5HDBB

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 114
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5hdbB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5hdbB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5hdbB03
3E2MA 1RS0A 1ATZA 5KYUA 4G1MA 5E6SB 3FCSB 1N3YA 3TVYA 3F78A 1YVRA 1AUQA 3K6SB 3ZDYB 4UM9D 3NIDB 2ADFA 3EG9B 5E6UA 2IUEA 1JEYB 5HDBB 2ICAA 3M6FA 2WW8A 4PN7A 4G1EA 4HQLA 4NENA 1M1UA 1JLMA 1PCXA 5E6RB 3K71B 3EH2A 3GXBA 3OL2B 4O02A 3HXQA 1JEQA 1U8CB 4MMXA 1T6BY 2NUPA 1PD1A 2P28A 1CQPA 2M32A 1DGQA 1IJBA 2NUTB 1ZOOA 1JV2B 5KYNA 1OAKA 3NIGB 3ZE1B 4O3TB 4WFQA 4XW2A 1OLZA 1M1XB 1M2VA 2VC2B 2VDRB 4O3UB 3EGDB 3TXAA 1FE8A 2I91A 1MJNA 3PPYA 1ZONA 4JX0A 2XGGA 3EGXA 1RTKA 4Z7NB 5KYUB 4K3JB 3EFOA 4C29A 1PD0A 1T0PA 4MMZB 2I6QA 3F74A 5HGJA 3NIFB 5KYXA 1IJKA 1IDN1 2I6SA 4G1EB 4A0QA 4WK0B 3HXOA 3VI3B 3AL9A 1L5GB 1RD4A 1AO3A 4MMXB 2VDMB 2VDKB 3T3PB 1SSLA 4C2BA 4BJ3A 1QC5B 3VI4B 4UM9B 4MMYB 1V7PC 2VDLB 3EOAI 1SQ0A 1NA5A 4GZ8A 1Q0PA 2XWBF 4HQFA 4IXDA 3FCUB 3ZDZB 4IGIA 5KYWB 2QTVA 4CN9A 1SHYB 3IJEA 5BV8A 2VDNB 5KYYA 1XUOA 4G1MB 5E6SA 3FCSA 4Z7QB 1XDGA 4HQOA 3BQNB 3K6SA 1MQ9A 3EG9A 1JEYA 5E6UB 1YUKA 4HQNA 2VDPB 3PPXA 2ODQA 4JDUA 1AOXA 4NENB 4M76B 4F1JA 4FX5A 2O7NA 3K72A 5E6RA 3ZDXB 2ODPA 4C2AA 5LN1A 4O02B 1U8CA 1JEQB 5ES4B 2NUPB 3EH1A 1M10A 2NUTA 1YVPA 1JV2A 1N9ZA 3V4VB 3ZE0B 1PT6A 1M1XA 1FNSA 1QCYA 3TW0A 1M2VB 3TCXB 3EGDA 1BHO1 1MHPA 3T3MB 3V4PB 4FWWA 3EGXB 3BQMB 3OKYB 3AL8A 2B2XA 4UM8B 5KYYB 4IHKA 3NVQA 4CNBA 2VDQB 4NEHB 4WK2B 1MF7A 1M2OA 1SHTX 3EFOB 4WK4B 2XWJI 4MMZA 3PPWA 3EOBI 1TYEB 1U0NA 1UEXC 5KYXB 4DMUB 3ZE2B 1BHQ1 1DZIA 3N2NA 3K72B 3AFCA 1L5GA 3Q3GE 5HJ2A 1IDOA 2UZYB 1CK4A 2P26A 3K71A 4WJKB 1XDDA 3OL2A 4HQKA 4Z7OB 1QC5A 4F1KA 1U0OC 2VDOB 2X5NA 4MMYA 3RAGA 1MQ8B 1MQAA 3ZQKA 3IBSA 3QA3E 4CN8A 1LFAA 1RRKA 5KYWA 2NVOA 1ZOPA 1SHUX 3PPVA 3AL8B 3HI6A 2WINI 3IJEB 3OKWA 3BN3A
chains in the Genus database with same CATH superfamily
3GHBL 2D0PB 1SHZA 3A4YA 3GSXA 5KANI 4BUGA 3U3XA 1K97A 2H6EA 5FOTA 4WGGA 1YIAA 2Z83A 5JR3A 4L37A 5IVNA 2NQTA 5I7FA 5D6CB 3RVOA 5PNTA 1ZLSH 2BM0A 1Z4NA 1DAPA 5D1ZB 2JLUA 5ARBA 3PWJB 4ZVQA 4OK5A 5KYXA 2CMGA 3T5CA 3LX4A 1H22A 2H07A 3AMKA 3RTEA 1T9ZA 4O4JB 2Q8AH 3IH5A 3IT8D 1LWJA 3QXAA 3WFHB 2UYLB 2YVLA 1X9RA 2CDGA 3VU2A 1GNRA 3DIFA 1A4JB 3OSUA 1Z9LA 2DI9A 4OB7A 1N1EA 1XTPA 3HO6A 1ZD4A 2Z3FA 4FZVA 3SQLA 1L8LA 5DLML 3FPKA 3VVMA 5JH7F 2FSPA 4RDHA 2XPGA 4JBXA 4MR9B 4PG6A 1NIDA 3LUGA 5TQ0L 2IBSA 4M99A 3A14A 2WDPA 2K4AA 1ZKDA 5DLLA 3IDFA 4BXSV 4A6YB 4Y9FA 4FQ8A 1BRTA 5JSFA 5K1ZA 4U39A 2PTTB 4PJ7F 4GBGA 1XWFA 4MV6A 4CR8A 2IH9A 3VWJD 1VBKA 3NZEA 2NSDA 5LQUA 2NZVG 3GVPA 2EEXA 5AENA 1YB1A 1N8ZB 2RAUA 3DBXA 4GVPA 4DO4A 1G59A 4XIYA 4QGFA 4H88H 2Q46A 4HT1H 4ESKA 1I9CA 2FJUA 4UQ2B 1S9HA 1EG2A 1W73A 2E4FA 3HJ0A 3K0FA 5IMMA 2XBDA 4KKLD 3EDDA 4A6DA 2BBSA 1S9YB 4ZMVA 4EKDA 1ZGAA 2X0IA 3B2PA 3ZUNC 3E53A 3GSOB 1LDBA 1W6LA 1AB6A 4TTDD 4NO2B 4UNUA 2DFLA 2PNFA 1TO2E 3A9VA 1BMGA 3G5YA 4O4IF 2FK7A 4YVNA 3KKPA 4H25A 4I5EA 3L3KA 3ZSTA 2C1EA 2YW9A 2Y1GA 3H04A 3RSOA 2PFGA 4QTHA 4M9SA 3HDGA 4JEIA 1XQ9A 3NCTA 4Z7WE 3L7FB 5CW1A 2EJUA 1SC3A 1AO7B 4QTIL 5ABDE 1FQJA 1A2OA 3NEXA 3CNOA 4OM8A 3FDFA 4GS7B 1KYTA 5JPMC 2FUEA 3II6X 1QTRA 3AUWB 3IAAA 3OY2A 4WESA 3REGA 3QPQC 1JN6A 5FBVB 5K3OA 1ZANL 2WSDA 4BNXA 3DHPA 4HCIA 1E6JH 2QVTA 5A4FS 1J0CA 3FDZA 2YRXA 3RIAK 5LBIA 4D9JA 3U7YL 1FWXA 3FYTA 3ML8A 4BJ1A 1VLMA 1MW3A 3EEBA 4K3JH 5EF0A 1OILA 4YACA 4WI5A 3W82A 4X63A 4NEHB 1XZEA 5BWBA 1T0MB 5AKRA 1IGYB 1UC9A 4PTUB 1QUNB 4RX4A 1P1JA 1T6WA 1A7NH 4Q14A 4UV7L 2ZKLA 4GQQA 3WLEA 1IUNA 3GXOA 4XYGA 3QO0A 3OC8A 1OT4A 4B76A 4XPAL 2B6NA 4MCAA 4EI6B 2Z43A 3DAYA 3M4NA 3CAFA 4M9QA 3LYRA 3PC2A 3T5MA 3ODGA 3C6LD 3WBBA 2CBTA 3LKOA 3CLKA 3DR5A 1NFDA 1KF0A 2YUZA 3VFMA 2WWGA 1MPXA 4L0PB 3UG3A 2OMVA 4EPVA 3IS1X 4F4UA 3L1FA 3ZO0A 1FYTB 4Q4AB 1Z2CA 1F90L 4XRCA 1BEYH 1DDGA 2X4NA 2ZJ3A 4ANXA 3V7YA 5AAPA 1SUWA 4YIQA 3RS3A 3KBFA 1KYIA 3GJ3A 1EZVX 4N28A 1Q19A 1FZQA 3HG3A 5EPOA 3EDRA 1X8XA 3PAYA 1TJ3A 3MNZA 5HP5A 4OHYA 5KC8A 1YR2A 1A6WL 2BT4A 2FQ1A 4S1OA 4QREA 3QRGL 4LHUD 2WJGA 1EFKA 3N44B 1CHDA 3WGMA 3LQZB 1G5AA 4LSVL 2IYQA 4KFUA 4TMKA 2HJLB 5JC1A 4B5KA 3GUZA 3VE0B 3HVNA 2RG7A 3PE3A 5IG2A 1KBZA 4M6NL 4OJMX 1FG2A 4R1TA 2YQ5A 4LNAA 4ODTH 4EMZA 3OHXC 2F3QA 4IX1A 2I85A 3VNUA 1SEPA 2CO7B 3FT9A 3AUKA 5BWNA 3A2NA 1I9RH 1REQB 4RSRA 3GLGB 4IIQB 4AYGA 2OFQA 4C6TB 3E3MA 4P99A 1ZIBA 2J1LA 