5HDBB

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 114
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5hdbB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5hdbB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5hdbB03
4C2BA 3EFOA 1LFAA 1CQPA 1SHUX 4Z7QB 2P28A 5E6RB 4IGIA 1RTKA 2B2XA 3ZE2B 1JV2B 4WJKB 4WK2B 4MMYA 1MQ9A 1UEXC 3OL2B 3EG9B 4MMXB 4JX0A 5BV8A 1M2OA 2WW8A 1FNSA 5E6SA 3TW0A 1JV2A 1SHTX 1M2VA 3N2NA 1XDDA 1JEYB 4UM9D 4G1EA 4HQLA 2ODPA 2VDMB 5E6RA 3K71A 1SHYB 3EH2A 3K72A 3VI3B 3PPVA 1U8CA 2VDKB 3AL8B 3NIGB 1RRKA 5KYUB 2I6SA 1SSLA 1V7PC 2NVOA 1AOXA 3PPWA 3IBSA 4C2AA 2P26A 4G1EB 4CNBA 4PN7A 3TVYA 3NIDB 2UZYB 4WK0B 3T3MB 1U0OC 4G1MB 4F1KA 5HJ2A 1T6BY 3OKWA 4O02A 3EG9A 1YVPA 3ZE0B 1CK4A 5HDBB 3BQMB 4IHKA 5KYXB 1OLZA 1L5GA 4IXDA 4HQFA 2WINI 3Q3GE 4O3UB 3EOBI 3RAGA 1MHPA 3FCSB 1MJNA 3NIFB 3EH1A 2VDOB 1XUOA 3ZDXB 1M1XA 1N3YA 4DMUB 4FWWA 2NUPB 4A0QA 5KYUA 4CN9A 5KYNA 1QC5B 5KYWA 3EGDB 4NENA 3AL9A 1DZIA 3OL2A 3EGXA 1JEYA 4WK4B 1TYEB 3OKYB 2IUEA 4MMZA 1IJKA 2VDQB 2NUTA 5LN1A 5E6UB 4HQNA 4M76B 3IJEA 3PPXA 1YUKA 1JEQA 5HGJA 5E6UA 1M1UA 2VDNB 4WFQA 3K71B 3HI6A 1M1XB 4NEHB 2XWBF 1NA5A 3EGXB 4HQOA 3TCXB 4CN8A 1PD0A 1JEQB 4GZ8A 1BHQ1 1PD1A 1RD4A 3EFOB 5KYXA 2I91A 2VC2B 3EGDA 2QTVA 2VDRB 4MMXA 3HXQA 1AO3A 1OAKA 1M10A 1MQ8B 1DGQA 3V4PB 5KYYB 2X5NA 3K6SB 4G1MA 3FCSA 4Z7NB 1QCYA 3E2MA 3GXBA 5E6SB 1BHO1 4JDUA 5KYYA 1SQ0A 4NENB 1N9ZA 1ZOOA 3F74A 2I6QA 3FCUB 4MMYB 4MMZB 1IDOA 1XDGA 5ES4B 1AUQA 3ZE1B 3QA3E 2VDPB 3ZDYB 2O7NA 3IJEB 2ADFA 2M32A 2NUPA 3M6FA 3NVQA 2ODQA 4K3JB 1ATZA 1FE8A 2NUTB 4XW2A 1JLMA 4HQKA 3HXOA 3K6SA 1ZONA 2XGGA 3BN3A 3F78A 2VDLB 3PPYA 1IDN1 3EOAI 3ZQKA 4BJ3A 1QC5A 3TXAA 1MQAA 4O3TB 1YVRA 1Q0PA 3BQNB 4Z7OB 1U8CB 3AL8A 1MF7A 3VI4B 4C29A 1L5GB 1T0PA 2XWJI 4UM8B 1PT6A 3ZDZB 1PCXA 4O02B 1ZOPA 1IJBA 4F1JA 5KYWB 3K72B 2ICAA 1M2VB 3AFCA 1U0NA 4FX5A 3T3PB 1RS0A 4UM9B 3V4VB
chains in the Genus database with same CATH superfamily
1IAOA 1JJ7A 4TKMA 2ZSUA 3DL0A 4NR0A 3CGTA 2Z6UA 4XWOC 3ZU6A 1VP9A 5LBIA 4HCGA 2VISB 1MFUA 3ZXYA 4BVFA 3C2SA 4J3OC 3NOVA 2B1IA 4R0LC 3CSFA 1E1QA 2GK3A 5JXGA 5KDDA 1RWXA 5E2AA 5C0AD 2RBEA 2ZWKA 1TKWA 1W5SA 2XRFA 2UYOA 1F4VA 3QGMA 5KIAA 2OV4A 4Q2ZB 3BWAA 5CJ2A 4O1HA 1HTWA 5IRCD 3ZJTA 4YI5A 3MQIA 1T3GA 1GT91 2AD1A 3HKBA 4LRIC 1I3CA 3ZK8A 1Q38A 5CT4A 4S0SD 2O4EA 1X13A 4NNXA 2A9CA 4U3JA 3W8NA 1RLJA 3M4YA 1ORDA 4WI6A 3H42B 1MKFA 1JUFA 5E2VH 2X9NA 5D5QA 4G2AA 3NXSA 3O6FA 4ELMA 2PIDA 1LO3L 2OTWA 1TYCA 2ATIA 2WJ3A 2VN5A 4LRNH 4F38A 4NWUL 2PZJA 1WLSA 1T04A 1L8QA 1AJ7H 3E2MA 1W36B 1VG8A 4BQ8A 1NNI1 1DAIA 5E56A 5DYIA 4LQ4A 3PQYE 5K51A 1Q0QA 5ES4B 3T0IA 1MW0A 4OCSH 4IWNA 1FTWA 3CFJA 3WLTA 4HFWB 2FF5A 4N03A 1ZK9A 2COUA 3MBOA 3GBEA 3DM5A 4LZNA 3QHFL 3N9GL 4DW2L 4F9EA 2ECOA 2AX4A 43CAA 3NDPA 4MGEA 1FDIA 3EDQA 1BXXA 3GLFB 3CZUB 2V74B 1JZ3A 3QHQA 3FBKA 4NLAA 5TQ0L 3HI5H 2DMRA 3GRAA 1TJYA 2WVVA 5EA0H 1OBOA 1ZHBB 1MCHA 1C0KA 2VUHB 4G63A 4O4JA 4JLSA 2A9BA 3U62A 2PUFA 3Q3HA 3T2LA 3MRJB 5CFLA 1G18A 3LV8A 2NO1A 3ZZSA 4X3PA 1RZRA 2XWTB 3GK3A 4DGWC 1YAZA 3BTVA 3K9CA 1OCZB 2Z08A 1XJQA 2BSCA 4JI3B 3BZ4B 5LVEA 3RSQA 3O8RA 5JW5B 2GHIA 5KX5B 2ERCA 1QRSA 2SODB 1FZMA 1NVXQ 1PWEA 4O2FA 3QG7L 4MWFB 1TAUA 1O8CA 3JALB 1T6ZA 4UDTB 3LPLA 4GI6A 1BMDA 1XEDA 1K8YB 4L1HA 3QJVB 2HXGA 4XXWA 3CEMA 1BNCA 3ZBMA 3I4FA 3VPDA 5BSTA 1FNCA 4AJKA 4JDUA 7AT1A 1NNEA 4QDZA 4WCFA 3MBIA 2ZR7A 4FR0A 3IAM1 3KH4A 5HQTA 2F19H 3DXAA 4DCOA 2NUTB 5KUKA 1E5CA 3L7LA 2XE7A 5C0RH 2AJXH 4GQQA 3PQ6A 3S70A 4ZZ1A 1CS6A 2JJMA 4OGYH 4LC9A 3SICE 4PCYA 4TTGA 3RP1A 2AF4C 2BJMH 4Q00A 4FQ7A 2FG7C 1V8FA 1CQPA 3H42H 1WHTB 2RI0A 4QDUA 3QITA 2C2OA 1G4HA 3D8HA 3WYCA 4F2DA 1DP0A 4LNRB 4P7KA 5CJBA 4FLOA 2OMYB 4FQJH 4Z3TA 2GN0A 1LMIA 5IJWA 5FFNA 5JD5A 2E86A 2TRSB 5FR3A 5E0KB 1A4JA 1IIKA 3JVGA 2J7PA 4HXGA 5B3NA 1A8SA 3HJBA 3WX0A 2HUHA 4J6EA 1B90A 4LVOB 1H2FA 3IIKA 1VACB 4JZOA 5L8VA 4PRHB 4HN4B 1ZGHA 5ESVB 3FT3A 1ETJA 1Q15A 2XNDD 3BGOS 3NPSC 2XBDA 1RY7B 3L81A 4LG1A 3QEQB 2PLRA 2JDID 2QDWA 4B83A 1SIOA 2I5YL 2EDNA 3KYNA 4ZMYA 1IHXA 1M1YA 2R6HA 1UP6A 2IPOA 4WA8A 2FSUA 1OAKA 4U7PB 1X44A 1PSZA 2WU8A 4KUCD 4DWWA 3L0BA 1GUDA 1WV0A 4ZXPA 3I74A 4NYLB 2VDQL 2K9UA 1CQKA 1U3CA 1JIUA 3DEKA 5HBGA 1EDBA 4JFSA 4K94H 1JUDA 5DBEX 1Y1TA 2BSDA 1YA4A 1N2CA 1M7IB 4MCYA 4YPJA 3E8MA 5FR1A 3QNWA 3NHFA 2PUCA 5TF1H 4GIBA 1XSJA 4G6FD 2VDML 3PGFH 4YRRA 2GS9A 1BQ4A 5BXFB 5FFMA 1K4YA 5B1JA 3F58H 2WW8A 1LDGA 3HBJA 4JQIH 5J3HC 5K3FA 3WE6B 1II0A 1KIMA 2VDKL 1Z9BA 4KZDL 3OWHA 1W4LA 3CK0L 3WKDA 4EA6A 3GLQA 5GVRA 5I66B 1GZDA 5DXJA 3SBOA 4AZVA 1CU4H 6CGTA 4AFNA 2HSGA 3UC0H 3Q0EA 4KNTA 2P27A 4TSAL 2AXEA 3ZCRA 5L88L 3NFPB 3F5FA 3D6NB 1Z0ZA 4L3CA 5K8JB 4XXWC 2ICEC 4BM7A 4YS6A 3HNVL 3H2JA 3ZLBA 1P2SA 4XN2A 1EQ2A 1ZX1A 4ODIA 2XN9A 4MNQE 4RKYA 1UD8A 1GP2A 2VP4A 2CDBA 5AAWA 4KOBA 4KK9C 3B5EA 3SF0A 3T3MF 1A2OA 1G5RA 4P38A 4U4BA 1G17A 4RPGA 4TYMA 1VECA 1BGVA 1DGQA 1JZIA 5MEPB 4K71C 1J23A 4LE0A 3WGUB 1J0XO 1SZJG 2CCJA 1TYZA 1A7KA 5EZLA 1ETZB 3E9DA 2V4ZA 5HBRA 5LN8A 3OKLB 1ZC3A 