1L3BA 3DE6X 4ETMA 4PWHA 4OAOA 3SJVB 2W60A 2GG1A 4TNEA 3LZDA 3IJ5A 2DQDL 1LF5A 2NUTA 2HA7A 1K66A 3AT8A 4XJSA 2RJOA 3OX8A 1T0IA 2GK4A 1A1MA 4ABTA 2BFDA 1P7QB 1I2ZA 4GRMB 5BYAA 2ZU0C 1RXVA 3JQBC 1BVHA 4F3FB 4BLUA 1IO4C 2IA5A 4ZCIA 1FMTA 5JIQA 2Q0XA 3WMWA 3V8OA 3HCAA 1NUHA 4HS4A 1MCHA 3TTUA 2G83A 5T3ZL 1ODIA 1W8IA 4QYIB 2OP1A 4O2FB 1Z28A 3ZTJG 1HI6B 4LEXH 5A7EA 4WNQB 9ATCA 1P2GA 3UBXB 4NFLA 2ZZKA 3AKEA 1CICC 4HN2A 4EA8A 3NBZC 3PKIA 1MH9A 4BK8A 4HKXB 1YEKL 3PKZA 5EJ4A 4O2BF 5C1DA 1YRBA 2R6R1 1QJCA 2ORBH 2Z8XA 3QW4B 3BCRA 4RIGA 3ZYOA 4CL3A 1DL7L 5HHOA 5E1HB 3BMNA 5JORA 2WB2A 4V0OA 3TR6A 2R7LA 2VLMD 2HTFA 4JI4B 3BW9A 1FS5A 4XNYL 5F3BB 3ZI7A 5JYBA 4S1QL 1G1MA 2DT8A 1WFOA 3Q3HA 2I27N 4NICA 1OT2A 1WFNA 3GJEB 3D8HA 4LOVA 3PHBE 1QYVA 2HT3D 3IODA 3QXDB 3T08A 2IYZA 4GG8A 1Q9KB 2Z93A 4QPZA 3QQNA 4HIJB 2JWGA 4TTDC 1FDIA 2GAFA 4PLYA 2R0ZH 1ODLA 3BCSA 2VXQA 5GGUB 1T5XB 4WOCA 1JEYA 1SCIA 2B78A 4A8JB 4HLQB 4BKUA 5DJ8A 3GLRA 5CVTA 4YACA 5MHTA 4MOWA 3L2OB 2GB4A 3RSOA 1VRWA 3RZCA 3CDGB 4PBRA 4PJGE 4HHEA 3L1VA 1N75A 1SBSL 5FTKA 5G3YA 2F6RA 2FX2A 1FHNA 1UPAA 1HYGA 1E3XA 2CPUA 5BVJA 3CHYA 4D9CA 2GR9A 3SJCA 2BRQA 3JWGA 3THML 2KLSA 3VSTA 4XP5L 1E5LA 3IR5A 2QNBA 5HFNA 1XF4A 1CZLA 2HHJA 2HJFA 1A7PL 3IFLH 1FZMA 1PR4A 3LC2O 4Z6AT 2PPVA 2FTAA 1KBQA 4YT8A 3WWZA 1HE2A 4ZTEA 3A6HA 4W6QA 1KCRH 4A0QA 1KY3A 1OLSB 5TGBB 5F9JB 3BD8A 3WO0A 1U3DA 4OKVB 3GHYA 1J0HA 3ZJUA 2FEMA 2R2BA 4X24A 4LSDA 5FA3B 3T3OA 5ACMA 3V79C 2KM1A 4LDAA 1FG2A 3EDJA 4NOBA 1JZ4A 5SY6A 3KCNA 4AQYB 3S2FA 4BLQA 3GP3A 1ST3A 3DKKA 3CZEA 3B1ZA 1M1ZA 1NGPH 4H1LH 2O61A 3THRA 4BMVA 2YJGA 2G5CA 4RQQA 3EMBA 3V5KB 3TLRA 2AK1L 4YRRA 1MAMH 1I5EA 3L5IA 4UVEA 4I08A 1EO8H 1OCOB 1B1CA 1OAKH 1TVHA 3X3GH 1R3UA 5IB2A 1TQ4A 2O7QA 4D7AA 4DP9X 3E7FA 1TTGA 1N5RA 2ZBRA 4NNPL 2AXNA 5J12B 1E4EB 3HU1A 3C3BA 4BCDA 1I94B 3AF2A 5LGHH 5ECWA 2OGZA 3RVVC 3ZD8A 5CT5A 1R47A 3ALWA 1XZCA 4OJMX 5CINH 1N33B 1Z5ZA 1DAOA 5L95A 2Q76A 1G9XA 3RJZA 3SDAD 1SHZA 4ZCPA 3EDYA 5C1PA 2OFQA 5LYYA 2GZMA 2J4WL 3ARDD 4K5NA 3ARGB 4ARVA 2QR5A 3D85B 5FOUA 4EITA 4ES9A 3KYNB 4OJDH 3IR6A 5HZHA 1U7ZA 4U2KA 3WHE0 1LUAA 3TWCH 4JZNB 3IEVA 4AZ8A 2OZNA 2ECOA 2QLNA 2VA8A 2VDWB 4EQ6A 3O6KL 4FL4B 4OGAD 43CAA 1TTCA 4ZXPA 3CDFA 1A5FL 1AZSC 3TMAA 1JV2A 2VXSH 2BN4A 2C9OA 3VNUA 4WZBA 5JMWA 3GGDA 4GXNA 3ZX5A 3HNSL 4BX2A 4CPDA 5H16A 1AYRA 2IAND 3DDCA 5I6DA 2I60L 1UM9B 2DQIL 1Q0SA 1C50A 5K05A 2HEGA 4PZLA 1SVCP 5C0ND 5FPQA 2W6MA 1DVZA 2FZ3B 2SNIE 4BK4A 3PEWA 3SF8B 4PJBF 1OF1A 1EHCA 2Q2LA 2X7LA 3ABMB 