5HDBB

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
466
structure length
466
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 114
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5hdbB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5hdbB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5hdbB03
4O3TB 3RAGA 3BN3A 4Z7OB 5KYYA 3ZDZB 1PD1A 1L5GB 1TYEB 1UEXC 3BQMB 1DGQA 4HQNA 5KYXA 2I91A 3ZE2B 5KYXB 1MJNA 1MF7A 2B2XA 1U0NA 1XUOA 3TXAA 1JV2A 3EG9B 4HQKA 4O02A 1JV2B 2VDNB 4O3UB 1M1UA 2M32A 4BJ3A 4O02B 3AL8B 1AUQA 4FWWA 3NIGB 3F74A 4DMUB 2ODQA 2XWJI 4WK0B 4CN8A 5HDBB 3QA3E 2NVOA 2ICAA 3F78A 3M6FA 5ES4B 1YVRA 4WFQA 5HJ2A 5KYUA 1FNSA 4Z7NB 4C2BA 5KYUB 1V7PC 4MMZB 2P28A 5E6RA 3VI3B 3PPXA 1M10A 5E6RB 4UM9B 2ADFA 1RTKA 1YVPA 4F1KA 1L5GA 3FCSA 2XGGA 5LN1A 4WJKB 1NA5A 3FCSB 3NIFB 1SHTX 1MQAA 3K71B 3IBSA 4JDUA 4GZ8A 3EOAI 4CNBA 4MMXB 1XDGA 3EG9A 1MQ8B 3N2NA 3AFCA 1BHQ1 4C29A 3ZE0B 3AL8A 3IJEA 3EGDA 5BV8A 4HQOA 3IJEB 3T3PB 1U0OC 2IUEA 2O7NA 3EGDB 2NUPA 3V4PB 4CN9A 1IJBA 1OAKA 2NUPB 4NENB 4MMYA 1XDDA 2QTVA 3T3MB 4MMYB 4MMZA 3EOBI 4NEHB 1YUKA 2VDMB 1LFAA 1N3YA 3EFOA 4PN7A 3EFOB 1SHUX 1IDN1 2ODPA 4C2AA 3HXOA 1ZOOA 4G1EB 1T0PA 1IJKA 1SHYB 2WINI 4WK4B 3ZE1B 3K71A 1FE8A 3NVQA 3NIDB 4F1JA 4IHKA 3V4VB 5KYWA 2VDKB 3TVYA 5KYWB 4MMXA 1CK4A 4HQLA 3FCUB 1U8CA 1OLZA 2WW8A 4FX5A 4M76B 1U8CB 4JX0A 1PCXA 3Q3GE 2VC2B 1SSLA 4IGIA 2VDQB 1RRKA 2XWBF 2NUTA 3K72A 4G1MA 3ZDXB 3ZDYB 1MHPA 2I6QA 4Z7QB 1MQ9A 1QC5A 3K72B 1M1XA 4G1MB 2NUTB 1AO3A 3PPWA 4NENA 4IXDA 1QC5B 1M1XB 3VI4B 2VDOB 1RD4A 1QCYA 3K6SA 1CQPA 3EH1A 3EH2A 1JLMA 1ZONA 1Q0PA 3K6SB 2VDRB 5E6SA 1PT6A 3OKYB 4A0QA 5E6SB 5KYYB 3OKWA 4G1EA 3OL2A 4UM8B 4K3JB 3OL2B 2X5NA 5KYNA 1BHO1 1ATZA 4HQFA 5HGJA 3HI6A 3ZQKA 1ZOPA 4UM9D 4XW2A 1SQ0A 3GXBA 3TW0A 3PPYA 1JEQA 2VDPB 1AOXA 1RS0A 3E2MA 3PPVA 2P26A 1JEQB 1M2VA 3AL9A 1PD0A 1M2VB 1M2OA 1N9ZA 3BQNB 1JEYA 2UZYB 3TCXB 5E6UA 2I6SA 3HXQA 1JEYB 1T6BY 1DZIA 5E6UB 3EGXA 4WK2B 1IDOA 2VDLB 3EGXB
chains in the Genus database with same CATH superfamily
3K4HA 2NZ8A 2O2ZA 4JFHD 1RXEA 1JWAB 2BD0A 2JF0A 3PE3A 4JSYA 5F3HB 1O6ZA 4F3FB 2IUUA 4GIPD 4M1DH 3EGSB 1VM6A 2DHDA 3D85B 2HTFA 1BIHA 4BJ1A 3IVAA 1UWCA 4WW1A 8MHTA 1FIGH 4D3SA 5EMHA 3MFFA 4TYWA 2BHTA 3T5MA 4A6XA 4DDVA 4QRTB 2C5GA 2H1SA 2RCYA 2NP7A 1G42A 4FZVA 2FPGA 5I1KL 1AK1A 5DSXA 2Q7DA 1QU3A 3GO1L 3SQOL 5DYGA 1P7QB 2AQ3A 3CH7A 4WXEA 4F2FA 3RD5A 1EJ0A 5K0EA 2QKIC 1JXJA 3PDDA 3MQ2A 4ZIRA 5DUJA 4GSKA 1E7UA 3RTQC 1P8AA 4WWHA 2OFXA 4XQCA 1BZOA 3BOSA 5BSEA 1P81A 2JJTC 4PJGA 1LB1B 1AI1H 1RAGA 5DN9A 3GEBA 5DMKB 1XB6A 1MH5B 1VBNA 3GLFB 3JYCA 1E5QA 4NRXB 1KYAA 2ZE8A 4R3UC 2R62A 3P4OB 3TW8B 5DWUH 1JV5B 3GI1A 4YRJA 3WLPA 3KWFA 4BFJA 5D1QC 2C61A 2BR5A 3WHKA 5CUSH 1AGCA 1TO1E 3BTUA 3P0IA 4LDCA 4J94A 3S36L 1OVZA 2QDXA 5IKCB 1U2TA 4EPRA 5KVVA 3QYAA 1JHKL 4UMSA 2R1YB 1FYTA 2Z6UA 4QLBA 1MOSA 1WF3A 2DWOA 4Z7NB 5AICA 2X05A 4NCJA 5CZXD 4E15A 3SQNA 4MB5A 1DG9A 5C0DB 5DX0A 3WXWL 1WZIA 4RZUA 1B74A 3LQZA 2JI9A 4MZDA 4C05A 1HYHA 5TF1H 3C3XA 4B34A 6FABH 3C6YA 1OGYA 4C07A 4I0PD 1II8B 2IVFA 3EAGA 3HBFA 3O8NA 4WNQB 5KTEH 3SZOA 2IYEA 3MYYA 3ILPA 5IEHB 2VLMD 3G7SA 4R2WA 4AY4A 1FWXA 1KEVA 5AB1A 1OC2A 2QLLA 3VH3A 1XP8A 2BW5A 4PEVA 4PTUA 3PC2A 3U1PA 4G6AC 1KY5A 3I5UA 4R7NA 3R76A 3KCNA 1R5IB 3REGA 2DBRA 2Y5TB 3PGXA 3U40A 3II1A 1XNHA 3ZCRA 4RTNA 2AK4E 4Q9IA 1GWNA 3Q8EA 4E03A 1D0SA 3TV8A 1PIWA 1FZJB 4MIOA 4JHXA 2XZCL 2Q1TA 1JJUA 3LBHA 4MDFA 1U3HA 4MGXA 3WLTA 5C34B 1QG3A 3SDYL 5A3SA 5KNCA 4R4FL 3GQBA 3J8F7 4AQDA 2CHXA 1G9NH 2XTMA 1DCTA 1LW7A 2CG9X 3F62A 1I4TD 8GPBA 4CU2A 2VWEC 1T1RA 2R0QC 1E67A 1JAZA 3LQQA 1C7ZA 4PY8I 3BE5A 3CVBA 1WAAA 4QQKA 2A1UA 4M1CC 4KN5A 4F80A 4YWGL 1M6WA 3HUDA 1A14H 5AUNB 5DSZA 3CMMA 3NC0C 4ZUTA 1NNUA 4DV0B 4ZVKA 1GGJA 2PVCA 4HNRA 1IPEA 5JHDA 4ZFQA 3NTXA 1RLMA 4DUVA 1I4FB 4W81A 1LO5B 3QJFA 3EGDA 1S7QB 3HI6H 3KQSA 2WJHA 4LGYA 2EW8A 1RFDH 3T0EC 3IQWA 2EHJA 1C5CL 2ESVE 5AKVA 3X1FA 2X0RA 3I2KA 1EVQA 2JBWA 2O2JA 1EM8B 2UYLB 2O2HA 3C7KA 2BY3A 3RVKA 3LBAA 4RY0A 1E4EB 5HIJA 1UXJA 3GA0A 1U95A 2VJBA 1DQJA 4X3PA 1X6LA 2VDOB 5DZOA 3OFNA 2I07B 1A8UA 4Z76B 2P62A 4WECA 2GFBA 3S2ZA 1ITBB 4E36A 1KJMA 5EWMA 3T0GA 3UT5B 4NP4L 1ZHBA 2I60L 3AREC 1AOXA 1RS0A 3ZQ6A 4LCVA 4RVDA 4RZHA 5HDRA 5FA6A 5EUCA 1B88A 2VAAA 5B7MA 3TZBA 2IZ5A 4W5NA 3GRWA 4A2WA 4DAOA 5AVWB 4JFEE 1FNCA 3GT3A 4LXHA 4HUXA 2BEKA 2WJ5A 1V35A 5HVFB 5C1PA 3AWFA 1MCHA 1QFWM 3SP1A 1QIGA 3LRMA 3WGQA 4WBXC 1NXPA 2FZ3A 3GF8A 1ZA2A 1NJFA 5ISZB 3QT2A 3UATA 3QPWA 4OFQA 2DWUA 2YHBA 1U7PA 3LA6A 5B12A 4HKZA 2WINB 1Z5OA 2DH6A 2GT9B 3B7YA 4D9BA 3WY2A 4WLCA 1ZICA 2HZBA 3K2QA 3WV4A 4FU0A 1I51A 2AEPL 1TZGH 2Q28A 2FIKA 3BUTA 5F96L 4XOCA 3X11B 4FXPA 1Z5NA 4LZWA 2IXFA 4R40A 1JRHI 1NI5A 4A2FA 1WMAA 1JEOA 4MQ5A 2FO4A 2VXVH 3G7TA 4E88A 4AY3A 2PCLA 1CQYA 1B0RA 4TS3A 4IG4A 2EXSA 1QFWI 1BIFA 1U9ZA 3DGEC 2FDCA 3GT6A 1P9OA 1SOUA 3P0JA 1OFHA 2AMJA 1OXUA 3G5XB 4G7SB 5IS2A 4WV1A 1XGTA 3HUJB 1MX1A 4KWIA 3A32A 5FBHA 1G8AA 1FYDA 1J5DA 4CF5A 1XTQA 5C1IA 1J12A 2V03A 1D9ZA 5EKXA 2J1YA 