4JJHA 3SR4A 5E00A 3Q15C 2WJ6A 5E6UA 4HYYA 2QBWA 3T0VA 6Q21A 3A6HA 4OBXA 1R75A 1BE8A 3FU8A 1E2NA 3RZCA 1YVEI 3SPJA 2IFFH 3CRNA 5HUHA 1CL7L 2OB1A 4NO3A 1HNNA 4NNPA 4UV4H 5D1ZC 1OSYA 1U3JA 1E9AA 4MINA 2Q5OA 3LS5H 4OATA 3PICA 4Q7QA 3V0WL 4IBZA 3O3EB 4K71C 2YIDA 4WFJA 3PHQA 3GS0A 4HIEA 2A6IA 3OVUB 2JBHA 4DGWC 5DP1A 1DDHA 1XWWA 1A6TA 3GQVA 2RB4A 3AJEA 2GN6A 4QGBA 3T6ZA 3GCXA 4IU3A 3LCCA 3IDUA 3SE8L 3I4CA 1TQHA 5LQRA 1RXUA 3QPAA 4M9RA 5JH7B 4K8RH 4B9YA 4B46A 4QRHA 4UMGA 1DEHA 4JRYA 1RJCA 4NBWA 3D3VB 3JWGA 3SZGA 2KS0A 3GSRB 1BOGB 2G9ZA 4JFQB 1KQGA 3O8CA 3PWLA 5DS2A 4NXMB 1IBZA 3O38A 4LYDA 1ILUA 1PWZA 1C7ZA 5JSUA 4WNAA 1I4OA 4U1IA 2OCIA 4I2VA 3BE1H 4DWJA 1MCRA 3ZZMA 4PD4J 3HBMA 5CN2A 1KYAA 2Q6VA 1NVXQ 5K0LA 3X0DA 5ADOL 1DFBL 3VDBA 5F89A 5KJ7E 3N2NA 3IAUA 2A94A 1MW8X 4AYID 1ZHFA 3N8GA 2J59A 1TU4A 3EZ7A 4HPXB 4TSCH 3MLYH 3N55A 5D87A 5CFAA 3I92A 3PNBA 1KHTA 4LW8A 2VMCA 2EIDA 5A02A 3VXMA 3ZRSA 2DY0A 3B34A 1UUSA 3NESA 3HE3A 4OY9A 221PA 5EWLB 3O2WH 2GTHA 1G9TA 2D7PA 4MDJA 4P9HH 2CB9A 1UQRA 3IEUA 3CX5K 1SOWA 2XZCL 3K9BA 5IYZA 4XW2A 4O4IB 3DBVO 3ARFA 2ZP1A 4OD0A 3JQAA 1PLGL 3U1SL 4XRRA 3FB6A 5I19L 2W2QA 1JJAA 1QRUA 4N2LA 1E18A 4M98A 2NVUB 3U36A 2CO6B 3AU0A 5GZOA 2F2HA 5C08D 3N0XA 4GS7C 5FA3B 3UPTA 1WZ1H 1W0VA 1DPGA 4PJHE 5FEBA 3TNLA 1Z6ZA 4MWFB 1R3KA 4G3XA 3M7IA 4ZCQA 3Q6FB 2AJZB 4AU1A 3AFMA 4ZVUA 3HZMA 4FXPA 1Z63A 1ZQ9A 1YCFA 2YS4A 3QEQE 2GO7A 3QXSA 43CAB 3KSZO 2B7LA 2ZS9A 4BB5A 4ZPVA 3WL3A 4ONEA 3NCXA 1C81A 4TMPA 4J2HA 2F1JA 3BIKB 1QFWM 5L4JA 3F5DA 2ZWNA 1FLRH 3O41B 2CYBA 4U6XB 3QBJA 4I6GA 4YHIB 1RIUH 3KKKA 2XWBA 3G7SA 2OTUB 2E46A 1ZTXL 3RFXA 5C5DA 4IOSD 3VI4A 1ORHA 4OHCA 3EAGA 4TL9A 3TXXA 3ISTA 4RIRB 3T6VA 4AVIA 4NBRA 2HYDA 3FPSA 4JZJB 3NAGA 5FYLD 1WG8A 1F4VA 3BUBA 2GVNA 3BAWA 3QFJA 4Q0MA 1DBIA 4IMJB 4BO7A 4NR0A 1WOYA 2VITA 4BTLA 3EC2A 5F7LB 2VAJA 2ZSFA 3AWGA 5CKGA 1X6VA 3C2QA 3E9UA 5FBLB 4RTLA 3MOAH 5SWZD 4QRSA 1CY6A 3AXSA 3PC7A 1Z5VA 3WGUB 3TCKA 2YK1L 1XCQB 4LMBA 3QT2A 3ZI0A 4HUUB 2EE6A 1EZZA 3C0KA 3KTAA 3DPDA 4APQA 4JI1B 1VKXA 3W5JA 2ONZA 3IMRA 1EBAA 1WXEA 5KVCA 2IF7A 5HOQA 2NXWA 3I2JA 5DX8A 3ET5A 3RGHA 3K9CA 1VB9A 3AGWA 1DXYA 1EUUA 5HGGS 4OHZA 3HW7A 2Y1OA 4S0ZA 2FR4A 5EC2A 4LZOA 1JIVA 2CXOA 3TW4A 1UBUS 2X6AA 3H42B 1WEKA 1MFEH 1QA9B 2YQBA 3QUAA 2C7QA 3SLKA 1VHJA 3RB7A 2ZGVA 1NBIA 3IFOB 5AVQB 4F56A 3OC6A 2XV2A 1Z2DA 4EG7A 5ITZB 4DR5B 5K7SA 4XCYA 10MHA 3QKWA 5CD1A 1DQIA 2A0LC 2ICWI 1M6UA 2B7BA 4KUHA 1ZD6A 3FYHA 1ZAYA 3UK7A 3HC3L 4FPXA 1A3LH 1R17A 3QW4B 1EVIA 4IIQC 4JOSA 1Z4MA 4ZAZA 1RJEA 2DCMA 1YUHB 5ERWB 4X54A 3QXHA 3EDQA 4JGMA 4FYSA 2ZVQX 4JFOA 4I4IA 4H4NA 2FZ3A 1YDHA 3I74A 3MACL 4HK0B 1UA7A 4K7PX 4P7KA 5KDLA 3FTYA 4I3SL 4FYRA 1YYLH 1XMIA 5BOZG 4JVLA 5E2TL 2YW2A 5I18L 4MX7A 3I8XA 4PX9A 4PG8A 3I30X 1WA1X 1AUVA 2XYVA 3T7CA 3V2AR 2X7JA 1ZE3C 2ZK7A 2CYCA 5EZPA 4S10A 3OZRA 2VLKA 3C8HA 4UTVA 4ZXFA 4E5XA 1F3JB 2VSCA 2FA9A 2X0JA 1K7EB 4FFBA 3S2AA 1ZNQO 1XTLA 4ZU6X 2E85A 1BOOA 2NU9A 4OLVH 1N19A 2JWGA 1C0IA 3FUVA 3I1IA 3LQAL 1XUOA 1CEXA 3IEMA 2LRHA 1VDZA 2JLXA 1Y18A 5LZ9A 2XBZA 3ULVH 4ZRMA 1HEHC 2C04A 3TH2T 1L9XA 3KR3H 4L7VA 4HUTA 3EDKA 1I7NA 3KOXA 5GQSA 1C0LA 3GDOA 3IQHX 3SBWC 3S7TA 3UT5A 1T20A 1X5IA 1UKTA 2FSFA 4M02A 1N3NB 2GJ8A 3ZK7A 1E4KC 3TT1L 1PJCA 4OI4A 4MJ3A 3K6JA 4DCTA 5JW4N 3F64A 3LKRA 3SC2B 3FOAA 4RIEA 5EP1A 1GPUA 3GC6A 5FYKL 4S04A 4LV5B 5KTEH 2Q9BA 4D9EA 3E84A 2BEWB 3D6JA 1WZMA 1G87A 5TQ0B 5H5JA 4ZJYA 4ISBA 1QANA 3FYUA 3SNKA 1FFRA 1IFXA 3UERA 3QDGE 1NLDH 1HE1C 3CO5A 1FLDA 3AUFA 3LMKA 3AEQB 3RK4A 4NRYA 4J4PC 3UAXA 1RULL 5IF0B 1G8HA 2ZFUA 3UW3A 1PJTA 5C86A 4JEUA 2G75B 5IKMA 3B89A 4R2LA 5EEZA 1YRLA 3E0XA 2JKIS 4WJ5B 4WWID 2RALA 2Y1EA 1AHHA 4MGZR 3TYFA 1AGNA 3U0TB 1ESDA 2VQ1A 5JOFB 3M5PA 1IT9H 4HUQB 4HYTA 4D9KA 3RVTC 3V1YA 3TNMA 2EKSA 4ZMLA 2POQX 2VLIA 2OMZA 1CUIA 1QHSA 1MCJA 3JVGA 3WL7A 4XC3H 2ZSDA 2XDQA 4PRDB 1P5ZB 2Y8EA 5TDNA 2EG9A 5LLIC 1J9GA 1QQ7A 4N22A 1ND0B 1P1BA 1K98A 2B59B 5BR8B 4G8JA 3DOSB 2G5GX 3RX9A 4C7JA 5H94B 3TI7A 3CW8X 5A0TA 4RHUA 1PL0A 1RQNA 1BSIA 1G21E 1P6QA 5KKAA 3CQFA 1HY3A 4JZJC 3HEMA 1ISSA 3D6HA 4CDMA 2C5HA 3APDA 1T7VA 1W6RA 4CM9D 3H9HB 4KBPA 3KDAA 4JBLA 1IC5L 1A72A 1Z22A 3QA9A 3U3MA 2O50A 2WC1A 3ILPA 1VI2A 2PPFA 4O08A 2AFNA 2GW5A 2A1WH 2FX7L 1FX1A 2X5XA 2ONKA 1BIHA 3L9XA 1OKKA 4MR8A 1ZHKB 5H0IA 1S3FA 3T0FA 5HR5A 3RWIA 1O89A 4XAKE 2VWQA 3FT0A 1ODFA 3KVOA 4DG5A 2ZOKA 2EEDA 4LSPH 5EWIH 5IEKA 3VH8A 4AIZA 1M57B 3R1IA 4GI5A 5F7JA 