4FGKA 4BNNA 2ZX5A 3O4IA 3PQDA 3X2FA 4TSAL 4Q6IA 3I2CH 1SRQA 1MORA 3OPQA 4GW4B 5F7ZA 1H1DA 1CQPA 3W3AA 3EYUH 1YECH 3T1QA 5DK0B 1G2OA 2QDKA 3EYAA 4GLBA 5CUSH 4BFZA 2AMUA 5FYJD 3FRPA 4JFTA 1S7RB 5IMLA 3S1AA 1SBBA 4RH3A 3AOGA 1NC4D 5AJZA 2QADC 4JEIA 1E60A 4B9JA 4OGXL 3V34A 2O52A 1RVDA 2C7PA 2DQ4A 4IXWA 3GEEA 5E6SB 3S0JA 1GJWA 2AC2A 2WQXA 4MS1A 1S7UA 4P3WA 3DJSA 5DVLA 3CCBA 3QWFA 5K2OA 2C94A 5I23A 1KELH 3ZBUA 4N2HA 1DLFL 2RHLA 3OKAA 4C7OA 4CGTA 4G5OA 4P2OA 5DJXA 3B52X 1I1YB 4NM8H 2IYQA 1P5FA 1KN2H 9CGTA 1D09A 3IMEA 3BJLA 2Q8NA 4LYAA 2GHWB 1C12B 1DQDH 4ZCRA 1J24A 3UMTA 4MWTA 1XDDA 2VAJA 3N2YA 4NZOA 3HNRA 3VDMA 1CB7A 3F2LA 2CHNA 2ATKA 1UZNA 2DQMA 1XCTB 1W2HA 2WKSA 4XXWC 1EPUA 3TIIA 4NQDE 4QUHA 2BMWA 2VAXA 4N8EA 4YEFA 3C6EA 2VSFA 4ENTA 2E9IA 2Q0HA 4IXNA 4QKQA 5C7XL 2ZJYA 4K9KA 3TCXA 5CRIA 2FYYA 3A58B 2OAP1 2EBHX 2YZ1A 7TAAA 1YBFA 2O23A 3P40A 4J7RA 3R44A 5IQ7H 5A4AA 2DUUA 4X20A 1EA7A 1TLKA 2WLJA 3FOLB 2B1JA 3OHSX 1P7PA 1E2FA 4XB1A 5D7JB 2HWYA 4L29B 4J6EA 2UY6A 5DASA 1XIWC 2A4MA 1U42A 2G0KA 4N5DA 2IH4A 5E2TH 4YC7A 1OXYA 1RI3A 4M7OA 3U2IA 1C2TA 1JRLA 1QIEA 1OK8A 2XPYA 1BXXA 2Z65C 5D6NA 3OT4A 3OJOA 3ILXA 5DHXB 3G9XA 5LZ8A 5FKPA 4MSUA 4M48H 2APBA 1GCFA 4NEGA 1QH9A 3K46A 2BEUA 2GVDC 2I55A 3B7TA 4R1TA 3A9WA 2DYSB 3BXEA 3Q2LA 3RW9A 4LE1A 4X9IA 3DR3A 4ZD3L 2VL5B 2ZJ8A 1LP9E 3ADOA 1U8AA 3OLQA 4ARZA 3NB0A 3FO0H 1N8SA 3ZY4A 1BJKA 2IEAA 3EY9A 4O3TB 1US8A 4UM7A 4JI5B 4HTFA 3SDXA 5HR5A 3GROA 4NTZA 1CEEA 4C4RA 1EBAA 3OC5A 3MCTA 2AG0A 1S5PA 3JD1A 2FVYA 2FR8C 4LL4A 1NNEA 5DN6A 5F1NB 4P5RA 3EKCA 2ZP0T 1U8XX 3UJPA 1NUPA 3RSGA 3H3FA 2Q9UA 1JDAA 4MB1A 4LKXB 4CKWA 1BVKB 1SEPA 3ZBPA 3JSXA 1XGKA 1WFIA 4TOYL 2BOCB 2IGFL 5BRAA 2FLVA 3UB2A 4Y2DA 1Z75A 3AU9A 1KDPA 4ZMVA 4NZ8A 4NFSA 4MS6A 2P8JA 4WKPA 1ZGJA 2WM2A 5HHME 2JDIA 3HB7A 2ITCA 4NQDB 1AS7A 3R3ZA 1N2SA 4Q48A 3FYUB 3W6OA 1L3CA 5LD2C 4PZ0A 4OQTL 1KYDA 3RKDD 1I4EB 1ZWIA 1VBKA 3VHRA 1KNXA 5DNCA 4E22A 1WZ1L 5IZCA 1UJ3A 5D1QE 3T3PF 2BI8A 3OMIB 2PWAA 4A0GA 3ECVA 1PT8A 4DWWA 2EIJB 3OHMA 1H2EA 3QELA 4MQUA 1I3RA 2V3EA 3PGDB 2FY8A 4UDUB 2DN7A 4JUTA 1VKHA 3AM5A 2A1UB 5GJCA 4DK5A 3BJIC 5AM1A 4G0MA 1A3LL 3B34A 5IT9A 5FB8B 3CVIH 3AL8B 3IDOA 2FWLB 1R5IB 2UVPB 1JHDA 1C08B 2CLHB 4I8DA 4OYHA 3DGEC 3FS9A 1C7IA 3W11D 2K7ZA 2DTDA 4XM0A 1Y5LA 4BNYA 4M8QA 4WOKA 2WD0A 4C3VA 4JFXA 3CNHA 4UBDC 3BRWA 1CI3M 5D8DA 1L5GA 1OV4A 3BI9X 4U3HA 3THWA 1XFAA 1YMUA 4DLTA 5AXDA 4HPYH 2XICA 4TM8A 5KU7A 1ZM7A 1GPUA 4HJUA 1URLA 4P3PA 2WUWE 1HT1E 3NCYS 1GKEA 2VLRA 4WWKB 