5HDBB

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 114
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5hdbB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5hdbB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5hdbB03
1MQ9A 1AUQA 2VDQB 3BQMB 1PD0A 5BV8A 1IJBA 2IUEA 2VC2B 2VDNB 2VDPB 5ES4B 3VI4B 1N9ZA 1XUOA 2XWJI 3K71B 5HGJA 4G1MB 2VDMB 3AFCA 3ZE2B 4O3TB 2VDOB 4JX0A 5KYUB 4O02A 3IBSA 4HQKA 5KYXB 1QC5B 3TXAA 4HQNA 1JV2B 2P26A 5E6SA 4PN7A 3K72A 4MMYB 1T0PA 1XDDA 3ZQKA 3OKYB 1L5GA 1FNSA 1M1XB 1RD4A 2WW8A 4Z7QB 3EH2A 1CQPA 3PPWA 1RRKA 2VDKB 3T3PB 3VI3B 1IJKA 4HQLA 3ZDXB 1MQAA 3AL8B 4IHKA 3NIFB 2NUPA 1ATZA 3FCUB 3EG9A 3BQNB 1M2VA 3FCSB 4CN8A 4G1EB 1MJNA 1IDOA 1JEQB 1V7PC 1XDGA 4IGIA 1JEYA 4UM9D 4NENB 3IJEA 5KYWA 1AOXA 1M2OA 1RTKA 2ADFA 3F74A 2M32A 1YUKA 2XGGA 3EFOB 3F78A 2B2XA 4MMXA 4F1JA 4FX5A 4Z7NB 1PCXA 2ODQA 3GXBA 5KYNA 1T6BY 5E6UB 1PD1A 1SHYB 1ZOOA 3EGDB 2UZYB 3OL2B 1ZOPA 3N2NA 3K71A 4G1MA 1IDN1 2QTVA 2NUTA 4HQOA 3NIDB 3K6SA 4MMZB 5LN1A 4DMUB 4O02B 3QA3E 3HXQA 3EH1A 3M6FA 5KYYA 1QC5A 1U0NA 1U0OC 3NIGB 3PPVA 3ZE1B 4WK2B 1QCYA 1TYEB 3EGXA 3ZDYB 3PPXA 4WK4B 5E6SB 1U8CA 1OLZA 4MMYA 4UM8B 1CK4A 1MQ8B 2WINI 4HQFA 3TVYA 5HDBB 2I6SA 1L5GB 3NVQA 1SHUX 1M1XA 1M10A 2NVOA 3T3MB 1NA5A 1YVRA 5E6RA 1JLMA 4Z7OB 4C2AA 4CNBA 3PPYA 2XWBF 2VDLB 1SSLA 3EG9B 4WFQA 2VDRB 1M2VB 1M1UA 4G1EA 1JEQA 3TW0A 3ZDZB 1RS0A 1JEYB 1PT6A 1SHTX 3IJEB 4WJKB 5KYUA 1AO3A 3TCXB 1Q0PA 2X5NA 5KYXA 1DZIA 3AL9A 1BHO1 3EFOA 3V4PB 4A0QA 3HI6A 3HXOA 3V4VB 4NEHB 4C2BA 1JV2A 4M76B 5E6UA 4O3UB 3K72B 3EGDA 1SQ0A 4JDUA 1MF7A 4XW2A 3RAGA 2I91A 4C29A 3OL2A 4FWWA 2ICAA 1MHPA 3Q3GE 1ZONA 1DGQA 1BHQ1 2O7NA 3EOBI 2NUTB 4UM9B 3AL8A 3K6SB 2I6QA 4GZ8A 4MMZA 2NUPB 1LFAA 1UEXC 4IXDA 5HJ2A 1OAKA 3EOAI 4CN9A 5KYYB 3FCSA 1N3YA 4F1KA 3OKWA 3EGXB 3BN3A 4NENA 3E2MA 2P28A 5KYWB 1U8CB 2ODPA 1YVPA 1FE8A 4MMXB 3ZE0B 4BJ3A 5E6RB 4WK0B 4K3JB
chains in the Genus database with same CATH superfamily
1RCYA 4PJ8C 3PWUA 2WSSD 5I8PA 2AI0H 2RMNA 4DM4A 5IT2L 1I7ZA 4HLUC 3T8XA 3QZNA 5HK9A 5B2EA 3FCBA 2C2GA 4ZW8A 1S3RA 1P5VA 1T0OA 1YGPA 1VHDA 3PT5A 3S36L 1AH1A 3B85A 3IKMB 1F3DH 1O97C 4YL9A 4P4KD 5CGYD 4QVGA 1A6PA 1JK9B 1G8MA 4CLOA 1W75A 3JR7A 4GLOA 2ZJ7A 4NCBA 2ZYHA 3VD3A 1KMIY 3W1EA 5EOQL 5H94A 1S78C 5HHXH 1W15A 5M2QA 3NOVA 3JQRA 1E3QA 5D7LB 1FRGL 3H3KA 5ALTA 4RORA 2EKLA 5ALXA 4ANWA 5A1TA 3O6FA 2JXMA 2BSBA 1VFUA 4LY3A 8CGTA 1CK4A 4D79A 1SU8A 4V0LA 3LY9A 4BCCA 4DQKA 3BOSA 4ZAYA 4Z76B 5C1OA 3QUXC 4HPYH 4HEQA 2ONKA 2VHXA 1EWHA 2X0VA 1OFUA 2PFSA 2FFBA 2FEDD 3GZQA 1GPBA 4U7FA 3GRKA 5ADOH 4KI7A 2JIPA 1SEQL 1QQTA 4QIRA 3EJUA 4RBNA 2G3NA 2D7MA 3BGSA 4C05A 4HCRL 2RG7A 4JC8A 4RHUA 5FJIA 4DUPA 4C2UA 4KQ0A 4TVSA 3STZA 3KKNA 2AHOA 4YOKA 3E58A 3SX2A 5DMJB 4BQSA 3S5LB 4OHVA 5KTYA 3VPDA 1HR0B 3HDHA 2EQ5A 5HGJA 1CZLA 4MITA 2VH1A 2IIPA 4IDNA 3NTRA 4PJEE 8ATCA 2HCBA 1QLJA 2XKJE 2F7IA 1X9HA 2QSYA 1DC4A 3EYAA 4AUYA 3IVMA 3DAFA 2BFVL 3SFTA 4RLSA 1EFLA 4TSBH 4KGZA 2X2YA 5K3FB 1D2EA 2E9IA 3AEZA 3REQA 4YJ3F 4JFXA 2ZSFA 2VKXA 2IH3A 4F2FA 2Q3MA 3R7QA 4UBIA 3E9CA 4U7JA 2ECOA 1MRFH 4H20L 1XKQA 2JV6A 4CDHA 1M71B 1S0UA 1O7DE 4DSZA 2BOCB 1I7RB 1JNYA 2Y0CA 2B16A 2W8BB 3B5JA 3UJNA 4PSVA 4JPWH 2P80D 4BN5A 4DTGH 2AYYA 3V1YA 3V5DB 1Y63A 3VO0A 5K8TA 3G04A 2Q5EA 5EZQA 2Y4OA 4D8XA 1SCBA 2J5QA 3IEIA 1R5VB 2Z8SA 2BGRA 4RFNC 1HEUA 3FQUA 4B9KC 3WMPA 3GRZA 3BXXA 4UDXX 2XCTB 4C56B 1FU8A 1PT7A 4TMXA 3CM0A 1AGBA 1DKOA 2WB7A 2I71A 3LVTA 1OI4A 5JS8A 2BNQD 2IDFA 5BYAA 5CB0A 1JP5A 1I10A 2DJIA 2FQXA 3T0WA 3O3EA 3MN1A 2GH1A 4X7DC 2Q86A 3IQXA 1S9XA 5H0IA 4K73A 4CIXA 3OPQA 1A5AB 1T7WA 1TM3E 1FRFS 5EGNA 2ZXCA 1ZSVA 5G0WA 2E9WA 4B5ZA 2X2OA 2R56L 3UJ8A 4OX9B 1QIDA 3EPPA 1MCZA 3TXAA 1UQRA 2GQ0A 2FSSA 1UH2A 5HSFA 2ZI4A 1MQ8A 1A0QL 5E4EB 4QDTA 3TYXA 4P0PB 1BVLB 4NYJQ 4XOIA 1JYNA 3VOBA 2IEIA 5J1AB 4QHNA 1TTAA 1PR5A 3JALB 1XZWA 1GKEA 2NSMA 3SB3A 1AKWA 3E9DA 3DYOA 1IXSB 2XLBA 4V0OA 2ZE5A 3CLFH 4YT4A 3FBQA 1YDHA 1YNKL 3CHQA 5L4MA 4PQEA 2XYBA 2ZXFA 5BNZA 3RWJA 1F2TA 1T7ZA 4YQEA 4H8WH 3MLAA 2DOCA 3MV8D 1OAKL 1JGVH 3HJNA 2A38A 4F93B 4Z4QA 3CQPA 4OJAA 1I7LA 4HJUA 2AJ3A 1U5BA 5LYJB 1UKVY 4OZGA 1MO5A 5KVFH 5EIBC 1BWRA 3C5ZD 3AY4A 4ILDA 3JXEA 2Q8AH 1SB9A 4OP2A 2Q7YB 4E7OA 4OAOA 2C4VA 1IVNA 3IXTA 5JPMA 4JJ7A 3N2KA 5C0NC 1RHHA 2FZ3B 3WFZA 1X5HA 2XHNA 3LNCA 4JUDX 4XYBA 2DQTL 2B6HA 3JYNA 1VLHA 3QH4A 3IAEA 5E7IA 1ZPLA 1UGNA 2PY6A 3GU3A 3VDQA 3BJIC 2OK0H 3RGHA 3BAEL 1ODFA 2G1KA 2GYUA 2FQ1A 1GADO 1NA8A 1WAMA 3MQ2A 3N1UA 3VG0H 1BCSA 2FATL 2VERN 3QA9A 1XQ1A 4C0SA 3B3GA 3QNUA 4E9WA 3QDJD 5KEZA 3TVDA 1XGPB 5D2LE 1BAGA 5EWMB 2EDKA 3WKML 1JKMA 1QDEA 1P6XA 2O2EA 4CVWA 4QWWD 3PPWA 3HS3A 3E22A 4NMWA 1GNLA 4AQDA 5DDHB 4UDYX 1C9DB 4JN2A 5DJ5A 5ERGB 4YAKA 1EO7A 5EUOA 2EARA 3LZFH 4GPD1 3TCLB 5AEAA 2ZJ3A 3VGHA 2QKIA 2WK1A 1KK1A 1MIHA 3P30H 1GSAA 3AB7A 3FAWA 1KK3A 3RM3A 2H3XC 3U46A 4FS8A 5FA3A 1CF8L 3FF4A 4RMRA 3V7WA 2PRSA 2GHTA 5U1PA 4MVJD 2PMFA 4B7IA 4PQYA 3BGFC 2Y1KA 4OGAD 4BVKA 1VCHA 2PZMA 3L4BC 1DKRA 2WXQA 1OWLA 4IS6B 1GCYA 2N42A 