1M83A 2K6WA 1JGLH 4FEAA 4X8HA 2B4CL 1DQZA 3EWNA 4YE4H 2ZAIA 2TMGA 3KU1A 1ZD9A 4ODUA 4N0FB 2DLIA 3ZR4B 1G5RA 3CUYA 5BQ5A 4XNDA 2O1SA 1B3IA 4WAFA 2HT2C 2ID4A 4U6TA 4MB1A 3ITEA 5JUWA 1Z06A 3ZZ1A 2BEVA 1I1OA 3C24A 5C4MA 3P40A 1UXWB 3B48A 5E9JA 4MZ2A 4XP5H 4US0R 4XCXA 1MC4A 3WXBA 5D7LE 3B7TA 1Q57A 4ND2A 3LY7A 4JLSA 4XAWH 5C9JB 3U6RA 5D86A 1BFTA 1ZQ1A 3H1PA 3SBXA 1XAUA 2BWIA 1NBOA 4YDIH 4ISVA 3ELQA 5LYJB 2W6JD 2RGUA 4Z3FA 4M0LA 3RG2A 4X4ZA 5SWSB 4HUNB 5CJOL 1QSED 4M37A 4LNRB 2DH2A 2DOCA 4BO2A 3ZPDA 4JB8A 4KRNA 1ETJA 2GDZA 3MT9A 4J3OD 2LU7A 1RAMA 2J9ZB 4ZCMA 3FNBA 5M2QA 2OJZL 3UXEA 4FKKA 4JJAA 4U3JA 3AI7A 2ZZNA 4C7OA 1UXMA 1HPLA 4G8GB 2DHDA 2YASA 1SUJA 4DUWA 2CLHB 3C1UA 3B7PA 3DEHA 2FPXA 4GG8A 1JPUA 4UINL 1SKYB 3WP0A 4QRRA 1NR7A 1MW9X 1WHTB 3N1UA 3ARED 1J2RA 1G8GA 2FW6A 1A8UA 4GLOA 1M7DB 4ZEMA 1D7OA 1ZINA 1CLYL 5KPJA 1RSYA 3HAEB 3ARTA 4YO0A 2J6EH 3NHMA 1E3ZA 3C5ZB 4Q4EA 1VACA 1YMHB 2AK4D 2WCSA 1PZHA 1XF9A 3CWCA 4LLMB 3KH4A 3WDJA 4E4YA 5AKVA 3VAAA 5CEZE 1NW6A 4HIPA 4L1HA 2I78A 1EA5A 4QYSA 4AGNA 2QROA 1DBAH 4M22A 2HUNA 5IHPA 3QDMA 3VW3H 1VI6A 3QYJA 1LP9F 3LU1A 4TYQA 4HMPA 4KE7A 5I6XB 1YBMA 1LSJA 4HBCH 3JWOH 3U31A 3GI9H 1MPAL 2R39A 2RBEA 4HH8A 4I5GA 1FEZA 4AIOA 2NTVA 1JGDA 2WOJA 4IMLB 1OWNA 2F5AL 1CD8A 1OKEA 3IXMA 1YEEH 3L77A 5FFMA 3QZUA 2XKNB 1AD2A 2ODHA 1RUQL 4K3GA 4HCGA 3HP1A 2YDYA 1M33A 2D0OB 4FTVA 5LNEA 1R3LB 3RM3A 5CDGA 3ZGOA 3TGXA 3ARWA 4I1OA 1TYBE 2HHHB 3NA4A 2VZ0A 1KE1A 1MVFA 2RJNA 5F5XA 3ZHVA 1KO7A 1P4BH 5L2KD 2NU8A 1OLXB 2X5OA 3MWJA 2SODB 2QXTA 1TJGH 2YRBA 3BMVA 3HS8A 3DGFC 1V9LA 3DMFA 4OJCA 1JGVH 3BILA 3MUEA 4PB9L 4B32A 2Z31D 3QIWB 2Q4OA 3CH6A 4JE4B 1S3GA 4IS3A 1E3JA 3A3YA 3ML1A 5IN5A 1U3FA 3MJ9A 2ZWYA 1Z7GA 2CPUA 1M8PA 4BO9A 4XMLL 3WFDL 1PWYE 4DSAA 5F51A 4NENB 2RGWA 3BO8A 3TFQA 3DV6B 3S68A 1ZA6A 3ZH2A 4ED9A 2A38A 4OQTL 1WSAA 4OZIF 2OZ4H 2Z7YA 1ZN9A 4L8SB 3PY9A 3SYPA 4JHZA 4LV6A 4Z4QA 3RDTA 5MN5A 4ZYTA 1PL8A 3GRKA 5JDIA 3B5EA 1G7PA 4JJ5B 2YMOA 5ERGB 4FMFA 4Z7OE 5CEEA 4L0YA 4IIFA 4WWOA 3KEMA 2VL5B 2WF6A 3UP1A 3MNVB 1UINA 4JP3A 5LLDA 3DHEA 3ZPXA 4LGPB 4QELA 2IIPA 4DILA 2AN1A 3W0LB 1Z6GA 3P20A 3SF8A 4YIKA 1DBBL 1A14L 1I51A 2VXOA 3Q2CA 3K8KA 4AEIL 4LAQH 2ZM5A 1U4NA 3OOEA 2HRLA 1BEUB 3RKRA 1NQTA 1Q0QA 4L4VB 3HVJA 2R2BB 4RPLA 3L0BA 2P2ZA 3NETA 1EFUA 2YD4A 2I76A 3UAJA 2NLJB 2GB4A 1VZGA 3FHLA 1JZFA 4C78A 2H4WA 1JAZA 3PP4L 1XVUA 2D4FA 1BW9A 4JO3H 1KENL 2Q86B 3UJBA 2VIIA 4ZI5A 5I51A 5G4KB 5I9IA 3FSWA 1BHSA 3VD2A 1GHFL 2B3RA 2F67A 2FL5A 5LVAA 4Q9RH 4G09A 3I2FA 3SHFA 1PNTA 4E14A 1NOKA 4OCYL 3KVRA 3ZTCC 1R4MB 3LOQA 2O5ZL 4JITA 1H6CA 4ACAA 3N6RA 4RVSA 3HB5X 4B33A 2IRWA 5HIMA 3DX3A 4AWJC 2VF7A 3UMGA 1JIKA 5KJRH 4LVUA 3L5JA 5I76A 1X7WA 5A16B 4H0LC 4PWJA 1O9ZA 3SDAD 4U9IS 5F9DC 3RX8A 5AB0A 1TGYA 2J0EA 3EZGA 1Q0RA 1CRZA 5IKEA 4TSRA 3UIEA 4YA6A 4OX9Y 4QXGH 4WGFA 3CUTA 3IIJA 4KUCF 1ZZGA 1A4XA 2TYSB 1D9KA 3B5HA 2HKIA 1ODUA 3T3NA 4FT4A 1R9JA 2GEFA 2NMSA 4YCAA 1H8LA 1I1CA 1NCGA 3TCLA 2QL9A 4C2TA 1K5NA 1SOSA 1NDUA 3RPIA 4MEAA 4JEMA 4B34A 1T4MA 3W5DA 4GWGA 2JCSA 3ETNA 4GKVA 3CLUC 2FT7A 2R2AA 1DQMH 3W34A 3ZX1A 1KIPA 4MYUA 4R7NB 1T9KA 2QT9A 1SVKA 3DUFA 1X3SA 3T5TA 1UMBB 5HMMA 5LXVA 4CEIB 3LKSB 2HK7A 1PWHA 5JSYA 5DJ6A 2DWSA 3DE3X 3MLSL 3BZUA 3C5ZC 1HVXA 1TZMA 1I1YB 3EDCA 1HEYA 2EFHB 1DMSA 4JC4A 3JVDA 1V2GA 1RIHH 4M1ZA 5E9DB 4KX9A 3IUMA 1NMCB 4RPHA 2C84A 4K9DA 1GPBA 4FABL 3HNSH 3BMNB 2E3VA 3U7AA 2DI8A 3H75A 4MQSB 4R8LA 3Q8AA 4X1IB 3BHBA 5J1SB 5I6XC 1LA2A 3LUBA 4WNCA 1A9EA 3BP5A 1BWSA 1GADO 3HVIA 1N4XH 4BRWA 1O5IA 2X19A 4YPFA 3FTUA 3OFSA 1RYFA 3PE9A 1EM6A 1H94A 5C80A 1KO4A 5AW3B 2WBJA 1OX4B 2C97A 2FBJL 4FNGA 3N8IA 3WZ2A 1WW3A 4E9SA 2V0CA 2NQ8A 3IE9A 5DJ8B 2PNJA 2JI1A 1P44A 4NZ9A 3FCOA 3D5QA 1TYJA 5BNFA 4Z2YA 1RHKA 5C0BB 5KKCA 4WU7A 2CA4A 1V2HE 2VRKA 2OR9H 5FIEA 1VFAA 4PJGE 4YBLB 1Y6ZA 4NRXB 1E32A 2AEOA 4WI8A 4ZIRA 1LD9A 3HZVA 1WCQA 2D1TA 5A3IC 1ILEA 1ZJ4A 3TT3H 3T5BA 4K55A 2IV7A 2F1EA 3OZEA 5D72L 3JYLA 3FQNB 1M8JA 2O8EA 2EJWA 2GJZB 3QIWC 4MSWA 1HHHA 1KN2H 2VYNA 4IRJC 3BWXA 5AVTB 3CLHA 1NUAA 1WP4A 4MI3A 5CX1A 4BVFA 1JL3A 3FFDB 4AG4H 1A4AA 1Z0IA 3I32A 5C52B 5J12B 4PBRA 2X4TB 2X9WA 1D09A 2V7PA 2H1FA 2HKFL 4EKYA 2J88H 1OP5H 4X64B 3NRQA 4LCUB 1Z88A 4OZIB 3ILQC 4CM3A 5HYFA 1W52X 2ZKIA 4Y7DA 1QFXA 2HT3D 4L8SC 2FZLA 4EHLA 3CUKA 3CSSA 4DV6B 2SCUB 3V4OA 1WXHA 5E4TA 4EJ2A 4ZN6A 1Y0LB 4XSHA 3LCJA 3U46A 2ITFA 5DKFA 1WCIB 1U92B 4H13C 3KJNA 4IK6A 2QBYB 4PJCB 1UT1A 2VRNA 3LUJA 1YR6A 