3DZ8A 4WERA 3TNYA 3A0OA 4BXVA 5C0BA 2YJ5A 4PLFA 5GVRA 1Q92A 3H2PA 4OZ4B 5JS2A 4L4JA 2I8LA 4OQEA 1VKZA 2BIFA 2IHYA 4LK4A 1GW0A 3PRHA 1RHQA 1Z5VA 5I4KA 3TNMA 5DD6B 2WYZA 2R0LH 3QMPA 1UZ6F 4GGMX 4G9FA 4IBSA 3L4KA 1M72A 4BWTA 4ONEA 3BZ4B 1G5RA 3N2EA 4XC1L 1TFUA 1T5HX 3HNTH 2P3YA 4MRRA 4MQBA 1W85A 5B7EA 1E6KA 4YRKA 1NSYA 1YR7A 1IVYA 1AGCA 5ICUA 2RB4A 5KYUB 3FSRA 4MTCA 3PWUA 2BZ7A 1Y63A 3U46A 2MPAH 2B1HL 2SEBB 1DBVO 3G5UA 2HTKD 1XMIA 1RZ8B 4JANA 6REQB 5HNKA 4D8PB 5D1QB 2PBRA 4I9WD 5DVKA 3GPSA 3WWYA 3T1HB 2B14A 4ISVA 3SSMA 5KNDD 3WJMB 2FECI 4II3A 3SC6A 5FEMA 4D94A 3OZVA 1NIPA 4LCUB 4DYVA 4IBLT 4O2BB 2ENQA 2V5MA 2UU9B 1U8NA 4NN5B 1U8PB 3NBNA 3ABOB 1AH1A 4U8GA 4BFXA 1P7KA 2GSGA 1RWQA 1YONA 2GOYA 1UIMA 1H0SA 4EG1A 4FFTA 2VN6A 3TIEB 5TFSH 1IEVA 1KI3A 4HY3A 5H83A 3WYDA 1LBSA 2JIZA 4Z8XA 2AFHA 2DWYA 3DVSX 3S4YA 4DNQA 1RKRA 2ODEA 4WVLA 3UXMA 4WEQA 1M0EA 3C6SA 1FVHA 2OTUB 2FFQA 4NKMB 1UVQB 1F2TA 2C4KA 5CEZH 4XMVA 4S1SH 2ZRQA 3DO7B 5C07A 4MS4A 4QPDA 2H8PA 3C48A 2B9AA 4E51A 3KZOA 1GFIA 3C6LA 2CDAA 3BVNA 2QTMA 2ZM6B 1XGQA 1D9XA 1K8IB 5DGCA 4MVCA 3DFZA 1HGXA 2MOQA 1R5WA 2Q86A 4G3YL 4LQ4A 3WIHA 4LIQE 1F8TH 2XGGA 3DW1X 4OJAA 1WBDA 3G5WA 2XKNB 2BFNA 3WL5A 4BKSC 2V4UA 1DXOA 3QDMA 4NQUA 1X74A 1DZIA 5JZ7D 4J8RA 3AF3A 1BYIA 1Q0PA 1T5SA 1LJUA 3UCFA 3TA3B 3IILA 4ZYUA 4FFMA 1L5SA 3H2BA 4OJQA 4A0RA 5F1KA 3S2UA 5FO1A 4XCFL 3UJTL 1UURA 1IIIA 2DOCA 3VR5A 3SDYH 2LLLA 2AQ1A 1QP1A 4LZNA 3KPRD 3SCMC 5K2MA 1WA2X 4MCHA 3CK0H 5EP1A 4ZMTA 2XB6A 2VJ0A 3CV3A 1JKJB 3VWKB 1MFCL 2P2DA 3MA7B 2QMHA 3IUPA 1CV2A 3AUYA 2H6PA 5GGTA 2WUEA 3P0HA 4PBSA 3KOWA 4WLCA 1T15A 1A9EB 2EZ8A 3ZBQA 4GSLA 9MHTA 3SX2A 5SWSD 3BDIA 3NJJA 2JGRA 3T0EC 1AS0A 3BGWA 3I9MA 4PGCB 2HP4A 4HOZA 3P2YA 3ITEA 1FNLA 4J0IA 2GAIA 4MO9A 1V10A 4S2EA 1T1EA 4FQQB 2P65A 4RV4A 1EFXA 3G5XB 3DT6A 4BMCA 3I6BA 1CYDA 2F5BL 5DW0A 1E0JA 1U8MB 2X70A 4H6VA 5FIUA 1YOBA 5I9TA 3SNHA 1UXGA 5FM4A 1T35A 5IWAB 3QEQE 1UBOS 4XWOA 1MI5D 1OE0A 4ROSA 2SCUB 2DMRA 4CIVA 3GW8A 4TWIA 2XRZA 2R4SH 1PLCA 3TH3T 5CHYA 1Q0RA 4LJ4A 2I4MA 4JP2A 1NRIA 3VISA 1VACA 4KGVA 3CFUA 3L5JA 2FZCA 1RZ7H 1KYOJ 3OJMB 5KWEA 2OV4A 2B99A 2KI5A 4Q9QH 2YGPA 3KK0A 2E4FA 3P4OB 4MQTB 3A4IA 5IFJB 3IDSA 4PVCA 3D02A 1VRSA 4G6KL 1OAUH 4P5KB 3L1KA 1W0JD 1MCSA 1UXKA 4YJFA 5A7FA 2JHCA 4W1SA 3AS2A 4AVJA 4DILA 3S2GA 3V8RA 3LLMA 1PT9A 2X1LA 4QDUA 4X7SH 5ILQA 2REXB 1KJMA 4OQXA 3QRGL 3NLLA 4AL8L 3B78A 5C3TA 1C5DA 3IAQA 4FQ2L 1UD3A 2IALA 1E6CA 3WK5A 2PBZA 4Q4LA 1B6TA 1Z2DA 2WXPA 3PDDA 3O9ZA 2R8RA 4D6XA 4ND1A 