1VBFA 4PFSA 1EANA 3IMEA 3IUQA 2BI4A 1FMLA 3NTVA 3KWWA 3QQ4B 2BC4A 2DT5A 4GX0A 1JDNA 3HLAB 2ZJ1A 5J1TB 3CFJB 1B0GB 3D3WB 5AYTA 1NLYA 4ODWB 1A9QA 4AZUA 4AWXA 3IV6A 1BROA 1TQ6A 4QF1B 1G2PA 1WHSA 3AF3A 1L8LA 3CVDA 1NDMA 3MB8A 4C7OA 1DHKA 4LYDA 2ARWA 4UQCA 2HMYB 4N41A 2BFFB 2WLMA 4X64B 3EDRA 2CNWD 3KYNA 3NACL 3JD2A 2D5IA 4FLOA 2AEQL 3AP3A 1DT3A 3JZYA 3DTNA 5EOVA 1FUEA 1TM7E 2BM3A 4G9DA 3O45B 3EC1A 2BYTA 2FYVA 3NPAA 1A3CA 2P44B 1HE2A 4U1IB 2JFYA 1E5VA 3MGTA 1NGQH 2NCMA 3MX0B 1ODLA 1J8SA 1D09A 3NGBB 4V0KA 3OOHA 1N1EA 3BKYH 1EVEA 3HUDA 2AHIA 4JDZA 4WNAA 4MUYA 4XODA 2FEOA 4OGWA 2M8XA 1JVNA 2AJXL 1JZ6A 1S2DA 5KCMA 2O20A 4EZEA 1M3JA 2ZQZA 5CCBA 4PZPA 3G2PA 4IMIB 3H1ZA 2DY0A 1PUIA 2NVOA 4AK9A 1ZICA 2OFFA 5C2JB 2XZQH 2X2JA 4HAIA 3PP4H 4KVAA 3RWEA 4UPDA 1IC1A 3IT8D 1R3IL 3TW0A 4EA8A 4MCZB 4ZZIA 4L4RA 1Q0PA 4PWGA 1FYFA 3I9V6 5GSRA 3V6ZA 2AI1A 1PZEA 3CVBA 5CR1A 4IDAA 3JASA 4HDOB 1R5JA 4QOKA 4Q15A 2B4TO 2PR4L 3SQXA 4DO5A 5ISZD 5ECYA 1VFOA 1DBAH 2LR4A 5DJ8A 3G1UA 4OHOA 4M99A 3M4XA 2C5SA 2UY6A 5C8DA 4D6YA 2FWRA 3UZEA 3TGPA 5E2UH 5EF2A 5JARA 1U92B 2PBRA 3U3JA 3BRCA 3SDZA 1QD0A 3QQDA 4P4LA 1SYVB 1AGCB 2KHZA 2VR4A 1BMTA 1TCRB 1G6KA 3IXMA 2JLRA 2CXUA 1O8CA 4N6GA 4N2NA 3D50A 4RADA 1YR8A 2DHRA 4XMVA 2ZRQA 4Q02A 4I3HA 4WJLA 2WHPA 5T3ZH 3PHOB 1PWXA 2EJWA 3K5RA 1CQXA 1TYRA 2QFRA 3GELA 3SQRA 2IPTH 3DSNB 1P6QA 1ZL0A 1QUPA 4TV9A 4U2GA 2JFBA 1UJ4A 2QN2A 4NR0A 3P54A 2WWWA 1V11A 3SF8A 1TSHA 2PIAA 1NUNB 5DNCA 1K97A 2Z0BA 5C0FA 2AL7A 4BFTA 4CU6A 3NCXA 3DFMA 1F3RB 3WHLA 3M6AA 4Q8BA 4HOYA 4G7VL 4FRWA 3X2FA 4IW3B 2BDEA 1W19A 3EH3B 5EN2B 3M1CA 3RY4A 1N5IA 5EZJA 3NOQA 1LNZA 3G68A 2G5PA 3NNSA 4WBSA 1TEXA 1YRAA 4ZRNA 3LKOA 3R4RA 1U3YA 3V9EA 4MQ5A 2DFNA 3PREA 2AOVA 1ZLWK 2FW7A 2HUPA 3UN1A 1CF1A 1XR8B 5JS1A 4PPYA 3COZA 5D70L 1SHSA 3B34A 4MYPA 3NIGF 4WJ5B 1UBUS 1R4NB 2V7UA 3ZZMA 5L6LB 3B9QA 5JCOC 3Q4GA 3FQYA 1U0BB 5CEZL 3UAJD 2C5FA 5BO1H 1X5XA 2RIKA 1TUGA 3WS6C 4PHHA 3A21A 3MT0A 2QHLA 3R0XA 3IAGC 4Q9QL 1JZQA 1DAFA 3QXUA 1OH8A 2J44A 5HYJA 3QTLA 2P46B 3NIWA 5IW1A 4J3JA 3JQBA 1U2ZA 3UP1A 4TQUS 2EKQA 1P5ZB 2HHHB 1NRWA 4WY7L 1L9PA 1XA3A 5I6PA 3ATEA 5LQCA 1GAQA 4KFZC 3DLIA 2J6EA 4JJ6A 5HM8A 5ER9A 1HE3A 1KJYA 1CYWA 2IXQB 3NHAA 1ID2A 3WQBA 2QP3A 1L8OA 2GI0A 4BTLA 4EHIA 5HKKD 1OGAE 4ZFGL 3ET9F 1G60A 1MO6A 2BR4A 4IK7A 1TMCB 4F3KA 3E8XA 1U30A 1KBPA 3OJWA 3W8EA 4A23A 4YMVA 3IGKA 1EZ4A 3E03A 4MWCA 3I9GH 1FSGA 3DCIA 3KKQA 3CDFA 1MR3F 3PWNB 1PL3A 3AHHA 2EZ0D 4NEHB 3FT2A 2HLDD 1FDOA 4DTGL 4RD3A 3ZPDA 3K6SB 2J3QA 4OY3A 4RTQA 3PUKA 3JWNE 1E0JA 2DB8A 5D7KD 3UENA 2YPLD 4BNMA 4JY7A 2D7OA 3PE4A 4AK1A 5GGXA 2NX5E 3NWOA 4EKGA 4FQIH 2AZ4A 4XR8C 2KWIA 1KTVA 3PC3A 1DVRA 1UUSA 3LUKA 4EG3A 4O4IA 2ASVA 3ARBA 1Y5RA 2FSGA 3P2JA 3VRLF 1PPIA 4XPFL 4MWTA 4U7PB 1L0PA 3BRSA 2H0RA 1N6UA 4ZPVB 3F84A 1XU9A 3WFIA 4QNNA 3H0CA 2LFGA 3BQVA 2UXFA 2CO4A 1T4MA 4P5KA 3CXDL 2DTSA 2EXTA 5I1DA 1TUIA 5AYVA 1E4VA 4DCQA 3OIDA 4R9NA 4Y0VA 2IZ1A 2VHTA 1FYEA 1U6KA 3P9YA 2R29H 4GSQA 1JGLL 2FZWA 4YSUA 4A8TA 2REBA 1OILA 1ZH6A 3DT6A 1UC4B 4F71A 1SKAA 3S28A 4LHWA 5JEDA 2ERJB 4HIXH 5JIQA 3GI8H 1L5GB 2DPLA 4R97C 3IT3A 1G7QB 3OLZA 5D1XB 3P9QA 4WI6A 4PO3X 4UQAA 2IFFL 2FYYB 3OSZA 5KSBA 4URWR 3CLFL 4NAUA 3GLZA 5K0CA 3MFQA 3DEZA 3H5AA 4IRJC 1JI0A 4YAIA 2A9KA 2BGKA 32C2B 1ZA3A 3Q9NA 1EQWA 3QEOA 4N1CA 3SG0A 2XX0A 2GI4A 3T1NA 1RLJA 3VXSD 4Z9XA 3HB3B 1NVKA 1LKZA 1AZSC 4ON9A 3B9KC 4W8HA 4JEUA 1Z5NA 2VXTL 3QIAA 4N5MA 1BVNT 1B4RA 2VQ6A 3JCZA 1PKEA 1AGFB 5ABPA 5IB4B 4AG4H 1G5FA 1QBKC 4JFEE 1VHQA 4A7SA 2I6UA 1XF1A 4CF6A 1GD1O 1HZZA 3VAEA 2ATKB 4ITUA 2DWCA 4Z0NA 821PA 4PJ5D 5IMKA 1PT9A 4PZUA 4CMMA 1UMCB 5HILA 4JYZA 4FWBA 3OX2A 4NCC2 1QVOB 4MCYB 4ZFZB 5DHUA 4D56A 3QU2A 2Q0HA 1JZTA 2BC9A 3EFOB 2YNMD 4GLRH 2QLBA 3V4PH 3QE9Y 4X0KB 4W9LC 4Z8YA 1F6AA 5C0DB 2PSFA 5GM2A 4OV6F 1UWFA 1UWEH 3JAKA 2XKNA 1NAMB 1KFCB 3ME5A 2B7DT 3QFRA 3PFIA 4WTOA 2F17A 3T2LA 1DL7L 2NAPA 2BEKA 2E9BA 2P9ZA 2Q7XA 3ROMA 2Y06L 1RRCA 2PKCA 1A7RL 4X0EA 1DVTA 4R5VA 4BGLA 5B37A 1WMAA 1JI1A 4D43A 2IANE 1WABA 2XTLA 2AUNA 3CGWA 3VKGA 1D6EB 5I1EH 5LC1A 5A3ID 2G0LA 5TE4L 3RC2A 1KTDB 5GADl 1X8XA 2CUTA 1V7MH 1OCRB 1G8FA 3IAHA 1BXAA 1U93A 1OH7A 2CZGA 1Z29A 2O0KA 5HPMA 3ST7A 3QVSA 3MWDA 2JVUA 1EFRA 4FQXB 3QI7A 4YDHB 3MLVL 1R75A 3L4WA 5EBLB 1P2BA 1N1DA 3W9DB 1J8DA 3PWJB 4FQJH 2ZBQA 1R5OA 3DRQB 2R8OA 2A1IA 3MV11 1VI2A 5CFRA 5JY1A 4PX5A 1EQ2A 4HT3B 3A14A 3H87A 4A73A 2LU3A 1YQDA 5BRQA 1PVDA 4S35A 4YASA 2IFTA 4J0GA 1AGXA 2IPNA 4JB2A 2XNAA 3MWEB 3PWKA 3NPZB 3OCUA 4OHCA 1PKQA 2BHSA 3D0QA 1JDJA 1L1RA 4CN4A 3SYNA 5A3IC 4YCAA 4N48A 3FDWA 2AW5A 4AS3A 1YR2A 4JQXC 4YIKA 4IOMA 4L4JA 3SO3B 3CVCA 4CM6A 2F43B 1CDHA 2XNHA 5AVRA 4TQIA 3E0XA 3ND5A 4HGWB 5KQGA 4AVKA 4IILA 3CFBA 2ZVQX 3MAWA 3I9AA 3RHTA 1ADCA 4J3OF 3D39B 4WOCA 2ZOUA 2MRYA 1NCBH 2XAAA 2W43A 1SG9A 3ZK8A 2JHAA 2YKLL 1A4BA 1PR6A 2KPNA 5K3BA 2J55A 3PU6A 2GD2A 3E5MA 1M74A 2EC9U 3H99A 5C0CB 1VKNA 5KYGA 3IQWA 3F73A 1SKQA 3M2PA 2XWDA 5IK2A 4IOSA 1DB3A 2CLEB 4K9NA 4MW5A 1XCTB 4Y19B 3ROOB 5JIIA 5CCXA 1U8XX 4I7ZC 1ZH2A 