3GFVA 1UM9A 3TINA 1WZ1L 5PGMA 3C2SA 1Q6ZA 2PP8A 1UWXK 1U0RA 1R6BX 5AFAA 4PGGA 4XGKA 1GUYA 4WW2F 3IEKA 1GAQA 1MF7A 3AVPA 1H15A 4M7OA 3UUEA 4OMFG 1TKWA 1J07A 1ND6A 3R0VA 2I8CA 4RGOH 5AW5A 4KHZA 5JY1A 3TEZA 1TT6A 4I5BA 2P2SA 1SEBA 1L4NA 4BE9A 4RBPH 1JPGA 1NCHA 1T0JB 3MRTA 2LKDA 3ELDA 4N0FA 2HRDA 3WKCA 4M8NE 3EHBB 1WMFA 2XR1A 4CDRA 1MABB 3LU1A 1T1XB 2FJFB 5KYTA 5IMKA 3HE7D 1Y9EA 4NQZA 2YUZA 2ZCKH 1DEDA 1RZGB 4YDIH 4RV5A 5E8OA 4EPWA 1I8UA 4W9MC 5ENVA 5HPMA 3LL7A 2ETVA 4LMQE 2J09A 5JIKA 4LG1A 2FATH 2A6JA 2PY6A 5DHMC 4RQQB 4WI0A 4RA9A 4N8VG 5B4TA 2FBJH 1RHHA 1UT9A 1UM8A 4EP1A 1F13A 5FYLH 1E5LA 3S96B 3BXGA 1YGPA 2IAMD 4R90H 3FI0A 4IV5A 5I8KL 1S7XA 4OUDB 1V3KA 2HUEA 2IXBA 2FZKA 2QJRA 1ACCA 2H2SD 4PW0A 4IVPA 1WJGA 5AAWA 4KY1H 25C8H 4JQXC 2XD9A 4KAAA 4HOXA 1NAHA 1R9JA 5K3FA 3O6FA 4BH7A 2WUBL 3HB9A 3ZWXA 4V0RA 3QNZB 4FFVD 4FQ7A 3TNJA 1EIBA 4F6RB 3F6LA 3EG5A 1F1AA 4R4BB 2H47C 2J6EL 2X9GA 3ZE0E 3HRZC 4UNUA 4PYGA 5FUVA 2DMCA 3TOXA 4BTVA 2QVLA 1HQ4A 4IHJB 2WXRA 3FLMA 4JHZA 1DSFH 3A6BL 3ESPA 2HA4A 2YJZA 4WEOA 3VSQA 4YTEA 1D5MB 4FS8A 4ZPXA 4ICXA 2UZXA 3E5NA 4JVUA 2FE4A 4DCMA 2YVUA 5L0QC 5GV7A 1A82A 3FR7A 1F58L 3ZTYA 1X5YA 3R5JA 1AIFB 4GS7C 2WLIB 4AJHA 5FD8A 4AQ1A 2WPNA 4XB3A 4BO8A 1H65A 1HEJC 4BYMA 4LJ7A 4Q4JA 1Y98A 3DJTA 1KCUL 4CM6A 5JY6A 4LEEA 4QBFA 1A5AB 4X6EB 2CXTA 3E0QA 1KYYA 5E7MA 2CSXA 1ICIA 1FL3A 1R3LB 4BO7A 4EB3A 1AE6L 2KQNA 3X1NA 3DX7B 3KVDD 2Y3NA 2OBGA 3A6KA 1S02A 4O1MA 5K9OA 4D94A 4Z7WB 1F4PA 3MJDA 3N0AA 3ARBD 3H86A 4TMXA 1JIUA 1GIAA 3MWFA 1NNEA 2OSLA 1NCIA 4ZAVA 2H07A 3I72A 3FU7A 2ATKA 4PZUA 2QM8A 3OQNA 3RL1B 3VU9B 5J1SC 4Z7QF 4G3XA 3UMTA 5IJDC 1Y82A 1PG2A 2X1QA 4OGYL 3HBNA 1UOPA 3LC7O 1RY7B 3X1BA 4J0DA 2WHQA 1QS0A 2H1PH 3FMIA 1RZFH 1ZN8A 4E6PA 1JHAA 1GAEO 4HDSA 3L5HA 1M6EX 3WK8A 1ZBQA 4L8SB 2DJUA 5MFPA 2FJSA 1N0LA 4DGIH 1B8VA 4U7HA 5D7EA 1Y3AA 3DL4A 4UT6H 2VCHA 5D7SH 3S5YA 3HJEA 3DAPA 2FRGP 4EG4A 1WS7A 5IANA 4UNIA 5JH7B 2NSQA 3CPEA 4D8VA 2V5RA 3G6JE 5IBTL 1U0LA 3EFOB 4QIHA 4LJ8A 1MRZA 5C46F 5MEPA 1V8BA 3FW1A 3SS8A 4U6YA 3TBCA 1A9XB 3LZDA 3F5WB 3RGVC 4HXGA 4B5EA 1U36A 1IUZA 1TF4A 4MV5A 3OFVA 1H5BB 4HDMA 4ZI2A 3FO0H 3PGA1 4CM4A 3DJRA 2XUIA 3G6DL 4BCYA 2FZCA 3ATEA 4UFOA 3BMXA 3FMGA 2DY2A 5BNIA 1LPNA 2PWAA 4J91A 3ULUL 5C0EB 5A43C 1SXGA 3F7PC 4OD2B 3AR2A 3WRXC 1AY1L 1O9HA 3QG7H 3WKDA 1I13A 5TMPA 4LSSL 2CVFA 1W8OA 2LU4A 2RJNA 4WUTA 1QX3A 3IAM1 2QMJA 1QONA 7REQA 1N8NA 1DIGA 4KNYA 2ZE6A 4BSVB 4TPRL 5DHQA 2BOBA 1S3FA 4NPJA 1LP9E 16PKA 4IIFA 4LHQB 4Z78A 2IFGA 5JHMA 2BEUA 3E1F1 3ZLJA 3UJ6A 2B0CA 1UPUA 3VSVA 3AKCA 3UTSA 5F93C 1J23A 5T5QA 1JHVA 4EB0A 3ADCA 1U99A 1SKYB 3L0CA 2ROQA 4O5LH 3S29A 2CCVA 5H5JA 4LDEB 2A9KA 4MAYA 5CJBA 1UINA 2DQIH 2ARKA 2NU6B 4NM4L 3VKHA 1JWBB 1WCBB 1I3OA 4KOBA 3VR4D 4BQBA 2B8EA 3NHWA 1RHFA 1S6YA 5D70L 1S3KL 2J57A 4P3OA 4M9OA 3ZHCA 3QFDA 3SYKA 2QHRL 4KUHA 4HV4A 2G30A 2G9QA 3RIAK 3PQCA 3S7GA 1YQGA 1ZGBA 2V9RA 3F01A 5ICZA 2UZ0A 4YJZL 3LUAA 1K5PA 4KGVA 3DFFA 2PSFA 1F9AA 1JR3D 1GGHA 3KHSA 3GAZA 3DOUA 2DQJL 5AB9A 4DR7B 2FQFA 4KITB 2DI9A 2BI7A 1QLWA 3NKFA 3OTQA 2XN9B 2E9BA 3BSHA 1IM5A 2AXEA 4LHXA 3P9IA 5LBUA 4G0PA 3TTVA 1PK9A 4A6EA 4FI6A 1RZKL 2E4VA 2RJ3A 1MFBH 3JTTA 3RODA 3IU4L 1I8IB 1JVBA 3OJXA 4ZVRA 3B2XA 3UTPE 4LRWA 2ES4A 2B82A 2H1RA 1CD0A 3L3HB 4LNAA 2QN1A 2WXQA 4XVJH 1NE7A 5F1PA 4QTIH 1UFKA 1KRWA 1F5SA 4J7AA 3U4BH 2F8IA 3WK7A 1SG9A 3GZPA 1K7CA 1PNVA 2QSUA 1ZVMA 3ZQUA 2DMGA 2QELA 4FBLA 4JLRB 5KCMA 5AUOB 2PUWA 2IADB 1IG3A 3M4JA 4JFDB 2HW8A 4NOBA 5FYJH 3D8NA 4WMLA 4LZNA 1R3KA 3H05A 4Z4FA 2VEOA 3PXJA 1JPFA 2HLNA 4R1OA 5CEYA 3DWEX 4W9JC 2ATAA 3VOSA 1W581 2VNSA 1Z2DA 3CB4A 3LG2A 4URZR 4B17A 1KUMA 3VM5A 5C0FB 2HOQA 2UUDH 5I66B 3BL6A 1A2YB 4EJ0A 4S2UA 5G4KA 2FR1A 4INAA 4E09A 1E5XA 1PQUA 5JDCA 3JWDH 5DEIA 4QYXA 5CXUA 3CV3A 2V3EA 4FFRA 2O5EA 5CLZA 5G0VA 1KOGA 2OP4L 5CPFA 5HDBE 3IOCA 4DV6B 2BP0A 3F7NA 3QO1A 3U3XA 5FWXB 3L7BA 1Q0XH 2ZAOA 1UD6A 3Q8LA 3VXMB 1I7SB 3TZKA 2JHAA 3K0FA 1EZVX 4D56A 5CFPA 2H00A 1LC3A 3QBJA 2W07A 1RACA 4JRXE 1JYEA 3HI5L 1DQNA 1C5DB 4GBGA 2VIRA 1SXJE 4Q9QL 4ZTBA 5FLVA 1O58A 3OM3B 1ECLA 3R0IA 2HX9A 4B50A 5DHAA 3LWZA 3BXZA 3PHAA 1FJHA 4MZXA 4M00A 3TJEH 4DN4H 1YBVA 3LC0A 1G8PA 2XHEA 2KJQA 4KQCA 3B8HA 1D6VL 3H1AA 5B8CB 3A4NA 1MH1A 3LSOB 2JGJA 4DCJA 5IQNA 1SVNA 2R2HB 1TVKB 3JQFC 2C2YA 1XJ5A 1UOEA 4KK6D 4FN5A 2OXHB 5GRYA 1BQEA 2OS7A 3ZQWA 1YUBA 4UQ2B 3A9UA 2WXMA 1XZMA 5H59A 2IDCA 2UUCB 4PRLA 4UILL 4RNRA 1W8IA 4ENVA 1JMVA 1A64A 4QRUB 5D7JC 5IDXA 1MO2A 4DWJA 3SFVA 4MO9A 5CEZL 3HMXL 1QVZA 4PLCA 1BZ7B 5GGUB 3T3GA 3BAEH 2X4RA 1SYSB 3HUEA 2PZBA 3S2EA 4CQMB 2IYFA 2XTJE 3MWGA 1KCKA 4UEOA 1JG2A 2X3UA 4RY2A 1I6MA 5JA8B 4XMVA 2ZSIA 4V1DE 3QIUD 1W2WB 5B4UA 1FF9A 4F2HA 3LMJH 1DBSA 2D00A 3R3VA 4BPRA 4KLAA 3IAAA 2X0NA 5EQFA 2X8LA 3NT2A 3R8BB 3K31A 5HVNA 2R1XB 2OI9C 3PQYA 2ZR9A 1UXSA 4NQDD 2IOFK 3LF1A 3B70A 4JX9A 4CR7A 3BLBA 1OQXA 4WXRA 1QEWB 4RXUA 4D0BB 1N5RA 1NURA 3CNEA 1KQGA 2BEWB 4HAIA 2ZJBA 4TQAA 1H1TA 1IM9D 4M0CA 3WJMB 1AC5A 2JIXD 2I66A 1ZH8A 2XKNB 3ZGXA 4KVZA 2CSUA 2QKYA 5BXFA 2NT1A 4KRPD 