3KWXA 3M5DA 4ZMXA 4TMXA 4UB0H 2Q3HA 3TMYA 4J3OC 3RT9A 4NQVA 3CLEH 1FNSL 4D44A 1C30A 2ILTA 2WYUA 2H7VA 5I26A 5D4QA 4D0GA 1NDMB 1LS6A 4NBWA 5D3MB 5H3LA 3EVTA 1TPXB 1CZOA 3E5NA 1P9OA 1ORQA 5CJOH 4M61B 5KWYC 3JTTA 5IB3B 1QWUA 1QEWB 5C5IA 3RKSA 2I80A 4DZ8B 2A88A 3ZWBA 4CBVA 3WFEH 1URPA 1P75A 4CCSA 2NY2B 4QTUB 1G9MC 3HE6B 4RIRB 4LLQA 3UJIL 3DDZX 1IBGH 4TT3A 1R4NB 3K0WA 3TL5A 2AOTA 4I4CA 1C7EA 4JPWL 2D0PB 1XJCA 1JXOA 1KENH 3SFTA 4FW8A 4POZD 1S3RA 1M7GA 2VYCA 1B8NA 4BCCA 4C4ZA 5HHNA 2VC2L 2ZWYA 3TN0C 1AR1C 2A86A 5IB4A 1MCPH 3PI7A 2YBGA 2OR9H 1LDYA 4NUGL 3AM8C 1QLHA 2GZHA 5JSHA 3L5XH 3PJRA 1WXGA 4S0XA 1D7FA 1M2VB 4HUUB 2QP9X 4PS0A 3Q8WA 2XWRA 1CLVA 3T3PE 4B3FX 2OGUA 5H2BA 3U80A 3NG1A 1YC8A 1U5AA 5DLML 4LKOA 1QCCA 2ZKHL 5BMVA 5C35A 2OO5A 1YJDH 3M17A 4FOLA 4I36A 3O2NA 2P42B 1CY0A 2UXBB 1O08A 2H1LM 1A9RA 1RNLA 3E9MA 3TINA 2P2YA 2A94A 2VXUL 4NBUA 1FE8H 4S0SD 4C5CA 1FVDB 3MA9H 2DICA 4X7FC 3O8NA 4EUKA 1FNGB 3L1EA 2WP0A 2DLIA 5J3HC 4UDNA 2CL7X 5CWSA 1BFDA 3DZBA 2N47A 2GFBB 1JN6A 4PIRF 1YFZA 2V4ZA 2HLDD 3EO1A 4HUNB 1ETA1 4P2QA 1AQ6A 3MPOA 4RELA 3CW9A 2AOVA 4RAQA 4A92A 2PJUA 4LHZA 1L5NA 3TV8A 2CHQA 2R23A 2W6PA 3RHZA 2YJ6A 2AV6A 1VL2A 4PJ7E 2X4NA 3VQLA 2O57A 2XNAA 5AJXA 2JB6A 3ILPA 4JAVC 3E35A 2F1KA 5GZ1A 1MCWW 2PWDA 3QUZD 1HCYA 3K71B 1ZCJA 5HHVL 2GVNA 5TTRA 4BAGA 5A1JA 3A6GA 2WSLA 3EJWA 2REOA 2LTQB 1Y6JA 1AGDA 3KYMB 3KUUA 1RWKA 2W0FA 1OW0A 1PDKB 5J1AB 5JNYB 1WEKA 3L1OL 3OJVC 3I8SA 2R59A 3GJ4A 3WTWA 1KB5L 1UZ6E 4JPVL 1XGUA 4Q7QA 4XP1H 3ZCRA 1VFUA 3ZY3A 1N12A 5EZPA 1U30A 3BPOB 2WUGA 2HHLA 1IEQA 3D5QA 3PNQA 1AOZA 2YRLA 4G70B 4M6NL 3C6YA 3ND9A 1IZ0A 1N67A 4ZI7A 2Q5BA 1HMPA 4QXGL 3D87B 3VDXA 2NZIA 3ZWAA 5DZNA 1VSVA 1Q2XA 2G7ZA 1OH8A 1JU3A 5TPZA 4U6XA 4R1OA 2COVD 3QU7A 4LF6B 1AKUA 1QZ1A 1FRQA 2VK4A 5I0YA 3OIYA 3HJCA 3T3PB 2AAVA 3IGAA 3AJAA 5I75B 5FHRA 1G2QA 1R0XA 4KIJA 5GJTL 3CRQA 1J11A 3E3NA 5KTPA 3TRDA 1TITA 2CFRA 3DE0X 4R3NA 1HEIA 4KW7A 5DGXA 2CCJA 1FNEB 4MMYA 5AVYA 2XTZA 3I1IA 3H1PA 3W3ZB 3BILA 1FL6B 3ISJA 3J7TA 1T1GA 3H9CA 3VI4A 5I8EB 5JANA 2NYYC 4GKSA 1WH0A 3K0FA 2PH3A 3MJFA 4XPHH 3UK1A 5AKIA 2WANA 1S2EA 4U0RC 2PGDA 3LYUA 2J6HA 5AKZA 3EPKA 2R51A 1YCDA 1P84J 1W19A 3DWEX 1QEXA 5EUQB 2B2CA 4APQA 1U1GA 1BDIA 1ZJJA 1UT1A 4F5WA 2POQX 4JREB 3KXLA 4PJ7B 4XC3L 2CNOA 4V0KA 5KANG 5CLTA 1LPNA 2Y5EA 1VE9A 5ICZB 4I9NA 1ZANH 5DD0H 1WJGA 5HVNA 1ZKDA 1I9IL 4RA0C 4R2LA 3VFPA 5G1PA 4RVSA 4C4YA 1EFRD 4OB5H 1PWEA 2EQBA 4UHDA 4LL1A 2ICWJ 3H1GA 2PP9A 4R7TA 4A10A 1SUFA 1IAKA 5M2QA 2YXBA 