4CMHA 4PY7B 1XX6A 4MVJG 4J29A 3AKYA 4LYFA 1AKTA 3IURA 5FBHA 1DVFC 1JGUL 1UUNA 2NNAA 3KR9A 4C20A 1LS6A 5FAKA 3MUZ1 4BEWA 1LWRA 4YRKA 5JNRA 5E2UL 2D2XA 4M7JH 2WO2B 3AUYA 4J7XA 3VXPB 3CG8A 2E3JA 4DBLE 2XOKD 3WRWA 3CEAA 1Z13A 3H9GA 3NDRA 3PYMA 3A6JA 3FTDA 1IHDA 3S5LG 5LA6F 4J3OG 1YRHA 1YDFA 3KB6A 4N1AA 4O2CA 2MSLA 2EH7H 5IJKC 3W1VA 1P7WA 2YO3A 3DFUA 5GIPE 4UIKL 4B84A 4HIEB 2VJMA 4R7VA 5KVAA 2WLNA 4OJDH 1V4BA 3M3DA 3ZO0A 2G9ZA 5ARBA 3FNFA 4FHCA 4JJFA 4DIFA 3HBFA 3LYAA 1XQ9A 3RYCA 4MQFA 1KKLA 3U9UB 1DEAA 3MJFA 4U1MA 1N2HA 2Q0QA 2OFQA 1ZJ6A 2FLKA 4H8UA 3TQQA 3SQWA 1J7VR 3GRGA 4MX8A 4P4NA 5JHLH 1N32B 1FFNB 3KSMA 3F7YB 4ZI5A 3KPQB 5IQNA 1CC3A 4G83A 3I75A 1HEHC 3O74A 2E7LC 2O3SA 1WFJA 2ZF9A 3NASA 2JQMA 4U7HA 3GJYA 4O4LB 5JSKA 2V3FA 4N86A 2DEYX 3QE5A 1VPOL 3GZNB 3W2GA 2P7HA 3ZKMC 4OBSA 2J3HA 3FYUB 1C7SA 2IH4A 4V1CA 1QHYA 5JI2E 3ZHSA 4FFSA 5EL0A 4QUJA 2X1PA 3GXPA 3ICCA 3IOYA 2VP5A 4DY4A 3I4CA 1UA7A 3H18A 4YCJA 3WBKA 3VXSE 43CAA 3GK3A 3T9CA 3AY7A 2B3TA 1CFBA 5J3HC 1RJDA 2I67A 2IVFA 4OQNA 3RJ5A 2EZ0C 4YMIA 1M1SA 5DYOB 4G1MA 2J5RA 5TK4A 3R7NA 1I24A 1S2OA 4A2FA 4PV9A 4DWVA 1NURA 1JTEA 4D3FA 5FFGA 3MA0A 2QQKH 1YGYA 3L5IA 1XCQA 4AXWA 4C7KA 4R7ZA 4KTEL 4XGIA 1ACMA 2OK0L 4CKBA 5E00B 4LBYA 4WHYG 2ZT9C 1I2MA 1OT5A 3QOWA 2E6QA 3TO2A 1EP9A 3CNEA 5E8NA 4UILH 4RDCA 1I4LD 2I91A 4WBNF 3KT0A 3GLUA 2JLYA 1AYRA 4NAJA 2CSPA 2YS7A 3CEMA 5D8DA 1J1PL 4LDRA 2VJOA 1EP1B 4OSUL 1YWGO 3D7PA 3UZQB 5B36A 1KJ2A 4TPRL 1PZSA 3GGOA 1FDSA 3LT5A 1BXUA 2R27A 4ESOA 4FMDF 4AF7A 4XAKE 4OZ4A 3GSWA 4ADJA 1WICA 2VN4A 3QA3B 3WS3A 1MX1A 3C6SB 1UAGA 3RJZA 4BKLB 4OOEA 3BD5A 1JHAA 2HTLC 4JVSB 3C2SA 1T5TA 2M6RA 1EUYA 3KG5A 3HZVB 2V2TA 1RYBA 4JHAH 1XELA 1GHFH 4XP4L 4KKLD 3ARBC 4IGKA 2ANCA 1YUHB 4NENB 1C3JA 2F9LA 3PHJA 1L0BA 3B6SA 1CIPA 4U9IS 5D7LE 1NUPA 3ZCRA 4HRVA 4WW1A 4W4OC 1A8ZA 2AV7A 3K30A 1TQ4A 4GI6A 1F3JA 4CDGA 2QGZA 3E3QE 3WO4C 5F8RC 4F37F 1AO7B 4WIAA 1Z3GL 1R0XA 3ARGD 1HH6B 2G70A 2XRYA 5LHDA 3NETA 1CUFA 4DWOA 2CJ3A 1A6WH 3EG9B 5IJVB 3B7PA 4B5EA 5ID0B 3BZFA 2CXHA 5GGSY 5DHXB 2ZP1A 1EJOH 3MINB 3WYNA 2WZPD 2OENG 1DAOA 4LMAA 2YRBA 4ZOLA 5FUOH 2ENJA 4J7RA 3T54A 2WFAA 4U6TA 4XUDA 4YUVA 3MTEA 4NQUA 4IRSD 3VFMA 1ZM3A 4NCC1 5L3SB 1KPRB 5IKCB 2YJQA 1XGQA 3VZSA 2FGWH 4C14A 1WY5A 3W2HA 3PWVB 3TNYA 4BA8A 4NQCE 2ISSD 2P7TA 1ZGAA 3DJTA 2HG5A 4NRZB 1E96A 3L8MA 2EEDA 5C1PA 1G9NC 2DQKA 2OM5A 3QEGH 1TKRA 1VCAA 3IDJA 6CGTA 3L3OB 3MLWL 5DJAB 2RK4A 3G8DA 5CYOA 2XACC 4ZCMA 4JO5A 2HLFC 5M7QA 3GQFA 3THYA 3LIUA 1U2HA 1HYGA 2WKQA 3QKWA 5REQA 5I8EA 4HYQA 5SZJA 1VP9A 3I76A 3ULSB 4A2EA 3EH2A 3VU9B 3QWFA 5B1CA 5CDTA 1RVFL 2NZVG 2RHDA 4PBXA 1OI3A 4DQAA 5JANA 5D4QA 2ADGA 2NZYA 4FA8A 3T7KA 2ZAOA 4QO8A 3EYOB 3QFJE 2I80A 3HR7A 1NJFA 1XEUA 5AW4B 2AMGA 3IUBA 3K9NA 3BEVA 3NABH 2A58A 4GL2A 3GJ7A 1PGRB 4JO4H 1QCDA 4AEIH 1IBLB 4AMGA 4TUKH 1B8VA 1S5HB 3N50A 1OSZA 2F1HA 2WTUA 1DJNA 1ZITA 4GKZB 4ODHH 1SEVA 4E5XA 3IBYA 2Q5HA 4C56E 2BGJA 1TDQA 4YAWA 4ZT7A 1CU4L 3DLBA 2XE8A 3KQMA 1N18A 2DMBA 4ZT1A 3RUIA 1G98A 1YB1A 2ERYA 2ZATA 3ZZ1A 3GOQA 4PR0A 5FNZA 4FQ5A 3EJ6A 4B43A 4RIEA 3NBKA 2D5BA 1KYTA 3EQ7A 2NPIA 1NFDB 2JKZA 5I48A 2YJZA 4QOHA 3UAGA 2JI3A 1DO0A 3LIPA 1PLGL 3SYQA 2DQCL 3VR5A 3LRLA 3P2EA 3AP2A 2XMCA 3W9BA 3OZVA 1S7GA 4N9WA 3U2SB 1ZHOA 2FSPA 3BIOA 2WSBA 4JFQA 5DD3H 3AX6A 3I5MA 2E8ZA 3ARTA 5LMCA 5JRZA 4UTAH 4X5OA 4Z7UE 5JYDA 1SXBA 2DUJA 4NU0A 5D6DA 4BKOA 2VDML 2ZBDA 3SCMB 2XUGA 5FWXB 1N5LA 1TLMA 2G0NA 4XE5A 4CIDA 1NULA 3MYRA 5EHQA 4HVLA 3F2IA 4FM9A 3D25A 1RV6X 1V54B 2DLFL 3G5VA 1EEYB 4DGUA 1T8UA 4FFWC 3MYZA 1AQDA 3UT0A 1PIGA 1DBWA 1NFIA 1XXLA 4CMEC 3BT0A 3N2ZB 4HC1L 1GU7A 2OYPA 1QCYA 3FDJA 3SC2B 3BIFA 2HNBA 4WUUD 2HK7A 2PR9A 3V8VA 5B3JF 3AUAA 2JBHA 4AJPA 1EV2E 1BZYA 1TU0A 1H6TA 5IOPB 6REQB 2QW8A 1GYAA 4HFJA 1I8IB 3PHQB 3SJZA 3R0ZA 2NU8B 2XCSB 3QZWG 4KUHA 3Q2NA 4C83B 1R8XA 2YN2A 5JZVA 2J48A 2CDNA 5FADA 4HVCA 4OF5A 3DPDA 4WUVA 1USWA 2WXLA 3VG9C 3WLNA 1NXTA 3QJUB 1SA0B 3WWZA 3HN3A 4HLDA 1TFPA 1NW8A 2PEZA 1D7BA 4H2CA 4Z9YA 4EKNB 5IN5A 3WVNA 5I76B 2G40A 4LSZA 1CRZA 4MMXB 5PGMA 5ETUA 5JFGA 1RJ9A 1LMIA 1DL7H 1P4BH 1UOOA 2CNWA 3OJDA 3DC7A 2GFHA 3P45A 1WE2A 1WXGA 3UATA 4J91A 3ML8A 1UA6H 5I1AA 5A3QA 4M98A 4P3DB 5EEXA 1LE9A 1G5GA 3LRSA 4Q1VA 2IA5A 2FMXA 4L8CA 4TUYA 3PWZA 4U05A 2WQZA 4BOYA 4BQIA 3FB7B 3PQ4A 5IVXE 2Y07L 2VIRA 1MC8A 3ZDAA 5E24E 1DBPA 2CLRB 1VXRA 2IP1A 3C12A 4UUJA 4AC2A 1XYYA 2ZYDA 5TE6L 4OGQC 5MP6L 2B25A 2UVQA 3MBXL 2HJFA 4YAJA 3LHPH 4ZCTA 1F2QA 1INEL 4KXMA 3G5XA 3G8CA 2J7KA 3D8HA 1DBKH 4LCCC 2VC2L 2HMWA 2BI7A 3DGGB 4L08A 5JHHB 3OU7A 2CO3A 1UXSA 1PLAA 2HLDA 1MNNA 3DTDA 4NFHA 5CK5A 2JHGA 4Y9RA 3WIHH 3D33A 3HS0A 5DZ9A 2IX3A 2DTML 4F3FB 4PRIA 1BA9A 1ZVQA 1ZLWH 3EQ9A 2PCLA 4AYEC 3H2IA 3L4BA 3IDGA 4ACBA 4OSOA 1P7CA 1GAXA 4URFA 1U8YA 1MIOB 1I01A 1JALA 1Q1NA 3CFEB 4JASB 1E8XA 3PKZA 2QGBA 1MAVA 5HYVA 1Z4LA 4FLMA 5KQMA 3VNRA 4CSPA 4OKVB 2CDFA 5DS2A 4X5WA 1LQTA 5FOWA 4MNQA 4S11A 1YZZA 2WUDA 4YAGA 2ZE0A 2FPKA 3GGJA 1MG5A 2B4YA 4OT1H 4L0DA 2HM7A 3HCWA 2PQ2A 1R74A 1QH0A 3UTSA 4TQ9A 1TF2A 1TXGA 