4S1QH 1ZU5A 1L7PA 4OB5H 5D1XC 3KLSA 5DUBB 2WYZA 3WEBA 5CCGE 5I24A 2GVYA 4P4SB 4AGMA 2QV0A 3OIFA 1NOKA 1T5BA 3WYDA 1JHXA 3BDVA 3GBNH 3WGVA 4IMLA 3CTMA 4H6PA 3ZBPA 4EH1A 1D7AA 4FYQA 3EZJB 2DQCH 4J8RB 2ZPKL 2A35A 4RF3A 4R1PA 3TDNA 1DTEA 3H42B 2O8FA 1AO7E 2MQCA 1EVKA 3WNOA 1UB5A 3D8TA 4RZ3A 4L8YA 2GILA 1S9XB 3UNXA 3PF8A 1MW9X 3ZJ4A 2W60B 2B7DT 1T7WA 3CUSA 5DC9B 3SK0A 4NN5C 1W72H 3ZGHA 4Z7AA 3E3OA 4UFPA 2FPIA 4X3CA 5KHLB 3EOTL 4EZEA 2DV6A 3PI6A 3A6JA 3L0BA 3FFCD 1GN9A 3VR2D 4EI7A 3D3EA 1KB5H 1TZMA 4JANA 5BVGB 1LD9B 1FL6A 1YC8A 3UG7A 1BEEA 2C1XA 1UM6L 2ADIB 3BFOA 1J0AA 5FX2A 5K8VA 4O1IA 1JNNL 2G9NA 1LUAA 2DFNA 4R8LA 3EUAA 1N5YH 3SJCA 2QVXX 2I03A 1T8SA 1JV2A 4RQTA 3KEFA 1T2XA 4O4IA 1UA3A 2PO6D 3BVDB 1FTGA 1K08A 2Z09A 3I30X 5IH7A 4MNTA 3G6AA 3VWJA 2PWFA 2GS9A 1ODJA 5DK4A 2OK8A 4AX4A 2P28B 1U8OA 3F85A 3KDAA 1AQKH 2HCJB 2BP8B 3ZIAD 1XYVA 5F2KA 1OFUX 1LEKA 2WK2A 3HFFA 2GX6A 2XF8A 4KUZH 3IS1X 4FFWC 2FI1A 5DLLA 2PMKA 4LYDA 4Q02A 4B4UA 4IW4C 1ZEJA 4L4TD 3A6EA 3RJ5A 1RQXA 4EI5B 3JQCA 3BIJA 4RMJA 4HF5H 4QXVA 1GDHA 1O9ZA 5TPWL 3U7IA 4XPIA 1A72A 3AI7A 3RIKA 1C7QA 3WIDA 3D52A 2R69A 1RPTA 4XJTA 2NY0C 5FADA 1XNQB 1VA5A 4F7MB 3RGGA 2TRHA 3EH2A 4RUKA 5LQDA 3BPNB 3TMAA 3CY6A 4H8QA 1OAQH 5J3HD 4CV3A 3AY6A 4BKPA 2WWOA 1R5VB 4M3HA 1ILEA 1GSMA 2VZ1A 4GPTA 2BSRB 3V0HA 2LTQC 1AACA 3VG0L 3ILXA 4F58L 3ASUA 4F7DA 5THKA 2UZYB 4QUHA 1UJ2A 3RI5K 4KLZA 2OGWA 4ES8A 4J16C 4ELMB 1C9YA 3C5ZB 1UD4A 1FW6A 4XDYA 3EWIA 3UT6A 4TM7A 4REMA 4E07A 4OK6A 4CJXA 1JTPA 2FO8A 1JDBB 2IGBA 4F11A 1KEEB 3P2DA 3A3KA 3KYOA 2XB2A 2X7HA 1Z9SB 1XCGB 2WU0A 3FTZA 3NHAA 3MPUA 3SM3A 3W11D 3EOZA 5FK9B 3RWOA 3VH8B 3NG1A 1HR0B 2CK0L 5AW9A 1R5JA 5I5RA 3NP9A 1INQA 4IJQA 2ZT9C 2QSCL 4GE0A 3WHXB 3T41A 1UDCA 2X5OA 4YBZA 2ZCLL 3O6VA 1UFVA 1U30A 4LLYB 4CIYA 1SAYA 3QUSA 4CL8A 3L77A 5DXWA 1JZQA 1YI1A 2GB4A 5GZND 4XEUA 3K6RA 4ANFA 4JFUA 1PD6A 2MMXA 1MFVA 4EK9A 3BGMB 1KN4H 4A63A 1F6LL 1IC4L 1TFHA 2EJUA 1AV7A 3GPIA 3B56A 1AP2B 1ZIAA 5FCDA 5GJSH 3PUIA 2JLRA 2NYRA 5U4QA 3OPYA 3MA7A 2VJMB 4K05A 1ZEAH 1G6RB 5JS7A 1FLRL 2PKEA 1N8TA 1A1OB 4EGJA 1I6LA 1Y4AE 1ZH4A 2WIFA 4XQEA 5D2LA 4P3CH 5FA3B 2HFEA 4H5SA 2PD3A 4ODWB 2Q2VA 3BCSA 4OLEA 1H9AA 1KBGL 1WY5A 1U8JB 2PR7A 2P77A 3ZE2B 1XVAA 2YARA 4X6BB 1FY2A 3AFMA 3KWVA 2A0LD 1QLFB 2FHCA 4PCYA 5DWQA 3PE6A 5HXAA 1B0ZA 4CN8A 1T0MA 5AVTB 5I2IB 1V11B 1EEYB 1ZS8B 4KXNA 1MCLA 1CICD 4NIMA 4HNAB 4HH8A 5IVXF 4HAVA 4RVHA 2EDCA 3D0KA 2EJBA 4XCFH 1Q7CA 5CP7B 3VFMA 4U33A 5DEZA 3MK31 4U7FA 1XAKA 3L49A 2YKLL 2JFHA 4P4KD 4A2PA 4UBIA 5DJ5A 1UAYA 2VBGA 2F3QA 3ULUD 3L8ZA 3PDUA 4PU0A 3ZN6A 3FRPA 2TMGA 5IJZA 2HJGA 1GH7A 5ESRA 4BINA 2V3DA 5C52B 4OM7A 1A7PH 2G0LA 4QREA 2YWCA 2CMFA 1RULH 3RAEC 5J9PB 1EHYA 3AQYA 3B3FA 4E2OA 3AJ8A 1UMDB 1SQFA 2BLFA 3JWDC 4XPBL 1UACH 4TWJA 4XZ3A 4PB9H 5LAPA 1CUFA 5E5MA 1KPVB 2ZP0T 1XCQB 3L1FA 5L6YH 3FLEA 3GARA 2UXCB 4QGAA 3COOA 1SUJA 2QJDA 2DQTH 4I36A 4HIXL 2AJ8A 4F7EA 1E92A 4OR1A 2NXEA 4DIFA 1AH1A 3NGBB 1Z29A 1BFSA 3I1JA 3QDMD 1TVHB 1T5KA 2COVD 4MGYR 1OGJA 1FA4A 2B1AL 3QR2A 4JEMA 4PWEA 4RKQA 1SVWA 4MA3B 3G79A 3RFFA 3WMWA 2C5HA 2ZE0A 3ES6B 3PC4A 4LPCA 3MERA 3TN0B 4TZKA 5EXEA 3WIOA 5JW3L 4Z51A 5JYEA 4ETQB 3NKLA 4BX0A 1JBEA 2VP3A 4WEMB 4F8YA 1JG3A 1P73A 4UCXA 3TIEB 2VLRB 3QAZB 3TNFA 3EYUL 2LE0A 3FUIA 1YGYA 3C6MA 1PZCA 1ZIPA 2PZKA 1KAMA 4P9HC 2ZBGA 2V5MA 2GUGA 2WGXA 2OMYB 1KTDB 3UTZB 3GHEH 1D1PA 2JJ2D 5HSGA 2VF2A 3HKZA 1IAIL 3SVTA 1W94A 2ZREA 5CCDA 2WUEA 3VNAA 1O6VA 4KAQL 4WO4D 1J2RA 3CVCA 4UYPA 4I5EA 5K1JA 4IJTA 3E3QE 2W9DH 3BK1A 3EDKA 4HWZA 2WMNB 6ABPA 3WRYA 3AP2A 5K2MA 3H8NA 3UH1A 1I24A 4DQXA 3OBBA 1SELA 2CDNA 3IDSA 1YQTA 4BNDA 3MRVA 4GI8A 2P67A 3NOIA 3U4QB 3K8ZA 1XE3A 4W1TA 2A0WA 3S1SA 4GC9A 1PCSA 2YZGA 3LUHA 3HBAA 3T5DA 1JTTA 3A6LA 2IV3A 2W38A 4FXGC 4UHEA 3R23A 4ICIA 1N68A 3SN6N 4XVTL 4MJ5B 1ADJA 5D1ZI 5I9SA 3ARGA 2DB3A 1ZT4A 3W5BA 1NBYA 1E3DA 2XUWA 3ZKAA 3GJSA 4V0OA 4XCEA 3V46A 3D6NB 4TKWA 1RPAA 5HHNA 3PWLA 1E7RA 4XB2A 3ITEA 2XXAA 5L9DH 4ZVTA 4MA4A 3T7CA 2P27A 4WXMA 1DQVA 4FQCL 2X89A 4M1YA 3GQVA 2VT2A 1XROA 5B53A 2YQ4A 3GVPA 1W0VB 5HJDA 1DIHA 1KZYA 4W63A 1DX9A 3STUA 2XCLA 1F48A 1QMGA 1QHGA 4NEHB 5L40A 3NIDE 1EVYA 5INDB 1GVNB 3QVXA 1E63A 4HXFB 4ZFGL 2WIGA 3AIIA 1Q0YL 4FQPA 2R27A 4MRCA 1N5MA 2O8NA 3V4VB 4F5EA 4GRLA 2WF9A 4XAQA 2ZCUA 4NO5A 1JAIA 3UCRA 2OMTB 3KDMB 5AOLA 1X8XA 2XTZA 1VJ1A 1CLVA 3A5VA 3RSCA 4NDZA 4HCRL 2VDOL 3DPIA 5DHUA 1JLMA 1TPXB 1LSOA 5JORA 3DAHA 3VI4F 1RCTE 3V5KB 1WDKA 1UB6B 5KBYA 1CR1A 1TTAA 1MFUA 2OSXA 3FM9A 3BJIC 3EY4A 3IELA 4PG4A 2ATEA 4MUAA 1MEOA 3CMOL 1RSZA 1KEGH 3BE1L 3K80A 3I8XA 3VO9A 2N0KA 2H65A 1NVVQ 1Y3IA 1FP5A 5DS8B 2IL1A 4MYPA 3LPMA 3L3JB 3ZCSA 2A9PA 4PV8B 1IHUA 3V5NA 4HWBA 5HI4D 3EA5A 1KTKE 2W92A 4NX0A 4UHFA 3AI1A 2C7GA 3DZKA 2RIRA 4Z23A 2V9ZA 4GKZA 2IKSA 4W7HA 1P91A 2OV8A 2GUYA 4IBWA 3KR1A 1QBLL 3FCSB 2OSBA 2PLTA 4R8WH 1I1FA 4QUBA 1PFWA 1QANA 1RHRA 7TAAA 2JCXA 2DFPA 1C4OA 4XYEA 4P5MA 1BH6A 3CZMA 5IT2H 2GUWA 5AAMA 1P4IL 1MO4A 2NX5E 3NYKA 3BT2L 4NENB 5ERWA 5K20A 2HJFA 2G5BA 1E59A 2DY0A 4IXNA 2R2BA 