4YEDA 5HDQH 3NPAA 2CSXA 4L9LA 3HMQA 2WZQA 3KJIA 3MS7A 1CC3A 2P9FA 3UWPA 1O2DA 3PSHA 4Q1DA 3IELA 1FFDA 3AXIA 5I1JH 4E4YA 3JWNG 4HQ0A 2G36A 5E8DH 1SB8A 1M5TA 4RZCB 3CLRD 2TYSB 2D5IA 3SQBB 3PDWA 4KVCH 2JELH 5F1IB 1AF4A 2EG5A 5EJ2A 2E4WA 3SSNA 3EC7A 4P3NA 1A65A 1JQBA 1D7OA 1D6VH 4B6EA 1QUPA 3IBSA 4RE5A 3UAJC 4FLMA 2D5LA 4ORZC 5AUOB 1NF9A 2A30A 1CY6A 3C5ZD 4NQCB 1OGPA 2AQNA 2Q1UA 2PWZA 5AG9A 2QROA 3WLSA 2P0AA 2Y1WA 4V0MA 3D9AH 5KJFA 1ZU4A 4PINA 3U19A 2QIPA 1Z34A 5JATA 5B12A 1ZSDA 3F7PC 1CL7L 4B9PA 4FW9A 1ENOA 5EXTA 2P9JA 1T21A 4HS8L 4KV9A 1C3JA 4YO7A 1UOOA 3M88A 2JAXA 2VHZA 4Y9DA 2X2EA 4DJFC 3LY5A 4O4LA 2BH0A 1HUQA 3K9HA 2VCYA 4ZCSA 2JLAA 4QHLA 1XZJA 4L8YA 5LOVF 1RFDL 1IAIL 3W05A 4IKKA 2RTTA 5CDSA 4FYIA 3LV8A 2XMDA 1Z2EA 1HS6A 1SJEB 3GRWA 1USKA 3CX3A 1KNOB 2PYEE 5JBIA 1JHLH 4FT2A 3VXSA 1EFKA 5F0PB 4QRDA 1K2DB 5CIPB 2FN7A 1Q1GA 1N6NA 3S6JA 2EP7A 1WPQA 3DV0A 3RY5A 3O3AA 1KJ2A 5ADPL 1CYXA 2HHAA 3WP0A 4K23H 5CILL 3BXXA 1Y98A 1U8HB 3H2JA 1RERA 1EEQA 4AG3A 1KETA 3JQ7A 4J7XA 2XE6A 3EF3A 4OF4A 5DHDA 4Y0GA 3KAPA 3OCUA 4C58B 1GKOA 4HUMB 4GUAA 5E8OB 1IMHC 2FUG1 4J1UB 1C7JA 2CHWA 5IVDA 3I8XA 1A6ZB 1EGVB 4GC5A 3B12A 4XM1A 2X0WA 1IUZA 3F04A 1OWMA 1QQTA 1XDWA 5F3HA 3KFXA 4WCFA 4BBJA 3ZC3A 4BRUA 3WRYC 1I32A 2LNDA 3RHSA 3II1A 4RM2A 1UOLA 2Q5OA 1NDTA 5HFJA 2R0WL 3V0EA 2C8LA 3AP3A 5JJCA 3ISVA 4OLXL 3TBWA 3PGFL 3C8MA 1ZMTA 4UEWA 4UQ2B 3JWPA 4B84A 2ZTMA 3GB7B 1FDWA 4WO4A 3SZGA 5JOQA 2Y9PB 4KXYA 4X50A 4J3JA 4YJ2B 4B32A 4F12A 4HFWA 1WKCA 3QR0A 4L8BB 1UPXA 3TBTA 2WJHA 3TZ6A 3DIFB 4AEIH 4OB6A 1NKSA 4PRBB 1G60A 4Q3DA 4UNUA 5DX1A 2VJPA 5EIXA 2HT2D 1IVSA 1EJ2A 5EDXA 1NIDA 1RPAA 1RP8A 4D9FA 5JPCA 2AOXA 3JZAA 1HL7A 3MROB 2KZBA 5DHFA 4X6FB 3T8VA 1N2XA 2WVGA 3BUQA 2ICWI 4H88L 2DB8A 4P7KA 4B79A 2IZZA 5AKVA 3G8YA 1W91A 3B37A 4N0YH 4FFBA 4EG8A 4PWEA 3WDLA 1GRNA 2XWTB 4Z7AA 1DN0A 5CP7A 3GLHA 1VHDA 3ROOA 4RF3A 1G0NA 3VRHA 2PYEB 4FAAB 3EJRA 4DV1B 2ZKWA 2AZAA 3Q1SH 4Z53A 2B3RA 1OFUX 5IKEA 5KVFE 2XCOA 4AMVA 3AJRA 1LMIA 4QAMB 2XWQA 1YGPA 2X5JO 2GDJA 2P9ZA 4KI0A 3VXTB 4RRPA 1TTTA 2XU9A 2WYHA 5H4HA 4FHEA 2CLCX 1XVUA 5FBRB 4D0CB 2ZS7A 5C8YA 1JZEA 1NBZB 3CUTA 2NY3B 1AGPA 4LEBA 4YJZL 1OOEA 4E42A 2WD9A 4XTRA 3QK0A 2NX5D 1XGRA 3IIJA 5IKPA 3JZIA 2E9GA 3DG9A 4LJAA 4IDNA 1DXYA 3COZA 1FNNA 4MULA 3KB6A 3WDKA 5EYPB 3I9V6 3G0HA 3OKEA 4IBYA 4HDMA 1UAAA 4PJHA 4N82A 1R3KB 1O94A 3FUCA 1DDOA 3ZLQC 4DZZA 4WTZA 1NCCH 2J8UA 1G5IA 3IVMA 2NACA 1DBAL 1KXTB 1CJUC 1M73E 4F3KA 4JE4B 3TD6A 3DBLB 1BYNA 3PC8A 3EZJB 2YJ4A 1JJFA 