1QAWA 3ELAT 3R7FA 4P04A 1O58A 2XA8H 3UNXA 3MBWB 4E41A 1AU9A 2WAAA 3T94A 3ZCVA 5AXAA 1REQA 4A8JB 4B3FX 2VK4A 2GHRA 1LK3H 2REQA 1LE5B 2RE8A 1ULVA 2GXUA 1PUJA 4IDPA 1NFRA 1B4TA 3AV3A 3EF3A 3D31A 5FF6A 4IRJA 2B3IA 2OO5A 4FYQA 4FL4B 2WHYA 3DO3A 1C0KA 1WVGA 3CSDA 3EF4A 3ULUE 4CVXB 5IH7A 2ZBEA 1S4MA 3RC3A 3DKPA 4ZMWA 2EDBA 2OXGA 3U0PA 1GA1A 4YMHA 3MLXL 4ZTPH 1H19A 5I2IB 1B43A 3VNSA 1GL6A 3ER6A 2H11A 4DSNA 3UABA 2X87A 3UAWA 4LPCA 4PSAA 2DBLH 4DN3H 3I4LA 3BRWD 4ES8A 1GKLA 1RAFA 2GEKA 3MSPA 1RVDA 3O7WA 2DD8L 5KX5F 3UYLA 2OPCA 3PWPA 4RKFA 2CHUA 3UWMA 1Z7JA 1KI8A 4YSAA 2YWRA 2WWKT 4OCRL 4HUUB 3PNRB 4Y4HD 4DWJA 3GJ5A 1VKXA 3ULUF 3P4YA 1JHXA 2YQBA 4LEIA 1TI7A 4XH9B 3OCJA 1S7WB 3EW7A 2I99A 4GH7B 4PJ5A 3RARA 3BHJA 4AX3A 5AVQA 4KHZA 2V9UA 5GXBB 1J10A 4K5OA 1ED3B 1T80A 1HA3A 4P34A 4D0SA 1OXSC 1DAIA 3U4AA 1I7UA 3G7UA 3DBXA 3DXFA 5J2UF 4DVJA 4XEUA 4GSLA 4X5LA 4NIMA 5CIPB 4NKRA 5DP2A 2CMGA 1H3VA 3OFSA 4AJNA 4LSPH 3APNA 4RAVA 2V3VA 4AZ0B 3FO2A 4PLKC 5KBDA 5B4UA 4J03A 1FVEA 1W4RA 4JBHA 1RYEA 1GGHA 1E61A 4RZ3A 2BE9A 2OMXB 2FGZA 1NV9A 3DX6B 4PRZA 4JSRA 8FABA 3C5XA 2SHKA 2MSDB 1IU9A 3VSEA 3H6GA 4HDKA 1A27A 4YUWA 3RHWK 3PL5A 5G40A 1OWNA 4IJ3B 1INQA 2NUAA 1WT5A 3I1YA 4X8LA 5CSGA 4RFEA 1MOPA 4RDIA 1GZSA 4UUQA 1QRSA 2VDLB 2J9ZB 2WB1A 5CXUA 1LSJA 5I74C 2I1WA 1P31A 1YDGA 1CFNA 2O2CA 2FBOJ 3DFFA 2PP7A 3WIEA 3DX7A 1J00A 4LGRB 3KPPA 3BH8B 5C1IA 4RWHA 5JSZA 4PO1A 4K81B 1I5RA 3NZUA 5D1ZI 2K1MA 4IFBA 1L7NA 1NN0A 2QVMA 4NO2A 3JARB 2IWRA 4L3ED 1C5BH 4XN5A 1XVIA 4B35A 4HX5A 5LKAA 2BEJA 2P8MB 3PRJA 2YSTA 2VL4A 4K03A 2JJTA 2W2QA 2BKLA 3QJRB 3UPDA 3BESR 1JDUA 4G6KH 3ZHFA 4P2QD 5BR7A 2CHNA 3RT9A 3SBXA 3B2UC 3FS9A 2UUCB 1XD2A 1QK5A 2B8OT 5JCOA 4PRNB 1RRKA 2FMIA 1T1XB 1ENPA 5E2VL 2WB4A 1LZLA 1O94D 4CLXA 2AJYL 1WAAE 2ESVB 1EAPA 4BBJA 3KBFA 4H3HB 2RHCA 3DHMA 4QNPF 1NT2A 3Q0EA 1H0HA 4JEHA 3I6GA 3BVTA 3CZAA 3SKOA 4JQIH 5SWSE 3NO4A 4JS7A 2K6GA 4PAGA 3W4JA 1S5IL 1L7BA 4H8QA 5JO0A 3BH7A 3DUWA 1Z0UA 3ER9A 3TL5A 3ILVA 1U0NA 3RHZA 1KCWA 1E4KA 2G1JA 1C1EH 4G01B 2YAPA 3KW7A 4BK4A 1U9CA 1ZINA 1Q50A 2Z64C 5TSDA 5ALUA 3WKEA 4QC2A 1JJBA 2WLIB 3L5JA 3NQIA 3RRZA 3RS0A 4Z49A 3GFUA 1JFVA 1FNDA 3LIZA 1QVAA 3BHMA 1M1UA 3NHSA 1OTUD 1ENOA 1KY2A 5B3SB 4BFKA 1A5SB 1ZYUA 4L0PB 3DJSA 4HKZB 3TVMD 5FOJA 4GJTB 1CY6A 4M61A 1CICB 5GGRY 2AQIA 3R5XA 3TYFA 1KJ2L 3DUSA 4LNRB 4NQDB 3C7CB 1KBKA 4FWWA 2PMCA 3PLRA 2QVXX 1WQ1R 2DP4E 1EGHA 4XVSL 2B3DA 5LOVA 4J1TC 3KD4A 4TKWA 4JU9A 1BZ9A 2VQDA 5T41A 3WIFB 3MZ0A 1A2QA 5EIBD 2G5BB 3MKGA 4TTDC 4FLEA 4MAFA 2A9RA 4RKRA 1P4HA 4C7BA 2W70A 1VGEL 3FA2A 4Q7MB 3U4CA 2A94A 5ECGA 1QFWH 4XCXA 4JX8A 2O0LA 4U9UA 2C9QA 3PICA 2H26A 3BL6A 3WNNA 3OQIA 4DETA 2RHBA 2MSEB 2HQRA 2GJ4A 2EUXA 4BCYA 2VJ0A 1OQOA 2VTEA 3SQDA 1R8JA 2YFNA 3DHEA 4W5JA 1XALA 4IS2A 2CHWA 4RESA 2W98A 5FUOL 1RWPA 2OZPA 4ITRC 2NMVA 5AT1A 4CVZB 3DE1X 3IVRA 1A7OL 1NPJA 4LX0A 2JL1A 3W5AA 5D84A 3VXSB 1SEQH 3MSXA 2HPHA 3ROLA 3FO1A 4C87A 4XRCA 1L5MA 3CNLA 4OLWL 1SMDA 2H0QA 4ZIRB 4QG7A 4KI5F 1TTPB 2ZUSA 1MC1A 1XPOA 3H1BA 3V9CA 4G8CA 4HZLB 1E5UI 3KRTA 1E7RA 3D81A 4LLUB 2O50A 1PW3A 4RBPK 4X92A 3QI9C 2Z9CA 3EFEA 3K2QA 4TROA 4LASL 3BH0A 5BY2A 1P2VA 2A4KA 1C1HA 4LF8B 2F6AA 3FTCA 3MUGA 2XGJA 1JKJB 2PQ6A 2V2WA 2YGNA 2WYOA 2HNKA 5A4IS 1WNFA 1DJXA 4KK9C 3FGOA 4BO4A 4GT0A 2BMDA 3UAXA 1E2ZA 5HHTA 3ESZA 3C3AA 4WESB 2JCYA 1KPUB 3BGMB 3U4KA 4ZCPA 3S2FA 1E2PA 4LZJA 2IALA 4DLNA 4NSNA 4DSTA 1R3KA 3RDTC 2Q5BA 4YA6A 3MMEB 3K71B 3QQ9D 3BGIA 6YASA 1TJ4A 1EK2A 2OCYC 3BP4A 4MBOA 3I53A 2EXWD 4UT9L 1RSFA 2ZD0A 2UZ3A 3SZGA 4C76A 4ZX3A 1YONA 5E8EB 1U7OA 3LHDA 2J9FA 4INZA 4CIAA 1ZM7A 3LQ2A 1WA5A 4C4TA 2Y0DA 1WMDA 3OECA 3VFVA 2R1UA 2RMKA 1YEHL 4I8XA 5ESVB 1DEEA 3UDWC 2BOBA 1U95A 1RUPL 2QTHA 3ESNA 1VKHA 1FU4A 4M8VA 4EDFA 4F60A 2FO4A 1TU4A 3RPKA 3QO0B 4FFYL 4L48A 1NKRA 5CNHA 2R2HB 5I6LA 1CGTA 1GT91 1YR7A 2XWRA 4MMZC 5FT9A 4DR2B 1T1IA 3TBWB 3PYLA 2W90A 1I1QB 5CM9C 5U4QA 5TPWA 4P8QA 5CUSH 3TJPA 1AACA 1MFVA 1E5DA 5C71A 5GRYA 1U0QA 4R01A 4RK7A 2JLBA 3D06A 1P4SA 3GCDA 2V4UA 2CBPA 1S4IA 2RR3A 43C9A 4NH4A 2VPPA 1CLCA 3AGPA 1UOLA 3QPBA 3DZBA 1I1NA 1AP2B 5DO2C 1IL0A 3NA4A 1OIXA 3P52A 4IJQA 3GJQA 3T3GA 4NN6B 1B8UA 4EKYA 1R17A 3HB0A 2JFXA 3U1BA 4CMIB 5F5NA 2HHLA 5E6RB 4OLXH 3MNMA 5HDBE 1C2YA 3TNMA 3WKAA 4OQDA 1EXNA 3DZFA 4D0DB 3NJFA 2GILA 4JKOA 3MHTA 4DUYB 1V7NH 2DR2A 5FW7A 2K4WA 4D0BA 2YR3A 4FW8A 1SXSA 2FWMX 4BGIA 4NC9A 2OTUA 2Z2JA 2ZULA 3RZCB 2IEBA 5EO9A 2NR6C 4L8DA 3TYGL 4UKDA 1RJZA 3ATBA 4RY0A 2NY1D 3HI5L 3KQUA 5K3DA 4ABYA 5CD3B 8ABPA 5EIAA 5C08A 3AC0A 3PUUA 1V8FA 4NN7C 5IW6A 4G3YL 4G2AA 4GINA 1QU2A 4IOKA 5JASA 4IHBA 1IFHL 2OD7A 3OZAA 3S4SG 4KDRA 4WH0A 3AUSA 4NQEA 3G6AB 2BNRD 3BN3B 1GYUA 4H5SA 1T5IA 4L2IB 4URKA 1MFCH 1GVNB 3Q8FA 1M1XA 4DQOH 1NJ2A 4CF3A 2WMYA 1N2GA 1LK3L 3SE6A 1MVFA 2R8SH 4TUJB 1N3BA 2BH2A 2W94A 1WG3A 2W95A 1NQAO 1LY1A 4M8LA 3NDYE 1KLFA 4KY2A 3S6JA 3U17A 3HZMB 2ZKYA 3GC3A 2E4FA 4R8WL 3EOZA 1F8TH 2Y1WA 3REOA 2F68X 4GOOD 2YYZA 1Q5PA 3WIBA 5GZ1A 1G42A 2ECKA 1FGNH 3KELA 2C5AA 4ZTPL 2ZPTX 2O19A 3G6JE 1SPDA 