3T3PF 1U21A 2ZAHA 2VZUA 2OMNA 4DP5X 4DK6A 5DHRA 3SSAA 1I01A 4N5IX 4LFBB 2A94A 3W5DA 4KDTC 4FTVB 3JR7A 5SX4H 2C7PA 3MV11 3LRHA 4OZIB 4CTOA 1OAAA 2JI7A 1CIVA 4GQPH 3T7KA 4GLOA 5A4FS 3EZYA 4ND8A 4YQEA 4H8HA 5K01A 5DYOA 5AW7B 4NNYA 1PYOA 2FZEA 3CNHA 4HUUB 2PYED 3SC4A 4LHJB 1OB1B 4PGFA 1PLCA 4NXSA 2F3SA 1V5IA 2FSGA 1IQDB 1CP3A 3RRFA 4XR8C 3ZDZB 5I0YA 1WPQA 3LN5A 4XUGB 3BFVA 3DZCA 1TJPB 4Q05A 2OZLB 2AG8A 4KWCA 3WN5B 5C0CD 2CE7A 5SYAA 2AK4A 2H8PA 43C9A 3FPGA 3R7SA 2EH8H 2B1RA 4JJ4A 1XTZA 7YASA 1WNTA 2Q0XA 3SX4A 1KTCA 1PGRB 9PCYA 5ILOA 4O4HA 1XAHA 2GTZA 2CYBA 1XJQA 3MCTA 1KI3A 3PDIB 1K97A 3GWZA 2JIXB 4LDQA 4YO0B 4JB9L 1T1ZB 1MOZA 5T3XD 2NW3A 4IIQB 3URKA 3D25B 1C1EH 2SKCA 5BRZE 1JSCA 4FQLH 4HKBA 4QODA 2IXEA 4TQIA 5F89A 4UIKH 3IRCA 1LVEA 2JKIS 5EYPB 4RQUA 1T3SA 1Z6GA 3I0ZA 4FNQA 1G8MA 4PZDA 3RB8A 3KLOA 1DLIA 2GT1A 3BPLB 4HCGA 1AD9B 1H6UA 2POQX 4BFXA 5BSHA 3DLAA 1NPDA 1PLGH 3LNDA 1P7ZA 2AFIE 5C32A 2ESVA 2WXFA 4WAFA 5ID0B 1GTJ1 1FUUA 1GZHB 3HVJA 1HWWA 1HLFA 2CBXA 1OXKB 3O21A 4JU8A 1WB5A 2ZF8A 4DFDA 5AYTA 5JPMA 5KSZA 4QRDA 4MOWA 2R6FA 3TA3A 2VXSL 1PV4A 3DHPA 2FWUA 1L7IH 1L5QA 3CLKA 2F4VB 4KL8S 2I76A 4DLXA 3H2JA 2YXMA 4GR9A 4EMSA 1RKBA 4WUUE 4W1RA 1RZ7L 3PZRA 5J6GB 1COZA 2ZUWA 3CCBA 2IYXA 3SC6A 5JXJA 3LTVA 5LSAA 3OLXA 2M6KA 4JFEA 4XMPL 1NVMB 2XT6A 3IKMB 4MCZB 3CNLA 3CE1A 1GW6A 2P41A 3ZVRA 4QHKI 4HEA6 5K45A 3QEUB 1OOEA 4FQXB 5BN1A 2CXOA 3QZUA 4D0SA 4Q5IA 2NZVG 4XP5H 4JH0A 4L8CB 2B83A 3HFJA 3QJRB 3Q6MA 3WZMA 1FFEA 2NVUA 5J0BA 1A1MB 2YA0A 4E1BA 4DMKA 1NJ1A 5HS6A 5BZWB 1G1MA 2HHJA 5CVUA 1SFDA 3DAYA 3QH3B 2A5FA 4UUAA 3LHFA 2W9EH 4F3NA 2PTHA 2HQOA 3ACCA 2E37A 2XMGA 4HC1H 1JZJA 3TPCA 1ACLA 3S34H 3UHPA 4O2FB 1CWUA 2YXNA 1BEUB 4YCBA 1X7YA 5ICMA 1NE2A 1V7NL 2RSLA 4BE5A 3FGZA 1E9BA 1KZGB 2WWXA 3EO0A 2BM1A 4HNVA 1NV8A 4RVSA 4R1QA 3N0RA 4MUGA 2O4UX 3CLFL 4TUYA 5AW1A 3LTNC 5D7LA 3P2TA 3E7FA 1OOWA 3BAIA 3IVKA 3RTAA 1XG5A 2P30A 3HKCB 2O5YL 3KKMA 3QTTA 1R0KA 4I4IA 1DVXA 3BERA 3FPFA 4QI3A 3TPKA 2W81C 3EDFA 4JFFB 4WJKB 3K94A 1MI5E 3FJOA 5IWCA 1GPYA 4J90A 1TUEA 1KS9A 1F2TA 3CXRA 1JHTA 4BV1A 1IE3A 3UGJA 4PV7A 5LGJB 4WO0A 1X1BA 2CUKA 1S7UA 2CMDA 1MZVA 1YB5A 1EFDN 3SY6A 4GL2A 5DNYB 3UAJA 3BIWA 5A06A 4BFYA 3H85A 1J8RA 2KWIA 3PF9A 2EEBA 3BVTA 1ZA1A 4NQSB 1LTHR 1WIPA 5JOPE 3QPQD 1X7HA 3PL6A 4DDMA 3W2DH 4JJIA 3QDGB 2AXFA 1IV8A 2YMXH 1HSZA 2Y9MB 1N2IA 2HA1A 4MDJB 4FFYL 2P5UA 3D85D 4MP3A 3U7RA 3MFYA 2JLLA 3MV7E 2OA0A 3AVUA 2WLZA 1Z45A 4YRSA 4KHXH 2QMOA 2CNKA 4C83B 4XBEH 3EPHA 3A9VA 1KTLA 1LLUA 2MR6A 1K66A 1TIUA 3GLGB 5JXEC 2CH8A 3A28A 3CIFA 1RFLA 2W2OA 1P7QD 3BKJL 5ADPH 3MT0A 4AZVA 1DTUA 3NCCB 1XRSB 5KVDE 3ULVL 1JLSA 4Q18A 3L0DA 4WKZB 3ZIYA 5LZ5A 4EJSC 5HYJA 2ZULA 4JR9H 4P2AA 4KZEL 2FUQA 3X0DA 4HT3B 2DPHA 2FLVA 4S1OA 2WG2A 5IAGA 3A8TA 5DGCA 3KLHC 1N4XL 2PZLA 3FIJA 5LD2B 4G1VA 4TS1A 4MR8B 3CVIH 4A2MA 2QMUA 4MWFA 1PJ8A 1TMKA 5GHWH 5LMUB 2RI1A 4KJPC 3FYTA 1XMIA 2EJVA 4N6GA 1TNNA 1GTMA 3N2GB 5LQUA 3PABA 4IRSA 2CA3A 3TJZA 4KQ0A 4F06A 1RRKA 4U0JA 4CGTA 1Z39A 2H57A 3TMYA 3OJVC 4H6XA 2UZ1A 1OROA 4PYLA 5D1ZB 1DXOA 4UM8B 5EC1B 5ANME 4J0FA 3QRBA 4HPYL 1A4AA 3GRBA 1BWSA 4XE5B 1Z4IA 4OOFA 5J5VA 1XO1A 2H3KA 2P5EA 3QUAA 4WGFA 3TVMB 2WHVA 3TLBA 4IDOA 2A9VA 4JGUA 4ODSH 2E9GA 5DJCB 4OA8A 4QRPE 2QLVB 2I2DA 5I71B 3VR5H 1DADA 2LRHA 1IN7A 1FUIA 4ND5A 5DK0A 3GLSA 4KXZI 3WADA 1QRTA 3PHQB 3HMQA 3PG2A 1UUSA 5EIBC 2J44A 4KXQA 4QHLA 2BR3A 1QRNB 3QCTL 2HIAA 2IYTA 4UMFA 3WTBA 1Z5VA 3ORFA 4CCSA 3GRKA 3LGAA 1AUVA 2IYRA 4F60A 5J13C 2K6ZA 3EG9A 3AACA 4JQZA 1V39A 3VWKB 3I37X 3FCXA 4F3CA 2HJLA 1KF9B 4PM1A 4MMYA 1CZKA 5DGQA 1Z6YA 5IMLA 4UPDA 4GFXA 1EEQA 1F11B 2DPMA 1IONA 4BCBA 3HEMA 4GQBA 1YYLH 4FDUA 3C6QA 3UJNA 5I0DA 4KN6A 4GUOA 4NV0A 3TBTA 3CLTD 3MD0A 3ZIUA 1NZRA 2VQEB 3I3SR 3V32A 1ULSA 3K9QO 2AN4A 2G5GX 4Y16C 4UQ3B 4O5AA 1TQDA 3QTLA 4Z4QA 4YQXL 2AXJA 2K6WA 3G6JA 4YV2A 2WMYA 1B43A 3ZHYA 3GBLA 2OHIA 3N85H 3IRUA 1WEKA 3QQDB 4KZCA 4ZFZA 1TJGH 4ZD6A 3U9WA 1OAYL 3V0IA 2I3BA 4Y5XC 1KTBA 1KEWA 1YRBA 3UMYA 2WW8A 5IMOB 4EHBA 4IJ3B 2FX9L 2B16A 4K7PX 4R83A 3S7TA 4TTAA 2IWHA 3U7QA 1V1JA 2C31A 1WVGA 1IAIM 3W9SA 4OJEH 3D3JA 5H68A 2AHOA 1ZVHA 4XZUA 4QXTA 4BNWA 2AOUB 3DMRA 3MWLA 2NY6C 5LJYH 1W0WA 1CQJA 4OZFA 5TQVA 4G7RB 2Y5EA 4B7ZA 4FADA 1ML0A 3VOAA 1VZGA 2VXBA 1JTOA 4AENB 5DJAB 5B36A 1BZYA 1QKZH 3IQDB 1CW2B 1Y5RA 3H8WA 4JFYB 1EDDA 4PTTA 1OIWA 2BY1A 3PYXA 5DKFA 2CNNA 1DBJH 2E75C 1JWSB 3RJMA 1SCIA 2GSIA 1UWLA 2G6BA 2VB5A 3AU1A 1IAII 5D96C 3H9HB 3THYA 4TYYA 5HVGB 1AMNA 1CJMA 4XFKA 1ZZGA 5EZSA 5JD5A 1I31A 1V8DA 5EFIB 4R2JA 5ISZD 5E2UL 2WWTA 4CM7A 1JZSA 2WHPB 2VAMA 4ZW6A 1Y5MA 3ELAT 3TEMA 1O54A 5TE4H 1U28A 5CIPB 1G4MA 4ZMXA 1Z2PX 4ILEA 2HA0A 1S3RA 1XR9A 3UPUA 3NZEA 5KKCA 4I3SH 5LO7A 3KHTA 5CYFA 2J1LA 1KFGA 2JJYA 1XGPA 4KBYA 4R1NA 3OP1A 4N1EA 4FLMA 1K06A 4IF6A 5E4EC 1N92A 1N64H 1N2CB 2DTMH 2QN8A 2JJVA 4ALLA 4W9EC 3OE7A 4LYFA 2CHWA 2X42A 3GKZA 3MRRA 2A6DA 1RUQH 5M3BA 2NCMA 4GXFA 3LYUA 4FNOA 1VKXB 1CUCA 1GGKA 3FHOA 4XI9A 1JGLH 4A7GA 1Y6NR 1O5IA 1B0PA 5JAQA 5EGSA 3VXNA 5K0NA 3LOUA 2XRZA 5CVDA 