1FUUA 2Y1ZA 3LX8A 2JI3A 3Q85A 5BWLA 2GN8A 1YRQA 3QA3E 3MROB 2Z08A 2WUVA 1CXFA 3OAYH 4GOSA 2EXWC 3VQLA 4POZD 1P5UA 2CBZA 1PZ5A 2D8AA 1DJZA 4GMXA 3KVVA 1OGIA 3ZL4H 2NY7H 3V9PA 2UZIL 4CVZB 2EIMB 3HHSA 3KLOA 4GPVA 5E5MA 4QULA 3QEMA 1TTAA 5CLGA 3S2IA 2IS2A 2EHJA 3DMTA 2XQVA 2I6GA 3SHQA 4OCRL 3RBXA 1TTRA 3QEHA 3WN6A 2YNMC 3N85L 5M95B 3FO9B 3THYA 3MINB 1HQCA 4J7AA 2WWMC 3QI7A 2CIKB 1PZCA 1QRNE 2ZXUA 2Z35B 5CLTA 4QT5A 4ZI2A 3QUYD 1BAGA 1FO0L 3ZYZA 3T4YA 3L0IB 4R5TA 1JRHH 3RNLA 1N10A 4JDVA 4J0KA 2C1OB 2BFPA 2XF2A 3DLAA 1UB5B 1YEKL 3D6NB 4JUFA 4NICA 4HIHB 4K7FB 3HFML 2BE9A 4LQFH 1PBTA 2XWTB 3T7DA 3RJTA 2C8KA 1I75A 2C5GA 3AQDA 4KTTE 4LXTA 5E9QA 2FNAA 5SV4A 5GS1A 3V32A 1W29A 2IOYA 3MJVA 5ES4B 2J57A 4AYBA 3TCXB 3ZWAA 3FWHA 2Z91A 1XCMA 4ZUUA 5LCXA 2WANA 1QAWA 2AS5M 1DHRA 3GF8A 1TPYA 2R2HB 1YF3A 4R71A 3EIQA 4BQOA 4W70A 1YTLA 4NU6A 2A88A 3IT0A 2G1JA 2VJYA 3LWZA 2XY2A 1SCJA 2JFVA 5DMIH 3R9KA 4DESA 1W5EA 3GCWA 1S8FA 3G2HA 5AESA 4Y4HD 3M6FA 2VIRB 5DNWA 4QWWC 4CQLB 4TNVK 4CSZA 3HN2A 2A67A 5CHYA 3EYFA 3MFFA 4FOLA 5EMMA 1U6AL 4PY2A 2AC2A 4ONHA 4M7PA 4ODSL 3SDDD 4YLCA 2G9UA 2VNHA 3KQUA 3LZPA 1J8MF 3O0RH 1MFBH 4KN5A 1KK1A 1AV7A 4PP2A 4XPHH 2FPMA 3CE6A 3IP6A 5GGVL 3WIVA 1UAGA 1PKQE 4FFVC 4XB8A 2DQTH 1INQA 1T4CA 4RY9A 1ZUIA 5DHVH 2PKRA 4F7EA 2DWOA 1NMCC 3PDUA 2N7BA 2GCIA 4PJXF 2XPYA 1NNEA 3PSHA 5I8KH 2F6AA 2O2HA 3NFPA 1QRSA 1M1YB 4PY7A 4R2MA 5J1SC 2FX8L 4IW3B 2GM4A 3FQTA 2FP4B 4YPGB 2CXPA 3X3GH 1GA6A 4UIMA 1JG4A 3MMZA 4OLEA 1OA0A 4QLWA 3SDCB 2WCPA 2VSKB 5LJLA 2NIPA 4YZFE 3X2FA 2I3DA 3F6BX 3H2BA 4IOFC 1ZSVA 5JRZA 3LQAC 1G9SA 4YWGL 3HO1A 5FUCE 1AKQA 2HKHH 3HMWH 4BEIA 1IN5A 3TL6A 2DWEB 5PGMA 3ZZTA 4NI3A 1L1QA 5M34A 1H3UA 3E3OA 2B1GA 5IB3B 5E2AA 5FYJD 1RQGA 3UWOA 3KG2A 1DQSA 1D6EB 3K0AB 4YBLC 1Q12A 2QADB 2VJDA 3W78A 1W47A 3F67A 5FA4B 1IL1A 4B80A 4D96A 4JW3A 3T0EE 2I03A 3QHPA 2OZLA 2RI1A 3ESRA 1KAHA 4E22A 2IYZA 3D31A 3NXSA 2NU6B 4U7SA 2A0UA 3MWEA 2GPJA 1W8EA 1T4KA 5BN1A 1EGJA 1GL9B 5CBKA 3ZYJA 5JLZB 4TV3A 1GZQB 2KJQA 1U2CA 5J6HA 4NE9A 5J12C 2JJMA 2RDMA 3K4DA 3SGJC 2DBYA 4OZHF 1P2FA 1F8FA 5DEOA 2D03L 4WADA 3HZRA 2WD9A 5HJ5A 1I7TB 5EU3A 5HZHA 3BKJH 1SELA 2ZJ1A 1WX1A 2YZKA 5DDHA 4NBLA 2PCFB 1NGXA 5ED4A 1IHXA 1YRWA 5C0RL 3N76A 4JJFA 1Y4DE 3GEWB 1UT9A 3S2CA 3KJGA 4QJBA 1NQXA 1NW8A 2AL7A 4UXIA 3RC2A 5MP6L 2I80A 2AMUA 4N8VG 5HYVA 1MHEB 5I16A 2Q8BH 3BZ5A 5CR9A 1RQLA 2FXVA 5ALPA 3ILSA 1RPJA 2CEKA 4XVSH 1J0DA 1XVTA 4FERA 4G7SB 3CX4A 1CFVL 3LYAA 4GFXA 4X90A 3WBDA 5LB1A 4OVKA 1OFIA 3DOHA 1RP7A 1T24A 4R1OA 3IQZA 2NY5H 4BO3A 2XUZA 5AHRA 4R7LA 1UOWA 2W59A 4A7QA 5KTOA 1WU8A 5T1KB 4HV4A 2BUBA 2GUOB 4TN5A 1OZGA 4GLLA 5C0ND 4QTTB 4XX1A 5BZDB 3BF8A 2ZWKA 4XN7A 1IQ0A 4YNBA 1U0FA 1JP7A 1P17A 3ONFA 5HJ3A 1UC4B 1HHIA 3PHBE 1BSVA 3I5UA 1CE6B 2H4XA 1V35A 3RRYA 1C7QA 1V7ZA 4XASA 4TUJB 1EUTA 4E9LA 4PLNC 2HMVA 5C07E 3K6OA 4DDVA 4HMQA 3P9NA 1TA4A 5I1KH 4JFAA 4KFSA 1R24B 1NW5A 2ON6A 4UOQA 4FC7A 4ZHSA 1FNNA 3F7RA 2QTBA 4WINA 2BM3A 5KIAA 3SJAA 6NULA 4HJGA 3A9RA 3OQ1A 3U4IA 1EZ1A 3OJ2C 5IWLC 1JDCA 5B7QA 3WL9A 3GMNB 1T8YA 1CK4A 4Y1AA 5KJFA 1ZXQA 4IV0A 3UAAA 1XVIA 1GNPA 3TL2A 2XXJA 4MQ7A 4Z7VF 3AERB 4LCCB 4WKCA 5BURA 2GK4A 5J58A 3PI6A 1IQDA 4BVEA 4XH9B 3GIZL 4GMTL 3SBRA 3F96A 1VRWA 4AICA 3OJLA 1L7VC 3BHIA 2VQ6A 1JXQA 1QH1B 4O9HL 3ZWWA 3HXQA 2DZEA 1Q1EA 1KJVA 3UK0A 3GCDA 4DEVA 1PQWA 3GPIA 3GXDA 4TSAH 1J0BA 3UTSA 5EKUA 3AQIA 4QSMA 1P2BA 2BFDB 1RJ9B 1TM7E 2R4SH 1CJYA 3GF4A 2NQDA 3IPCA 1JGUL 3QUZA 2ORVA 1TJIH 3DZKA 2GXSA 3MREB 3AFHA 5JG7A 5IAOA 3DWEX 4A7SA 1I3KA 4RRPA 5DJCB 5B8CB 4KFTA 2DKNA 5I8CB 3CKKA 2H3EA 1QS0A 3V33A 2A6KA 2DC1A 4B6SA 5IF9A 4GXVH 1UXJA 2A73B 1PIFA 4J27A 4ZOBA 4PJXB 1RAAA 4LF4B 1U8JB 3KYMB 3S55A 3QJZA 3RU7A 2CF6A 5AVYA 2QFPA 2ATCA 1D6VH 4XD7D 3TA3D 2BM9A 2F53A 3UTCA 1OBVA 1J99A 2JF0A 4LJSA 4OYRA 3O6MH 1Q72L 5AVUA 3VNYA 1DTSA 1P9WA 4N3NA 1BM3H 3I9IA 3SDCC 1RZVA 1HX7A 5K0GA 3V0AC 1PFYA 2UYCA 3O3DA 4HXEB 4YV1A 3IE4A 4F2ME 4HBZA 3T3MF 4P2RB 1U3WA 4FJ6A 4MWEA 4S1SL 5DGXA 2GAJA 1L3WA 4OZFB 3BW9B 2CV1A 4AGQA 1SG0A 4BLQA 1SUDA 4MVJA 2Z2KA 2AEJA 5ENZA 3W06A 5C8YB 2ZLBA 5IY5B 1PAUA 5L9DH 1QVOB 3APFA 2I3AA 2QADC 4YYZA 3NCCB 4HKBA 2CLCX 4KUEA 1KELH 3NW9A 4GP8B 2I3GA 4MO2A 2PXAA 4AUEA 1FL3A 3I05A 1OZAA 3NI2A 5DK2B 5DBOA 5EI5A 1E67A 2AFRA 4D9QE 4OZ4A 1NUHA 1P2TA 1F6LL 3RPKA 4JOBA 4WKZB 4F91B 5DSCA 3ZKWB 4CA4A 4W5NA 1V7ML 4G9FD 3V6OE 3CF4A 1OI2A 2I07B 4FK8A 3JWNH 1STOA 2OFXA 2J46A 3DBLB 1IGJA 4Q4HA 