5DYOA 3WMXA 3RHTA 3MRFA 4CLOB 1BGWA 3BAKA 4NERA 2WM0A 4D8OA 5KOIA 3R19A 4M7ZB 1CDIA 1VL0A 4JN6B 3Q7TA 4N5NA 1LI7A 1DIHA 4M9XA 3ORRA 5L2KE 1KCWA 3LNHA 5BVJB 4OGAC 1RACA 1UOVA 1O7DC 3EFFA 2FDXA 2L3BA 3VPFA 4UQBA 2WSKA 2CFCA 4JC5A 3JTTA 3GDOA 3FQNB 2PANA 5BV1A 5HJ7A 2F0CA 4Y8AA 3LUBA 1RYDA 2YEZA 2NOAA 4D44A 5JMPA 2L42A 3PXHA 1MQSA 2ZUDA 1WISA 3AWIA 2F68X 3V7NA 3UW3A 4O2BB 1OPXA 3I6IA 4XB7A 4JRYB 1FNLA 3WFCL 2E7MA 2ZATA 4EDFA 2ZYRA 3G6AB 4LJAA 5KSBB 3K2QA 2E7DA 4PAMA 2HA5A 3AS3A 1YPZF 5JUEH 5DEIA 3WJAA 2BSQA 2PUEA 5KYUA 4BFXA 4QECA 2XWJA 5KCZA 5F88B 4G9DB 3R7NA 5GTDA 3MC0A 3H9HA 5FOQA 3W5MA 1A50B 2QV7A 3AW8A 3I2KA 5LLSA 2PCXA 4YSQA 3MOIA 5KSAD 3QBVA 4A2WA 5DQ9B 5A16B 3CX4A 1NANI 2WB2A 4MQTB 2Q1TA 5CW2A 2J5KA 4AC2A 4QYOB 3LZNA 1P4IH 4MRMB 4AXWA 4PC2A 2B16A 3NB0A 4DIBA 1IJNA 5CBAB 1HU8A 5HZHA 3ZNQA 4IHOB 5IP5A 4P4GA 4QOHA 3LC7O 3ZWPA 2OT3B 4YJHB 3DONA 4CM1A 3P5SA 3VOSA 2K70A 1N26A 4II7A 2ZCHL 5E6YA 2HLPA 4LNUB 1QIIA 4Y2SA 1GZHA 1SHSA 2PMBA 4D3SA 4AP9A 2XWJB 2EW2A 1AHHA 2Q3MA 3K70B 1MJHA 3BIXA 4QOKB 1H69A 3KTDA 2E8ZA 2N0KA 3QWBA 5EO1B 3FU3A 2ECQA 3K74B 1HE2A 1FC0A 4F4JA 4TUUA 3RSZA 4BFOA 2YN0A 4M83A 1D2PA 1BJ8A 2KI6A 1RAFA 3MN8A 2XUQA 4JT2A 4RVBA 5JZVA 5EKDA 5CYGA 4ZTBA 2GNAA 4BAUA 3R7RA 1SCAA 2N7BA 4ZFOB 1H2RS 2P6UA 3WVNA 4DB2A 5H3LA 4IHBA 4IXNA 3VXOB 4TUOA 1Y1UA 1ZXXA 2Q2NA 1ACYH 4YV7A 1L3WA 2WYOA 1Z5PA 1J1PH 4JUIA 4RENA 2G60L 3ATAA 3HFMH 4G42A 5DZJA 2IZ5A 3QX9A 3OCVA 4GS7C 5LGHL 3GGWB 5LDSA 4X6DB 4D5GA 2Q2QA 5KREA 4AYGA 1SOXA 4V03A 5EIFA 2JIPA 1KGCD 2DPMA 1MAVA 4N2DA 1G21A 5CJOL 1B3IA 1PWYE 3OEHD 4Q1BA 2V0AA 3KZCA 3VZBA 2VN8A 3O26A 1G2QA 1UBMS 4S35A 1U98A 4BE4A 4WECA 2NR6A 3OX3A 1GFSA 4E6PA 4WUTA 1MCFA 1GNVA 4MVJH 2P7TA 5K9JL 4G85A 1TPXC 1RULL 4D02A 1ED3A 1G20B 2IV3A 2A3TA 1A0QH 5IC6A 2MOKA 3ZJVA 2G3ZA 3ALWA 2C9UA 4NUGH 4GPBA 1VIAA 3RJOA 1OJ7A 4P3DB 3ED1A 2WLNA 2AZTA 5LBSL 4PHHA 1P53A 2J8UE 4JY5H 2OHXA 3MV8B 3V1UA 4PWGA 5LDHA 4YYEA 1TUEA 4FZJA 3ZZLA 2P5YA 1QH8A 4UMGA 3G23A 3C5HA 2PT9A 4UJ5A 3GA5A 1D3AA 3HA7A 4LGPB 3QY0A 4PGAA 2OW6A 3WNKA 1LDMA 3U25A 1PNCA 10MHA 2Z2XA 2D2FA 2VXYA 1XMEB 4OM1H 4YQXL 3L0SA 4ZQCB 4JSYA 1YF3A 4NS0A 5C5DA 3V4FA 3B82A 2VQ1B 5KUMA 3RAPR 1K9TA 4O4HF 1IJKA 1VBKA 2CC2A 2AKEA 1MW2A 3VU9A 3IEAA 1W1IA 1U2ZA 3OOYA 4Y4KC 2R8XA 4DPCX 2XQGA 2GSGB 5ID1A 4NQVB 5EEYA 4ASUD 4MB2A 1NUNB 2FUCA 1J5OL 4BHTA 4AK1A 4NMWA 2YSSB 3FU0A 3TWOA 3ZZTA 3JATA 4YSUA 1DEDA 1HHKB 1KDYA 1IUKA 3VR3D 3TBFA 2YXBA 2O3TA 3B9KC 4BIKA 4OB8A 5ITZA 3LS2A 2DT5A 3MRTA 2OO5C 2O1AA 1ESNA 3AHDA 2RCSH 1GM5A 1CRZA 3NWOA 5IROA 4JEUA 2A8YA 1W8EA 1UT1A 1SUJA 4Q21A 1ZJ6A 1ZEAH 1NMEA 5FLVA 2NNAB 4KKZA 1H6DA 2GAAA 2PO6A 2JVUA 3EDRA 1WD8A 3DJYA 1C16B 1K8IA 1OKEA 3GLHB 2P49B 1UMDB 3U0PB 4EGAA 3H16A 2AG5A 5HHMD 1J9ZA 1ECYA 3ZIAD 4UZGA 5EMNA 1W581 3RF7A 3CZEA 1X7YA 3VFWB 4X9HA 3JRXA 4AX8A 2D7NA 3SDAC 4JZJB 3B12A 3ZE2E 4YBRA 3U4AA 1FNGA 3D0VA 1YJDL 5IV2A 3E8UL 3QV1A 1NCNA 1TZAA 1DQKA 5KG9A 3PEFA 4ZKDA 4KE9A 3M6AA 4JCMA 4MP8A 4FGMA 4WW2A 1VFBB 1Y0LB 1RC0A 5B38B 2BF4A 5K69A 4HQNA 5EZ6B 1PZFA 4DLVA 5AW7A 4TLTA 4TVSa 1V71A 1P5HA 1CFVL 4V2IA 1INEH 4ONFH 9PCYA 1SUAA 3CLSD 1BOYA 3I9MA 4JC0A 2OZNA 2GCEA 4DE5A 4AV4A 4MYCA 3T8XB 3DHJA 2VNAA 3LDBB 1M76A 3F7PC 1PWXA 5CLJA 4AIZA 2RARA 1H8NA 1QPBA 2NZYA 1E2PA 2IT1A 2DD8L 1YJQA 3VSTA 2PS3A 2VR3A 3ILDA 2G77B 3QUZC 1AAJA 4L50A 1KAQA 2XXFA 2WJ7A 2GASA 2IZ7A 2ID9A 3V4UL 1KI6A 3OKLA 2G9HA 1H5BB 3C6MA 3WXVH 2P5WB 1KERA 1WP4A 5IVDA 1A4XA 4TM7A 2GBGA 5ICEA 1XNRB 2DQDH 2HTKD 5KVDE 3C3PA 4GBGA 1WWCA 4W93A 4LPTA 3BEVB 1D0IA 3T6KA 4O4LB 1RAAA 3PQ3A 5C09B 4LWPA 1BVZA 1UODA 2WV9A 1EUCB 4QGAA 3KXKA 1EGJA 3M1OA 4MGZR 1Z07A 1NCBH 3DX7B 1V55B 3WLSA 3QVAA 5CLZA 1JIBA 4TRPH 3HN6A 3RTQD 3PXXA 2KS6A 1MHHA 4H1TA 2G9NA 1A5FL 4CEIB 3NIGF 4J0CA 4F7DA 1XSIA 2QN7A 2HJLB 4QPDA 16PKA 4LVHC 7MDHA 4ADGA 1CFTB 3LP6A 3ZHLA 2B4AA 1ZI8A 3DR3A 1E2MA 1EVLA 2BIQA 4HKJA 4YPVA 4U1KA 5LOVF 2NT3A 3BRWA 3QIUD 1U8YA 2PR2A 4B0OA 4PGGA 1G7MB 1E6WA 3AHGA 2OK8A 4J7XA 5E8PA 1G7LA 5C0GB 4HCFA 3W9DA 3TH2T 2X4OA 2XUGA 3K8MA 5BVGA 5BSKA 3IDNA 1E9QB 1VTKA 4IMKA 4I89A 1NP6A 1MZPA 2OFOA 1RUKH 3DBHA 4MZ3A 3L6EA 5AW0B 3DRQA 4LKOA 1EX0A 1UDAA 1Q1JH 5T1DL 3LGAA 5J1AB 3L1IA 4RVHA 1PR4A 1OHHA 4RL6A 1OE0A 4L3OA 1FZKB 4WCYL 3K0CC 3MMEB 4JQXA 1XCWA 3AWGA 4GKSB 3M4ZA 3WTSA 5BVJA 3VXQA 5D7KD 3CN7A 4H1LB 4M5ZL 3VH3A 1N6PA 2JWHA 1UKCA 4OHXA 1DKPA 5K3CA 3L49A 5I9SA 2G67A 1UA6H 1V5WA 4JSTA 1QCCA 5I9NA 1EO5A 5KTEL 1N0IA 2LUOA 2AV1A 4OHOA 3QZWB 2ZRNA 4L7QA 2ZXGA 4GO6B 4PX2A 2XUAA 1G3QA 4I5EA 5EIBC 1WE2A 4W9ZA 2R8RA 1S5IL 2H3NB 3QI9A 3U7FB 4C56E 2X6RA 4JKNA 1Z5YD 5ESWA 4PJ7F 1L4UA 3D2BA 2IGLA 1Q20A 1J0CA 1PFQA 1NCWL 2XZLA 4ZAKC 4A0SA 3C6KA 4FWIB 4R2GD 2FWRA 2HY7A 3TI9A 3RUDA 1B0RA 4L27A 1E5XA 4U7FA 5KWJA 3VFDA 4UNQA 3UA3A 2NXJA 3PGDA 2REQA 4IIUA 1I1YB 3U13A 4D42A 4HS4A 4QPEA 2X4RA 3AIOA 2GI4A 2WCGA 2J3IA 3A3OA 3CW9A 3VI4B 8AT1A 2JCWA 2O05A 3D4PA 1JNXX 1JIIA 2RIPA 1TJ4A 4JO8A 1DEXA 5AW2B 2I4MA 3O41B 4F9FA 1XU7A 5JRDS 2EDMA 2R27A 5LBVA 4J4HA 3ZN6A 1XIWD 2G70A 