1QGAA 3U7YH 2VAPA 4LY9A 4PYKA 4OCXH 4HCIA 5GGYA 5L7WA 3MELA 1R8XA 3L95A 5DI3A 3GXOA 3ET4A 3RS0A 2MQ0A 3R6LA 4QRRB 3SDXE 3M2PA 1U8KA 3H42L 2VF8A 2DJ5A 1SHYB 1FSPA 2P2LA 2ORIA 2DOKA 3HO1A 1M8KA 4Y1SA 4C4XA 3H7BB 2Z4QB 2QVKA 3K2MC 4PC2A 3O8BA 4RMBA 1S2OA 5ER6A 3KSBC 2ZQZA 4N4YB 2YN3A 1HNXB 5EJ9A 4BKQA 2VNAA 2XQYK 1CG9A 4D9JA 3D4GA 1KEPA 5MEQA 2E21A 2AFVA 3R5XA 2DQKA 3NRJA 1YKGA 5EBLB 2YJTD 3F7YB 5G02A 3T34A 5IHUH 4G6MH 2Q2WA 4AXWA 4Q4AB 3B6SB 1KIUA 2WXLA 3EHBD 3BB4A 4V03A 4OHWA 5FYDA 1MPAH 2WZ6A 1F4WL 2W0PA 3ZGLA 4CMHA 5EF2A 2IANE 3LPAA 1DLFL 3MRNB 2Y6VA 4K8RB 4AK1A 4P2QE 2O1XA 1WUHS 3PFWO 1RQ2A 3KR0A 4OL0A 5PNTA 1DUZB 4WY7H 2QLYA 5DJ0A 1L3NA 2FJHB 4OCWH 2RAMA 3JAKB 5GS3A 3AFOA 3E7PA 4W6WB 3OT1B 4HSCX 1L9TA 3DRQA 1L5OA 4YFDB 4RCZA 3IXTA 4JJ5B 4HFNA 2HMWA 5KYVA 2JFGA 4MV1A 3KHQA 4NQCE 4JGGA 3TOZA 4D98A 5LQSA 1QR1B 2H08A 4HK3J 5E6IC 4R1LA 1O8BA 4JRXA 4CGYA 2V59A 3GJYA 1W75A 4JT4A 3MRLB 2D0PB 1AKQA 1F0YA 1E42A 1OAKA 2FWLB 1HYSC 1A3LH 4L37A 4A38A 4R1TA 3M5CA 1KJ2A 1R8JA 4LDOB 3OMIB 1IEBA 3DV0B 3DO7B 3A1NA 4D74A 3DHVA 2Z3FA 4JFPB 1DJPA 4XODA 5CMLA 1DT3A 1LWJA 1OLZA 3NHRA 3NJMA 3QXTA 3I8OA 4GKSB 1SKAA 3BMNB 4IGIA 3JVGC 3ROTA 5JW4M 1TYDE 5FWDA 2ZG2A 1QRSA 4XBPB 5KDOA 2CYCA 5AALA 3VVBA 4YHKL 4X94A 4U3SA 1OPGH 3GMOA 5K6RA 4UVDA 4O2AF 3NRBA 4QRQA 4R7VA 4HWSA 1ZHLB 4QD2E 4GMTL 1QAOA 5I8ZA 4XP6H 5JALA 3VH4A 4MPTA 5ECGC 3DM9B 4Y9EA 1ES9A 3QNXA 1D5ZB 2XTJA 3RIEA 5GGVL 3C60A 3RJDA 4G6KL 1OZHA 4TYNA 4IQ4A 2J46A 3VAYA 3GVIA 4E9LA 1D2MA 5CR8A 4OI8A 5T3ZL 1A8PA 4KQHA 4ECNA 3HUUA 3PLAE 3JQ9A 4WW1B 2N42A 4DNLA 4HHAA 3PRYA 5E95A 1LTXA 2FX7L 4U0RB 4IZIA 3MFFB 5EOQH 4PYRA 1SOVA 4PSVA 3CPJB 5FWYA 4PV9A 4GPVA 1QNZH 2G3ZA 4C5BA 2O3UA 1JBJA 1T9GR 4RNCA 2LCQA 3ZO0A 2FPGB 1YC2A 2DH5A 4DILA 1ZK1A 4QICA 1XTTA 3D4CA 1UPTA 1A6TA 3VFNA 3UMBA 3HY3A 3CDZB 5E38A 3OZXA 1ECJA 3KV3O 4RA6A 4ZIRB 4BFKA 2DZEA 2XEXA 4IU2A 1HXMA 1ZVNA 4ZU6X 1X4ZA 5FHAL 1EO7A 4J23A 4W9GC 1GHTA 4PJGB 2DQEL 1ZO8A 3FSEA 2HBZA 4JOBA 4WWKA 1G6RL 2PBZA 3I92A 1A7OH 3PNPA 1FSGA 1WP6A 4EKNB 1AO7A 2H6EA 2VNHA 1WQ3A 1UFUA 4PE5B 4XP9L 5I8EB 3G89A 5IESL 3MROA 4GRWE 1R0WA 3N0TA 1AGCB 1NM4A 1PJCA 3OSVA 1PK7A 1V25A 1SXZA 1E1QA 5T8IA 4MJ7A 3F7RA 3B12A 4OPMA 1T9KA 4FLSA 4IQ8A 4HVCA 4B3MB 1HS6A 4AEHL 3NHFA 4DCNA 5CO1A 2CJPA 2H7WA 1F8TH 2FH8A 5IPFA 2FUTA 2WJZB 1QTRA 2FH5B 2XUGA 3IULA 4G07A 1QVVA 3EDCA 3IDXH 1GJRA 1L4UA 4NZMA 1UJ3A 1E8MA 1TLFA 2QGBA 3EMDA 2WLHA 1NCNA 3W5MA 3MWEA 2OW7A 5BR4A 2N1BA 1E8ZA 2VP4A 3LQZB 1YK1A 5FGBC 4B96A 5D5ME 1YBHA 5C0OE 2X4PA 1IPFA 1F3JA 2RHDA 1IRIA 3BK7A 2BYTA 4LQ4A 5IKMA 2VLKD 3W2HA 4BRZA 3C5VA 4OKSA 1XU4A 3I9LA 4NUMA 3ILPB 3OKPA 4CM5A 4NBKA 5EOCJ 3ONFA 1ZW6A 5I4IA 3F8SA 1DJQA 4L5BA 4EDFA 4O33A 4LDPA 4WWID 4MLPA 4F97A 1ZCRA 1TDQA 5DMXA 3OY2A 2D7OA 4MZIA 3J7TA 3HMKA 3C7DB 1RZ8A 4LOKA 2VG8A 2CLCX 1IK6A 1MC4A 1AKJB 3ULVD 1CS0A 3L40A 4URYR 2WUWE 4XTRD 4ER3A 1BGXH 3ADPA 4LLVA 5EORL 3K6DA 4PCSA 1I2ZA 1XFPA 2J1WA 3MLVL 4RD4A 3IMFA 4I6JA 3ZGIA 4LASL 2I55A 1U3HB 2K70A 1N0UA 4OQLA 3AWDA 4UTNA 4NUQA 4UOW1 5KX5A 3GQBB 1LV7A 1EGJH 2Y24A 2XRFA 2HSJA 3QDJA 4E5XG 4PBWD 3WGIA 3LQFA 4WUKH 1V3JA 1XF3A 4ZDJA 4C1BA 3VM6A 4ZMPA 3QOWA 4DVRL 4JT9A 3TR6A 4P5RA 3NCYS 1ULHA 3CTTA 3NJKA 4YHLH 2A1UB 4LSPL 1PSKH 2H4HA 2D7NA 1G5TA 1PFYA 4YRKA 3PQ3A 3TI7A 4ZUTB 4C4KT 1FFCA 3LLSA 4IGFA 1K6IA 4GUDA 1KO5A 3LDAA 1Q14A 1ZD5A 3OC8A 3QJFB 3WDSA 3HPJB 3EGDB 4YAQA 3OHMA 1MLBA 3D7KA 2R79A 4HGMA 1Q5PA 1ADFA 2XN9D 3F6EX 3GBMH 1TZKA 4BIKA 1XZCA 5EZJA 2OLEA 4KI0A 3FH7A 1HE8A 1D6EB 4LVHB 4POYA 4M3JA 1UUNA 1G8JA 1MNQA 4NYIQ 1CDOA 5IF3A 1FH5L 1BVNT 4YHZL 3EK2A 3OF6D 3GDFA 3MLSH 4XCCL 1UK8A 1DQJB 5K3AA 5E4IA 4JRYA 1BKDR 5DA0B 4A7VA 4M7RA 1E77A 3DYIA 2GFBB 2RJOA 1ECCA 3WS6A 3WS3A 1ZHBB 1OFVA 3LD9A 2IU4A 3G2NA 1YO4A 3IR6A 2Q0HA 3CC8A 4Y2NA 5GGRY 2VAAB 2HJSA 3I5XA 2GLUA 3H2GA 2YC1A 4JFDD 4F86A 4HUXB 4BUHA 2P1RA 3JVDA 2ZKHH 1JDPA 4P2RE 1TQ8A 4RGNC 1PWXA 2PWEA 2PN5A 2DQDL 1XJ0A 2EINB 2XZDA 3DLHA 3IJRA 2FZ3B 5KVMC 5H8DA 2ZT8A 3G5TA 1P3DA 5CHYA 5EUOE 4MW0A 1XELA 4CKEA 2XWRA 4HKZB 3DMTA 4HRAA 3PDJA 2VXUL 2A1IA 2AIRA 1RZQA 3EWAA 4GAYA 4DA9A 3LO5A 4UTRA 3MCLL 4Q7KA 3IR7A 1RI5A 2FIKB 3SJZA 3RADC 1N70A 2WXPA 3VDCA 2AX3A 2IPAB 4YHBA 5AXCA 2C7BA 3IGKA 2PZGA 1WHPA 2FO4B 3VXMD 4RIEA 4H88L 1B0RB 4NARA 3V4VL 4CC4C 2F2TA 1H3PH 2EBUA 2YJ6A 1FLAA 2B21A 4LRUA 2YSSA 3QHQA 3P4UA 2O5XL 4E21A 1A66A 4IXDA 1N8ZA 5IEJA 5DD3H 2GBLA 4WV1B 4Z8FL 1XGTB 3CFKA 3P4XA 1IHPA 4PWIA 4X64B 3S2IA 3LCMA 1P53A 3L02A 1AG0A 4TUJA 5KNDA 1FFGA 4PSPA 3T3HA 1T4BA 2WNHA 3FB4A 1JS4A 2XPZA 2B7BA 4J1NA 3OQHA 4E41E 4CKWA 3BRWD 2XE6A 3MT9A 4Y2VA 3KZNA 3BZFA 4PY2A 4WA8A 5EC8A 3B5IA 3N42B 4AIEA 3CF4A 3BZEA 4L8GA 4NOKA 1G41A 2OQIA 1CF2O 4Y4HA 1KXVC 4FHJA 2YOCA 5ALWA 5AW5B 4Y2SA 4HUVA 1KBPA 1F3LA 1OFGA 1FAIL 4I5BB 3GI9L 4FYKA 1SEBB 5DXJA 4CQMD 1ZV2A 5F1SA 1S0UA 3IOMA 1JFTA 1NMBH 1JPGB 3NPSC 1A5TA 3IWUA 4PJ8A 4N0FB 1H3XA 4CHGA 1I82A 4QO1A 2BT4A 1CQKA 3N91A 5IMKB 3T6ZA 1WO2A 2PHZA 4Q48A 4D7BA 3R7BA 1K3ZA 3HMWL 2EX4A 2HKFH 3GXMA 4DQOL 4UEQA 4K9DA 5I9MA 3GSUA 