1YB5A 4J2TA 4CSSA 4V0NA 2XQFA 4OLYH 3ETGA 3GRUA 4UUNA 3PDIB 4MB2A 4BNGA 4NRXA 5AYUH 3LDAA 1E94E 4YDQA 1T9BA 4N2HA 4MXQC 1TOAA 3KOOA 4Y4KC 4ZMNA 3HCVB 2YY6A 4ZARA 3HG5A 4KX9A 4AYBA 3VUFA 1UXLA 4IKOA 5I18H 4BFZA 4WO4D 1TR7A 1JAIA 2JK5A 3ULUD 5IJKA 1U8EA 2FIKA 3CZPA 1Z6GA 1W72B 4FLRA 4DCTA 2WE8A 4E51A 1NSFA 1AD0A 3W3AA 4FMPA 1R5BA 3QZUA 3QZWA 4LRNL 4RTRA 4PZEA 4K3GA 4B6ZA 3NCMA 3L3KA 1K6JA 4MV9A 1K5HA 3HNRA 1G7IA 4RXMA 5GOTA 5SY4A 1VE7A 4GGMX 4R5HA 2R0LH 5AI6A 4B2IA 2ZRKA 1WTCA 2CHGA 3TPFA 3OLWA 2Q8BL 4NAHA 2GLXA 4OFKA 1SSLA 2C83A 2GCOA 4NDMB 1MVNA 3TV3L 4UARA 1J8FA 4NZDA 1UMBA 3MWYW 1YNSA 1RZQA 4X91A 1FSSA 1ZSDB 1NVAA 2BERA 5T3YA 4IM7A 1QHNA 4UCXA 3FGPA 1K8RA 1XO1A 1DAKA 4W1RA 3ESVF 1EBBA 2ZIUB 2AN9A 3RTGA 5JORA 1YT5A 5C6TH 3GAFA 3ISRA 3W8RA 4L02A 3WK4A 5I5MA 2LE0A 4NO5B 3FF8A 2Z98A 1IEBB 5BSHA 3B2EA 4GP8B 2OXEA 4R6WA 3QE2A 3MLXH 4EB3A 2UUDH 2VDKH 5JXEC 1VQ1A 3S3CB 4HLCA 4KKCC 1ODIA 5THQA 1OZ0A 5IYZA 3PEEA 3BMWA 4HIQA 2C2WA 1QQDA 5FI3A 3OIWA 2FJUA 5JPDA 3AY3A 4TTAA 1FFSA 3U36A 4Y4HC 1QVZA 2ZKHL 3QG7H 1E9SA 2BNUA 4OB5H 3ELQA 3UXMA 1XIWB 3ECSA 2X0UA 2ZUUA 3CTPA 3WHXB 4EITA 3MTDA 1NPDA 2Z3VA 1MTZA 3LX4A 4RWYL 1E4JA 4CJ0A 1CE8B 1G17A 1UKZA 5EINA 4G0NA 2FUEA 5FOXA 1X7XB 2UXCB 1R3LB 3M70A 4NZUL 4PP2B 4JIGA 2QHXA 1HDXA 4F7PA 3GLFA 3JATA 2GD1O 1E9AA 1PWEA 3BLBA 5LBGA 3VHLB 2VISA 2CE7A 4YBHA 5AQ1A 3B38A 1XXHB 1YF3A 2QLFA 4N0FA 2AE2A 4LJ8A 2CKNA 1TVEA 3O2DH 1MHPA 2DIAA 3PNOA 1PGPA 1YE8A 1C1EL 1I1YB 4AB1A 2D8MA 3E1KA 3P4MB 3AT0A 4E46A 2H1VA 3CLVA 3CXHK 5DE3A 5IB5B 4GG6B 4OI8A 1XB2A 1A6VL 5EXXA 3SIXA 3TINA 4YBQC 3KSBC 2ZU6A 2ZS8A 4HDRB 2IPTL 4LSTL 2PW1A 3A4YA 1S9YB 1U3UA 4DV0B 3PHLA 5IJXA 2IBZX 2CJPA 3BMCA 3BFPA 3VMOA 1GPH1 4FFDA 1JGEB 2Z8ZA 5HI5D 4JCCA 4CKCA 2H59A 1MAHA 2ZJ5A 5ALSA 3P77B 1PK7A 4O08A 2BN4A 5JY6A 3H7BA 4QSMA 3WK6A 5JJCA 2WUVA 1EE2A 3FPCA 3MRCB 1QBMH 5T1LA 3MJRA 3W81A 2AGJH 1T8PA 1IC5L 3IU3A 1D5RA 4KNYA 2VT2A 2DWOA 1PLKA 4MUMA 2YJ6A 3C87A 3PLNA 5EA0L 4KKRA 4F3RA 4LZZA 1MG3C 5J5AA 2C77A 2OI9B 3M5PA 4X99A 4HBZA 4GXVH 5D7JC 1FSZA 5DEZA 4R0MA 4ERSH 2GK3A 3PEFA 1UJNA 3DLQR 4P5PA 3VGGA 3I23A 5CU9A 3DMFA 5TQ2B 1CYXA 2Z6FA 2OGWA 4G09A 3KR3L 5HGAA 4QOJA 1SYSA 3L7MA 4Y5VA 3AF6A 5IVXF 2GN8A 3FIUA 3UMTA 4FB4A 1V9LA 3DV6A 3BMQA 4QU8A 2QSCL 1TTBA 4CKWA 3AK4A 5FYKU 4AO6A 1SBSH 5CLHA 1F9EA 2ALAA 1ULHA 3QJYA 2DQHH 1C41A 3DFZA 1FO0A 4X8HA 2H7CA 3PNMA 1KEZA 4XPGL 1TIBA 3KPVA 4XDZA 1DO6A 4YONB 2IOFK 2VAPA 4OHMA 5FQNA 4MS4B 3GBNH 4AQ7A 3OVUB 4JT2A 4AN1A 2OKCA 3WIIH 2Z93B 3DF9A 5LWQA 3KWVA 3QTTA 3ZE9A 1QMPA 4DT1A 4FKMA 2DJMA 3JYLA 4OCRH 2DI9A 2VBIA 1FSKB 3U80A 2EKPA 2WBJC 1G7MB 1YI1A 2JA2A 1JR4A 3IJEA 3D4BA 4UVIA 3ATDA 3L18A 2XWZA 4ZBJA 5H2BA 2B83A 1IKFL 1BKDR 1KO7A 4LHZA 3C6LC 4BRZA 4XYMA 2ABWA 3R0MA 2F54B 5LKNA 3PR1A 2H9GB 1UUFA 3GP3A 1Q4NX 4BZQA 3DLAA 1PZFA 1Z3RA 1GYCA 4MX7B 3MCKA 4EX7A 2YZ7A 3GN2A 4QTIL 4Q1CA 3ETNA 1F3LA 4AF8A 2VQTA 4K5LA 3VKVA 3N43B 3SVTA 1T6BX 1KSJA 4J9UE 2OAGA 4J0EA 1MAAA 5DGXA 3T12A 2Q4RA 2XWSA 1NLBH 4MA4A 3QJZA 1A4CA 2CLKB 1SXJB 4KZEH 1PS0A 2O7NA 1ECCA 5CDYA 4EJSB 2P5TB 3TGLA 1IOWA 3GPBA 3VR2D 1QFUH 4BS9A 3SR0A 1BFVL 4S0TD 1QRNA 4U7KA 1GARA 4JRFA 5BVHB 4PYHA 3VRIB 4B27A 2CJTA 5CDFA 5K0SA 3MOQA 1OSPL 1OW0C 4AGLA 3O6LL 1XG5A 2C00A 3BEOA 3K4HA 1MJ8L 3L4UA 2Q2OA 1J48A 1O6ZA 3WTBA 3WR5A 3CXRA 4N7RA 1YDWA 1KN2L 3OPVA 4LXQA 2CWRA 3ZGOA 5HXMA 4C5AA 3ECWA 1KI6A 3T0EE 2WAYA 4OGXL 1K2WA 1IC4H 5MF6A 2QS9A 4FQPA 5ICCA 4BO8A 3KMDA 2BVPB 2Y69B 5DFTA 4LF5B 4ARZA 2PNDA 1VIYA 1BXZA 3P0EA 4HQRA 2JLUA 2GJ6B 1THTA 5D3MA 4YHPA 5JHBA 2OI9C 1VLQA 3PWLB 1CD8A 1RPAA 3E6AA 3UWOA 2YPVA 4FYMA 1F11B 1ZT4A 5A7BA 1IGTA 2ZBRA 2C04A 5L2KD 2IPXA 2XZPA 2Z8WC 2J3KA 2ZRMA 3E9ZA 4WU5B 3Q8CA 4MJID 2B1IA 4XDHA 5BSEA 2WTXA 4X1YA 2VDRL 5JW5B 2O59A 5DTEA 3V00A 3CN3A 3EWAA 4Z6AT 2X1HA 4AG4L 3IEPA 1IC7L 1YZQA 1OE2A 1U5CA 3G2HA 4G5RA 4BUZA 5FWNA 1SMOA 1KULA 2FJHB 2J8UB 5BZXA 3RIAK 1AR2A 4HALA 1QLRA 2H7VA 4FYXA 2H3KA 4RGNB 3WL6A 4EI5D 4OM0L 4MDRA 2FW0A 4PC3A 1QTSA 4PAZA 3M1IA 2FFJA 4C4BA 3OE7A 3HXLA 3BVNA 3ESCA 1OFUX 3DD1A 3FUMA 2IMNA 5F89B 1VCNA 3V4PL 4E5NA 2VH5L 4JFWA 3FNQA 4K46A 1KZQA 2GD0A 3SS7X 1RZKC 3FFOA 3AG1B 2YPKB 3P9MA 1H5UA 1UKYA 1YZUA 4KGDA 4P0TA 1UBEA 3R3UA 4E11A 2J6WA 5MHTA 1F86A 1DP4A 1WCYA 2EE3A 3JWPA 2JCWA 5GV7A 4AN0A 4YRTA 4HNVA 3ILDA 2CW5A 5D2LA 2P28B 4FHEA 1MHHB 2AOTA 2NIPA 4Q3BA 4X80H 2X0WA 2H2HA 4MV7A 3BYYA 4M6NL 2AWNA 3E2HB 1I7QB 5KU7A 2XECA 1F4XL 3CUSA 1SBHA 3MV7E 1GTFA 1B0IA 3CVHA 1EFXA 5B57C 4OZFA 1HS6A 1NVBA 3AITA 2ZGVA 2HLEB 5CBPB 2ZJBA 1Y6QA 2BZCA 1Z6YA 1ZGBA 2WWTA 1OLUA 3KQQA 5J47A 1NGWA 3AREB 4DABA 3VVBA 3OPUA 2C2KA 2VH5R 4BNVA 5G2OA 3CFYA 2HSWA 2A74A 3F3SA 3JBG7 4PJGE 2J09A 3VO8A 3HLKA 3H05A 2CBOA 4HJ0D 3VFUA 3H9ZA 4OKIA 4UAOC 3LDBB 3D1VA 4QPDA 2FPIA 3AY2A 3EXJA 5DS1A 2VM9A 1K6EA 1QYGL 2HFEA 2WMPB 2UV8A 3TT1L 2ZDHA 2R0LL 5IF0B 5K6RA 2ODEA 4U0KA 4CQMB 4YV2A 2R4RL 3SDXF 4PRPA 1ZD3A 3VNYA 1QFWM 2YPVH 3P4OB 4IMLB 1T8WA 2QVBA 1F90L 4LKXB 3GDBA 3NYIA 1U4SA 1CFJA 1RFGE 4OFVA 3EUDA 3I30X 2VLBA 3V0JA 