4LSPH 3U3JA 5CG1A 1IGMH 4ERSH 2BXYA 2POCA 4YGYA 1E4XL 1NMCC 1Z3GH 5EBWA 1N3NB 5A4DA 4ARIA 1JMYA 2EC5A 3T08A 3TO2B 2A59A 2YOFA 4IHAA 1Z45A 2O23A 3W8DA 2CSPA 1OGAD 2R9HD 4Y2OB 3Q2OA 1OXBB 1DE4A 2YWJA 2EVWX 4C57C 4GRDA 2V6GA 1VPVA 5EXDA 4NCC2 4E1BA 4YUXA 1I1FB 3NMEA 4LTNA 4KH1A 1U0QA 3AXSA 2QXUA 3PL6B 3LKNB 4QHMA 2SKCA 5EFIA 4GKNA 3ARDC 3GW8A 3TBCA 3BF7A 2HA3A 5DHMC 1UANA 4PSRA 1OGTA 4IUBS 1Y6QA 1DVXA 2QJWA 3ZVNA 1KSHA 2VSKB 1INDH 1TLFA 3OO0A 3IAFA 2XRAH 3QSKB 1ZHKB 5C70A 3LQQA 2RB8A 4KJYA 3ZE1B 3E9RA 4DDHA 4RJKA 2M6SA 1Q16A 1PW7A 3OZ7A 5BYKA 2UVFA 4HXYA 2WZQA 4Q7MB 2VDLB 4ND3A 3DDFA 2ZX8A 4CKQA 3VXSA 1O08A 4XMLH 4YAGA 1T4CA 4CW1B 2I6TA 5IROC 4BLTA 1WCYA 1FYTD 1JKJA 4HS8H 4YHNB 1R88A 3ISJA 5D6OA 5GJBA 3B9KA 1UM9A 3D0KA 5I3ZA 1MQ9A 1E0OB 4F04A 1SXJC 3O2NA 3SHFA 3GIWA 5HCUA 4PX3A 3SY8A 4IYRA 2G28A 3KVQA 3OQIB 1XH3B 2YJ6A 3U1TA 3IKKA 2ZQZA 4JPKH 3I2HA 3GVHA 3JSAA 4KMLB 2EUZA 4JRWA 3DETD 3FYCA 4JNCA 1IFHL 3LW8A 1BJKA 4HWRA 2DQEL 3H2YA 1IQDB 3LWBA 1B16A 3FO1A 1FP4B 4JVUA 5JPCA 2GCPA 1WP6A 3CISA 3TJMA 5LIRA 4CVXB 5I1HL 4M4RB 1ZH8A 1RFDL 2XQIA 4BEIA 4DOHB 1R64A 3CFEA 4BQIA 4BX8A 1C1DA 2EDOA 2PX5A 2V98A 3VFWA 3TTSA 4EVNB 2GUYA 2Q3XA 4KY1H 3QI9B 5I23A 1OA0A 4K23L 4U6SA 5BXFA 3VAAA 1DO5A 2BGRA 1H6FA 1BH6A 2IODA 5D8JL 2A77L 1XAGA 4OB7A 4UZEA 4HS3A 3DNPA 4UQLA 3CLEL 4Z7VB 3RBXA 3WEXB 4O2FB 3D7SA 3BDYL 4OP1A 3GGPA 2AQHA 1SXJB 4AJWA 4Y6GB 1WZCA 2ODTX 3TJPA 4AQAB 3HWRA 2D4DA 2R2HB 3DFKA 3P11L 1T3TA 3AVOA 3V4PA 4MD5A 2PKDA 2W43A 5E1IA 1E4WH 2BEJA 4KPHL 4RTKA 1WBJB 1WS7A 4E5YA 1MQKH 1KAOA 3JASA 1FE8A 5GAJA 3G8CA 2JELH 1TO4A 5A2QA 1F8UA 1RHRA 3UBGA 2PPAA 1UXKA 4RHFA 3JATB 2AB0A 1MJGA 2PGNA 3WJLA 5SWSB 4IKEA 2VCYA 2X6QA 2PWZA 4N12A 4KTDH 3MPCA 3CH4B 4PZPA 4J1UB 1E2KA 4MJLA 1BOFA 2GJ8A 3I3SR 3Q2WA 3MXWH 3KPWA 3JQDA 1RU9H 3QJHB 1L9SA 1UKVY 3NZSA 3U36A 4QAQA 2WO2B 3LDAA 1H0HA 4BATA 3QIBD 3FOEC 3NBMA 4L0YA 2HLDD 1X7HA 1P4UA 4EGJA 4MQ7A 4Z7VF 4L85A 3N75A 3T4XA 3VI4F 3R4CA 4F9PA 2FDCA 2ZSVB 1OTXA 3KYMA 5DHUA 1K08A 4OUKX 4OJDH 1P39A 5CFHA 1M2KA 2FT8A 3ZKMD 1RVV1 2KM1A 3TX4A 2YXFA 3LCVB 3O3OB 5F76A 4KUZH 1ZD3A 2F53D 2AFRA 1RUML 3BVUA 5JS6A 1ISPA 5HDOA 5D1XB 1U8QB 5A4FS 3MLSH 2XXBA 2BK8A 1D7FA 2YKLL 5T1KD 3HDGA 2CD9A 4D45A 1H42A 5L4MA 2CGZA 1SPDA 4IMLB 3KPQA 4NCXA 4ZPVB 2ZOTA 5FPSA 2VT6A 1FDLH 1VKHA 3QPAA 2BSXA 5T1LB 1OI7A 4UBIA 2H1SA 4EN3B 4QRPB 4BTLA 2YK1L 4LV8B 3TL5A 1MY5A 2XCUA 1JQDA 5AT1A 3W0WB 1YEKH 3QIWC 3AKDA 3STLB 4IRJD 3TFOA 5AM3A 3GBVA 4TQ9A 1Y6GA 2H7YA 4BP9A 3WYGA 3PRKE 4XPIA 3LHSA 1XZGA 3RF6A 4ZAFA 3UJAA 2W88A 1S9KC 5JAPA 4ZCMA 2A88A 4Z9KB 1H0RA 1VSUA 4HGYA 3ZIAA 3O8XC 3R0QA 1L7PA 1NDQA 4U6TA 1QQTA 4TWBA 4P4RB 1V1RA 2WN3A 4G8FA 3FQ2A 5DD6B 5IHWA 4RSGA 3V5NA 4B48A 4BDVB 5A1JA 1UWGL 4IIJA 4LNHA 1N78A 3O4HA 1O6GA 1QVVA 2NUPB 1YTUA 2H4XA 1RIIA 1SUCA 3FAZA 3ZV7A 3CFKB 1QFWH 1A9VA 4PLPA 4PEVA 2OKMA 4BPBA 3AZPA 4FKEA 1TNDA 3ECAA 1DADA 1JPSH 3D4YA 3WWDA 1CFNB 3IJSB 3OSUA 1U0TA 1BZ9B 2F9LA 4BN4A 4OKSA 3O8LA 3ADCA 5DZAA 4XTRA 3U4IA 1X0XA 1SY6H 2EE9A 4OAPA 2LLLA 2Y6TE 1PHRA 2A2ZA 1MQ8B 4KPUA 4JRFA 1PJ8A 1KPGA 1XRSB 4R4BA 3C43A 3GSVA 4Q7JB 1ZKDA 1XXLA 4N7JA 4LXTA 3CCFA 4WI3A 3FS9A 2VP5A 3ZDYB 1I3NA 1YKGA 1XO1A 4AGQA 1D4ZA 5FM4A 2FX3A 4WLUA 3GB7B 3HU2A 1RVFL 1NPYA 1FVEA 2AKRA 1RJ9B 3N86A 3ZR4B 1C41A 1RRGA 5T3XD 3KGSA 3D59A 1MFPA 4B2PA 1CL7H 3LY8A 4PJXF 3VD2A 3ANXA 5BW8A 5CEXB 5CZXC 1W1UA 3CLTD 1F20A 4S3MA 2GO1A 2HP4A 3CVYA 3I72A 3IHLA 4N8CH 4L8GA 5L51A 4DZ8B 3MLPA 5IW8A 2JKNA 5FOJA 4APQB 2EW1A 1FLRH 2LPMA 3UWSA 3AR8A 2YRXA 2H1IA 5EBLA 5GJSL 4P2OA 3FSAA 1ICEA 1KVRA 1SPXA 4PZ0A 1ERNA 5KYXB 2ZCLL 4CU2A 1ZMXA 2H32B 4J6RL 4L29B 5C0IB 2EVHA 2M26A 4EI5D 2XYGA 2Z8ZA 3DMTC 4D80A 1Z0DA 1WZMA 3O2SB 2DI8A 4PR5A 4HP5A 3ZKWB 1IEXA 3FTQA 2RQEA 4I88A 4G5YA 5EOQH 2QSTA 2FSSA 2Q9CA 3NAAH 2BHRA 4X0KA 3FSVA 2QVLA 1IEHA 4I3HA 3GPIA 2DWUA 3F5DA 3TA3D 3BZWA 4J0HA 1LV8A 5JLAA 1BQHA 3V9EA 3ABZA 1YECL 3TO2A 3RC1A 5AI8A 2Q8AH 5BNIA 3S88H 4XP9L 3N85L 3K70C 4OLAA 3O4FA 2V5VA 1YA5A 3LS5L 2HHJA 4AY5A 3KNBB 1YZUA 3OEEA 1C3JA 4MHTA 2W0LA 1NRJB 3ZGLA 2WLIB 1OV4A 5EMJA 3VYUB 5F77A 4NQED 1B0IA 5J9PA 4XCCH 1UAYA 3FUDA 4S1TA 3RS2A 1PK7A 1KS9A 3D0LA 1U7WA 3WLOA 3ZTYA 4LF3B 4KQKA 1RP1A 5JNYA 3JQFC 1UBSB 3PHSA 5L7YA 2XN2A 1FYDA 1GHFL 4U6HB 4YCSA 1WAAA 3O8DA 1KTLB 1TCAA 3UZEC 2WC7A 3ORQA 3IMTA 4YSAA 2FKNA 3HJRA 5JSZA 1P7PA 3MRCA 5JPMB 3TW0A 4L4JA 2DQMA 4FHDA 1KJZA 3UK6A 4NFDA 4N5UA 1NJ8A 3HY3A 1CNEA 4PS3A 3GUFA 1Y8ZA 1Q21A 4QNRA 3ZX1A 3ZBUA 5DYTA 2REOA 5CCDA 4D3FA 4YK4C 3UG3A 4MVBD 4ANKA 3FHTA 3HZYA 1S7QA 3E0GA 3FRPG 3MGOB 3FTVA 1TJGL 1U3HB 1BQSA 1KXVA 4WDIB 4ZQHA 3ZE2F 3L7DA 3C60C 2COQA 3CCHB 2B2XH 4QQNA 4DR2B 2ZJ6A 3SDAB 3QVSA 4WF7A 3WKML 1O5OA 1JNLH 1HCVA 4DGUA 2EILB 3MRRA 4UTBL 3R8CA 3W7AA 3BP6A 4NM4L 4EEKA 5J13B 1F0PA 2X23A 2BMAA 1JZHA 4LBAA 3UACA 4KO9A 2AMFA 5K2MA 1FLDA 1IM3A 2ORED 5KJRL 4NFSA 3NJKA 5E4IA 2H7WA 1CYWA 4CEHA 3K20A 4NPYB 3GRUA 2GGSA 1EHIA 2I71A 3JQOB 2BN4A 2A78A 4B60A 1SGKA 4FQHB 1A7UA 1P17A 5ID1B 1SOSA 2O54A 2I24N 1C9SA 1FLAA 1ZA1A 1N2EA 