5E8OB 3VGAB 2VYRE 3OAZH 5HPMB 1I8LC 2ARJA 5E2TL 3RUFA 5L53A 4LHSA 4OLVH 1RIHL 3OU2A 2M1ZA 4CM8A 2A6JB 3SFTA 1RYFA 3MLYL 3UPCA 3FWZA 5NLLA 4RA9B 5IJXA 2XDWA 2QX7A 5C0ND 1FFAA 2PSEA 4MHHG 3LS4L 5H8WA 3H7LA 3QX3A 3KPRE 5J57B 2GJZA 1S7XB 3HG4A 1CYGA 1NSFA 2H41A 4N5UA 2YKGA 2F1KA 2IBZY 2ZUBA 2PLAA 1AIPA 5JISA 3O6FB 1D5IL 3ZHNA 4BH7B 4UBJA 3NUKA 3BN3A 1UPBA 1VEPA 3G7UA 3AC0A 1ZMOA 2FB4L 4HFRA 2J3SA 4B2LA 1U0JA 4KKCC 4UUPA 4MVJE 1H6FA 3ME0A 1NF2A 3QVLA 1HQ4B 4KSCA 5C8DA 4M5YH 3R1IA 4GSLA 2DN7A 3RI3A 1VL6A 3MJ8A 2UZXB 2WRZA 1XGZA 4J3OD 5JHLA 2DWYA 4I9NA 2KZKA 2UVDA 2D0DA 3DE4X 4CCYA 1HI6A 5B6PA 3OR6A 3H4MA 4YXLH 4AQ1B 3D3VE 2J1XA 1D2RA 4MA7L 2ID7A 4ZQKA 3ZWBA 4FW8A 5E08L 4Q4JB 3K71A 4JEUA 1Y7VA 1E6KA 3DW1X 2IYAA 2NMSA 3UUGA 4K7PH 4BA8A 3PTLA 2BI4A 3WO1A 3O91A 2H6OA 4TM8A 5JJIA 1FL3B 2ICEC 5EA2A 2WQXA 1CZHA 5HHPA 4KMQA 2QTRA 5B1JC 4ZGGA 4M8VA 3IU3B 2EIHA 2GRUA 3CDGA 4O2CA 2DL2A 3B43A 1CJCA 1L7NA 3JVIA 3VFPA 3PPYA 4PGCA 2G9KA 3L4BA 1WSWA 3SHOA 2OSLB 2GQHA 3U0WH 4TN5A 1WU8A 1LYQA 3PQ7A 2WV3A 4NN6C 4OHZA 1U4SA 2C7QA 3FU7B 1IN4A 4B2IA 1FXWA 2ATKB 5HSFA 1YDHA 2DI8A 4FQ2H 5FGCE 4BSWB 1FBNA 1BX1A 4EI5D 4PYQA 4FCVA 1U04A 4LKXA 4DUPA 5EJGA 2YA1A 1QS0B 1Q94A 4LO9A 5F7YC 2BFNA 4A82A 1BVKA 1GQQA 1RBZA 4LRIA 3D54D 1RQGA 4HDSB 3QEBZ 1K75A 1WXXA 1XAGA 3CUUA 1MHEB 1N0LB 3WIHH 5CGTA 3N44F 2IO5A 1CQIA 1IKFH 4EYKA 1W7AA 3CXHK 4HSGA 2QX9A 5IC4A 2O6DA 4EUFA 3KUCA 3HB3C 1OT1A 5F7LB 3C3CA 4AM8A 4YJ2A 1WULS 1H2XA 4NVRA 5MEPB 2ICES 3C5ZD 2Q1UA 5HFAA 5LCXA 5HF9A 3FHJA 4V2IA 15C8H 1V55B 2HRRA 2JIZD 4U6YB 5EV7A 3UK6A 1CL7H 3MOAH 2WWRA 3NO4A 2P9ZA 5MI0C 5BYJA 1BHSA 2GXUA 4ZI3A 3NMUF 3GIWA 2YPVL 1YMME 1UBKS 4JZYA 4HDMB 2NX5A 5FUYA 3IHTA 2AN5A 4CM4B 1DBPA 4H25A 5T3ZD 4JYBA 1E7MA 3T3DA 4UAGA 2WB7A 4IIJF 3MXWH 3GXUB 1X9RA 3VTFA 3T0IA 4X0KB 3F47A 5JTWA 4MVBD 3QDAA 3M9XA 3PFQA 5K3OA 4KNTA 4J3NA 1RP9A 2AZTA 2ZRPA 5CDTA 1GN8A 4BRSA 3HHRB 7REQB 2IUYA 4F37K 1A27A 2HUHA 1U42A 3T1HB 2R9HD 4L4ZA 3ZR5A 1UM5H 2BOBB 1EPUA 3HWWA 2H2GA 3DMGA 4PHCA 3IQFA 2PTTA 2NZWA 3QVUA 4EI0A 2XUJA 4WTZG 2JAHA 1XDTT 4Z78B 2XUFA 4RZXA 3PIRA 4PSCA 2BEUB 2DIAA 1TMOA 2OSVA 3A67H 4LEOA 3UTSB 1M7HA 3EPKA 1NA5A 3FWPA 5B1IA 1HURA 2EBWA 4GMSH 3ZHSA 2Y66A 4YAOA 4LX8A 1XXLA 3VGHA 1BKSB 1UBTS 2H7XA 1PI3A 4N03A 4KK4A 1DEAA 4MAYB 1LCIA 2W94A 3E03A 4GXTA 4Z9AA 5ETUA 2NCEA 2R4RH 4JY7A 3BWBA 4EAQA 2A9BA 1L7DA 4LAQH 4AZWA 3UK1A 2B3TA 5KC8A 1YS6A 3QFDB 2BF4A 4XSVA 3F71A 2RONA 1USVA 2NVBA 4GT7A 3RU8L 5DVLA 4JLBA 5D71H 4KJXA 1T66C 4KI1A 2L0XA 1E27A 5ICZB 3RV4A 5BRZA 2ESRA 1RZJL 2B6HA 3FWNA 1CVLA 2QOEA 4N1HB 2YVQA 1BMGA 1N3BA 3DYBA 1SD5A 5F0LB 5D6OA 5DZSA 5T8KC 1G59A 3PGDB 2F5AL 3QR0A 1TTUA 5J4VA 4HWEH 1LWOA 1ZJ6A 2QADC 5TQ0H 3VZDA 1QG6A 2FHSA 1DAMA 1MCWW 1I4DD 3FKQA 2FX8L 2O6FA 3S8GB 2AFIA 5DJ2A 3QMVA 4CYMA 3S8YA 3E1ZA 2BMDA 1JNYA 3JTTB 3G0HA 3A1TA 3P5BA 5LP6C 4TVPL 2E1RA 4N3NA 4AU1A 4M6OH 3DEAA 2YRPA 3H16A 5CFQA 4R7XA 2BSSA 2Q1WA 3IQZA 4I5DA 4MRPA 3PDHA 3LFHA 2MPVA 5HCNA 2YRBA 2YH2A 2YWEA 1G4AE 1AXTH 2C04A 4B3JA 4EYSA 4KVNH 3NANA 2QY6A 5LR6A 1U65A 3CUPA 4NQVA 1YT5A 4WUUA 4NQTA 4O00A 4CGZA 1UT5A 5GGXA 1S2MA 1NMAL 1N1EA 4G8GE 3QHAA 1I7RA 3LKRA 1JPFB 1MXFA 3KXKA 2YX1A 5CEYB 4K7JA 2OT3B 3LIZA 4C4YA 2Y07L 1UMKA 4ERSH 3ROOA 2VRNA 2VLKB 2JCGA 4ALIA 4TTPA 2CO1A 3DW3X 1JGVH 2DETA 4YP0A 4DFIA 5AJYA 4M7WA 2W0KA 4OKVA 5I74B 2HU5A 3FQRA 2HEGA 1CUWA 1YMUA 5G4KB 3RX8A 3LZFL 3MMPA 1E2ZA 1AG9A 4UTAA 4JM2A 1G9NC 4N9OB 3TN0D 3K5RA 5HJ3A 1USQA 5FF6A 2DLFH 4BOYA 1KENH 4JB8A 4BKUA 4R2LA 4EGQA 2ADFH 4WCFC 3FN3A 2ZUQC 1MIOA 2YWHA 4ETNA 2BP0B 2QIOA 1NL0H 3K74B 4G59C 3E9MA 3QO1B 1JI0A 2ERCA 2VLRD 3IJ9A 2VYCA 1B4TA 1RK0A 5FYKL 1HEHC 5F1YA 3K0FB 5LGHL 3AUVA 1NVKA 4NNPA 1L5VA 3RSGA 1WBBA 4JE0A 4NCDA 3AM8A 3V2GA 2W07B 2Y6UA 4HDAA 4HT1L 4YMVA 2VIRB 1KJ9A 1RUPL 4KC3B 4BWTA 1DFBL 1ZLSL 3PWVA 1DWQA 1WD7A 5EVJA 5B7NA 4MKRA 1E61A 1YB4A 3FDWA 3KYDA 1L5SA 3OAWA 3CVHA 2HWWA 3WZLA 3JASA 3IBSA 5CHNA 4FXTA 3AEQA 3IMEA 1GQYA 4PRPA 1DO8A 2DEXX 1TUBA 1UPXA 4L5AA 1T03L 2O5NA 2OWEA 2QENA 2XMCA 2WB4A 2A9ML 3LKOA 2ZIGA 1Z9LA 1BVRA 3P52A 3W39A 4F7CA 4QPZA 1VPLA 4CHTA 2XBTA 5SX5H 4X9HA 5FT9A 3VR6D 1MI5A 3FZEA 4M9RA 2YPKA 3C8DA 2GBCA 3BDXA 1IJ9A 2NY2C 2X4RB 5AK3A 4NCHA 4P8QA 4A04A 3M7FB 3DZDA 2VF7A 3ZGOA 5P21A 2YNMA 1NCCL 3PXLA 2V2WA 2JCBA 3MAWA 4D9MA 4P5TC 4QU5A 5KUMA 4NMXB 1XYGA 3ECAA 4RLFA 1ZK0A 4HTAA 4RRPA 4IKPA 1SO8A 1BQ4A 3UYOD 1E6LA 4LQCA 4X7SL 3PQYB 1YR7A 1UXSB 4S3MA 4ZYZA 5HG0A 4CLXA 2DEYX 4A3SA 1E9PA 1GV0A 3MRPA 3CFUA 1TCRA 4XPHH 2QV4A 4GRMA 4LNRA 2HT3D 1Q9LA 1GUAA 2ZYUX 3MV7A 3VI3E 2JGDA 1Q9WA 3B1UA 3MBOA 4MRSA 5BXFB 1GFIA 1H3NA 2YD3A 4JHBA 2W71A 4CN1A 5E8JA 5JWHA 1V37A 1E18A 1ESZA 2QRVA 2ZVDA 1CQWA 5KTTA 3BJEA 3M6WA 3WQQA 5KNBA 2QRHA 2AR0A 3WGVB 3JS5A 4IGEA 4IMLB 2H1CA 2WYOA 4PS8A 3ULKA 5IB2B 4HH4A 2QMHA 2O8FB 4CMMA 3ARWA 2EXXA 1OH7A 2QROA 4MRBA 4PS3A 3CSFA 2AQRA 5AZUA 1IZ9A 2K9UA 3QZBA 1M1XA 1TVDA 4O58H 5E8DL 1AO3A 4GBJA 1PQZA 4WERA 1A7QH 4ZAFA 3T71A 5GGTL 4RAVB 1K8YB 5ARCA 3QUCA 2V7PA 2FPIB 5F9OL 4HBCL 4JBIA 4RKFA 