3DEYX 3R3UA 5BN1A 2KC0A 5DNUA 3F6JA 4AKIA 1AD2A 1CXHA 2V9QA 4JDTL 1EXWA 1AM4D 4ON9A 4CM9D 3HC0A 4TNWF 4YHLH 4OLUH 5I74C 3ESBA 3D06A 4UIMA 1CEYA 4NYJR 1DVRA 2Q1YA 2OLEA 4OLBA 4EOWH 3FWHA 4PIPA 3TXXA 4QKTA 2BR5A 1LRKA 1D7AA 1F4WH 2EBFX 4NLLA 4BBZA 3BP6A 3GWZA 1GZUA 2CUTA 2H1PL 4R41A 2EW8A 2PA0A 3FA2A 1MHTA 1TMQA 4GIAA 5FWYB 4P49A 5BMFL 3ZCQA 4P4SA 3NZ8B 2BFAA 1QYIA 4ZEOA 2NW2A 3WL9A 3VXMD 2G75A 2UX6A 3GLTA 1XTQA 3F2IA 3OFNA 3CFTA 1OP3H 3U1VA 2QTZA 4I0PA 1J8HA 5JPNA 1XDSA 3GSVB 1YMMA 2CHZA 4JKPL 3SPVA 4OLVH 5BR7A 5AVJA 5HFAA 2F4VB 1CFMA 10MHA 3HEIB 3EIOA 1QUEA 1BQ4A 4X85A 1OIWA 3RDJA 4LRIA 2O8BB 1JNHB 2P8LA 3LT2A 1S8NA 3VU9B 3FDFA 4KROC 3BZFA 3HMXL 1KZ4A 3L3IB 3QNFA 1GCUA 3NHBA 1QMPA 4MVJI 2UV8A 4KUCD 4L9DA 3OIUA 5AW2B 3UC5A 3GBSA 2F8IA 1S7WA 4HLCA 5A3IC 2EOAA 3N1UA 3HDHA 1C9NA 2W80C 1XPRA 3RI5K 1EAQA 3LUJA 4DR7B 1AURA 2PX0A 2ZDGA 3B1VA 4MVJH 4NK4A 4X6LA 3QH3B 3UHAA 3TSAA 3KPPB 4D41A 2P1YA 3IAEA 3UCQA 2P6RA 4CL7A 3GUHA 3RB8A 2FEDC 2DU8A 2BS8A 4PW4A 4QDXA 2IGBA 1R18A 3VTZA 1PV4A 5FGRA 4UVIA 3ZWVA 3KHUA 4UFNA 1KJIA 5THQA 5I0ZA 3B20A 1JL3A 3VFVB 3DHWC 1OCCB 2AABL 4O08A 1J56A 1RIHH 1ZL2A 4R2GB 1BQHA 4B83A 1C3OA 1O97D 1DKRA 1C1XB 4C01A 3QVGB 2JFQA 1VCNA 4ESKA 2GX6A 2QUHA 2V0GA 2HMTA 1QFPA 1TJIH 3CTMA 5DVNA 2WNSA 3KBHE 1TXKA 4Q3LA 1OPXA 2I33A 1ZR2A 1NW4A 4P5SA 5F1PA 3MZ0A 2H0JA 3SC2A 1OLLA 1ZTXH 3W5HA 4FULA 1OK0A 2PTGA 1IC1A 2R6GA 2CRYA 3RVOA 4XDGA 3OUZA 3NACL 4CQMB 3ZL2A 2CLLB 1RU3A 2XWSA 2R7NA 3IAPA 2OG2A 3D30A 1KCSH 2MYPA 5ALGA 2PIDA 4N0UE 2E6KA 3OZEA 4MQEA 2YIDA 3O90A 1QP4A 4PG6A 1QNLA 1HKLL 3ZVVA 3Q06A 1Y6QA 3I5YA 2YFNA 3IBTA 2P43B 3O8OB 4HEA1 4IXMA 3AZUA 3TBFA 2VISA 2ZSWA 3PFBA 3VR6D 2AV7A 3L54A 3IHTA 2AMLA 3WSQH 2XNKA 1ESZA 2F3TA 3R41A 5AZEL 1B4DA 3UPTA 2QW0X 4OSPA 2OO7A 1G2IA 4R7ZA 2P6UA 4QEZA 3ZCXA 4AENB 2OD2A 1SWVA 3K16A 3WHE1 3H7BB 2FH5B 5L3QB 3WR5A 1DBML 3IBEA 3AKCA 5IDXA 4NH4A 1WLSA 3SXUA 1MC4A 3M83A 3INOA 4KZ0A 2C3VB 1GNSA 3X3HA 4RZ2A 4IINA 4RKYA 2LXNA 3M6FA 4Z18A 2MMCA 2PGOA 3O2DL 1AD0A 3N2GB 1BEYL 2B1GA 3QO0B 4RZUA 4P3XA 4CIYA 4EBQL 3WFJA 5I16A 2J0UA 3JPYA 3H9UA 1VE3A 2PYIA 3NVKI 2IDMA 5H82A 1FO0B 5FV4A 2MDTA 4RGND 3JVEA 3OB8A 1JB9A 4HG4J 2HG5B 2Y1OA 2IG2H 4JCCA 1L6IA 5JI2E 3NHKA 1D5IH 4GP6A 1JXAA 5IJCC 1IGCH 3UYPB 3V8CA 1R19A 2AI3A 2H4FA 2WFMA 4JB2A 5L8LB 2HO5A 4BYHA 3DGFC 4U7JA 2X3CA 3BAXA 2Z31D 4E2WA 4DPLA 2O7VA 5E8PB 3OAUL 4NJ9L 4I4TA 3WKQA 3P5SA 1EGQA 2Q0ZX 4L3EB 3R9KA 4A6XA 4BNUA 4GPEA 1W0VB 2FH6A 2WSMA 1VG1A 3NTRA 4WOPA 1MOEA 4HH4A 4IDLA 