5CZRA 3GA7A 4LS3A 1A7OL 4PJHF 1ITZA 3G5YB 2VDQB 4EZKA 3HG7A 5GWXA 4RAVA 4TXMA 4X6YA 1RT9A 4HKXA 4X6CA 2LOEA 3FPBA 4CBVA 4BN0A 5A3VA 1WUJS 3IV9A 2O8CB 4PJIE 1A7BA 3CS3A 4M55A 2B4QA 5A2AA 4KSBA 2QTWB 4C3OB 2YVAA 3FRPB 3GKZA 3NP9A 4FZ5A 5EE3A 1LLUA 2JK5A 2ZOSA 3T7RA 2IE8A 3PVSA 1XEXB 2RGNA 1AY1H 4EUHA 4BWFB 1OJLA 4I4WB 1WC7B 1UK8A 5BS0B 4M6ML 4X5WB 1NF8A 1Z39A 2X9YA 4OI8A 4F9PC 1T2QH 2Y7SA 3MLWH 4BXVA 2PPDA 3ARED 4F92B 3IMWA 2BP0B 3RYMA 5CLLA 2NY6C 5IG2A 5DT2A 1R8YA 3KYMB 2P80D 2WHEA 3R1GL 4EHDA 4QFBA 4KR0A 1EUCA 1SEQL 2P0YA 2AYYA 1ZLVH 3KQTA 2KWIA 3G7TA 5ALIA 4LSGA 1CTNA 3QIUC 4GC9A 3QUSA 3RY5A 1TT5A 4G0UA 2YW9A 5FADA 1Q1QA 2FEDD 2Z1PA 3V0VA 5IAOA 1P84J 1RPJA 1QU2A 4MHOA 4XN8A 2XOKA 2V7WA 2VABA 5E2WL 1ZKAA 1HYQA 4DNQA 2ESVA 4Q37A 2F5BH 1JKIA 1KG0B 3BAWA 3BT7A 3AROA 1ZISA 4D57A 5FORA 3U7HB 4YHPA 1RXEA 3MRFB 4CLOA 3O74A 1XMWA 3S96B 1Z5NA 4WFED 3NJJA 1V95A 2IPXA 3BDVA 3SZ3A 1LJ8A 3QO1A 3PENA 4AYFA 3R3YA 4OD1L 4BYGA 5AJTA 3UT0A 2W65A 1YDGA 3L02A 2HXAA 3VFPB 5BN5A 3S6JA 1SB9A 1Z9SA 1G3MA 1UXLA 5L40A 5FTWA 1CXHA 1J87A 2H0FA 2I3BA 3ADKA 2VJBA 4QREA 1RFGE 3KJ6L 3P0HA 3SGDH 1IBGH 1M05A 2YNMA 1RSYA 4ZNEA 3GGGA 3NPAA 4CN8A 5ILOA 3K8LA 1JB1A 1BS2A 2D6FA 1DU4A 4XP4L 4OVUA 2VMCA 4N9WA 5KX5F 3OT5A 4M0UA 2GVDC 2Y9RT 4R5TA 3O3CA 1MFZA 3U9LA 4L8SB 5J11B 1HZJA 3IS3A 2XJLA 4R41A 1AZNA 1UXSB 2XNDA 3RROA 3P3SA 3AOEC 4BO8A 2IX9A 3O45B 1ZA6B 3MV7E 3WQRA 3PV6A 1YSCA 4OLWL 3IIIA 1RJZB 1PJRA 4D0CB 3K09A 1B4JH 2VYND 2H4WA 3NS7A 4XH2A 4IKIA 1GKLA 721PA 4Z3KA 4IJMA 4HLCA 4R2GB 2CVZA 3MNFA 4AL8C 1CBUA 5CLXA 4WFFD 3AFIA 2H5LA 4A55A 3OMLA 3ZL4H 4NBKA 2K0RA 4ZYXA 2FHCA 3VDAA 1ZD2P 4ZUSB 3K80A 1ESDA 2GARA 3I52A 3TPUA 2EKPA 3JV5A 3F96A 3V10A 2VLRB 5M94B 4GW4B 1COZA 3ELWA 4CC4C 4PBTA 4I1NB 3RVDA 1A9OA 2DYPB 1N9PA 3PWZA 2ZUEA 3PWJB 5KNBD 3WLPA 3SE3C 3QBEA 1AHPA 2J5QA 3SXJA 3GMMA 3AF2A 2PTVA 3LLSA 7REQB 2QMYA 3OSKA 1X70A 2CUAA 4HXBH 3DXAD 1AIZA 4FWTA 4LFBB 4JO3L 2OP4L 4HDSA 3CHPA 1MOSA 3THOA 3Q8MA 2C0QA 2VQSA 2ZWAA 3L5HA 3M34A 2BNRA 2WZ6A 4C07A 4W9CC 3FHLA 2ICEA 3OTHA 2ARKA 3DMMD 2ZUQB 3K9HA 3MV7A 3QXHA 3EKCA 4KZEL 2EEAA 4NDMB 1GY8A 4HJ0C 3VO1A 1JI0A 1BGXL 4DIFA 1KTDB 3U9TA 3IO3A 4GMSL 1QH1A 3L5WB 1XZAA 1J9GA 2Y0EA 2ZUSA 4PJEB 4PLVA 2JJ1A 2PU5A 2AOXA 3DIFA 3DVAB 3A36A 1JFHA 3B8SA 1Y3AA 2P7HA 3K9FC 1MENA 2EWWA 1WXWA 3GFRA 3TQRA 4H0HB 1ISJA 3OHMB 3L3HA 5J40A 4G8JA 2ZB7A 3WN5A 2L0XA 2ZIXA 5AIAA 2AXHA 4DZZA 1MLBB 2ZONA 1JHDA 2IPNA 3G5LA 1E8NA 1R4XA 3ARDD 4FYQA 1MO3A 2I3ZA 1JE0A 4Z78A 4HZUB 1YZLA 3R06A 4P0TA 3SZUA 4UM9A 4L4SA 1AXEA 1V1MB 3A6DA 1OLXA 2E6KA 5DVLA 3SOPA 1JYXA 4QPJC 2JFPA 2W70A 3QDHA 3EIHA 3IUSA 1U33A 1KAGA 3GSRB 3KL2A 4PD4J 1QWOA 1X6NA 4HSGA 4CDHA 1IRXA 1ZMRA 5KQRA 5CCKL 3EOBI 3NDBB 4DF9A 5FLKA 4BLPA 3ZE0F 4YAQB 3DSNA 4IIJB 2ID5A 1GTG1 3WL5A 3H1GA 1NRWA 4P05A 1LC3A 3HJCA 4UEJA 5MF6A 4YXKH 2QLBA 2CHXA 4GEGA 1IT9L 1LK5A 4APXB 3SYKA 5K03A 4HMEA 3H9SA 2WVGA 4UU9B 3IFSA 4BO9A 4ETIA 1IM9B 1LQTA 5KVMC 1SBBA 3MX0B 1FFGA 1RHFA 1UT6A 3ILVA 1PI3A 2JIZA 2ZAGA 4TM8A 3WMWA 1JR2A 3AILA 4A6YA 4I19A 3RIFF 3Q2KA 1BZ8A 5JAUA 3RDJA 4BUHA 3K0AB 1ZSNA 1LV7A 3OE7D 4LHJB 4HX9A 1U8AA 5FYKE 1P0MA 3O1JC 1MW8X 4JW3A 1P2UA 1QTRA 2Q5BA 5LNEA 4WNJA 3DF9A 2H51A 2H18A 4R9VA 1UAAA 4MJ4A 5EU6A 3RG1C 5IB5B 1R5OA 2CJWA 2RGDA 1OVZA 5C07B 2GFBB 4UD2A 4MWOA 4YLEA 5JANA 4RETA 4UILL 5JWRA 5EP2A 1EK2A 4ZDHB 4HUVB 2QT6A 4MLZA 3FLEA 1NAKH 2IANA 2ZTLA 1M7UA 3TRJA 4J43A 3O4OC 4Z0NA 4YV1A 4NI6A 5L95A 2O3UA 1FG2A 3C87A 4ODXA 1JJFA 2NTFB 2N59A 5EO9B 2OOKA 1NLFA 1T1WB 3JWOL 5KBKA 2K4MA 2DY1A 5G0UA 1WFTA 4I0CC 2YBRA 3DK0A 2E7LA 4CQNA 3NH6A 1MQ8A 2OCLA 3MJDA 2K45A 4BRWA 1HSBA 4L1TA 2Y7LA 3EJ6A 3H19A 3REWB 3S8FB 1XCPA 2ISQA 5ADHA 4KXAA 3WLWD 2Y77A 3A6EA 5ADPH 1CDUA 2QADB 2XW6A 2ZXEB 3IKMB 3V46A 2MWCA 1PZCA 1X19A 2PTTA 4O2RA 3GLFE 4G0MA 2CQVA 5EIHA 3T8YA 4LCWB 2FSEA 3VB9A 3G2MA 3RC2A 3FR7A 3DVNB 4NZRH 4F7CA 1PKQE 1YI0A 2HWKA 4JJ5B 4FQXA 4C6TB 2XV3A 4JN2A 3TA3A 3ZI4A 5LZ9A 5TARA 4JFEE 3RUHA 1WX1A 3PDWA 3A2NA 3L4TA 5KX5A 3ALPA 5FYJH 4TNWK 1OT4A 3I58A 5CK4A 2JLAA 4LF4B 4DUXA 2I6XA 3QLUA 2WQAA 1G6VK 4W7HA 3A2KA 3QYNA 4D4LA 1F7VA 1EDQA 4FQ1L 5FL7A 4UM5A 5FPPA 2WJGA 3Q8BA 2BSSA 3VU8A 1U8CA 4YHZH 2ESVB 3UL4A 4X99A 4ENRA 2CCLA 2XNSA 1NLDL 3QUBA 4QPPA 3WGNA 1GMEA 3K1AB 5M04A 4NF2A 4DGQA 2B77A 2F43B 2WFLB 5HHNB 5HOQA 1QPXA 4YC2B 3ML8A 2YHAA 4AZWA 5HDRA 2K5UA 3IQIX 2XA1A 1OWWA 5I6MA 3LFUA 5SWZA 2JZOA 2O2HA 2PPVA 4HGWA 5H37H 4L9LC 1FFNB 4U1HB 1WW2A 1WB4A 3NBNA 1DDIA 1EO8L 2AOUB 2CJUH 2PKRA 3GHEL 1S01A 5ENZA 4KNVA 3A31A 3ND6A 5DTEA 3PFUA 4KKBD 4JIMA 3BH0A 4G59C 5EBGA 1BHQ1 1WUTA 1X80B 1AC5A 3WG7B 5K3BA 3H17A 4WFEE 1H6EA 3MRLB 5EJIA 4QT4A 2QVXX 1EBUA 2Q0XA 4NJEA 3IS1X 1KOLA 4IH1A 1TJMA 1ZRNA 4V0ME 1KQFA 3U6BA 1A2YB 3JVEA 3Q6GL 1H1LA 3KYDB 4UARA 2JKVA 1OSZB 2EFYA 3L3DB 5FO1A 3ADPA 4RGMC 4XODA 5F78A 2OSVA 1IULA 1KBBA 1NCDL 1QKIA 3H75A 2QQKH 3HVDA 4Y9DA 4L5AA 5I45A 2C61A 3W77A 1CWVA 4KCGA 1M7XA 4RZKA 5C07A 4FXGA 3HGTA 3KYOA 4E9LA 4RTQA 4HGRA 1O0CA 2OE2A 1JR3D 2AW3A 1OAZH 3LWDA 5EMKA 