1AD0A 2AXGA 3QUBA 3RTLA 3L43A 5KVFE 4HNTA 5GGSA 5KS2A 4ONGH 1GGVA 5KOVC 5JCXA 4Q9RH 5BP7A 4M8IA 4MV3A 1W2GA 2PKCA 1JFFA 4P9NA 3QI2A 4JANB 4ALJA 3D6HA 1T2EA 1FL6B 1YNLL 2CE2X 2WWNA 4IJWA 1BWQA 3DEFA 3OT5A 5H4GA 2KLRA 3AIOA 3QUYC 1NCJA 1DDTA 1UATA 2CQVA 2VSOA 3S55A 4EY7A 5ANMA 1O7DC 5GSVA 1SXHA 1ZVYA 1JV2B 4O4IB 5ACZA 4QWWC 4OLAA 3D2UA 3JU3A 3SQXA 3M6DA 3G6AB 1GIGH 3HR6A 4QLRA 4F1SA 1DBQA 1E2EA 4FTVD 3FAWA 3ZJTA 5ICGA 1DBML 1OZGA 2H32A 1SXSA 1Z2NX 2NSLA 4PY7A 1LEKB 4QRPA 4BLRA 3NAAL 2NXJA 5AVYA 1GPUA 2FD6L 3E5MA 4IHQA 2WWKT 5F52A 3FUWA 3NAMA 1M0WA 4L5JA 5ERYA 1IARB 3L1IA 3O3EA 2PTVA 3TZVA 3IEAA 3DFKA 3MJ6A 3IAS6 2R11A 2EX0A 3ASWA 4ZUSA 4BY9E 2X87A 5M29A 3CLUC 2HDOA 1KC1A 3W9EA 4XPIB 5I7SA 1NX9A 1XDZA 2JDIA 5BXYA 1KACB 1TU3A 4I9UA 2J3EA 1WNFA 2E7LA 4BEBA 3OZVA 4NOMA 3OZ9H 2OBYA 4PGMA 4AJWA 4PJBF 5A2JH 2XRAH 3O8QA 4C7KA 5JWRA 3QO0A 3R18A 5E1MA 2AW3A 3SIXA 4LJ5A 3DOHA 5EO0A 3SQRA 2ZCJA 5ALNA 1H1LA 1G9EA 2BFCA 1NU6A 2R2GA 3L7KA 5GMOA 1BO6A 2AEFA 4QXMA 2H6UA 1Y7PA 4MW9A 2OGZA 2HJWA 4K8RL 5CK5A 2H9GA 1G84A 1WXQA 5I9LA 4LYJA 4UEKA 4NZ9A 3ZH2A 2EDNA 3PQ5A 3PC8C 1EJ2A 1XLWA 1YYML 3AEUA 2W8ZA 2J72A 2H4XA 3IJSA 5GRVK 3FWYA 1IE5A 3HXMA 4LOLA 3QQ5A 4CMEA 4JLOA 3KYOB 3V4FA 2ZQKA 4F15B 1NBZB 3OMAB 3W5AA 3IUYA 1U7UA 4DV3B 4ZUVA 5E4AA 4UMEA 3C98A 2LU5A 5BZDA 4ENEC 4UE3S 4L3VA 1E4YA 2WXJA 5KAMA 4MDIB 5F70A 5AW9B 2R8OA 1INQB 5I1IL 2PW2B 3DDGA 1Z0ZA 1N32B 3MCG1 5HK9A 1IHXA 3VG9C 2C3PA 4JG9A 3IKCA 4HG4J 4P2CG 3B1WA 3PY9A 4C4SA 4JUTA 1OM3L 3TZHA 3QE5A 4HOZA 1U1GA 3KSUA 1OGSA 1V7MH 1LC0A 2ABWA 4GWKA 2EKSA 4TNWK 3L6UA 3N2IA 2ZBRA 3UZUA 5IJWA 4AUJA 2K2WA 1A9VA 1CTOA 5FI3A 3SGDI 2HQ1A 3JWHA 5AUMA 1S2NA 1PJ4A 4TKMA 4TTIA 2RAVA 3LD8C 2EVIA 5BOSB 3K8QA 2R8EA 1BJ1H 2WJYA 2ISSD 3L1HA 1YMHA 3L2MA 5I6NA 4WTXA 4C56A 2F53E 3QLUA 2BMKA 1NYTA 4BBWA 4QUAA 3SBXA 5L8KB 2WZ5A 3IJHA 3HG1E 3P3TA 3BWXA 2VR6A 3L6FA 5D2LB 4K6HA 2I6SA 3FQ4A 3LY9A 3NCXA 4H5SB 4IHOA 4JG1H 4R0LC 3U1BA 1T20A 1WZ2A 5DMIL 4FQXD 3ZDYF 2EX1A 1KZ4A 2UYYA 2IDMA 3UFBA 3A3YA 5I19H 1KR5A 2P9JA 3S3SA 2F7IA 3MD9A 2CNWA 2G9ZA 5D7NA 3RS9A 1QR4A 4YMPA 3WFDL 3GW8A 2MSCB 1NAKL 1T0MB 1PKQE 4GXVH 1NW9B 4WZAE 2Q5CA 5TQJA 3JBG7 2CL5A 5LDHA 3D07A 4NPKA 4HKJA 1XCBA 3FSJX 2DQGH 3IF1B 2AC2A 4MJJA 3VFMB 4PLZA 1IY8A 1KDRA 4DN3L 3R3XA 5HMLA 3FKJA 1IILE 1VHTA 5IK2A 1UA6L 3O4RA 4KKRA 3U1QA 3WGYA 1NM5C 4H15A 2ADJA 1DZ3A 3UT0A 2BBTA 1L7AA 3D69A 3FRPB 5IQLA 2W48A 1YPZA 5FV2A 3K32A 1FRNA 1H6EA 1XSJA 4RAHA 5C97A 3I4CA 4HKXA 4C5CA 2ZE7A 3AS0A 5EJ6A 2ID5A 1SVMA 1EANA 2PWHA 3LLCA 3MLUL 4ZC1A 3SCZA 3VVCA 5D93B 1PG7X 4P6VF 4D9GA 4QGBA 1ZD9A 2R2CA 3GRAA 2FSFA 4DB4A 2JCCE 3RY5A 4G8IA 1UHVA 1BDYA 3SDDA 1IC7H 4GGMX 1XEXA 3U4CA 1XF4A 3SDXA 4QDZA 4KYTA 4LC9A 3F6BX 4DV4B 4JFFD 1IM3A 3GPLA 1O5TA 2WB2A 3MJEA 1E79D 1F8XA 4F7EB 4HZLA 4ACBA 2FZVA 1ROCA 5F7DA 5AI8A 1MJJA 3K9GA 5F9HA 3TCLA 3DMYA 3L1VA 2IX9A 5NULA 5BRQA 3X1XA 3C70A 3O8XB 3E27A 3EPRA 3AMLA 4P5EA 4GOND 3WMGA 4YV0A 1THAA 5DEGA 2ISQA 3B6JA 3PU7A 3LK7A 4M4PA 1FCCA 1JHMA 2GYVA 5A5VA 3P2MA 3AMKA 1O95D 2QSYA 2ZKWA 3CBGA 4YACA 4DYVA 1KARA 1KTRL 1V7PC 2W2TA 2QIPA 3HE6A 1MJ5A 4U9IS 4YAWA 2IANA 5FLKA 1Y1UA 2RKBA 1TMGE 3X14A 3QDGD 4P2QA 1ZNXA 1U9JA 4I89A 1OHZA 3FVQA 2G72A 1D6SA 2APVA 3JQOB 2BIPA 3EDQA 3N76A 3UYRL 3FOLA 4YDHB 2YGNA 5DBIA 3U1TA 3UZEC 1OP4A 2G06A 4ZXBA 1JL3A 1LF5A 2BVOA 3A6HA 2W6IA 4NQCA 4OIIL 4IOMA 1MJUL 1DEEA 2YBRA 3SF8A 1D2NA 2RR3A 5DJYA 5BN4B 1P8JA 4Q6BA 4J2XA 4M9XA 1XL6A 2FGWH 3Q2NA 2DX7A 4HWZB 2H0EA 4TVPD 4O02H 1RT9A 1YEEH 4PYNA 2XFXB 2D2EA 5IM4F 2V2XA 1RABA 4BMOB 2O8BA 2D3LA 4MS1A 4WSOA 2Y1LA 1WJ3A 1BMDA 4WJZA 4GSDH 4ZDHA 3EZ7A 4BNDB 2Q3BA 3KYMB 2LTAA 2ZBFA 2PAFA 1MAMH 3I42A 3IFOA 1KYQA 1LNQA 4Y9FA 1IFXA 1CP2A 3P9CA 1CXHA 3AERA 4PGEA 2PF6A 2TS1A 1WZEA 3AI2A 4DLWA 3DK0A 3ZVMA 2MMCA 3V6MA 1K72A 1FNLA 2BM0A 2FN9A 4Y0GA 4B27A 3ARGB 3I01M 3OUZA 2QQNH 1NBYB 3WWEA 2OCDA 4Q21A 1FLTX 4BH8A 4LFHD 2GJSA 1VSCA 5HHNB 3F9RA 3ETNA 4PD4J 3PWLB 3BULA 1NT4A 5KOJB 1Z16A 1VQ1A 1M8FA 1NW4A 4WNCA 3CFIC 3RJ9A 5D1ZD 4LCWE 4AKPA 1Q84A 2OL3H 3GD1C 2I4LA 3H7AA 1CLUA 3G2QA 1NGYA 1B0WA 2O6CA 4ODBD 1TFPA 5CBEB 4KJZA 3FN4A 3WN6A 3V42A 1NDQA 4JQYA 2VVTA 3TVMD 2G88A 4R54A 2UZPA 1UH3A 4E4YA 5FYKD 4GRLB 1W9XA 4NXMB 4OZGE 1ZJZA 1CLYL 3PICA 1LGYA 4ZZ3A 2V6HA 5GXBB 1JL8A 3LBIA 4X1YB 3Q43A 4FNLL 4PJDE 4XMLL 3HNSL 5JORB 3UL4A 3M81A 4K9EL 2GC4C 4L73A 3TH5A 2LLLA 1WZCA 1HOEA 1QRND 3N06B 4YHIA 4PHXA 4FQ1L 3IXAA 4RPGA 2OSYA 3HV0A 3GPEA 3LKNA 1XIWC 4KDRA 2X4IA 3ABGA 3GRWL 1LX6A 3VWKD 3ZW7A 5LB4A 4GI9A 4K9MA 1GD1O 4HJIA 3RGWS 2AKEA 4S1DD 4LOHA 1BM7A 421PA 4C14A 4IDAA 2J25A 1PR6A 4YRFA 3KQMA 2PETA 4L6IA 5HCIA 3VR1A 1GZ6A 1RHQA 4AI7A 3EZ2A 3EEIA 5ARBA 2XCIA 4PP1D 1BG6A 1BXUA 3PUUA 4GKZB 4IJUA 1NDUA 4X00A 5T4FA 1DL5A 4C55A 4PLJD 4FD2A 3H13A 3FD8A 4CSTA 4OCRH 4TTSA 4KXDA 2A6IA 1NFDE 3L48A 1I1FB 1JK9A 3ML9A 4ENQA 3EDMA 4P5MB 3N43F 1F7UA 3E53A 1I1OA 4LF4B 1RHUA 1MVFA 2JJWA 4KK9C 2HJFB 2FFQA 2G5BB 1G4RA 4C5AA 1Q1ZA 5DXFA 1M34E 3RFRA 2B2NA 5TEVA 3KB1A 4WK4B 3B1KA 3TC9A 3CS3A 4QOIA 2EWWA 4DIMA 