3LE8A 3LJKA 4QI3A 3QXXA 5C5EA 1T4WA 3HZMB 3KZXA 2YPLA 3EXG1 4XE5B 4BEIA 3QUQA 4K2AA 2CO7A 4XNBA 3EVZA 2FF5A 2CXTA 1QPBA 4G5RA 2EYTA 2ZAOA 3HCEA 3TCLA 2B15A 2WQVA 3EGSB 5FV2A 4CA4A 4H1UA 4BVAA 1KO8A 2JFOA 1ZOPA 1HDZA 4EDXB 1I3OA 1GTNA 4JFFA 5DOVA 3WWDA 3T3DA 1B42A 1E5VA 2WO4A 3TLEA 3BCDA 4QJ5A 5LYJA 3DJRA 2DQTL 4O2EB 3PPXA 4WUUA 5TE6L 2OXGA 3F5QA 1Q22A 3RDTC 1S7VA 1O5OA 1T4DA 4A15A 1QFZA 3D7NA 1EK3A 2HLHA 3IWUA 3O31A 4XNZC 4XQGA 4TV8A 4BV3A 2HF8A 1AUVA 5CLQA 3G17A 1B4TA 4XMTA 4HFRA 3QLUC 1U8LB 3ZPXA 5HXMA 1FBNA 5FYKL 2O59A 4JP1A 5DTRA 3VXOB 1RC0A 4JRYA 3MRCA 1QF6A 3DV4B 4KRLB 4I5GA 3KLKA 1HWGB 1FJ1B 2VWEE 3SKMB 2V17L 1S3IA 4HK3N 2PS9A 5T1DH 1J9GA 3ELDA 1ZFNA 2XYRA 4YRLA 3BGFC 3K6SA 1E9AA 5EBMB 4ZDKA 1GZHA 2NY4D 2J41A 5COBA 3C5VA 4FD2A 1M2NA 4JJ5A 1VMIA 2O1SA 3VOAA 2C95A 5JCOA 2B6HA 5BN3A 2EARA 5FEUA 2CV2A 4LQDA 2KZ1B 4YI3A 2ZIGA 4ENVA 3R06B 4QCIB 4YUYA 2VWPA 4C6RA 3GZPA 4LIPD 4CMHB 3T54A 2FF7A 2E2WA 2BFBA 4M29A 3DRTB 4AUUA 4FG6D 1XZWA 3UABA 4FZEH 6FABH 1XNHA 3NVQA 3OF6A 1F20A 3HKZA 4LHUD 3IGFA 3CC5B 5L6YH 4FXOA 4L3WA 2XI4A 2N0MA 4L8SC 4C0XA 2PMKA 3TVMA 3C8DA 1CF4A 3FQWB 3L0DA 1AXTL 2RCSH 1Z17A 4YGAB 4J91A 3H6AA 1Y5MA 4F8YA 1U9JA 5FL7D 3QWNA 3QEGH 4B6FA 1QU3A 3FH0A 1JZIA 3K5WA 3KXKA 4GRIA 4P23C 1Q1NA 1ULVA 3IPBA 1T5WB 2AXJA 5AKGA 1NBMA 3CZFB 4DRXB 5ANME 1TU2A 2EKSB 2V7TA 3UPDA 1MRFH 2OMVA 1I1FB 3NDBB 4U6TA 3RFZA 4GMHA 1KPRA 1Z2KA 4MMZC 2UUCB 1QUFA 1CUVA 3KYAA 2BWDA 4MUGA 3L8GA 1CERA 2VG8A 4FZVA 2EH7H 1Y8ZA 5IN5A 2TSBA 4WV1A 4WKZA 1EAMA 4Y16B 5H9VA 3IDYC 4LKCB 4KI5F 4ZAKA 2I9LA 1G7LA 4DOMA 5FBZA 1CE1H 2AITA 1XF3A 1DAMA 1J1UA 5A2CA 3UTPD 5JWRA 2GZ3A 1VG0B 3MRJB 5F9MA 4JBYA 4OU4A 3KPQB 2AVGA 2JI2A 3JSAA 3PF8A 5FF6A 5HCNA 5A2KH 1DFBL 1VEPA 2WQ8A 5KQMA 2H2PD 5J56B 2Y2YA 2W22A 4EGQA 2I7SA 5IM7B 5IT0A 3NEOA 2FLKA 4HEHA 1PFCA 1JVKA 3FGOA 4FUQA 5J1TC 1QTNA 2YL2A 3CX2A 2C4UA 3D69B 2A0LD 3UMCA 3PDOA 4YAWA 3G6DH 3HCBA 4FINA 2FBRA 3D6MA 3SBEA 3R23A 1MREL 1XH3B 4TM7A 1U93A 4OM1L 2F1HA 3KXFA 1LSUA 2ZULA 4FUTA 4CNQA 2J45A 3EZYA 2VW7A 5KSAA 2UAGA 4DEPB 3RRNA 1E4WL 2J88H 2O1WA 2XWXA 2H06A 4OXIA 5KREA 4O5LH 2QPFA 3BXZA 3PFWO 3VSBA 2X10A 5HHQB 4J07A 4ZS6D 1LBEA 3IEXA 1IEXA 1J48A 3GUUA 1AJ7H 3MFQA 3UW1A 4GP9A 1UJCA 1S9DA 5I9QC 1W5FA 1VL5A 5K93A 2QMUA 1IQUA 4GAEA 4HF7A 4MR9B 2DUNA 5FW8A 4HLDA 4HVTA 1VRVA 3IPXA 4OUUB 2A4ZA 4XFJA 3EDKA 5EO1B 3L4JA 4PVDA 4C43A 3OJFA 5M04A 5AOCA 1E7VA 2R2EB 3S2YA 1XXDC 3KZVA 4OIFA 1M1UA 1R24B 1SCDA 3QUKA 4CKXA 4ZMQA 1RTTA 4Q7MB 2F53A 5ANMB 