4C3UA 4X5QA 1QZNA 3IQEA 3PBKA 2XF8A 1FBNA 1L4LA 3OAYH 2O5VA 2Z3VA 4DKEL 3FRPA 4KMTL 2P9YA 2AQ8A 5IQ9A 3I83A 1IK6A 4FFTA 3T65B 1HG0A 1AXSA 3S29A 2O59A 1YVPA 1T3FB 2PYZA 4QGBA 3N8NA 4CM9D 3ROOA 3KPMA 2AF3C 2L7JA 4BGLA 5E6IA 4NZMA 3KLHD 1WY7A 3IUEA 4YMPA 5EUKA 1UH5A 2X42A 1KJ2B 1XR9A 4NFHA 4UTAH 5GHWL 2H2SC 1KYWA 1LQ2A 4RKFA 3POCA 3FVRA 4IHJF 5KSZA 4K9EL 5I19H 5CD9A 1UM5H 1AVTA 2I22A 5F5NA 4E3WA 4G6FB 1FNSL 1EHAA 4Y1AB 4FDUA 2ZW9A 2VDMH 3PGFL 3EGDA 4ZOEA 3ZKXC 4TYUA 1CXKA 2A6DA 3RLSA 1MFEL 2FPLA 1X1DA 4EXKA 2B3DA 2YS4A 1PJSA 4L4RA 5FOBB 3K70D 4S2SB 5MEQA 1DVQA 1M5RA 5IT5A 1MI5E 1HXMA 1HZHL 5AW5A 1QD0A 4Q03A 3M5CA 3T4PA 5IVXF 2EICA 1DBML 3JV0A 3AM1A 3QKRA 2ZP8A 3K31A 3C74A 4OUOA 3F5MA 4DTIA 4JLPA 3QEQD 2IDCA 1TCUA 1S7QB 3RTLA 1JJAA 3HCDA 3GVCA 5C0BE 2CNWA 3BJZA 3JVVA 4Y9TA 4KDVA 4L5FE 1TENA 3WTVA 3QPWA 2OB1A 2F6RA 5AJVB 3OPYA 2MU1A 5CVTA 1M0EA 3VGJA 4GG6E 4NC2B 5JC8A 4PLJD 1GEGA 4QUEA 5G4NA 4QUHA 3HZVB 1Z8NA 4X7TB 2QPLA 4JLDA 1SUBA 4ZEWA 4DQAA 2XVGA 2V5RA 1JDUA 1E77A 2WAQA 3DFFA 3I9V6 3I04A 4P3NA 5INTA 2C82A 2ATKB 5BURA 1QLWA 2A6JB 3QQ3A 2OMTB 1GVIA 5IB3B 1LEKB 1KIFA 4FDAA 3CHOA 3U79A 2CLHB 2DY2A 2OORA 5L6YH 4H18A 5BSRA 4I1YA 1QMPA 2RHGB 1I01A 2RBKA 2CKNA 4HDIB 4NAHA 4LTDA 1YVUA 2C2XA 2YV3A 4ZUWA 2I2DA 2WVVB 4EEXA 2QPFA 5HHPA 4X0KB 2VBIA 4P5DA 4E0BA 2MR5A 2Q5EA 1BG9A 1MREH 3LPOA 4DA9A 5A06A 2IH1B 3MF4A 3WE7A 5KZCB 5AKEA 3AG6A 1W4BA 1GTL1 5GONF 2E5LB 4OM7A 4E4RA 4DCGA 2PSFA 4NSKA 1YB6A 5K9OA 1QUNB 3MV8A 2VDWB 4PXYA 3JQPA 3WHXA 3T0EB 2VDKB 3MJRA 4FCAA 4J3OD 1Q7GA 3PEUA 5EZIH 3U4HA 2WJVA 4ECEA 1JZFA 4CEIA 4GLBA 3WRXC 3QEGL 1NDMA 1LBHA 1D0SA 2E37A 2CEKA 2GAOA 3LHIA 4ZMAT 4TKUB 2MFNA 3HB5X 1MFBL 2AVGA 4W5JA 3WOHA 4ALMA 2KKQA 4FYVA 3QFJE 3C08H 2CMKA 3EVZA 3GB7A 4Y88A 1HHIA 1NYTA 4CCWA 1QVOA 3TPZA 1OT2A 1I36A 4M1OA 3OZWA 4KPEC 3WNBA 4M37A 3EYVA 1GGNA 5CGYD 3RIEA 3LPMA 4RISL 3UC2A 1L0QA 5I5EA 1GKEA 1G0OA 2X8WA 3GEWB 4G5SA 3DUFB 1NYLA 1KEWA 3V79C 4R7NB 1U30A 2FEEL 4XNUL 1AGYA 2IYTA 4O2BA 1G9XA 5JJKA 3QP9A 3DX0A 4I18C 3FJOA 5AW1A 1ZUNA 2PU7A 3UZVA 1QZUA 2Q0ZX 4PRNB 3KELA 2XFXA 5SWZB 5DC4B 1A3LH 1E3JA 4TSCL 2HSEA 3KCWA 2H4JA 3P3RA 4YHPB 3HFSA 3OGCA 4J3VA 4ABUA 4RQUA 3ES9A 2FX5A 1N7JA 3JRWA 2PG3A 4J4PA 3CSSA 3V6MA 1NNUA 3K1DA 4UB0H 4M8KA 3U17A 2RTTA 5FWRA 1OXTA 3S2CA 2NY6D 4U33A 3S0PA 1M2OA 5E6SA 1BE8A 1TEGA 3BMCB 2YQ4A 2GXUA 2G60H 3WI7A 2P6MA 1HEZB 2TMDA 4UE3S 35C8L 2C42A 5C0FA 3S35H 4P4KD 3G6DL 1KB5A 1OXKB 1DVUA 4FXPA 4CLRA 2W0KA 3TN0C 5KMGA 1C7RA 5CB8A 5KNCD 3BAEH 3JQBA 1VCOA 1U3HA 3UTZB 1DQNA 2AXQA 2OMXB 2PLWA 2OXHB 3P73A 3CMOH 3T5WA 4GEKA 4V0KA 3SD7A 2JAOA 4FGSA 1S7TA 3OQHA 4V1DE 1SC4A 3V80A 4WKNA 5TH2A 4WV1C 3P2DA 3AR5A 4JHZA 4LSUL 3UJ6A 3P9CA 4PLNC 3QMVA 1X1TA 1NX6A 1ZS2A 4GSRA 2YIMA 2BIMA 5A4JA 4JRLA 3LY6A 1OMOA 4MDHA 1N0HA 4FDMA 2P6PA 1TSRA 2CT8A 4XGKA 1L0YA 3VGAB 4NQXA 2HFFA 1Z63A 4K3HA 1NKRA 2GO7A 1S1CA 2EADA 2IP4A 3A1NA 4ZW7A 3WBFA 5IN4A 5EEVA 1G64A 4CE6A 4YHHB 2QTMA 2OQJB 3F5WB 3O4LA 1DOHA 4BNGA 2X9XA 2CVHA 3VKVA 2ECKA 1CK0L 4Z2YA 4Y0AA 4ZDKA 2YZ7A 4QXMA 2PGAA 4PREB 3WKYA 5DKFA 1Z6YA 4IILA 3QW4B 1YPZE 3QFDB 1ZVJA 5C6WH 1OR8A 3NCMA 3TV8A 3B7SA 3QH3B 2BNQD 2BT4A 3UYPB 2CIKA 4BUGA 1C8KA 5H3HA 5K2OA 3BTUA 4RQTA 1Q0TA 1L5GA 2CKBH 3FF7A 4B5EA 2YASA 1V7MH 2EEFA 4AKIA 4F8TA 3W11C 3GRYA 1IZKA 3L79A 4LPSA 4XZ4A 3EH3B 1NEZA 4M9OA 3TBSA 3ITEA 2YGPA 4WI7A 3PVCA 1JWAB 4UIKL 4EQ3A 3UWPA 3W9UA 3Q4GA 2CD7A 3W6UA 4OKNA 3U7JA 2XVLA 3RRQA 5FUZH 5JDJA 3OP4A 2KLSA 3CFMA 5IJXA 2V5SA 4DQOL 4PGDA 5NULA 2YVQA 5I24A 1KZYC 1KOAA 5GJTH 4IRSA 3GH3A 4RF2A 3D6FA 3PJEA 3F6YA 1IGIL 2CUHA 2NXYD 4MDJA 4UUBA 4X42A 2PLFA 3BHIA 4KAXA 2H9GA 2OMUB 1RUPL 3MGBA 4FYJA 3D69B 4XCNB 2PUQT 2R1VA 4DDWA 2I55A 4HATA 1R37A 3IWVA 2CXQA 3HAEG 2HG0A 2VLJB 4KX7A 3NASA 3T04D 4HEA6 2H06A 4JQXC 4L2YA 2CHEA 1KN2H 1HWHB 3S7ZA 4NHUB 5EEZA 3NCYS 2RJOA 5EVCA 3DD1A 3FHAA 1XF5A 1PG7X 2CAKA 3U1QA 2EF1A 5EWJB 3INRA 3ARFC 5DJAB 5B1IA 1AKWA 5EO9A 2DQ6A 5B39G 1A7QH 1XDZA 3A6FA 5F6IC 2X2HA 3WS3B 2ZS9A 2FD6H 1D2OA 4AL4A 5EHXA 1KNOB 3PG2A 2PQ0A 3HPJA 3IFOB 5FI3A 3ILPB 1XIWC 4PJ6A 1XRQA 4E4TA 3H1EA 3HN7A 4ZYYA 3BXNA 3ORJA 4ANUA 1P9RA 4BO7A 3I01A 2D0IA 1KCRH 1FPTH 4TSAH 4XYGA 2ZKHL 4MDIB 2BP5M 4NC9A 1RZFL 3T15A 1QNZL 2I4NA 2W2PA 3L6CA 5ANHA 4OY9A 3AR2A 1Z9LA 2AV6A 1ZTXE 4N54A 4LK3A 3F97A 1SOQA 4G0NA 2LIPA 2O8BB 3V0WH 1CZKA 2DFDA 1E4OA 3L0IB 3Q6MA 3MMSA 3VTFA 2ZSAA 2JJ8A 1EEYB 3LT0A 3ZH2A 1NE2A 1G291 4WXHA 5CLIA 2WXNA 5B4MD 4XD7D 3OETA 2MSNA 4Y0VA 1IWBB 1PSKH 1Z68A 1QKZL 2CDEB 1GG9A 1ENOA 3CC8A 2GPJA 4LHEA 1JEJA 3AZUA 4E14A 1ST2A 2VLJD 5E9DE 2MYNA 2MJWA 1Y3BE 4CKEA 3EPKA 2G4LA 3C4QA 2NUAB 2FBOJ 4F1SA 3ND8A 4JI8B 3D8RA 1DL5A 4RMNA 4AM8A 2RJNA 3LKPB 2X6AA 3HDTA 3A1VA 4J1NA 1H23A 3OB8A 2PWYA 4JJ6A 1JVKA 3CWCA 3FHEA 5FO7A 3GKWL 5IUNC 3O2QB 3MEQA 421PA 5JYBA 4ODVH 4PZCA 3ZW7A 1CEXA 3TLXA 3IMCA 3U1VA 3EA0A 3S5UA 1JK9B 4R4BB 2WJHA 4Y19B 4Q1CA 1HA3A 5A0VA 1V5JA 4MJIE 3IQDB 2GB2A 1BROA 2AZXA 4ANWA 4MS3A 2MHAA 2OENG 4JYAB 5ERGB 3QF4B 1A14L 2OZEA 4B9AA 3UUEA 5CHYA 3NZ8B 