1ICEA 3B2UD 2NT4A 1SY6A 1ZHHA 4Y3UA 2H2WA 2NO9A 5D5MA 1ODIA 4GNKB 3KXFA 1SWVA 1M1SA 3GNMH 4NHCH 1MVLA 3IOYA 4EUHA 4QAMB 4F72A 4JVWA 4LRNH 4IS2A 4CDMA 3FTDA 3EF4A 1RYHA 2XCSB 5T1JA 4FP8H 1IZ8A 1GZ7A 4KODA 3IEVA 3RM3A 2Q3JA 5DYOB 4NNYB 4KNSA 4DAEA 4PR5A 1E2DA 1T9AA 2NN3C 3HEIB 1ZLDA 3L7EA 4DHEA 4I88A 2PNJA 4APQC 2VYNA 3UOGA 2Y9RT 3AVEA 1AA9A 3LN5B 4O0LA 4H1LA 3VSAA 2BVPA 4C22A 2XVKA 1I7QB 4AJ2A 1SC6A 2HGSA 4R2IA 1G3RA 2EOAA 4FKBA 4BU0A 2AK4B 2OXTA 43C9B 2D3WA 1E8YA 2QTNA 1E2IA 2O7VA 1WSDA 1UXIA 3DX4A 2HN9A 3CZ4A 5I1CH 5JW5A 5JR1L 1D2GA 1D4FA 2E76C 4KK5D 4MCNA 1JQKA 4AMWA 4NKMA 4O4HB 1FGNH 2JLZA 2GTZB 4L3WA 5IDYA 4N8CH 4QJ3A 4ZO8A 2PYFA 3CEMA 3HCWA 5CAYB 2NW3B 3KJGA 2G70A 3E22A 4FKMA 2GSMB 3HZZA 4M8KA 4HKBB 2B1HL 1TJNA 2V9QA 2XB9A 2A73A 4FDWA 3MBXL 5F89B 4ETYA 1FH2A 1JZIA 4JDTL 1XGRA 3DR3A 3C08L 3OB8A 3MOGA 4EELA 4IDBA 1SSLA 1QDUA 3ARTA 3ZX4A 1V41E 1O1YA 2Y99A 1ZONA 4L8LA 3USZA 1SOSA 1TF2A 3MLZH 2L7EA 2C8NA 2ESVB 1OGAE 4X95A 1O03A 1OGTB 4Y0VA 1UEJA 5EOCL 3BTOA 5B5SA 5JU6A 3IDIA 4V2CB 1Z3RA 1B0GA 3M83A 4RY9A 2RMNA 1POWA 5CEZD 4HLZG 5E5RB 5JPMB 1SVKA 1LBIA 3WP0A 2ICWJ 4F4IA 1A5FL 3N55A 4N68A 4FNAA 5HGDA 4HXBL 3LCVB 4QRRD 4TULH 2F3TA 3D6UA 1HCZA 3N86A 2ZXUA 5LCVA 3CZKA 4FGUA 4D9EA 5AFSA 1TYCA 5SWQA 3BH8B 3NP4A 5DLDA 1NIBA 2OYRA 3OWRA 4XC3H 1Y6GA 4JFEB 1H2EA 3NBAA 2F9LA 3MFGB 1QF6A 1RCUA 1FP2A 4GKNB 3AF5A 3R6WA 5LAXA 3UG4A 1GZVA 5LVAA 3C8MA 1PR3A 5B3JC 5EUOA 4LIPD 2EG5A 3BIOA 3H5RA 1N6QL 4CLOA 2VR9A 4F9EA 5BSRA 4BXOA 5CLIA 1EVJA 4K8RD 2VQDA 4MAAA 4K73A 3B2DC 2AYYA 3D9AL 4G7YL 4FDLA 1AXIB 3KPQA 2VPPA 3EIUA 4XCYA 4JHAH 5H7XA 3VTTA 2SECE 2GN4A 1L8QA 1U8FO 3AJ7A 1ZM3A 3FO1B 2WWHA 3UK2A 3BLPX 4KPGA 3U09A 2R4UA 2E7ZA 3Q5DA 4UWQB 1X7YB 1XRLA 1T5LA 3PPVA 4BWWA 4PJEE 4FHKA 2BL4A 3QB7C 3EGWA 1CLCA 3EO0B 4U3CA 1MCSA 4XB7A 3O9WD 2EHDA 5EU4B 2G7MC 5BSTA 4X24A 4TUYB 1BRMA 3OD5A 5AW1B 4DH2A 1O94A 5D7LB 4GSQA 3ICVA 4Q12A 1ANKA 1QP4A 3IVKB 4BHUA 3GFGA 2I62A 5CLFA 1E5UI 2P43B 1LQSR 1NLBL 4JO1L 5A6SB 1ND0A 2E86A 3TX6A 3GLIE 2RGUA 1J1OH 1P5UC 1YVRA 2VHQA 1EX6A 5KKNB 1EZSA 1G7LA 1PZ3A 5FW6A 2G83A 1XQ4A 2KI5A 3H2BA 1XV8A 3IAQA 1OYYA 4E41A 2FGKA 3A4VA 1Z62A 4JCOA 3HG0A 1F2TB 4TSAL 4RDBA 3KWJA 1NVEA 4F7KA 2CGRL 5CUQA 1SJHB 1TF5A 1E2NA 2NNWB 2OV3A 4IGBC 1IFGA 1S7UB 2Y5QA 1R00A 3TLKA 4TPKA 1B9KA 2XNHA 4K2AA 1ODFA 4BNLA 4JZNB 5F3BB 4I55F 1OW0C 4LJLA 5T3XH 4MR7A 1EXWA 2FZ4A 2VNCA 1MHPA 1FHNA 3DHWC 5D6CA 1STOA 2GTHA 3TZEA 1N5JA 3PL6B 3ICWA 1GL3A 3V1KA 2ID9A 1XPOA 4IJ5A 1UPCA 1GOGA 3SXPA 2ZRBA 3J7HA 1Z3GH 4REQA 5BO1L 1TZBA 4PLWA 3FMGL 4M61A 3V7AG 1J49A 3RVXD 2P5YA 5B6JA 2B4CL 1TRHA 4R5XA 1NMQA 4HHGA 1EWQA 1BXVA 3AW8A 5I73B 5CCHE 1CMOA 4BGEA 2X19A 4K1LA 1KTLB 3D6GA 2OULB 1Q83A 1JD7A 1YOBA 2XUDA 1TQ4A 3MKKA 2IP2A 3KPRA 1G6VK 4OGGA 2GUOA 1OP5H 1VP3A 5IFJA 1ZM2A 5EZYF 3ILVA 4ND2A 1PY9A 2X86A 1IUNA 1OAUL 4HWNA 2JEZA 2HB6A 5GTDA 3NBUA 1Z4JA 3KKOA 4E1AA 4RJLA 3D4LA 5HYJB 5LBGA 5SWSE 3AEKA 2R8SL 1JH8A 3I9AA 5FAAA 3G8AA 1ORIA 3HCVA 5CLYA 3UEZA 2N3ZA 3ZE0B 2J5LB 1CHDA 1F38A 4J3UA 4MVJA 2YAHA 2RGDA 2R96A 4MD4B 2BP5M 1KCVH 2R0ZL 4ZTPH 4MWFB 2DMKA 4IRJC 2ZSKA 4LXQA 3CVHL 2IPMA 3CGGA 3RVLA 4HU2A 1I9RL 2B0SL 2XGSA 3VKWA 1X15A 5TDPB 1L2TA 4UU1A 2LW3A 4S1PA 3EC2A 4BZPA 3PABB 3ROXA 1DVFC 3DC7A 1XN1A 2X1PA 4B4VA 2YD7A 5KINB 4LSMA 4LBYA 1U3JA 4L4YA 3LPDA 4DMRA 4FONA 1I4LD 4TYQA 1FYTD 4Z3DA 4BQEA 2GK0A 2AANA 3OL2A 1S8AA 1Q0HA 1MENA 3OM0A 4ZMRA 4ILDA 1A98A 2HRPH 4UUOA 1MVNA 5CA1A 1L9XA 3IUSA 4P3YA 3OVMA 5I1HL 1J5XA 2FG6C 4NJAH 1A6PA 1I8MA 2P5EB 1Y9JA 3ZKQD 3VD4A 5JDIA 1DCFA 3LUBA 2Q2QA 1IYZA 4OD3L 4IL5A 7MDHA 3CYFA 5JWOA 3IBFA 1GPKA 3CR7A 1I85A 2R84A 3D59A 4RKWA 1DIBA 4QDTA 1EJOL 3LIPA 5DK0B 3KQPA 3H2QA 3E80A 4QC2A 4YCAA 1H6AA 2X9WA 4QG3A 1VBKA 1KO8A 4U8GA 5FORA 4QHLB 4M53A 4LKCA 2Z35B 3SYLA 4N0YH 1TPYA 2X0EA 3PVZA 1EWHA 5JARA 2QLNA 4RX1A 3U3RA 1AKJD 2ZKMX 1JJBA 2C8KA 2HJLB 1PJBA 4DC9A 3CLEH 2GZ2A 4MMYB 2GK2A 4C1NA 3IV7A 4EAEA 2ERYA 3ANLA 4LXIA 4MS6A 2D2CC 1C0PA 1HL3A 5IMLB 3DG9A 2UWEF 1G9HA 1URLA 1BDBA 1OW3B 2ZZUT 3BIAX 3V7MA 1XKXA 2AKYA 1ZRHA 1U2CA 1U3HD 1YEDA 4HGQA 3WK9A 1ZMXA 1EBAA 2G1KA 4WZBE 4EN2A 2I9PA 3D18A 4KKLD 3IQHX 1YZHA 2VQ3A 3B9EA 2GPZA 3DURA 4V1CA 1WOMA 3G6JB 3WLKX 4Y9RA 3E6AA 1ISSA 3EJZD 1UBFA 3KDSE 1FL5A 2Q5LA 4ZFZB 1PHPA 1ROWA 1ZHKA 5J47A 4TKLA 1B4LA 4QGFA 4NYJR 1YMMA 4A6YA 3QFTA 2OMXA 4J1QA 2QRLA 1P2SA 1TQ2A 1SHWA 2R0LH 1XCMA 2FWOA 4FWWA 3GAMA 3NYIA 4R8MA 4QXTB 2IPNA 3RHZA 2UZIH 1HT1E 3BQ9A 1L9KA 1CR6A 4UM9A 2CCKA 1W0WB 1CQJB 3V0GA 1E7YA 1H0KA 2OM5A 4OZFB 1PG7H 4GY4A 4U2GA 3B1JA 4ZHSA 3OFND 3KL0A 3RSFA 3ZWAA 2EVFA 3I6YA 2HSWA 4AG5A 3OY7A 3JXEA 2ODTX 3VVWA 1UZMA 4Y19B 4B80A 5IVPA 5K0LA 3PKZA 4X90A 3F3KA 5CJPA 3H65A 4PTTB 2YWBA 4FMCF 4BFLA 5LLTA 4JY6A 1KFCB 4J27A 5ARDA 3VKFA 4XRCA 1Q7TA 2GSIB 3EXHC 1U3ZA 4KK8C 2DGDA 5E1BA 1TSRA 3NSYA 2X3CA 3QW4B 2QDKA 3CLRD 3NIBA 3THYB 5HYSG 3HB1A 1N67A 2HC9A 3UIEA 5DHTA 1J8HB 4YGXB 3F84A 1B15A 2R23A 1U9KA 2X0JA 1CYDA 5IKEA 2J5WA 4YAEA 1IY9A 4ESOA 4L0PB 3EYOA 5CJJA 4XO3A 2BGJA 3ZXUB 1LK5A 1QABA 1U8MA