3BKMH 3IQHX 3CVHB 4OKIA 4TKWA 4N2LA 5FYLL 3TOVA 1D9ZA 3CRZA 2JNZA 1RFLA 4TSBL 5DHTA 1WC7B 4U1KA 4X1YB 3W0WD 5F7AA 3L7KA 1GADO 3ILVA 1TRHA 2X5PA 3UHOA 4RMWA 1RUQL 3OJDA 1GA1A 3SDDA 1J1PL 3FO1A 4O51A 3CXHK 4GPVA 4E4TA 3LFUA 1OXMA 4BASA 4BM7A 5JC8A 1JI2A 1KC5L 2CALA 1L4NA 4OBRA 2YMLA 3IJHB 3L1UA 4JAMB 2XW6A 3DS8A 1LVUA 5EJMA 3LIZH 3DT9A 2DWTA 2E56A 2HRPH 1LI4A 3W2EA 3BIWA 3MD9A 2GN6A 3ESDA 3UFBA 3HHSB 3SVZA 2GCGA 2NZ9C 3BMOB 3X43A 4ZX6A 1E0KA 2JJYA 4XW2A 1L8LA 4RX4D 4QDZA 3NO4A 1L7VC 2D3TA 4PRHE 1SQGA 2H4YA 5D72H 1F11A 3TJMA 5IBRA 4RISH 5EIHA 1N2RA 4JJGA 2F54E 3FJOA 2V3FA 4HATA 1ZCRA 2FWNA 1MCIA 3KNBA 1QF7A 5I1IH 2HPVA 4H7DA 2JJUA 3PYLA 2VDQH 2XN2A 4CKCA 3WLBB 1ZR4A 3L0YA 4HJ0C 3Q72A 1STOA 4C7XA 1A4KA 1IBHA 2UZIR 4MIYA 1JLMA 3AF0A 2DLNA 3KPNA 2P5EA 4R31A 3W06A 1DJPA 3FZNA 3TBHA 3EOBI 3GRRA 3Q3GB 4DK6A 1M34E 2VNJA 5A6MA 2Y0EA 4M9PA 5GGVY 1JWAB 2X5KO 1E3ZA 3AY2A 4D0DA 4Y9UA 4TL5A 1M7BA 1QYGL 5F21B 2VXOA 1PRYA 5TGDA 1WEJL 3H04A 1YK0A 3HR8A 1OBHA 5DWDA 2BE7A 4MRMB 1RWPA 2BFOA 4MUAA 1KTCA 3RWEA 1PSKH 1XH1A 1TZGH 3OCVA 4DHWA 1RULH 4KYUA 1ESMA 1KIRB 1A5ZA 3K09C 1RZJL 4XR4A 4EYEA 5K0CA 3PFHA 1EAPB 5EPOA 5DJ2A 5E3JA 5CB8A 2ALJA 4YYZA 5I1LA 2BI7A 3S55A 4JFVA 1C29B 1B14A 5JLAA 5K6AC 2QMQA 4KN6A 1CFQA 2Q20A 3FKUS 1L2TA 1WCIA 1Z0KA 4IDFA 4DEVA 1CQIA 1NUQA 3OTHA 2OL3A 4TV9B 4F4CA 3CGWA 3VKFA 5EN2B 1WSAA 1EUUA 4CVXA 4NCDA 2OV8A 4MV7A 1L7IH 3PAYA 4X5RA 4K9EL 4C4PA 3VKGA 2YASA 3WE6B 3QRFM 3N40F 3JYOA 3VCLA 4QT4A 1UD4A 1YYLL 2XWJB 5AVQB 5GOZA 4RFOL 3AY0A 4JQYA 3DCNA 3VPBA 1LE9B 2H92A 5FR2A 5K8JB 1XCXA 3NSDA 2GGSA 4UT7H 2JGIA 3GT4A 5AOIA 1QV6A 4LVOA 1P5UC 2QU8A 1ECFA 3FETA 4Z54A 3ZLUA 4P0DA 4GMSH 2CN1A 3V6FB 3NK3A 2D3NA 5CP8A 4TN5A 1N0XL 4UUJA 3PJEA 1XK6A 3RABA 4PTUB 1V95A 1PYGA 4PRHB 4HLEA 1E2WA 2YHSA 4U02A 5JJKA 3UYKA 2VAMA 2H1WA 3O4OC 2NNLD 2F54B 4PWKA 3LX5A 4IUBS 3IF1A 2ZWMA 1IIKA 4K8RD 2FZEA 3B1JA 2WY2D 7FABL 5AK3A 2MHCA 5A0TA 5IHHA 1W94A 1MZVA 5ERYA 3R4VA 4ZTPH 5JJBA 2GJAA 3QXTA 1MTZA 4DSNA 3NM4A 4LK3A 3TQTA 4DNLA 1NRXA 1FRGH 1QNZH 2CDFA 4N2IA 1KMQA 4BMYA 4H8WL 4QRRE 2YPKA 1NQVA 4XP9H 2GFIA 5TDPB 3RWCB 4IRJD 1EZLA 2BWQA 4X8MA 5KKCA 1IM8A 5AW5A 3DMNA 4PU2A 2HMID 1V1MB 1DQLH 4WMLA 4V1CB 1OASA 4XNXH 4NNYA 1YR9A 3LB6D 5U4QA 5C0DA 2YO3A 5FO9A 1ASPA 5FGBA 1F4XH 3HI4A 5JQ6H 3SS8A 1YAIA 3LKOB 1GGVA 2XWPA 4JFAA 1KSGA 2VUKA 3QWRD 2P28B 4NKDB 5JUWA 5DMIH 5I6XC 4FMKA 1OF2B 5FPSA 2C1XA 5HPMA 1Z5PA 2AUTA 5DP2A 3X1ZA 4LXYA 2XOEA 2AR9A 4R0LA 2W42A 4O4YH 2FW9A 4LG1A 1SYVA 1BXRB 3MLYH