1NTOA 1QSZA 3OC0A 3WZMA 3QI2A 5FX2A 4Z1MA 1KIAA 4X5LA 1GPH1 5T57A 3CFUA 4CBZA 4ARVA 4K3JL 2CNYA 4XNMB 4R96B 5J6SA 4YXWA 1Y1QA 4HIEA 2QR5A 1AGCB 3IMUA 5FTNA 1PG7L 4NZOA 2VO5A 4BUQA 1DC5A 1W0KA 3NJFA 4QBKA 1IJBA 4ASUA 4M62H 1US8B 1RNLA 4NT6A 4M6WA 3ZU4A 4QXGL 4OSPA 1F4WL 1EFCA 1OARL 5CGMA 4IU2A 2X09A 5IJZA 1UKBA 2EWVA 4G6ML 1VE5A 3EG9B 3ZCVA 2CH8A 3P2YA 5DRXA 3GUUA 3AFLA 3GHHA 1C9DB 4MUNA 4US2R 4N86A 5ISZB 3LRSB 2DQJL 3WNCA 3PWJA 1QBMH 3PREA 1N18A 3NJ8A 2EQDA 4X84A 4KTYA 2Q4RA 4LVHB 4ZPVA 2NVBA 3OESA 1OTUD 1OASA 3AQIA 4IHOA 2BSBA 3CT4A 2B34A 2PGXA 5DWPA 4KFMA 1CQIB 1Y3CE 2WTOA 4EUEA 4JWKA 1YUKB 4OZGE 3PC6A 3P9NA 5ES3A 1GS8A 4B5LA 2AXPA 3ZE8A 1JGLH 2XVYA 2IFTA 1Q1AA 1QRRA 3DDHA 4M60A 3U7QB 5AOMA 1R0RE 4HQQL 4KMQA 3VTAA 4X5XB 2TAAA 1UZAA 4YHYB 3HCAA 3U30B 3N76A 3U9SA 3VFUB 1ZLYA 2W2XA 3PV6B 2XPCA 2ZCUA 1G5FA 1NGSA 1PQUA 2J09A 4P23B 2K4AA 1XDBA 4GC5A 3B13B 2Z7WA 1X80A 3I45A 5FCDA 1O94A 1O7SA 3QDJE 5C0CE 5E2TH 3BGIA 1JAHA 1GCOA 4MXDA 1YMMB 1WJ3A 5HVWA 3C2AL 3AEKB 5AKZA 1CQIA 3L45A 1DQIA 1BZOA 4XPFL 5E9DB 5ADUS 3G59A 3TD9A 3ASYA 1KC3A 1A9EA 2QLTA 3ZE1E 1PNQA 1IKFL 2OESA 3MB5A 3M1AA 3SQBA 1NVKA 2NSXA 1H66A 2CHVA 7PCYA 3DO3A 1QKJA 3DWTA 5CH5A 4XCEA 4DLLA 5CA0F 3FWYA 1NGWB 3KAPA 3LNDA 1M42A 1FDWA 2TSYB 4ABTA 2W80C 4IMPA 3G5WA 2BP8A 3P20A 1DVRA 3NJRA 5J6GA 3OZEA 2I6GA 1HT2E 3ZK0A 4FABH 4Z7JA 4FQLL 2WAYA 2XMGA 1XK6A 4HWTA 2MYTA 1MIHA 3FO9A 4GJTB 3V6FB 3N42B 4FUQA 3SGDI 4M6NH 3WGKA 5FNVF 3RVWC 4FOLA 1FFXA 2I78A 1WCQA 1AKJA 5TPWB 1W2GA 2VZVA 2VR5A 1L7IH 2IDFA 3UYRL 1LPNA 4FZRA 1PZ5A 3DA0A 5F9AC 2OO3A 4D0LB 1V37A 3FN0H 2IIBA 5HQ3A 3E9NA 3IOEA 1I85A 5LWYH 3KJQA 2YWYA 5LYYA 3RZCB 5BV7L 3GF4A 1UK6A 3GR6A 1XGPA 3CTTA 4K5OA 2H52A 5AYVA 1RMFL 2D0FA 4DMGA 2BC4B 1YB1A 2W8BA 2NCEA 4GAAA 2PBZA 3HNSH 4FMFA 3IERA 2H4ZA 5D3ZA 4EK9A 3HFFA 2GSDA 5KYWB 1HF3A 3E53A 5EESA 5BT9A 3WRXA 4O58H 4EQ6A 3RU9A 1GZ4A 4ODTH 3MTIA 4M46A 2H63A 4K2UL 3OBIA 3AUKA 3FN3A 2VMDA 2VHXA 1R15A 4JS0A 2OSXA 4L9SA 3B2VL 1TPYA 2HBRA 3DE3X 4ODXB 3IBGA 2E0PA 2NZIA 4EARA 5K20A 5K6TA 2P6RA 3V5HA 1TZMA 2D7OA 3K4DA 2Z4RA 4HV8A 1EGQA 2J2ZA 4Z18A 3QFFA 2ITDA 4RIRB 2RJMA 3GMRA 1E40A 5E9JA 3DX4A 1PLLA 2J3KA 3FLMA 2JHAA 4RZ2A 4B3BA 3Q87B 3FT4B 1A9YA 3PVZA 4W1RA 2ZVQX 3F62A 2NMVA 5HZMA 1VSCA 4FNAA 4BMNA 1TZOA 1BYPA 5HI3C 3MWEA 1KI2A 3KZ8A 1RQXA 3NANA 3P94A 4Y2DC 1X9IA 2QRHA 1AS3A 5ALLA 4OFKA 2VLLA 4TMPA 4ABVA 3KL5A 1E67A 4OMDA 3VQ1C 5LB4A 4UQIM 5DUMH 2IK8A 2VHVA 4G83A 1CC1S 1I8TA 5C7XL 4EJ6A 2IYOA 2AOWA 2BI7A 2H1RA 3UJCA 3E6AA 1EX6A 3FAKA 4GZ3A 4OF0A 1ODTC 4MNQA 2D7TH 5DXWA 1IYZA 4CI9A 4MWEA 4ZJUA 4NHOA 5EWLB 3LRMA 1KRWA 4HEHA 3AB0B 3TINA 4ZQKA 1CIUA 2F08A 3EDOA 5JOFA 2Z58A 1NYRA 1R6TA 4MTCA 3CNOA 4YVUA 2R4UA 1ZH0A 3HLTA 2CNNA 5D3MB 1XF2A 5A02A 1UMKA 2FQQA 1J97A 3VI3A 2C8LA 5AQ1A 4EX6A 1PNVA 2B3RA 2EDDA 2ZGVA 1OLLA 1RVDA 1LD3A 3LQAC 4I9HA 4FYRA 1WHTA 2DEXX 4L1KA 4O2AA 5CILL 3IO5A 2C9BA 4G0QA 4B79A 4OT1H 4WV1A 1N3BA 2NU8B 1KYIA 1XVLA 3G08A 2WKWA 2UDPA 2AXJA 2Q4DA 1HZZC 5F3WB 3S5LB 3E9MA 5LQDA 4U2YA 3PNYA 2XNAA 3B9EA 1GTFA 2EEPA 3OF5A 4Q6IA 3IHKA 1JQ5A 5JXAH 4MCZB 1YJAA 1GUFA 2B14A 2QMOA 2AG1A 2WFZA 3QQ9D 3DURA 3C97A 5E6ZA 4E3ZA 1E9PA 3WNZA 2O5XH 1SOKA 5JATA 3L8FA 5C3UA 3MW8A 12E8L 4OHCA 4QG3A 3MUY1 2Q0QA 5EQJB 1G1AA 2XZAH 1P7QB 2VJXA 3L1OL 3MFQA 4GG6F 4OFBA 4XWGL 3I9OA 4KB5A 1UEJA 4F85A 3DIVA 3QRWA 4ZW6A 2R8PA 3PWLA 3GXMA 4QXTA 2VZSA 4GP9A 3D7KA 2EKZA 1WUHS 3LVRE 1CE1H 2P7IA 3DX8B 3B2QA 1EXVA 3E1F1 3TJHC 3ZQ6A 4NBZB 4DGVL 1IAIL 2UZPA 3HS9A 2BFFB 3MG9A 1PT6A 6YASA 2GSIA 3GMLA 4GQPH 3IPCA 4TWAA 3TLZA 5EC2B 5F1IB 3H5NA 1JJVA 2JDIA 4Q3AA 4MQLA 4QBFA 2NMSA 4YXLH 4AEIL 3H9JA 3QG6B 2TMGA 2DYPA 4URXR 3RU8H 4TL8A 2H9YA 1JWUB 2VE6B 2GC4C 3A3PA 2ZUYA 3DEJA 2J56A 1OIVA 1M6YA 4YBQD 3QZBA 3KPMB 3VV2A 1JG6A 3C3BA 2X3AA 4O5LH 2G9QA 1SBZA 4HLUC 4HUCA 4LKCB 1ORSA 5AZ2L 1EA7A 5FCUL 4BMVA 4HIHB 1M6OB 4P2OC 2X2PA 1VFBA 1BSVA 4KQ3H 2VHCA 1RMTA 2R87A 4YJKA 4RD3A 4NBVA 3G3EA 3EFDH 2FW6A 4RF4A 4I55A 4AZ3B 3OWOA 4RMRA 3NCHA 4ENWA 4KR2A 4NO3B 2H5JA 1K4DA 4MICA 3MUHL 3FW6A 4FC3E 5JMOC 2HA2A 5LMZA 5LIPA 3KJNA 4MXVE 3NBFA 4C0HA 1NW5A 1QFUL 5L9AA 3VPAA 4MXWH 5FA4B 3U0PA 3TWCL 4FFNA 1XOIA 4V0OA 1WC7A 4PN3A 3Q5YA 2WICA 3P9IA 4PG4A 1GG8A 5DEOA 4ZYKA 2G36A 2YPLD 4BKTC 1NGZB 4COOA 4CSZA 1I6KA 4V2UA 2PV0A 3NSFA 1BWMA 2ZKLA 1T1GA 2A4KA 4MQXC 2JH8A 1MG0A 4ORZC 5DFTA 3E23A 5KSVA 4KK3A 1P84K 1ZJYA 4Y67A 3S48A 2A4EA 5G0VA 1J39A 1WULS 3RQIA 1H3PL 5LCVL 4HWSA 4DF3A 3H2KA 1QSED 1GGIL 1H5BA 3NLLA 1E89A 4M7JH 4ZO7A 1T7VA 1BZ7A 4NAUA 3HGQA 5M5BA 4OLXH 4NK4A 4PPGA 3WK6A 1PL8A 4OZIB 4MCJA 5FULA 1G7JA 2A0FA 3P02A 4WO4D 1RKRA 4NNPH 2IH2A 1J0HA 3D6GA 4LLAA 3QHAA 5DW0A 2E27L 5C08E 8GPBA 1XGYH 2YZKA 2ZSKA 1GQRA 2RGXA 2IBTA 1LE5A 2HTLC 4UOJA 1KXVC 3KR0A 5GSRB 1UD6A 3ZLTA 1ZD5A 3A6BL 3ELDA 2C77A 2RIRA 4JKOA 5CF3A 3I2GA 5G0TA 4KRGA 3O8QB 3IPLA 3P2KA 1OGPA 2Q5QA 1ANUA 1G8AA 3P9MB 2ZCZA 2D5CA 2BF7A 1IO4C 1CLVA 2ZM5A 1XRLA 2OBGA 2RONA 3FAWA 3PWVB 4LJ7A 4FYPA 3SQOH 1KELL 4OKIA 4UUQA 4AH2A 5EUCA 2JGMA 3S99A 1D9ZA 