4X8OA 4DAGH 1CXZA 1Z75A 2WUBL 1VSQA 4KI5E 3AR5A 3W7VA 2V97A 3MTRA 3LOPA 4F7PB 4N41A 4HRXA 5I9LA 5ITVA 4MAUH 1NJ9B 2VF8A 3K2UH 1XTQA 4IHOA 5GGTA 4W5TA 3HI5L 2QQ0A 3LN5B 3JTSB 5FYLH 1ZGBA 4EI8A 5K0CA 4Q2ZA 2FI1A 4WKXA 1M71B 1WXQA 4QAWA 4C21A 3CWZA 4ON9A 1MCLA 1B6SA 4L8GA 4CM4A 1IPEA 1JFFB 1WGOA 2WQXA 1OPOA 1DN0A 1A6PA 1AIFB 2XG4B 1SZJG 3DUWA 1AIZA 3ECQA 4JQYA 3SDXA 3ZSSA 2DDQL 2ARJA 1GA4A 3VXPB 5BORA 3HUJE 3ZBMA 2X3AA 1KIRB 1HZHH 3BP4A 3RQ3A 3K6IA 1ABBA 5KBKA 1R5WA 2W07A 1NC2B 3K15A 4Q9KA 2AJYH 3M07A 2WXOA 1ODAA 5M5BA 5A5DA 2NSXA 1QQDA 2WHEA 2WLJA 3W0WA 4LCIH 3GLRA 4JFEB 2EX4A 4NAMA 4WN3A 2XTZA 4HVTA 1M5RA 4OIIL 1LBQA 2JH9A 3CFQA 2CBPA 5EKSA 2OCXA 1RXSA 1UD4A 4LXIA 4OLBA 4OXNA 1NZRA 2GSGA 1NVAA 1AO0A 2BW4A 3VWKA 3N28A 1EUQA 3BH9B 4M62H 2HQ1A 2KZ1B 4P9MH 2P5PA 5FO8B 3RWMB 5B53A 4IU2B 4NZOA 5HUQA 2VXQA 4COKA 3HA3A 5J4LA 4Z76A 4DXDA 2F90A 2CNDA 1W94A 4Z3EA 1JPJA 3U2IA 1ITBB 1TCMA 1Q0TA 1IBLB 5KOYA 1O03A 2EDQA 4DM7A 5GMOA 2NY4B 4R51A 3BL8A 2ZWOA 1YK1A 2P8PB 1PHRA 1FO0B 3IMSA 4TVKA 4EENA 3ROKA 4Z7VB 2FDCA 4ZMYA 5JCXA 2YBRA 4LCCC 1XHFA 2DQGL 2V7WA 3JD1A 3OZ9H 4Q5IA 4GSXA 2W0SA 4F11A 1X15A 3JQFA 4NXNB 4V0RA 3NFSL 4KVZA 5AXCA 1OL0A 2VLJE 1OASA 1NKSA 3R7DA 3B5IA 3WAJA 1DO6A 1VKZA 2ZXQA 2ST1A 4F8EA 4X1KA 3QUXB 5BS0E 1NFKA 1SM3L 4Z3HA 5DHSA 4P08A 1DQJB 2VR4A 1R9GA 4PZZA 5B8CC 3EJCA 3LUKA 3FPYA 2WU4A 2X09A 3GIDA 4O8CA 2QLFA 4MKGA 4ZDWA 2WU8A 4CL3A 4WO4D 1U5AA 2LW7A 2O6HA 4EQ3A 1J2YA 3GQBA 2UWEF 5T3XL 4YDKH 2JG3A 3A5VA 3DARA 2Q2EB 3DX7A 1OW3B 2QP3A 2O6LA 1AR1B 1TDJA 1NIEA 2C77A 4H7FA 1V3QE 2ZOSA 5ICZB 1LL1A 1BIFA 4DWVA 1CLZL 2QLYA 3L4TA 1DV1A 3I2CL 1FZOB 1E5YA 3M3PA 2HUPA 2QUAA 4ER5A 1T6YA 5TX7A 1EVKA 3W11C 1TKRA 4APXB 2VXSH 2FGWL 4KAXA 6FABL 3T3MB 1O2DA 4ZNEA 1T80A 3IUPA 1OAAA 4F3KA 4DT2A 4ZMOA 1CY7A 3WFJA 5KW9H 3D12B 4U7MA 1GAFH 4FFRA 3NA9H 4A7PA 1CI5A 1RLWA 4EDXB 1RLMA 2I2WA 1HHJB 4JRXE 4TWAA 4YMLA 4P5MB 2ZIEA 4NC1C 3MM4A 2O8BB 4AVKA 1YQUA 4HPOH 3EO9L 3L6FA 2XH8A 1PTJA 1GXEA 4NZNA 4DBLE 2AC4A 5A9RA 2C4XA 4HGRA 2Y0DA 1L7MA 3FUFA 4ZFZB 4PZ9A 1JW9B 4JL1A 1O9GA 3BSZL 3KNZA 4WXMA 4TUKH 4RGNB 2OYPA 2XBLA 4PBTA 3KAAA 2CBXA 5BNTA 1BG1A 3I9MA 2NNAA 4FZEL 3GEGA 4ZOEA 1YMUA 4KQCA 1MKFA 4NQDB 2VZ8A 1P7HL 2HN7A 2OWEA 4O2FA 3GI8L 2EKQA 1AMOA 2EH8H 2PZGA 3QUKB 3I6GA 2H5EA 4IXDA 4CUZA 4F4IA 4CVXA 4XNUL 5DXAA 3IJEA 4JLDA 4WEUD 3DZ8A 3MTBA 4KMMA 4TV8A 3F71A 4P2OD 5JV5A 3WTVA 4GOLD 2AR9A 2EW8A 3MD9A 1M53A 1E94E 4C89A 4M0UA 4EQ6A 1UD5A 4QUGA 4XARA 1TTQB 4BBPA 3NCYS 3RH0A 3GP3A 3ROPA 2E27L 2F3RA 4QDUA 1AN0A 4E46A 3LAFA 3RWFA 1N0XL 3OQMA 4PLVA 3P26A 1Z15A 3X1YA 5G02A 1R3IH 1RLTA 5EESA 1IHOA 4OCSL 2MTAA 1TQ6A 4UBNA 4N8UA 1DT3A 3SD5A 3ETHA 1TEVA 2XIBA 1FHNA 3GIVA 1ZXKA 3GNMH 1YMQA 3BD4A 5AAWC 4Q3DA 2DEYX 5I1LA 2V7NB 4KDEA 2ESVA 3DULA 1RL1A 2VE6B 2LFGA 2MSDB 1J00A 4QUJA 3GVXA 4Z0BH 1P5FA 1NKOA 4LE0A 3N6VA 4PXSA 2O3UA 2GZDA 4BNJA 3NV9A 4DDKA 1VCOA 2I26N 4U1LA 2XN9B 1HOEA 4IEFA 1XRJA 2YGOA 4HEHA 3WKDA 2A9MH 2QVZX 1OPGH 2EO9A 3KXFA 2VOEA 1Z6XA 4UUMA 3KTOA 5AYVA 2DWDB 4PJBF 1CUHA 1TGVA 1UANA 3BVPA 2Z8XA 4KQIA 4JLMA 2RARA 3GZPA 3L18A 3ICEA 2C95A 4F6RA 3FB1A 1E90A 4LRIC 1IZ7A 4AULA 4K9JA 1CUJA 1JV5A 2R29L 3LCRA 1OB0A 1SUPA 2IWKA 4ILKA 1NFDE 2R1XB 3FFCB 4PJ5D 1TCRB 4O63O 2NY4C 2VW4A 4NJEA 4L02A 3LZQA 4ENRA 5IK2D 3WTSA 1DCTA 2YD6A 3I45A 3D18A 1KEEA 1II8B 2V5AA 1CR0A 1F58L 1Q9KA 3BTSA 1ZVYA 4J3OH 4YYEA 4CWAA 3DVFA 3H2IA 2JCCF 4KI1A 2IDQA 1IBYA 4ATNA 4JFFE 2B1HL 3AIOA 2IXGA 1E3SA 4U7JA 1RS0A 1EDQA 1J5OL 4LBVA 1HWWA 3FO0L 2Q99A 4MS3B 4J1TC 3G0DA 4OKSA 3DVGA 1BFVH 4QJ4B 3P2YA 4OI1A 1NL3A 3QUXC 2P8LA 4MXDA 2BGKA 1JG9A 2ERYA 1GMIA 4DHLA 1YAIA 4A1RA 3QMMA 3KKMA 3KQHA 5JPNB 1EFRD 4EHIA 2UWEB 4XWYA 1IXYA 2Z2YA 4FQXA 1AR1C 4RD4A 3ZJ5A 5B1IA 1LVUA 2Q2OA 3OR7B 1PV2A 1O5TA 2M2IA 3KJ6H 4PWKA 1YUMA 3FMGA 3RIHA 3TRDA 4QY8B 2GB2A 2AF2A 3E8UH 4GXUM 4OT1L 2VJ8A 5DQJB 5IASA 1DBJH 5BNXD 1DUYB 3DVNB 1H0HA 3DV0B 1G3UA 1UBLS 3S96A 3G2NA 3GMMB 2FK9A 3DA0A 1JFSA 3ZKXB 2WF8A 4DNFA 2JCGA 2O5XH 4CRPA 1NXTA 2GPWA 4PZEA 4P4RB 5IHZB 2D06A 3CW2A 4BU1A 1F8UA 4EI9A 2ENPA 4OW6A 5ALRA 4WZAB 1SQSA 2MHAB 3OAAA 3QJOA 2ZI7A 1GGJA 5DJ2B 2FUG1 2SECE 1T1WA 3NANA 1ROCA 4W1TA 5DGDA 1M2EA 4ZMRA 3DVQX 4L2IA 5DEGB 4JRYE 3FJYA 1JDBC 1NP3A 1QHHB 3U19A 2KI6A 3ROTA 4DT1A 1C0KA 4BSVB 4GIAA 2BSTA 4RGNC 1T89C 2CCWA 1QJCA 4WLOA 4YUWA 2P28A 1CFSA 1RZKL 4GP4B 4JRLA 5D1QE 4RA9A 2VDUE 1TUIA 2AFHB 2WV9A 2UZ3A 1HRKA 3CPLB 2IHTA 5IB1B 1N2JA 3DNPA 