4JVWA 1JXDA 5A40E 4U0JA 1FE8L 4UNPA 1NP3A 2FLBT 4XCNA 3CVIH 4KHTH 2PXHA 4RDHA 4FEGA 5A6VA 3MRNB 1C1YA 1KQOA 1TUBB 3A1WA 4FBLA 3K0SA 3N44F 5BMVB 5JADA 4TWBA 5HIIA 4KVCL 1VERA 1SVLA 4DOMA 2Z8RA 2HPAA 4RETA 3ICOA 3VDXA 4I9UA 4RSVA 3CDZA 3JAWB 1JF6A 1Y5IA 2XB8A 1AGDB 1TJIL 1NR7A 1MF2H 2P9RA 1SVMA 2E5LB 2HJKA 4Q19A 4XWOC 4R81A 3ABLB 3V4SA 2AX3A 4OIIL 3A67H 3IMVA 4JPVH 5T8KA 1Y6NR 3MTXA 3BUTA 4JLKA 1MWAH 4ARSA 1G6RL 2AR9A 4YP1A 3RJOA 4EYSA 5IAKA 2HJWA 3A9UA 3QYAA 3ESAA 4E22A 3GFGA 1PG5A 1RP1A 4QWMA 3O3AB 3OKNA 3OAUH 1T5XA 1KBVA 2I32A 1CZOA 1QDLB 4EFKA 3Q9LA 2PYFB 4EI8A 4LV5B 4YUEL 3QNXB 2A73A 4M8RA 1J06A 8OHMA 1E1MA 1I9EA 2R25B 2YQ5A 1PG7H 5F8QC 1G3QA 1WZ1H 4XB2A 1ZEAL 3RWCA 1M6NA 2Q2LA 1MELA 3CN4A 1QBLL 3MTGA 1A6TA 2X5JO 4W5TA 4G8JA 1PZ3A 5CHEA 4QGYA 2JAQA 2QRVB 4PGDA 3ID6C 4L3CA 3RUFA 3ABMB 3CX5K 1E90A 4IK6A 2WW8A 1KCVH 4LE0A 5C0CD 5DUMH 3PNLA 1HH9B 2OBMA 1FQJA 4WEQA 1XDGA 2JAWA 1Y89A 3V6OE 2N75A 5EUKB 4J7UA 2CO1A 3ICQB 2HN9A 3AI3A 3H2KA 3LOQA 2Q2WA 4EK9A 1P80A 3OSUA 5C6TL 3T7JA 2Z30A 1TCCA 3UKOA 1OASA 5CUQA 4PGMA 1DQYA 3LD9A 1FFEA 4BNKA 5HJ3B 2AEFA 3WO0A 1RJLB 3NVQA 3CFKA 5FOTA 4BGVA 5D6CB 2M2DA 2CSUA 4OQLA 4YSPA 4YLQT 3UUWA 4DHEA 2FWSA 5J4LA 1KJ3H 5DVMA 4PYLA 3RY6C 1MI5D 1O03A 1C12A 3C6ZA 1WJ3A 4TVKA 3HB1A 3WSQH 2RGDA 3AVQA 3TVMA 1G8PA 4HJTA 2WIMA 4FMCF 1GGTA 1K8IA 1L5SA 2IV9A 1GG8A 2VN7A 4REOA 1V7QA 1UEJA 2J1ZA 3P9NA 4UTVA 4DLUA 2HSJA 2P91A 4L7VA 4EEZA 2GTIA 4CEIB 4KREA 3C5JB 5KJRH 3LS5L 3KWXA 4UZFA 5D1QA 4ARIA 3EF1A 3RBZA 3VMPA 3JTSB 1WB9A 4PJFB 3B2XA 1QKKA 5DEIA 5JIBA 3ZTCC 1UKEA 2QVFB 5AOIA 3DYBA 4X8CA 2DBQA 2YN0A 4NPYA 3WGTA 3UK7A 4CMJA 5B7NA 4RD4A 4Y2JA 2X7XA 1N57A 2R2EA 4H8WC 4EB8A 5AW0A 3U9LA 5CAEB 3STXA 1F6LL 1EEXB 1J18A 2NXZB 1U9JA 1VENA 4DA9A 3H42B 4YEEA 3KVVA 1A6VH 4MVCA 4KMSA 2H65A 3EGWA 5B6JA 3QFCA 5LNK6 2BW4A 2IKQA 4W9FC 4S1WA 2Z6QA 7TAAA 2NAFA 1I1AC 1D5XA 4IOIA 2EU8A 3IHKA 4KKXB 5LOVF 4HT1H 3KXPA 3E6FA 4YVUA 3RS2A 1QWNA 1F5SA 1E32A 4EFDA 3RQIA 5DTFB 1B41A 3BULA 3U3XA 3B48A 1XMEB 1AFVH 5IWLC 5F1IA 1U8FO 3A25A 5IC4A 3QPDA 2Q8PA 3LDGA 1L5NA 4E5SA 1Z1WA 4GU5A 4TULL 5LG6A 3HE3A 2Y2TA 3FR8A 3TF7C 1WISA 3NJGA 4K0KB 1T6WA 4H8VA 3KLBA 1EXVA 3EXHB 1XAKA 2VDNB 5J43A 2J12B 2V0AA 2Q3LA 2J67A 4LQ1A 5HVHB 5F6HJ 5LXGL 4LE1A 3ZV5A 3D85A 3X1KA 3MNWA 1EXUA 3T7IA 5FTNA 3RTQC 1GTNA 3D0LB 4IY1A 4TT3D 4WERA 5D3QA 4PJDE 4Z7VF 4GP9A 3DMYA 2DYKA 1RZKH 1A9RA 2Y3IA 1C3LA 5I1GL 3BT2L 4X8MA 4MVJP 2XX3A 5CG1A 5ACZA 5J56B 1U7XA 1Y1KE 4KWIA 2W92A 1SHZA 3HG7A 3QIWB 4HLZH 3PDHA 1OX4B 2I6FA 1DQMH 1V2HE 4YSSA 4HX1B 4GS7C 3IVCA 2FW8A 4B0PA 3WFJA 1KTIA 4L8VA 2UU9B 2V6IA 5I28A 1JRHH 1NEUA 1U41A 3GMQA 3FJ1A 1QO3A 1RP7A 5EMLA 3K9CA 1IM9A 5KVGL 1KCUH 3ZDBA 4PXAA 3R3HA 3WY3A 4U2EA 5B7QA 4H60A 2NY6B 1TCAA 3PQFA 1A7JA 5EC1A 4Z23A 4QJIA 3KTAA 5JXAL 5C7XL 2GBPA 2YK1L 2EKSB 3GA0A 1CRQA 1KFEB 2VI5A 2W8BA 4ATWA 3WMFA 1RZRD 2C7OA 3TDKA 2NO5A 2A3TA 2AZMA 1CD5A 4XOAA 3D87B 1EDEA 5A4KA 4YX9A 5EEHA 4GQPH 1ZSNA 3O1JC 4DUXA 1Q94B 3IKTA 4L2LA 2BFCA 2EFGA 1B0WA 4N2EA 3PHIA 3VR6A 2WI8A 1JEAA 1NWPA 1YFKA 4LTNA 4MXWH 1DIHA 5JNLA 1ZD8A 1QS0A 2HA5A 3WGOA 3N9IA 3QJFA 2QORA 3PQYE 4ROSA 4XZ3A 1IM3D 1E4OA 1GRVA 4XHJD 4NJ9L 1YR6A 3UHJA 1UQSB 5E38A 5J4KA 4OQZA 1P7HL 3GOHA 1LTKA 2QZ9A 1APBA 4MD5A 3VSVA 4MJ2A 5E5UB 2CF5A 2CO6B 1BKYA 1K9SA 3N07A 1SUBA 3DEJA 3C60A 4ZVPA 1UM5L 5C08D 2OECA 3DKHA 3C8ZA 2BEWB 2OO5C 3IS3A 3FU8A 3ZYZA 5ACMA 3OCCA 3PCTA 2VWGA 1MQ8B 1KZ9A 1SNRA 1OZGA 4HQQH 1TTCA 2ZXAA 4L8GA 1JBQA 1ZLEA 1E9BA 4EW2A 2O3JA 1P7QB 4RF5A 4IZIA 1ZVSB 3NV9A 4UVHA 1DRWA 4I6JA 4V0SA 5HHPA 5LWYL 2YYAA 4ZG1A 3VNZA 1ZUIA 3SE8H 3LFTA 2XICA 4Q4CA 1YH3A 2MIIA 2B3RA 2V4MA 2H1XA 3OT5A 4WV1B 5JMTA 3QBTA 1Z6QA 2R0QC 4R2GB 2KZ1B 2X9NA 1XGYL 2MKLC 3IUJA 5I1CL 1NFFA 2NU7B 4G85A 4QJ3B 1K5PA 3RWFA 1U3JA 1ZIDA 2EFEB 1BZ7A 1LGYA 3G6KA 4RQBA 2XF2A 3VXTB 3FJTA 3WXVH 4MLZA 1WSST 3G13A 1HYRC 1K8DB 5DMKA 3ED5A 1QBGA 4LCBA 4PYNA 4DFDA 5I1IL 2G75A 3QRGL 4MXDA 1WBJB 1D1QA 2KYRA 4G67A 4D44A 2Z1NA 1H0RA 1KPHA 4P4RA 2XT6A 4FJ6A 4JJIA 1U3GA 2Q7OE 4AY3A 3VA6A 2XI9A 3DCYA 3W9EB 5L3ZA 4GBXD 4LMQE 2NV6A 3N42B 3LTVA 4MAAA 3WGGA 4POZD 3IEMA 3B5IA 3AKCA 1YEIL 3VUAA 1F8XA 4KDEA 4O4LF 3Q6FA 3OD5A 3DWIA 2F54E 5IK3A 1QC5A 1XGPA 3N1GC 3W6OA 4J7CA 5I6DA 1K2DB 2IDKA 1TA4A 3GWZA 1A9EB 1RPQA 5ALVA 2IBGA 2JFHA 1EJ0A 4ZW3A 4LVOA 1C5BL 3D4LA 1W4CA 5E08H 4I8DA 1PTJC 2QKIB 4HDNB 4L50A 1YAIA 3AL9A 2VHZA 3RBXA 7MDHA 3UMRA 2I27N 4JC5A 4HCIA 3WDSA 2NY4B 1DVZA 3U0WH 1E5AA 3LKSA 2OYMA 3D18A 2ZI7A 3JQFA 2QPTA 3BORA 3H19A 5IUJC 4LK2A 4I5GA 4CEHB 2CY0A 5CJOL 2V17H 4RPKA 4GI1A 2ZNXA 4KJPC 5D7JD 1EVZA 3B6EA 3AB0C 5ALKA 1EFTA 4M5YH 3WICA 2C4FT 1N5KA 1R19A 3OAUL 5IUSA 2H48A 2F1OA 2OA9A 1J42A 2WD7B 5LU9A 2R85A 3VH8B 2AK4D 3HU1A 5IM5A 4ODWA 2N0KA 1T20B 5CXXA 3T65A 4BRWA 1N2SA 3V5KB 1VMAA 1FTWA 1AH2A 1MXGA 4WT7A 3ISVA 5K9KA 4JNCA 2WWHA 3WTCA 2YWZA 5DJCB 1GCIA 3OG4B 4HWZB 2FUTA 1GLVA 3RVQA 1MFNA 2AXHA 3OL2B 5J63A 1T1RA 2MQ3A 2HA3A 2Q7DA 2AGVA 1RXYA 3QNYA 3MZGB 1BS1A 3VD9A 1PL8A 4BKSC 4RJLA 1JERA 4KGXA 2UYYA 