1XF9A 3D0VB 4KKXB 5TE4H 2PTTB 3P1VA 4DLTA 4IIJF 4MI6A 1KR2A 5I5IA 1E8YA 3BERA 3DZJA 1KPRB 3TIDA 1D2EA 1T0PA 3JQAD 3KZ1E 3H4MA 1VGKA 3V7WA 2GRJA 3AB8A 3OX8A 2VNJA 3CN1A 4B6ZA 4DPRA 2QG9A 3VHXB 4GUOA 1WZUA 4TKWA 4Q6IB 4C0BA 3K5RA 2GCIA 3LT1A 4F46A 1A6PA 3UOGA 5GSVA 4P9HH 1R6XA 4WN9B 3L4UA 3HZKA 1BFKA 2GSMB 4FEMA 2XH8A 3A58B 4JYCA 5JW3H 3P9MA 3ATEA 2C59A 3NGLA 2ANCA 4PS4H 1DBBH 3QWRA 4LLMA 5HE8A 3VQ2C 4MTMA 3QF7A 1AG0A 2L2QA 2M6KA 4Q6IC 3IGAB 4TMXA 4H0FA 3BPNC 1P7YA 3FQWA 2FWMX 4KBGA 3AYXB 4Y2RA 5ICZA 2M6LA 1I4DD 3KLLA 3N8DA 1G87A 3HBFA 4MEAA 3GELA 5FW7A 5LHDA 2H17A 3PWSA 2IMNA 4KFZC 4RGOL 5F71A 2ALJA 3L6DA 2BVPA 3L6BA 2PGOA 2PZKA 2REBA 1WSAA 1A6AB 4MWBA 5J2TB 3HUJA 4CMEA 1YN7A 2MRYA 4CM9A 2YWZA 4FOOA 1ZL2A 4IEEA 2R68A 1TNNA 3MCLL 3GWGA 5C09D 5HYJD 1JLKA 4POUB 3ELAT 3QNZA 4IBWA 3CKKA 4G80B 1JPGB 1USIA 2W6PA 1W72A 2ZBVA 4KXMA 2BWIA 3CB4A 1IVYA 1BHO1 1Y3DE 4N0RA 2ZI7A 3KPSB 4PRPB 3N2ZB 3CDFA 4QGHA 3UBMA 4ZHQF 3KYNB 3P4LA 3O94A 4N6OA 1ABBA 5ALUA 1Q9KB 1WCIA 2I6UA 2C5DC 3WSTA 3WQBA 1JYVA 1GGFA 5AZEH 4FFRA 4Y2DA 3F7OA 4AZ0B 3Q3GB 5FYJU 1RPTA 4M6MH 5E4AA 4JQIA 1DWPA 4Q14A 3ULUH 4LYFA 4QKQA 4OIBA 1I9JH 1DP4A 2HN7A 1RBZA 1A4JB 3GPEA 1P81A 2HL6A 4HRYA 5AD0A 4FDVA 2YHGA 5FOSA 1WS8A 2O07A 1WT5A 3N0AA 2BGUA 2OBFA 3LPGA 5DT1L 5JVDA 3ZRSA 4NUJA 5IGXL 3AI2A 5ALMA 3PFCA 1S7TB 1OYVA 4CMHC 4DLWA 3EY9A 1PHPA 4AX3A 1J0BA 3QFCA 3FSJX 5TC4A 4YQFA 4A2CA 4UEQA 3BJIC 4BH7B 1U93A 2ZTSA 2NXZC 4JLKA 1ZGGA 2RGNC 3PGDB 2REQB 5HTOA 1YSOA 1I4WA 2DCMA 3Q8EA 2YLHA 4GT7A 2YWGA 3MD9A 4J3SA 3PIRA 1RCUA 3EIEA 4CA4A 3HZRA 4YCCA 4NYMQ 4RSMA 1SXHA 4WKPA 4PINA 3DXAB 1GY2A 3V6ZB 2WYIA 1OZFA 5JA9A 4RY8A 3ZGYA 1JFRA 4I66A 2DLEA 2GFHA 1FNNA 5E6SB 1L6PA 2XRZA 1T2DA 5HIIA 4HLZG 5DHSA 5FDYA 5DD6A 2WTPA 3CPLA 3UJHA 4PP1D 4OBBA 3GGCA 1XIVA 4MQBA 4BOYA 1SBTA 1WVIA 3FSGD 2GXAA 1L1QA 4X6FA 3LQKA 1ZV5A 1TJXA 2WZDA 1GPMA 4O0MA 2DKFA 1ETZA 3I5MA 1YR3A 1NWHA 3P2EA 1KEML 3HPRA 3X1WA 1P6UA 4Q9KA 4NNJA 3W2FA 1KK1A 1FFHA 4NUPA 3VD5A 4RD6A 3SXPA 2HYDA 3M4JA 3T6QC 5DU7A 4H1UA 1EMDA 2R8EA 4ZPXA 2M98A 5FYLH 3NBZC 2IPTL 2JF1A 1A7RL 4PBDA 4INPA 2YMLA 2CNKA 4EN3A 1VJSA 2A57A 1XDSA 2WHRA 3CPUA 5ELIA 4YNBA 3NGBC 4LCWE 2Q7AA 2UY7B 2VSNA 5DDHA 2IEBA 1KARA 4OREX 3WQSB 2Q1WA 3D1JA 1BMFD 4KUHA 3FVWA 4G5FA 1T3SA 3MUZ1 4MJXA 4U7KA 4ECNA 3RAJL 1DVTA 2ONKA 4G36A 1BJMA 3O3NB 1NDMB 1FS5A 4OLWH 3SG0A 4KU4A 4X63A 1ZAYA 3MMPA 2Y05A 4DZBA 1O96B 3PDGA 1Q44A 1J8SA 5CM2Z 2I1WA 2OPBA 1K7EB 4LRIA 2CF5A 3O0TA 5IVZA 3MQFA 1Z6XA 2OXCA 4BMZA 5KSBA 1JT2A 3ZCPA 3F64A 2JNZA 4DBVO 2V7NA 5ADOL 1U92B 5EHZA 6FABL 4ZMOA 3KXLA 4W8OA 2NY0D 5HHTA 3JWIA 5JR1L 4A0GA 3WEOA 1QRDA 4X90A 1KLGB 1KBVA 4PCKA 3SSOA 4I5BA 3SPIA 2XEDA 1LWNA 2NY3D 4JX8A 3VKGA 1X5AA 4LEXH 3VM6A 1RPKA 2XA8H 4YCMA 3VA6A 1C1EL 1HL5A 2X12A 4KI5F 4A7TA 4JKKA 3T0ED 5FHBH 3L4XA 2YINC 2A5FA 2C3VA 1KOJA 4J1QA 4X6UA 2JV6A 2YPVH 2HRGA 4LARH 3EC2A 3US1A 4BKSC 3HYRA 3DTXA 1PQ4A 4OLFA 5C0OE 3KYCB 5KTEH 3VNYA 3A6JA 2APVA 4Y6LA 1NI5A 4UMDA 4AP6A 4AQAA 3AB0C 4ND4A 4PLZA 4IU2B 2OGTA 4LMBA 4X93A 4PRDB 5F21B 4BYMA 3FH7A 3CURA 1XNGA 4KK8D 4M93B 5T64A 2GR9A 3RAJA 1VGEL 2PO7A 1N0XH 4AWBA 3VDCA 4J4TA 2OI9C 4X8LA 2H3HA 1P7QD 1C0LA 3FOLB 1XX9C 3IDMA 2FY8A 2WWGA 1OZ0A 1S2MA 3ZJAA 2RAPA 2HX7A 4KZPA 1I6MA 1TQCB 3WL6A 2ZXUA 4U1JA 1UFKA 1KBZA 4WI1A 4F7TB 4QU0A 3QMMA 2CRYA 1X6VA 1YI1A 3I1JA 2R85A 2GM4A 4QKTA 2EXTA 3RWEA 2OD2A 4C47A 3BIWA 2XB6A 1TJNA 1Y0LA 2J0QA 5A7HA 2AZDA 4OCNC 1G9NC 5F7AA 1U3YA 5I1EL 1Z3GL 4XAWL 1PYWB 2YRPA 3Q48A 1JDAA 3E5RA 1DRJA 4I9UA 4QVGA 2HI0A 1F42A 2XIBA 1TGVA 1HE4A 1DUSA 1EA9C 2XVBA 3QW9A 3UO8B 5FPQA 1GZVA 4F2ME 4HDNA 3QUZB 2CHDA 1R47A 1EDEA 1NZFA 4YMIA 1JS1X 1MI5B 5IYZB 1GW0A 4TQIA 4PBSA 3IJRA 3APNA 4NOLA 2IGFH 2VRKA 1V39A 2QROA 1OAXH 1Q5PA 2E6PA 2HSZA 4ZCTA 2DJMA 3WOVA 4DQKA 2UXTA 5IAGA 5HX7A 3CLUD 1M57B 2UY6A 4TVPD 1RULH 5SZIA 4URHA 1UOLA 2L19A 3FF1A 4RMIA 3REQA 1M0WA 2WVUA 1IZ7A 4LOUD 4QHUB 3KB6A 2J32A 2F74B 3EOAB 5EU5A 1SQFA 3RKUA 4QRBA 1MFAH 3UGEA 2FSHA 3H04A 3SS9X 1QP8A 3B1WA 4B7LA 3CH1A 5I4BA 4FG2A 1MA0A 3L0ZA 4NQVA 3BH7A 1KLUA 4EKEA 1A02N 1P1ZB 5KTRA 2XKUA 1WGVA 4ZVSA 2P9JA 4IPTA 4YTEA 1U8PA 3HMQA 2HJ9A 1VE7A 2WTXA 4K7FB 4PJXB 2YD6A 1Z75A 3DECA 4MJ6A 2NVWA 2NSDA 4QLAA 3BHMA 3N39C 3A3KA 2JIDA 1KB3A 1G8KA 2CPCA 1B6UA 3LIZL 2B1RA 3SDAA 1H2YA 3MUJA 5I8KL 4AJNA 1OB5A 4FYKA 1ZJ4A 4DCVA 1VLZA 2JRCA 4LOJA 4P5KA 3OHXB 1YVEI 1JEDA 2GEBA 5LQMA 2GJJA 4MJ3A 3D39E 3WFEH 1XZDA 3SE4C 3PC8C 4ID9A 1DQTA 1VZHA 5AICA 5TE7L 2PSDA 4DPAX 2Y2YA 4BFZA 1V5IA 1U2DC 4DKAA 3QUXA 1Z2EA 3GTVA 2H3KA 4IXWA 3B9KB 5DI8B 5C8JA 1A1MA 2EJTA 1LWJA 3I9GH 1I1RA 4TOYH 1SXPA 1S5PA 2R4QA 1TYEB 5DO9A 1GU7A 1LWOA 1XMOB 2RAVA 2VIIA 3BSWA 3A9SA 1F90H 2OCDA 3TOZA 3VPBA 3ZPDA 5H80A 3ABIA 3FSZA 4HJ1A 4D9BA 3WTTA 5IAAA 1EP3B 3M89A 3A32A 3UHJA 1YEFL 4K73A 3NM6B 4B4WA 3KGTA 2WLIA 1DG9A 4P86A 1WEJL 2HVJB 2J12B 2MNUA 4LQLA 1IGFL 1F3JA 2N3ZA 5SWSE 4GNKB 2Y0PA 4D2IA 4YGAB 3ALXA 2BP8B 4G81A 1FP7A 3E2HB 3SM3A 2I03A 4MASA 2P8PA 2R1XB 2JGAA 1YA8A 1REQB 2VTKA 2PCJA 2X5JO 1IVLA 