4TVPD 4K9RA 1T1XA 3E82A 1T6BX 4HS3B 3QJRB 3TTWA 3WJMA 3SDDA 5BUZA 5BXYA 5LXTF 1C8PA 5D7IB 5HDBF 3KPRB 3MUGA 2KMLA 2BHUA 3VXME 2FUCA 1ENYA 3CGTA 2QX8A 1AA6A 3HG0A 3JVIA 2BNQB 1XZWA 3KRTA 3A6OA 3BWSA 4PV7A 4LWPA 7ABPA 2YHIA 4YHOL 2V4LA 1PJ4A 5EGSA 5NLLA 3WHKA 4HQ6A 4X24A 3PREA 1PFGA 4IKIA 1S4QA 2EC9U 1KJ3H 2ZYSA 1CDJA 1BW8A 1TYCA 1OFUX 1SMAA 4M7ZB 1C7FA 4HQKA 3LS4L 2WOOA 3JATB 4Y2PA 1AQ6A 2WLIA 3E7FA 3QNUA 3O7WA 1OAKL 4KNTA 1NCCL 1D5RA 4YDJB 4PZUA 3GMPA 2YFHA 1Q83A 4P3NA 4NO5A 4QU0A 4KJWD 3DETD 3NM6B 1AUXA 2C4TA 2B0SH 1XKQA 1CZUA 5DCYA 5JCJD 1SXSA 2R0QC 4WN9A 1E2KA 4GLFA 4W8HA 5MEQA 3EEFA 2EZ4A 3OX8A 3WNKA 5IMLB 1XNGA 3O9WD 1G291 1TFHA 5IZCA 5H35A 2IQ9L 2WWKT 2FSVC 3NAQA 4CG3A 1IXSB 2BFMA 5JIBA 4PJBB 2IVFC 3GB9A 3TFBA 4FCTA 1OREA 3U3KA 3GZOA 2H8PB 3RROA 3L9RA 3BD3A 1PR1A 4D9RD 1TXGA 3PFWO 3VI4E 4LU5L 1IM9B 3RBSA 3L48A 3MXWL 5ELMA 4ZCSA 3OSVA 1KSFX 1SIWA 1NF2A 3LD9A 2ZJFA 4BFUA 5IESH 4E0RB 3QFJE 4XP4L 3VD3A 1F4XH 2VHVA 2DF8A 3OZBA 4CHGA 4NNYA 3JAWB 2I6FA 4O00A 3O4LD 1B8OA 1ORTA 4BFXA 5B30A 3BAEL 4BMXA 1ZT1B 1D5IL 1FJ2A 2DUUA 2JFNA 1NN5A 3GRRA 4PJAF 5AOKA 1QZ1A 4MS1B 5I9TA 4LP5A 3CC1A 3ZCXA 3F6IA 3H0KA 3CLTC 4OLZL 5EUKB 2JCCB 4DEPB 1JZ5A 1WNFA 1RHHA 5C0IA 2R84A 3I6LE 1MMFB 4DKEL 3BDYH 5HFNA 3T7TA 1U0OC 4Q1EA 5AKYA 4NKOB 1U9IA 4B3BA 3LZRA 4NFLA 4TOYL 3V5KB 4J3BA 1NGPL 1QE0A 4L4TB 1X1RA 2WYIA 2C5FA 3V9EA 5A43C 2BV3A 4Q0XL 2R1YB 1NWPA 1VL8A 3P4NA 4K71B 3SJVD 4G5FA 4MXQC 4QXVA 2TECE 3UAFA 3PIDA 1NFFA 4RORA 5CB6A 3RWEA 4D9HA 4NQQA 5FUOL 5JPNC 1GCFA 3R8FA 1ZVSA 1UACH 4YGAB 2W5PA 3UBXI 1SVMA 2NSLA 1WUJS 2B1AH 3S8GB 1C9SA 3LCMA 4HJRA 4W1PA 2GN0A 2QUJA 4HNRA 1X86B 2EV9A 5LL6P 2AAVA 5E08L 5CJQH 1SXHA 2VMEA 3R3WA 5F2KA 4RFVA 3G6JA 3RIYA 4U00A 3H2QA 2IYXA 5GINE 5JISA 4OGXH 2O7NA 4Y4KB 5GGRY 3ZKXC 3I75A 3T15A 3MOSA 3OXRB 3N0TA 1LO0H 1XFDA 2Z7WA 2JAQA 4Z4EA 1OAUL 4TQEH 5D70L 2HRRA 4JE0A 2PX4A 3B5JA 3WTBA 4OM1L 4MKTA 2JEOA 2ZRDA 3GWJA 2QYHA 1JPFA 3NABL 1HH9A 5I5MA 1GDDA 1M72A 4PGHA 2VLKE 3GRUA 4MMZA 1JRLA 5EKXA 4C3VA 3MRCB 1UKZA 5TDPB 3VD5A 3GUUA 5TGBA 1HOCB 4NKDB 3MRSA 3J80A 3HC4H 1J24A 3MV9D 4FHFA 3ESVF 4BNDA 3ARPA 4EYKA 2YPVH 4LE1A 3WDKA 1THZA 5ACZB 2A57A 3RKUA 4BQ8A 4AZ0A 2OHHA 1KQNA 3U30B 3QCVL 2OM5A 2NNLD 3MV7B 4G1EA 4OTXH 4UTCA 1OGSA 5C97A 3LPOA 1BCRB 2IXTA 5EUBA 2BFVL 3PX2A 4WASA 1MOEA 2NX5A 1YEIH 1C8BA 5KVGH 2F8IA 2V7QA 2GYWA 3H8NA 3JD0A 2MSWA 2Y3IA 5DFVC 4Z9XA 5LXTB 5GGYA 1B0PA 1KJMB 1GJWA 2C2XA 2DH5A 2R0WH 4L6CA 2NW2B 4YCNA 1TVCA 1CUDA 2F54A 2B2CA 2IP1A 3EBHA 5IJ9A 1WBYA 1V10A 2YUWA 1M2JA 2VABB 5DUPH 4NHUB 2ETVA 5ALUA 5CT4A 1AY1H 2NT3A 5TPWL 4R0LA 4JG1L 5FWRA 1D2AA 2PZ8A 4KUZH 1HE5A 2AR7A 4Y2GA 1MZZA 4CNIB 1I7RA 4O59O 1X3LA 2PSSA 1GKEA 2IYAA 4OMUA 5SV2A 1R9FA 1RZ8A 3MODL 2IXQA 1OXMA 4BYGA 4KYIB 5I73B 3FOLA 2QFRA 4M7ZC 3ELAT 5L40A 3GQFA 5HTSA 3Q2KA 3L8HA 2TAAA 3HBQA 4K7PY 3GAMA 1R9NA 5A3VA 2BZ0A 3KWXA 2BMKB 2E59A 3OGCB 1DRWA 3FTXA 2WYWA 5CGQB 5C7YA 5J56B 3QXTA 2ZXFA 3TMYA 3MLZH 1UJCA 3AS0A 3W4KA 3UJIL 2ID8A 4OF4A 4RNDB 4L1SA 1E7WA 4MCYB 3EIWA 3UO1L 3RWBA 3QS2A 1E7SA 2BUAA 5JPDA 4YUAA 1YFJA 3DR3A 5CRIA 1E9QB 5D3QA 1GZUA 4PCLA 1NE2A 4LASH 1FVDA 3TCNA 4DBZA 1A1OA 1E2JA 1OAXH 3FMGH 1QKZH 3VTMA 4HWOA 4BMVA 3FONA 1V3MA 4DUYB 4JPVL 4JDEB 1ZLYA 4F0JA 2Z57A 3MAAC 4MW4A 2WNIA 7FABL 2OSBA 3KYKH 1LO2H 2AITA 2CIIB 3VVCA 3HBPA 2BTEA 2Q9CA 1NGYA 3IDYB 4I13B 4L8DB 3SKJL 4AO6A 1NNUA 3ZVVA 4OXIA 1E5UI 1UZAA 4JMLA 3QI2A 2PR9A 4KAFA 1Z5WA 2F59A 3UXFA 3GT6A 2HOQA 1KXHA 4PJAB 1T04B 4RH4A 3HCBA 3C7AA 1I9JL 3PBKA 2ZWZA 2QVGA 2R1VB 4YDZA 2Y2WA 5CLHA 2PKDA 1VYUA 2D5AA 3LLUA 4DEPC 1AZVA 3V6FB 2ZD0A 3RABA 2XVXA 3WQRA 4K3EL 4KNSA 4QC2A 3HPLB 3CFMA 2BAGA 3QJSB 4NAQA 1CJTC 5CCJA 2JGDB 3KKZA 3NOIA 1KCVH 3HI6H 1YS7A 3CB4A 1JCKA 3KPQB 4U2GA 3GK8H 2R7KA 2NZWA 2JELL 3FVVA 1RYZA 2XRAL 3WEAA 1HE2A 1NXWA 3MWDB 3RS0A 3X2SA 4DG8A 4JX9A 1LI4A 2G60H 2J87A 3QIVA 1BVUA 3BYYA 5AYUL 2PSDA 4FQLL 4TMXA 3MRMB 2PR4H 4BGIA 4DPBX 4UQBA 1GYRA 3FCBA 4XGRA 1IU9A 1J0XO 1GLVA 2H4ZA 3P9YA 3P96A 1BA9A 1FFXA 2LT9A 3N70A 5IU6A 5AJYA 1DNPA 2R56H 2O30A 1Z6AA 4E9TA 1U91A 1XBRA 3TX4A 2PPLA 4BWTA 4PJ7B 3OZFA 1BZ8A 2P0EA 3O03A 1KFAH 2E47A 4QD3A 4K6HA 3ZV5A 2XMZA 5DQ9B 2XWQA 1E7RA 1G7TA 3T5PA 3IM1A 4Y4KC 1R7RA 3OMAB 4NI5A 5DJXA 2BR3A 1BDJA 1GZ7A 3S44A 2LWIA 3REOA 1U8HB 2HQSA 3LIUA 5AVXB 3RLIA 3KX2A 3QXGA 7REQA 2PXXA 1MRDH 1YRKA 4UD2A 4HXAL 3SLRA 3X3HA 2GQ0A 3MHZA 1U8KB 4JM2F 4QRRE 5I1EL 3UYRL 4LCYA 5KVSA 3GG9A 