3NBYC 2BCMA 2H1PL 3ESXA 1MJ7H 1LEKB 2PUWA 1NFQA 5ADOL 3K8KA 1Z28A 1NMQA 1AIFB 3MX0A 4MW2A 5FLUA 1FN4A 1V8PA 4Q47A 2P52A 2ZF8A 1AKQA 1T34A 4AMZA 1OZUA 5DBEX 2KDYA 5F96H 2Y99A 2CDEB 5E6UA 1SVZA 1SVWA 5BRZD 3KSZO 4F7TA 5FF9A 1ECZA 3LRHA 5CHNB 1RKVA 1PJSA 4KDTA 2HCTA 3FPHA 3PGJA 1Q2XA 4BNXA 3KEMA 3TG2A 1L3WA 3WTXA 4Q4IA 3G5MA 2WTRA 4I5DA 4A55A 2EUVA 3S6CA 1W7AA 2I6GA 3L7CA 3ZJTA 4AEEA 3L9YA 4OIIH 3A67L 3RDJA 1T4KB 2W6CX 5IJZA 1JWUB 4PBRA 5FKPA 4JZOB 4EHHA 4K9QA 1RKBA 2OHOA 2BZ7A 4XP9L 1KTJA 1BCIA 1XSKA 1DAGA 3THXB 1TIPA 4NQDD 5JCJD 4PG7A 2QGCA 4OJFL 1ZANH 1KTRL 6TAAA 4N8EA 1OV4A 4ZFNA 2UY6B 5FK9B 4JSTA 2ICWA 5HBRA 1EESA 3MRIB 1CTMA 3TFOA 3P0VH 3O2NA 2MHAB 1FP6A 4OCXL 1JTTA 1PG7X 3QVVA 5MN4A 5KN5B 1QR1B 1S3KL 3IXLA 3RVWD 1EYZA 2HU7A 3S5JA 1MC5A 1YVRA 5JAZA 3X14B 3N59A 2FW6A 2PTTA 3QJTB 1UFUA 1EX6A 5EEUA 2HFFB 3WISA 4IQ8A 1MRCL 5F1KC 1H15B 4TZ0A 1K4DB 4ELKA 4L15A 1SXAA 5IUCA 1BFTA 5DNWA 3L5XL 1G19A 2L17A 2QRUA 5G3YA 2XXMB 4K9EC 4KYTA 1J07A 3NQ41 4BMCA 4H1HA 3BWUC 3EAQA 3SF8B 1LVHA 1SK9A 5FBVB 5TLSA 3OEHA 4M6MH 1GIAA 2ODNA 4BVHA 5FOQA 3E2PA 1JT2A 1J8HA 5FECA 3AR2A 5IXSA 3BT7A 3R06B 4APXA 3IGFA 4ZC1A 1OB1A 3C5ZB 4HISA 3KL4A 4IH9A 2E4XA 1QLEL 1HG0A 2O8BB 2IXTA 1W4BA 4QRUB 1P69B 3FUVA 3HA2A 4ZAKC 3NFNA 1I9IL 2LAAA 2WM0A 3MTIA 3EDOA 1RRFA 2G9HB 4R4BB 4ZW5A 3BZBA 4OTZA 4YP6A 4F2PA 4KOAA 1IX2A 3T3HA 3WJLA 3GTTA 1KYAA 4XBPA 4Q6BA 4RV4A 4MJ5A 5B4TA 4XM2A 1V3VA 1S9VA 5DM0A 5I0DA 3GLVA 1E0DA 1L7EA 2YD9A 3MNDA 4LBEA 2P2GA 4NCKA 5D5QA 3RWDB 1YEWA 4FULA 2Q3JA 4N49A 4D8UA 5LN1A 1WTLA 2C3XA 3EOTL 4GIAA 5TC4A 4YL4A 4NH0A 3RZCD 1P0PA 4CJXA 6PCYA 3ZZLA 2YVLA 4KQWA 3CY6A 2A9CA 1FYHB 4PUBL 4L23A 2MH4A 1Y6JA 3SYMA 4IDHA 3OCVA 3KVOA 1RZVA 1GU1A 3Q8EA 1F6WA 3T5TA 2VMCA 4K6FA 3HRIA 1PLBA 5KYTA 3UGTA 4IBUA 1G7JA 4HGPA 2PNFA 3UYRL 1BU8A 3RL2B 4XNMB 1L4EA 5EWJA 1OYWA 3U5ZB 2Q10A 4EPYA 1C4OA 1BOYA 2PWZA 2QBYB 5F9JB 1CXKA 3CC5B 3B3QA 3C08L 2MNWA 5C8JA 5MGNA 1WTAA 5FR3A 4WSOA 1ESDA 4Y0NA 2YHGA 4DEVA 2Q5OA 4DXDA 3LUHA 2F58L 3H8NA 2IW3A 1AO0A 3NLLA 2Y7NA 5IESL 1F18A 3M4JA 4OHUA 1FVCB 3H85A 1X1DA 3CH5A 2AK3A 3S2CA 8AT1A 1YY8B 4NABA 5J6HB 2GJPA 5H70A 4LF6B 2M83A 3HB3D 1ZESA 4UVEA 4P4SA 3HE7B 5DRTA 1OQXA 1LD3A 1Q3KA 4LRSB 3VVLA 5LZ4A 5SX5H 3HYRA 1SXQA 5EEWA 1AQMA 3IIMA 3ESYA 3PSAA 1MREL 5EHZA 5TDOB 4X7TB 2HFGH 3C0KA 4K9DA 3S2ZA 4HX2A 4N68A 2XUHA 1JV5B 3O3DA 4MXWL 5J57B 3PZRA 5HFAA 3OLCX 1YN7A 4J1UB 1YU6A 5EGSA 2O2GA 4EPVA 3MXTA 4IDBA 1NA5A 4OVUA 2Q49A 3C41J 4AO7A 5K0ZA 3EDYA 4B6QA 3BEWA 4XPFH 3FCTB 2HT3D 4DEWA 3QUYD 3QR0A 1JFFB 1KCLA 4C54A 5TPWL 4LNUA 3B7YA 5K4HA 3OQMA 1U8NA 2L3BA 4O58L 4M6WB 4E33A 1KACB 4LPKA 2E56A 2YOAA 3QHZH 2HMTA 3TM6A 4HEMA 2C3VB 3WGUA 4OF8A 1GQOA 4JZJA 4DA4A 3GSRB 3K5PA 1AGEA 4O4HA 4X5XB 3E9NA 4PTYA 2B1QA 3FTNA 4AROA 3C2AH 1NOFA 2WQ7A 4NTZA 2B2XL 4WZAE 1CB0A 1KAGA 1Q44A 4LZPA 2JELH 5G4KB 2F53A 2J3EA 4PBDA 3HP4A 1MKFA 1ZMOA 1SBTA 2B0JA 3HJ0A 1JPTH 1NYQA 1NN3A 2FA9A 1M8FA 2NQ3A 4C4RA 4G9EA 5GRVL 5NLLA 5H81A 1NCUA 3K4PA 5H80A 5AW1A 4BGUA 1Q0UA 1GYQA 4DYVA 1LTQA 1RZ7L 4G7VH 2DQZA 1PFUA 4DKTA 4HAGA 5K8IA 3BIKB 3GROA 4J0KA 3VV3A 1IBDA 1MAJA 5FUCE 5H3CA 1H5QA 1QRRA 3H9SB 4Y98A 2BFDB 5I8CB 1G9MH 2VXTH 2CFSA 1SQGA 3WYFA 4NV0A 1L5LA 9PCYA 5A2QA 4GP7A 1ADQL 1E6OH 5JW6A 5FBLB 4MCYA 3GSUA 3QXDB 1TITA 3DLPX 3DDSA 5CCKL 3L9XA 4TS1A 5CEZH 5AVUA 5JPNC 3QQ9C 3TN0A 1N0LB 4I48A 4TSCL 3SE4A 4I1OA 2XUPA 2CLVB 2NO1A 1CUOA 1I8MB 1KOLA 1A3ZA 4JL5A 4MVXA 1FNMA 2X3YA 2FJFA 4Q4JA 4NO3A 2OB2A 1RHJA 5B3JC 2W8CA 3FB6A 2AKAB 5LKRA 3OJ0A 2D2CC 2P3OA 2WJ4A 5TQVA 4RISH 4NZMA 4CR8A 3N3EA 5DJXB 4QRRD 3CVUA 4GSDH 1MW8X 2C7BA 2G4CA 5F6IC 2G72A 1NANI 2KE5A 3TX4A 3KIPA 2IEGA 2FECI 2WYTA 3GYRA 4ZTOL 5HVWA 4BBWA 1JPGA 1WZKA 2R59A 1SJMA 1WMSA 2ZRPA 4CBPA 4D7AA 4JYAB 4RMTA 3K1AA 1KXTA 1TTRA 2QAGA 4Q9JA 3K1YA 5HPMB 1EFVA 2OZ4A 2KYIA 4MZ3A 1A5TA 1NC4D 3DX0A 1G8JA 2QD2A 3WN5B 1UASA 1PYDA 3BH6A 4OD0A 1XF3B 4WEOA 1T1YA 5BNIA 5BT8A 3IUSA 1KP9A 5BSKA 3EJWA 3ZHKA 2RCNA 2VW7A 4HFMA 3ZS9A 3P3UA 4XZUB 4M1EA 1IAIL 4X98A 4A6YH 5ECGC 5C32A 4RPJA 3TT3L 5IMLB 2FU5C 2O6PA 4Q9RL 1AURA 3PWUB 4JQSA 3MR9B 1M6VB 4EMBA 4TSRA 4JNKA 5CBAB 4E6PA 4AYSA 4PJGB 2R6FA 5HMLA 3O4OB 5LXGH 3MJ9L 1U7TA 4KV9A 4WKZB 4JQIA 4TXMA 1KEEB 3NC4A 4ZT4A 3F5MA 2TAAA 4XJTA 1S9WB 1U0HC 3IUPA 1DBJH 1JK9A 1O6BA 1YIDA 4MW0A 5BUCA 1MHPH 1WSDA 1MQKL 1UGKA 3TZEA 5A3JA 4RMSA 4NRYB 2R8YA 4F9GA 4EW6A 4ONHA 3N41F 1VE3A 4HS8H 1EE9A 4F4FA 5K1JA 3ZQXA 2R84A 2OD9A 1L5HB 2QGFA 1CQYA 1L0XA 3QJOA 2X5PA 1Z6TA 5JZ7C 5FIUA 1WZEA 1RABA 4Z76A 3FFDA 1B4DA 3HZZA 4YRBA 5C0CA 3CPUA 4KODA 2XWBA 3COJA 4OAQA 1HXMB 4K3EH 3GMSA 4RV9A 4G8IA 5E8OB 2FEMA 1JDZA 3D4CA 3L45A 3EXG1 4E88A 4EMTA 3K80A 4KE6A 2MCG1 1ODSA 1E7VA 2ARJQ 1NXVA 3ZYIA 2Q27A 2TYSB 1ZGLP 4O5AA 4Y19A 2P47B 2OKGA 1FL6A 1FFDA 3T5AA 1V45E 1A76A 2QU7A 5DHSA 4YDJB 1WZLA 4L1TA 4LZKA 2VXOA 4GXNA 4WY5A 1DQVA 4BFIB 1WU7A 3FFCE 3F6EX 3TTTA 3DFIA 4M8QA 3JZAA 4PD4K 4UT6H 2NNAB 4BCBA 4NCJA 4GLFA 3FB8A 3PJFA 1PAUA 1WXXA 4ES6A 2EDWA 4NX0A 2GK2A 3H1GA 4JMLA 1E0KA 2YKLH 3K1JA 