4OTXL 1SM4A 4IDFA 3S8YA 2MTBA 1JGVH 4EGSA 3FOMA 2QENA 2CBOA 2D2EA 4W9KC 4FKMA 3FG9A 1FDOA 5T1MB 1H8OA 5I7EA 1U0BB 4YY3B 3V0JA 1KGUA 1GPDG 5IC4A 5JIHA 4C2AA 1TKAA 3IJHA 3DPDA 4OMUA 4KGJA 5D4IA 3AJ7A 1I13A 2WPDA 1FB5A 4LGMA 1IAVA 3K2UH 3QLVA 2E59A 2R6FA 3FUWA 4ZCSA 1EFRA 2NZUG 1A9BB 5D1QA 3ZDXB 1F4AA 1RJZA 5E70A 4CIAA 1MW9X 5AKKA 2E7CA 3LKPA 5EHNA 4RMHA 1QBGA 3D3JA 3AHHA 3JPYA 4UHDA 4TKUA 2QADD 1SZCA 2FUKA 2P3QA 1U2GC 4NQXB 3AEYA 4X8OA 2PH3A 4EHNA 2GAZB 4N01A 4Z7OE 1L8OA 1XVAA 3CNQS 3RVBA 2XVAA 2APSA 3Q85A 5KOJA 1E5LA 1PTZA 1LBTA 2ZWZA 4ZOAA 2A94A 2WUGA 2UXDB 3GBMH 1R4MB 4KMMA 1Z7EA 2DF8A 3TOXA 4UTXA 4IWYA 4AB1A 3H8WA 1OQAA 1E6EA 1FEZA 4KK6C 2VZEA 1EUTA 2AC2A 5IPFA 3VMNA 2R0LH 4JP5A 4DAOA 5F7DB 4YHLL 2BFOA 4B09A 5IQ7H 4DILA 5LOVB 2X1HA 3B3IA 2A9MH 1FZQA 1HL7A 1HXHA 4E5XA 1GJRA 3WO4C 4GZ5A 1VGVA 5DEJA 3HY6A 1E4HA 4AX4A 3BQUA 3AU8A 1RZGB 1SJHA 3GUTA 7GPBA 2CA3A 3TBYB 4RJIA 5FJJA 1RXIA 3W6ZA 1OW0C 2JAUA 1CV2A 4NCHA 2UZ4A 1RBQA 3NCTA 1HX0A 5CIQA 1JV5A 3QVXA 1TEYA 1BVRA 1YEEL 4S0TD 1X8JA 2Z4QB 5T1LD 4PLHA 2ZX5A 4BZ1A 1UBUS 2XWRA 5GZOA 4XCQA 2GEEA 3WMSA 4OBRA 3LUJA 4LQFH 2NLJA 2WWKO 1KMCA 2J7KA 4BLUA 4UBDC 2XQJA 4WTXA 3T99A 3IVKA 2ORWA 2AOTA 2J0EA 4WOJA 1CDHA 3L7JA 3DGGA 2X2YA 4WFKA 1BXGA 1FXSA 3NWJA 2F53B 2ZWOA 4X83A 4ZAYA 3OPNA 4DS3A 5TS2A 3EZ6A 4W8GA 1U4NA 4Z77A 3USZA 3GZJA 4FNRA 4HPWA 3Q1SH 5GZNA 3NIFE 2FR8C 4GT1A 3OZXA 5AVZA 5HOEA 3QEUA 2OFXA 2UZXA 5B1AB 5JDCC 2HT3C 1U6AL 3CZLA 3LH2H 3PNRB 2OW7A 2CO6B 2NY1D 1JLMA 1JF1B 1WRFA 2H4FA 3HUTA 4TMYA 3RUGE 3B1YA 4M2LA 3WDSA 1L5KA 2Q1UA 3VXMA 2GAZA 4GOMD 2XNJA 5I3CA 2K87A 1JZ8A 4GBXD 2FHBA 3L4KA 5ICMA 3Q43A 3AL0C 1D4AA 1XEXA 4HZAA 1ACZA 1DQRA 4NWIA 3AREA 4AKHA 1JF6A 1U91A 2AVNA 3F9IA 1DAFA 1DN0B 1NBAA 1USVA 2I7VA 3PLYA 2ADIB 3ZDZE 1FUUA 3ME0A 1XD2A 1TTUA 1T9GR 1PKQA 4W9EC 4MD4B 1V3JA 4PRPA 1VRWA 3GZTB 1I0IA 1B8UA 2XVKA 4CSTA 5B21A 2AWOA 3KB8A 3KUXA 4O5AA 2M1KA 5A6VA 4G80A 4EO9A 4EA9A 3FTXA 2XRMA 1SWVA 2WLTA 2XPYA 3TRDA 2IWHA 3OKPA 4JUAA 3N0PB 3DSFH 1ECFA 4EVQA 2BHFA 2PSEA 2EYRA 2EKSA 3CIOA 4PSAA 3GMNB 1FDSA 4BA8A 4ERSL 3IV6A 2Q8NA 1RL1A 1YASA 1WM1A 4B9IA 1V2HE 3AP2A 5KVQA 3EGIA 2IP2A 3SYMA 2JSFA 5DZOA 2QL1A 5KYYB 2QYOA 4XOUA 4X6EB 4GSDH 4MVXA 5CB0A 3W2GA 4RGBA 1WZIA 1AUQA 3E0XA 5E1DA 3BCUA 1P6QA 3CNEA 3SS7X 4EPWA 1HWYA 2W9LA 1O6BA 1HFKA 2VRNA 4MVJM 3SU8A 3QWNA 4L4VB 4JJGA 5JH7B 1ONNA 4HT1L 1LPBB 5EIAA 4LDLB 2DH6A 5L3VA 3HB3B 5JSKA 1U21A 3MODL 4HDRA 1IHUA 5HI4C 2XLLA 1BF8A 1IHOA 3ULAB 4G8BA 2IWEA 1DRVA 2QI9F 1A0QL 1PEKE 2Z5LA 3TDKA 2VH5L 4ZT7A 1WIUA 4GWKA 4YRLA 1DLJA 3QOXA 3BUQA 3CU5A 2QD2A 1ESMA 4AIEA 2O48X 1NV8A 4NG5A 1TF5A 3IDAA 4Q16A 3KAJA 15C8H 1AZSC 2HW8A 5DC0A 4G7VH 2FB4L 3WAJA 2OMKA 3Q2NA 1W5FA 2RFLA 4HEPG 5HIJA 1JD7A 3VFMB 3CF4A 3ABRB 3DEHA 1NBEA 4ICWA 3PB3A 3QJYA 1YR8A 3NFNB 2MNWA 2XQ0A 4B80A 3QMPA 3RPIA 4XVQA 1UPUA 2FRXA 3U4MA 5F8RC 2FK9A 1S9XA 3V32A 4BSVA 2VZLA 3ROPA 3VNBA 1IQ0A 4IDCA 2IHTA 5IEJA 3D6MA 2Y6SC 4BAGA 2DFPA 2ZD0A 4NQSA 4WHTA 1LO4H 2VKWA 2VUYA 4MYWB 3QENA 1UM8A 3MAWA 1O8BA 5IVNA 5DLYA 4QF1A 1HHKA 1QYGL 1PAUA 3W8RA 2HMUA 3R8QA 2Q7YA 5IIEA 1NQVA 1A9ZA 1A8QA 4R5HA 3LE8A 2YGVA 3ZWAA 5LNK1 1FAIL 1P73A 4L51A 3K16A 4PQXA 5EO1A 4XBEL 2QN1A 3MTGA 3OIVA 2WO4A 1QP1A 3JWDC 2WWTA 1MVUB 5I71C 1OLSB 5D3KA 1WBZA 1OU4A 4GMKA 1T89C 4HFUH 1HFEL 3KX2A 3V2UA 1D8TA 4ZVRA 4P82A 4PYLA 3Q0HA 2FHFA 1WIWA 3A1WA 2EDHA 1BG1A 4ETWA 3MSXA 1R5IA 1WZNA 3EXFA 2C5SA 4Q9AA 2BS71 5HYVA 4AJ9A 1YU9A 1AOHA 1SDDA 3DX9B 3FDJA 3A9RA 3R5FA 4OU5A 1SHKA 1T89A 3MCWA 1NGPH 2Y06H 4B4UA 4CGZA 5G1NA 1HI9A 4PP1C 1KU6A 2FWUA 1ZWLA 2R15A 3SCMC 3UV6A 4A92A 1QR6A 1UA7A 3DI3B 5JCJD 3D5OF 4CNIB 3CKMA 4W5HA 4HMQA 1FH5H 4LNRA 3Q40A 4ER0A 3QIBA 6Q21A 4YQXH 3HB0A 4CDGA 1E3IA 4HKBB 3DJRA 1NXSA 3PLNA 4EFNA 3RK4A 3UJNA 3UEZA 2Z1MA 1U2GA 3DAYA 3KOYA 3FCSA 1KXTA 3ZHQA 3ZKMC 2CALA 2RGEA 4U7HA 3M1BA 2UZ3A 3IFLH 3X1EA 3TEUA 5IWAB 4YPFA 4F58L 2JLLA 2H65A 4GH7B 4F9LC 4UDNA 2LE0A 1MQAA 1O9VA 5IB5A 3B38A 3P2JA 1C3LA 3FQNA 2FCBA 5DJ0B 3DKHA 3MRXA 4R8KA 4UOQA 2YC4C 2W4QA 1UT8A 3WUWA 4CGTA 4C30A 1GPAA 3CXRA 2QV4A 3I6KA 7PAZA 1J5HA 2BFFA 3T0EC 4FD3A 3RYIB 2EX0A 3RZWA 2DYKA 3S5ZA 4IIHA 5HJEA 1KGCE 4PRDA 1UBLS 2PY6A 2DJSA 2VNKA 3H5LA 1QG6A 4FMKA 3M4XA 4P9HC 1JF8A 4HGZA 4OZHB 5C71A 2EUWA 1A4BA 1US8A 1NMBH 2AMUA 2E7BA 1KMHB 1IN1A 4II2A 2WG1A 5BVHA 2IPAB 2O5CA 4XMVA 5EF0A 1NFRA 1KO8A 4AG5A 1HEIA 2BJHA 4M1DH 3FUXA 3UMBA 4XNQB 2PWAA 3U3XA 4HNTA 4H7PA 5MENB 5CMAB 3WRWA 1WE5A 2VO8A 4E4YA 1A6WH 4G0WA 1IBBA 4PZAA 3T7CA 4UQAA 2ZXEA 3V6ZA 3D4BA 3DKVA 4L37A 1ISMA 4FP8H 3GSUB 4QDXA 1TLLA 1RIVL 5IOPB 4WEMB 3AY4C 1A8JH 3QWOA 2YQZA 2OC4A 5GV8A 1KFGA 1P91A 5B1JC 3G1TA 4OXNA 4OHWA 2EKBA 1NVVQ 2PYDA 4FYMA 3FZUC 4K40A 4LMQI 5CX1B 2HDWA 2EYQA 5EJ5A 1O3YA 3T54A 4C0AC 3E82A 5T3ZE 3VA2C 4RZCB 2AF2A 3DRTB 5I7FA 3ASOB 5EMHA 3S34L 1KO5A 1YEDA 4G6AD 4RRPM 4CAGA 1TG8A 3FU9A 5EPMA 1NDUA 3U40A 3LQZA 3UK1A 5HDBE 1A2QA 5B3JF 3L3OA 3KMDA 1JN6A 2FZ3B 2DM2A 1GYVA 2A67A 1I8LC 1I2DA 4JXZA 2ZSWB 3MLZL 3VXSB 1TQ4A 3FK3A 3KYIB 1ZVMA 4FCHA