3P1JA 2FMIA 1MAVA 1Y9ZA 1BAFH 1TIPA 5B7EA 1Y1RA 1MHHA 4JNKA 3TZQA 2FY8A 3D39E 4L18A 4OMCA 1E5DA 3U30C 2G7MC 5F9JB 1B6UA 4OLFA 3WOVA 4HZIA 4HSGA 3CZFA 1IAII 2OMXA 2ZE6A 3B2MA 3TBYB 4OD1H 5JNLA 2AJVH 1O96B 1MJJB 1UEYA 1J0IA 4O02H 2A9DA 5DGTA 4RF2A 4HG2A 5BN3A 2UZ1A 2K7ZA 2FB9A 2XTJA 3B3QA 3NYIA 4LCBA 3QDME 3OSKA 1MJNA 4X0KB 1CDCA 1LBEA 4ELDA 1CEQA 1GTJ1 2CZNA 2J4DA 3WYNA 4GEJA 4OVVA 1GDHA 1XR9A 5TF1L 5EZJA 2Y05A 3ULSB 4A6EA 2BKEA 4OB5H 5FUXA 3IRPX 1RZQA 4JHXA 4NG4A 1GYUA 3N1GC 3E35A 2EUVA 3K35A 1HKUA 5CZXC 3FQRB 1EO8L 4AKTA 4C56B 2Q0SA 1Z12A 3O2SB 1PWXA 1RWWA 2DLHA 1LVHA 2J6EA 3IBGA 1WCBA 4J8QA 1VZ2A 2I2AA 4JDUA 4FTVE 2OBMA 5TE7L 4ADGA 2O6DA 3PEVA 4HBGA 2ZPTX 5L3SB 2YD5A 2JFHA 3KS0J 4ZPTA 3QGMA 2HI0A 5F6HI 1G64A 5D4JA 3QYMA 3O2NA 5I73C 5K6RA 5AJZA 3RJQB 3VHXB 4UHJA 3DMDA 2VUKA 2MOGA 1FFCA 3HA2A 1P61B 1CFQB 1J87A 4K9MA 3TE7A 4EKEA 4Y30A 1KT2B 3TEWA 3IELA 3T95A 1OD9A 5GY7A 2AJLI 1E5QA 3W6UA 3MRPA 1NV8A 1O6BA 4PG2C 4WWPA 4N6RA 2RB8A 2NZ1A 1J90A 4Y2SA 1AQKL 4AC2A 2ARWA 3G5TA 1KB5L 4JFPB 2WIDA 2LAGB 4C3UA 3ITDA 3FF8A 1V25A 1CT9A 1AKJB 1F0NA 4IK7A 1MFPA 2ZXAA 2WTBA 3JWDH 1BECA 2X2IA 3FTGB 1HQYE 2FW9A 5T3YA 2CR6A 3EZ8A 3PA8A 3BWDD 1SDDB 2ZNWA 4LLUA 3OJXA 2UX7A 1KMMA 5IBLD 2QMUA 3DI2B 1Y7PA 1GY8A 3RDPA 2EDKA 3KPPA 4UE6A 1SURA 4UUBA 2WKOA 3J81A 3NYQA 4WCDA 2PM8A 1HH6B 1E9BA 2FEJA 5ACLA 4I55F 2HFGL 2OMWA 2YRZA 3IDYC 1YH3A 5MEPA 3Q3CA 1ZK5A 2G28A 2CFOA 3UB2A 5C1OA 2H4JA 3H2ZA 5CILH 1XIWC 8ABPA 1XCJA 2H65A 1CU1A 1PV1A 3KL5A 2Y67A 5A4JA 4MCHA 3PNKA 3MLRH 4JBYA 4EUPG 1PG7L 2PWFA 4RHFA 4OLHA 4EA9A 3EO1B 1MG2C 4EGFA 2OZ4A 3ESOA 3CUPA 4A91A 1WEHA 2C96A 3PNOA 3U37A 3AR8A 1E1CB 4LYYA 5DT1H 4HFWB 3PRHA 3CZQA 3SJBA 3ZLTA 3K4HA 4I85A 3AY6A 4D9IA 5I4KA 5E2VL 1YONA 2JKWA 1V7NL 3WKCA 4Y6RA 1C3JA 3VXTA 4JS0A 5K0JA 2FPGB 1A5FH 1V05A 2YAPA 2AZXA 1W2HA 2X4DA 3X43A 4ANWA 3Q7QA 3R6WA 3APCA 5JWHA 1E61A 2V8OA 4IJVA 4MUHA 5E8RA 1G1AA 5LP6F 3UEZA 1QU3A 4X5XA 1Z0SA 2DH3A 2IDKA 3KM1A 4UJ5A 1BXXA 1XH2A 2P5WD 2XNSA 4G0XA 4RVCA 3KZOA 2CGYA 4WK0B 3O83A 1I1QB 5E1DA 2QTHA 4UU1A 4KR7A 5HRUA 3E03A 5FYQA 5GADl 4L76A 3EXIB 3N50A 1CGXA 1NC1A 4YWHA 4HADA 1DXOA 3W5NA 4CIBA 1J8QA 5ALQA 5IEHA 2W0MA 4LXUA 4R1UA 1DC8A 3AT1A 3PXBA 2FEWB 4A82A 4OUKX 5IT2H 3FFBA 3WV5A 2Q1WA 3G5WA 1L9MA 1D5MB 5CZRA 1ZJWA 4KTEH 3FD8A 3NEYA 3KAQA 5DGQA 3N04A 1MVUB 2IMMA 1KOAA 1GRNA 4IGAA 1LDNA 1SUSA 3L3DA 4JM2B 1GNSA 4JUDX 2CWDA 1MCFA 4DR3B 1DWPA 3QDHA 1N2GA 1ORWA 1JI3A 2H3XC 3VFOA 3HN6A 5AH0A 2DX7A 2Q41A 1J1OH 1LLUA 5IM5A 3WE7A 2HJGA 5HPYB 5EA0H 1DVTA 4DP0X 4LHJB 2H7WA 3EAFA 3G04A 1C30A 2WN3A 3DJFA 1N0LB 4B35A 1NAHA 5IANA 2WHYA 5DPMA 1QPGA 4TYYA 2OOKA 3LXCA 3LPMA 4MWOA 3ZIMA 3RTDA 1ZRUA 2KQNA 4D7BA 1K4DB 5E38A 1ES0B 4YRMA 4ODXA 1JZQA 4XZ3A 3T4AB 3X17A 1Z4PX 4B4VA 3OKMA 4X92A 3DTVD 2Z8RA 2RHBA 3VXQA 4R0VA 2PUGA 4BC0A 4P05A 1IULA 5C3LD 3QEUB 4C7XA 2W43A 3C12A 3SPHA 2I9TA 4PICA 2ZTBA 1R50A 5GZ3A 1T15A 3ARGA 1HTTA 3MA9L 4F3FB 1J06A 2CO2A 3TEMA 3QYCA 1O94D 4GXUN 1Q9OA 5JZ9A 5LKNA 3HE7A 5BW7C 3T7IA 4EJMA 4Q3CA 3IP7A 1RZKC 2V6BA 4B9IA 2PUAA 3N9IA 1C7TA 2VK2A 4B0MB 1JXOA 4LTMA 4N03A 1SU7A 4J2TA 4MP3A 1P1FA 3H0TB 5TH2B 1KTDB 4YLEA 4Q19A 3D0VB 4W9IC 2OILA 4HUXB 3T3PF 1SRQA 3BS4A 3F73A 4MI6A 4ZOAA 1G5TA 4IGBD 2WXQA 4FBLA 2OZVA 5DJAA 4ZAGA 4BO8A 1W88B 2YJLA 4D8VA 1JVLA 1SYVA 1O5DT 2D7TH 2ILVA 3HG2A 5D01A 3ARXA 5IH3A 4W4OA 1IB0A 1SHSA 1WRBA 4DP2X 1DLIA 5TPWB 4F6CA 1TFPA 1IXKA 1NBVH 5I5IA 5IJCC 3BP7A 4M1DH 4Q7KA 3RRFA 4FMVA 1FFHA 2IEYA 4E1BA 4NQEB 3VRJB 4D2NA 3KPVA 1KJZA 3O3BA 4G7VL 2DUNA 3RU9A 3ORHA 1VG1A 4GBXB 4GRDA 4WI0A 3PZRA 4XVJL 5HDQH 1P7YA 4GXFA 5GHWH 1U8OB 3D51A 4YRIA 1RWVA 5GJTH 4XRGA 1SD5A 3SDYL 4AJEA 3ZWDA 1K8ZB 4YRAA 1HDMB 3CRZA 5DFWH 4QWMA 3UJ3X 2YA2A 2ZBUA 5AKJA 1GUZA 2JLPA 2Q6KA 3V0DA 2OMYB 5AOZA 4HS8L 4BQ9A 3MV8D 3ZN6A 3VC1A 5IIEA 4PS4L 5TE4L 4N0DA 3I4LA 3QFDB 1G4RA 4G70B 2AEPL 4NWUL 4ZK8A 3TPCA 1KAMA 4J91A 5ID1B 3QX7A 1B23P 1FTGA 4YZWA 3HBJA 5CIPB 5BQ7A 4IHQA 3QRLA 1ZWIB 5FPQA 3DT6A 3N0WA 5IHXA 3GUYA 3JQCA 4XOUA 4C0XA 2YFOA 1OHQA 1ADFA 1XH1A 4QDGA 4HH3C 2BZGA 3PD7A 1QACA 4C3OB 3BHNA 4K9NA 2Z9TA 4F7TA 1C3OB 2I8LA 4XTCS 4Q52A 4UTRA 3TKLA 3QF4A 3IV7A 2V9ZA 1I8IB 1XGKA 3B2XA 4DDHA 4J7CA 1B4TA 4QHYA 2PYEB 3AVEA 2ISDA 2BBOA 3WN5B 5G4MA 5GS0L 1MABB 2UVDA 2BNUA 2RACA 1EAQA 3M7OA 5FXCH 1OAQH 5LP6B 3CX2A 4PFSA 1NYTA 1TLKA 1JU3A 5AXDA 5AYQA 4J5VA 4R4FL 3EOAA 4TL4A 2KLBA 3U3ZA 3KH3A 4ANKA 5DI3B 2QPTA 3CDGA 4KC3B 5CN1A 2COKA 