5L8JB 2ACEA 5K8VA 1FI8C 1X5AA 3F6RA 3RAGA 5B3LA 5MDHA 1GGIH 4HGRA 3QLVC 1Z3CA 4JFXB 4BFEA 4DOHE 4M7JL 1UEXC 2GRJA 1L1QA 2W9LA 3AMVA 1LU9A 4AJ4A 3H3PH 3FB5A 1VJTA 3OC6A 4HIEA 4D9KA 2JI2A 1RXCA 1EFPB 3GLIA 5IHBA 2DS4A 3D3QA 2VDQB 2Z4RA 2HWXA 5F9WC 2FWOA 5L0QC 3LIIA 2G83A 1FQWA 1VG1A 2JF0A 3PE6A 3IMBA 5CVJA 1JFRA 2P5WD 3RL1A 1M6YA 2PPLA 1Q0YH 1ZS8A 3GRWL 5EHNA 5LQBL 3FZEA 3C6XA 2IOIA 3GJ3A 2WF6A 2G07A 4DAOA 2H1RA 4LJ6A 3WAKA 2OYKA 1NBMD 2XNDD 2FR8A 3T3IA 3FQUB 3JRNA 5JSYA 3FOLA 1CR9H 4JKIA 3QCVH 3B70A 3I75B 4LOFA 1EKXA 2EZ8A 2EYRA 2W11A 4Q1AA 4EDWL 1RC1A 1KQGA 1EGJL 4MCNA 4HS9A 1LO3H 1BJ8A 4I55B 3GJ4A 3ESMA 3L1IA 2IH9A 3QO1A 5HQ3A 2GF0A 4U6QA 1MG0A 3QZBA 1WW8A 2V8OA 4BB0A 4PVCA 2Q86B 1AMXA 1VG0B 4CU8A 2BIHA 4QTTB 2I24N 2C2BA 4BEIA 4JVNA 1QQBA 3QKUA 2LLLA 2J57A 3BDYL 3I8SA 3OURA 4NNPH 4H2DA 1WQVT 1UOQA 2XB4A 1Z06A 3P0HA 3VHXA 3F7PC 2F59A 4FFRA 4LJ5A 3KE9A 5KQSA 3NGLA 4M9RA 3GMPB 2DN7A 3WUWA 3ZRSA 4EABA 5J1AA 2OP0A 4WV3A 1XAUA 3TKLA 4F4DA 2Y22A 1SCAA 1X80A 3O8RA 3QISA 4F3NA 4PGFA 2QL6A 1GYVA 3TJHC 3WNVA 5ENZA 1FYTA 4OFIA 1UBLS 5E08L 4KZKA 5AJXA 3SCZA 4MARA 5J2TA 4Z78B 5GGSA 2QN7A 2R8XA 1E40A 2ARJB 5BQ3A 2QYTA 3L9WA 1J8KA 4YDSA 2HRRA 5TR9A 3TO2B 3WGLA 1UVQB 2CH8A 5E8NB 2D1FA 3F98A 2KC0A 1GRWA 2MOVA 5C35A 1QW9A 1P4RA 3FWNA 3Q41A 1URLA 4QQNA 3UT5B 5EEYA 3QXAA 5HOEA 3QEHB 5DD1L 4E42A 3ZVNA 1URPA 4HS6B 5GJSL 2KBGA 4PM1A 2VYND 4ZYWA 2JF1A 5JXGA 3K20A 3OLXA 3LQYA 1LNUA 1Z7WA 4EXPX 1KZ7B 2C61A 2D0HA 1GOFA 4HFUH 4XWAA 3NCBB 4E08A 3E9UA 1Y8CA 3PV6A 3JD0A 4XX1E 3DVIA 3MU3A 4RPGA 2I4TA 1B6TA 5GJVC 1S2MA 2OBYA 2JJ1A 4XPIA 1WWBX 5IIEB 1AQYA 2VDNH 1TJGL 2DPKA 5F1YA 4AH2A 4GZ3A 5TF0A 5CFNA 2QDKA 4Z7VB 4S1VA 4BWYA 3IMCA 2WIDA 3BPCA 5KTNA 3ZMNA 1WIWA 2XXCB 5LNK1 5AFSA 2C8VA 3T8MA 2JKNA 3WZMA 1S7QB 4X8GA 4DERA 5A2FA 2H9IA 4BMPB 2PS1A 1AO7A 2CRIA 4L1DA 4P4UA 2ZT8A 4BA0A 1TA0A 3DPUA 1QBML 4MYRA 4UEOA 4A7PA 3U46B 4D8TA 1Z3GH 3EYQC 4IIQA 2CG9X 1RD6A 1CYGA 4FFPA 3LEVH 3FYDA 2UXBB 4KW7A 4YRQA 3GWJA 4XGZA 4QTHA 1DDHB 3A58B 5AQEA 3S1AA 5IKCA 4IS6A 2MWMA 4LHXA 5HJDA 1H22A 1RK0B 2W6IA 3PA8A 4MVWA 4JCMA 1FO0L 2VL5A 4E5VA 5DBGA 4NZJA 1G1AA 2HG5B 4NRZA 3QQ4A 2FG5A 2Y5TB 1G3MA 1PZUB 2HFKA 4P2RD 1NV8A 2D1RA 2FZCA 4BO3A 1QF6A 1P0FA 2WCPA 2QI9C 5FYKD 1PQPA 4X62B 4R1UA 2CZQA 2F19H 3OQJA 4C4OA 2Q76A 3AT9A 1F6BA 2HPZA 3BJMA 4NYMQ 2ECQA 4NK5A 3B7RL 2ED7A 3QQ3A 1NVFA 2CNOA 3WY2A 2MTAA 4KFRA 1RS0A 4FGJA 4AMYA 5ITWA 1LJMA 4ROTA 1SOSA 3BZEA 5D72H 4GLBA 2WOYA 4RHCA 2FSHA 2ICAA 2GWHA 1NAMH 3BJLA 1JZSA 5IX8A 2WICA 5CZXC 7PCYA 7YASA 5DI8A 4DJ5X 2ZSBA 1UPTA 4I0KA 4XE0A 1SXCA 4GKZA 4HGKC 1YMUA 2W6JD 3D39D 2YWGA 1ZANL 4FQ2H 4JDZB 1N6PA 3R9KA 5I9BA 4R3SB 1S89A 3GVXA 2ZONA 4U2FA 4DMMA 4FFLA 1NBIA 4KNSA 2W07A 4K86A 5JQGB 1D03A 2K9UA 2BM9A 2HBQA 4Q24A 3CH4B 3DMMC 3CH6A 3MRDA 3O2VH 2AEMA 1DDTA 1FA9A 1J4AA 3FSJX 3PNBA 2JLPA 3V8OA 1F45A 1P4AA 3O3NB 2HZ7A 1C5DB 2W0LA 2OMEA 2B2XA 1H3TA 3H4HA 3UCFA 4HS4A 4KMTL 2NY4D 1PLGH 2H0EA 3C43A 3ZDRA 1QA9B 2OJZL 3PWTA 5IS2A 1K7EB 3MRGB 2MOGA 1LSSA 1W34A 4DIMA 1D7FA 5DSZA 2YZ1A 1UOPA 1M42A 2B20A 3SGDI 5FO7A 5D7IE 3OAAA 3Q0TA 3DK2A 3LMJH 1U92A 1VSQA 3SBEA 3PIDA 5BW5A 1IAOB 3BXGA 2AP2A 1G0DA 4XE5B 4QQRA 4EI9A 2ORWA 4UW9A 3RROA 1TCRA 2NTFA 4U6VL 4WHTA 2I7DA 2H3NB 1Y6KR 1QH8B 3AINA 1EEYA 2HV8A 1Q7GA 2XVZA 4HH8A 1CVRA 4B6EA 2YQ3A 2A9DA 1T22B 4TNWF 1WPGA 4ZDHB 3D30A 4EI6A 1SY6H 4XBGB 1A7NL 3HA0A 3UV6A 1F1DA 5MN6A 1UC5B 2F5BL 2R1YA 1U8LA 1R3DA 1E1KA 1KNOB 1N0XL 1RK1B 1UYWL 1LO0H 3H13A 4MDYA 3MBED 5L8KB 3BPLB 1XTPA 2VBGA 3KD3A 3EVFA 3P9RA 1HHGB 1UADA 3LPLA 1CUIA 5GISH 5EOTA 1L4BA 2XYQA 4M5ZL 1FBIH 1GPNA 1TMQA 1BIIA 3S5YA 1YOVA 1UOVA 4PUBH 4XQGA 1BZDA 3TZBA 3TEXA 3BC9A 2IYQA 1W30A 3GIWA 1G5QA 2C9DA 3JS5A 1F4LA 2OMNA 1J70A 4F9EA 2HG0A 4AKGA 1QHQA 3TKYA 3ZWWA 1B6UA 1Q1ZA 2ATPA 1KYFA 1XHEA 5EJMA 3EYWA 1MCKA 4ODTL 4GSDL 2GJ9A 4L8CB 1G3IA 4TUYB 1XVAA 4LRUA 2Y77A 4UZGA 2P5ED 3FB7A 3GK8L 1KMNA 3LUDA 3B7UX 4PW4A 4Q3AA 2F08A 1E6MA 1YK0A 5A2KH 2IANA 1ISHA 3FNEA 4V2CB 1SCQA 3W5CA 1BLIA 4Q74A 1GGNA 4HSGA 4BEVA 1C8PA 2HJFB 1AZWA 1FL5A 1EFXD 4Y18A 3RC8A 3H56A 4FGZA 4Q7EA 3G5XB 1WQ3A 3AJDA 1AHPA 4OXXA 3KDMA 3PEYA 1JU3A 1R46A 1VBKA 3FU9A 4TL8A 4D3YA 2TMDA 5D2NE 6Q21A 4IV5A 3OU6A 5T3XD 2EJVA 4WCYH 4CKZA 2MYNA 1R2QA 4P2CG 2P41A 3DCJA 2XITA 2GCPA 2UY7B 3BF8A 3UQYS 2F7SA 5C8ZA 4IBYA 1GGIL 4PNZA 2W2NA 3CBGA 2ZP9A 1TIUA 5J1SC 2VNCA 1UZLA 4OHKA 2VN8A 4Y4HB 3HN7A 3RS8A 3CSYA 2C4WA 1E63A 1A77A 1KY7A 3B56A 1D5CA 3ZOKA 2EYTB 3QC5X 5SWZB 1I33A 2X1MA 4RGNC 2ZFUA 1B00A 2LFEA 3FOWA 3VR3D 3HKFA 1RM0A 3MCLL 1OLOA 3EQZA 2ZI3A 5EOCH 4M0DA 4AW9A 3P94A 4XVCA 5KINB 2QUJA 3OAZK 4YWJA 3NVAA 3KLKA 3EPKA 3SOPA 1SHUX 4RA6A 5JH7F 2FX9L 4ECNA 1ANKA 3TZLA 3RSSA 1EA5A 2WSDA 5ICZA 4FYYA 3FQTA 3NCEB 2NW6A 4KSCA 2GJSA 1REQB 1KBGH 4FEEA 4ODXB 2VYRE 2WU8A 4Z99A 2Y1VA 2IFGA 1QORA 1PZDA 2QSJA 4M93C 1P8AA 1QEWA 3M3HA 3D8RA 1PR0A 4KMQA 5BV7C 2IY8A 3W2FA 3NEXA 2C95A 2WF7A 3REVA 1UIMA 2XQKA 1M3IA 4HNRA 4XTCS 3CJQA 1YRQA 4DPBX 4BCDA 4OD2A 2X2PA 4UEWA 4LHYA 5C53B 3LH8A 1CT9A