2JASA 1NWCA 5I15H 1N0UA 3IPLA 3VVWA 1X9GA 3UEQA 5TTRA 4ALAH 5DHQA 4JZKA 2EEFA 4CN9A 4F4FA 2R8XA 3CN0A 4N5DA 4NBYB 1L4EA 1PN3A 4Z95L 2BFBA 3D2UA 1AZNA 1ZPDA 3VX0A 4Z78B 2XIQA 1GIAA 1Z6PA 4ZICA 2OMKA 1EVQA 1JNNL 4NUGL 3HOGA 3AEXA 1FFDA 3ABOB 2QQLL 3RUGA 4JM2C 1G7LB 1V9CA 3TG2A 2ICES 1Z4LA 4KDTC 1G7IA 1IG0A 4DIMA 5I30H 4HKXB 3QQ3B 1GGBH 3WS3B 1NATA 4XEHA 5CNMA 4EO5A 4P7GA 4QA9A 2DYSB 4P46B 4YT5A 1G5QA 3DKKA 4AKQA 4XC1L 3ZNOA 3WIHH 1Y1DA 2QVIA 2YMXL 3CK0L 3LZFL 3WZMA 1ZUNB 5EKTA 4KXZI 4X6DA 5EBLB 3ULUD 1CZ8L 3BXXA 1VSBA 3D0QA 1VKJA 3L1OL 4PXYA 4BXOA 3PLAE 2WZCA 3T4AC 4HN4B 3WBJA 3UCEA 1AMNA 3U4EA 3PWUA 2VPZA 1AOZA 2EWVA 4BQNA 1BLNA 4JC5A 1IG3A 1TJXA 2DPYA 1P7QB 2R2CA 2X9GA 4EDFA 3F1LA 3W39A 2QNRA 4IRJB 4C59B 3CEMA 1LDPL 2WGNB 4ABTA 4ZZKA 3KXPA 2CCVA 2EDJA 1TKWA 1G7JA 2P24B 5BXFB 4X5PA 3RZWA 1PD0A 3PHAA 5E4IA 3UZQA 1VPTA 4CFYA 2E9JA 1T1RA 5DZJA 4X7SL 1ZLUK 1KZYC 1TVBB 2NZ9C 1M2WA 4FI3F 1QUFA 1LSSA 2X6CA 1UBKS 3U4DA 4IUBS 4KK6D 3EGSA 2IYNA 2PRKA 4I50A 4FOSA 4S1QH 1P91A 5F9HA 1OFUA 4CN4A 1AFVL 4IVPA 5DHVA 2ZM6B 3KEOA 4CDRA 1R5JA 3FYIB 3FYDA 3P0RA 2G30A 3FUIA 4CODB 5FM5M 2XE8A 4LTDA 4Y0NA 3U13A 2XWXA 4NBSA 2CFCA 2B83A 2F9BT 2D2CC 2WJIA 1SD2A 3K09A 2NYKA 2C1PA 3VWJA 5I1IH 3CMCO 1WISA 4CUJA 3B9PA 4K94L 2REBA 4MUMA 4QNPE 1GU0A 4GDFA 3UMMA 1LXCA 4AJHA 3TVMB 2VN7A 3PFNA 4IQ4A 4XWOD 4CDGA 1KDYA 5E95B 3V4UH 5KSUB 1PYWA 4DP1X 3L9YA 1N5LA 1G8PA 2ODAA 2XLBA 5TDHA 4FW9A 1TMYA 2JLZA 1CGSL 4OPMA 4JQZA 4OCMC 3PE6A 2PWBA 4KQ2A 4QBFA 3BSGA 1Z5HA 1CGYA 3LXAA 4PSUA 4YP0A 2WLYA 4GBXC 5FM4A 4JKWA 2LLLA 4F96A 4DR1B 2XZAH 5E6RB 2EJBA 4M1CD 1ZUD1 2ZUDA 2VP2A 2X1XR 3HN7A 2P5YA 2OORA 3EFHA 4WOKA 5I2IA 1T6VN 4FCVA 4QGHA 3FU0A 2HFFB 2PMZA 1QHFA 1LK2B 4L2LA 4F9FA 4TS3A 3EBPA 1KB5B 5EA2A 4PC1A 2QSTA 2HD4A 5JSZB 4ICWA 1EIZA 1MFNA 1Z34A 5CYFA 3QORB 4WNQA 3ONNA 3AONB 3GEDA 2FEEI 1G1KA 3BT0A 2APJA 5L8JB 2Y1YA 2D2XA 4WEQA 1ODSA 1ICEA 1IBGH 4G6ML 5HW0A 4AVYA 5F52A 4OB6A 1FN4A 1WPCA 2CKDA 4EKIA 5ICYA 2V0AA 1YNTA 3WKAA 2C9QA 2G0AA 1DHTA 1DE0A 3B3IB 2WTPA 3WJ7A 1NC4B 4R4NC 4MDIB 5FWDA 2JK1A 4H3SA 4OLWH 2D54A 3OQPA 3GS7A 1WULS 1WKCA 1XDDA 4EI0A 4OF6A 5CVTA 4M9XA 4AY6A 3IDGA 4G41A 2JI7A 4EI2A 2YLKA 3HC0B 5GJBA 3WN5C 3C6LA 4EFLA 3RVKA 5C8VA 4RFEB 1JNXX 4FFOA 5KBLA 3HU5A 5LP6C 1LZLA 4Y19D 2H85A 3TOVA 1WWAX 1KMHB 2O7SA 1LE9A 4PRIB 4FLEA 4M55A 5J43A 4NE7A 2VHEA 4EA6A 1VGEL 3B9VA 2NNWB 3W8EA 2A3NA 2QTCA 3AT8A 4EGAA 5F1IA 3BH8B 1AH1A 4NU5A 2ADOA 3JWJA 1L2TA 1N9GA 4OJQA 3DJ9A 5AM0A 2I7SA 2ZB8A 3ADKA 1IAOB 1LP9B 2JHCA 2BFFB 2QELA 1F8YA 5HQ3B 4ZKDA 2PXYB 3JU3A 1JJ7A 3BPOB 4PQGA 4LHUA 5CPFA 2J33A 4G86A 1ZS8A 3F6SA 2HTLC 2EYTB 1ZMRA 3BMCA 1WUTA 3QVXA 3VXRD 3MYYA 421PA 4UTNA 1GTVA 1GO2A 3KYNB 3X1FA 3VNQA 1T6ZA 2APXA 2FV8A 3MTXA 2BP8B 2GGSA 3V52H 1IM3D 1BIIB 4RTMA 3ELYA 1KIQB 2Z1DA 4LCWB 4S3MA 5ERXA 3K5RA 2B4YA 1X77A 3QQ5A 4CKYA 4P46C 3PR3A 4OJFL 2AOUB 3CFKA 2Z6QA 4TTAA 1E9EA 1KMQA 2GTIA 1XMVA 4K7JA 3NZ8A 1YS1X 3BEWB 1MLDA 2YWCA 4BFIB 1Z36A 4JFYB 5DLYA 1IN4A 4PYKA 4NQZA 2XY4A 1LD3A 4BKLA 1X19A 3T5DA 3QP9A 3GXTA 3GEFA 4MI9A 1NEPA 1G94A 4HEPA 2F53E 5DZAA 5LKRA 3C60B 3RYMA 4AZ8B 4CN6A 4TVPH 3EH2A 3E9QA 1DTUA 4RJ2A 1LE5B 2WUFA 2ALJA 3WMWA 4P9NA 1N2XA 5CM8B 2JI9A 2J3JA 1SZNA 3Q9LA 1Q0YH 3Q12A 5F4BA 4D5EA 4KG7A 2BMFA 2IT1A 5JOEA 3KWUA 5ALNA 3SE7A 1HIMH 1G7HB 1MQKL 1XCWA 3IEIA 3BJMA 3RF6A 1OANA 1L5LA 3VZCA 4LWOA 4DMHA 4MVJE 1FSSA 2Y5EA 2R4RH 4HUMB 5F7WC 2ES4A 1RJYB 3PKJA 2WN2A 1GGMA 3L7EA 5DBHX 3S4YA 4W5OA 1OWOA 2PL3A 5KMGA 4ACPA 2NZYA 2ZPKL 2P69A 2H1PL 1V9SA 4BY9E 4JC8A 2BP7B 4O3FA 1SY6L 4ENQA 2BEUB 1OYYA 5F1KA 5T1JA 3A1CA 3F5QA 5AZ2L 3TVMC 1FY2A 2BP5M 4YLBA 4F3RA 4JUAA 2GMWA 5CP8A 3TJEH 1J2JA 2VL4A 4X98B 3L0SA 5C2JB 2EVFA 4BB6A 4MJIB 4PX5A 1O08A 5JCPA 1U3HB 5SWQB 4P59H 1Z17A 3BUPA 3UTOA 1SVZA 3CVWA 5D9SB 1I1NA 3U9LA 4BQSA 1C7RA 3PF9A 5A9TA 3QQ9D 2AV1A 1ZRNA 3MKKA 2LIPA 3R77A 1JPGA 3HC7A 3ECCA 3ETSA 1T29A 3G7UA 4NP4H 2J0UA 2DN7A 2YC1B 3KTDA 4QL3A 4GQAA 4RF5A 3MYJB 3ABLB 2QI9F 2IOHA 4J0FA 1V3LA 1W7AA 3KL3A 1XAGA 2Q87A 2KERA 3GH1A 2O1EA 1PX2A 1GTSA 5LMCA 5HBGA 3EPLA 5A62A 3CUWA 5C08A 5G4OA 3IUYA 3WSVA 3TF5A 4JUSA 5DRNA 2BPOA 1H9AA 2JKVA 2XXGA 1GGUA 3JXAA 4GXRA 3QXDB 2OGTA 1NGZB 5D85A 2WQSA 1ISHA 1CR1A 2QN3A 3QORC 4X9YA 3RX5A 1H3GA 3P0GB 3FW1A 5BQOA 4YMHA 3KGUA 4A5OA 4OSEA 2CQVA 9ATCA 4IRSD 2R8SL 1QF7A 2FHSA 4CMBA 4QGYA 4N0YL 2O61B 4KRLB 3RWGA 2XNCA 5EEVA 4EBFA 4F8YA 2O6PA 2RA1A 5DGIA 4H35A 3MQIA 5ILTL 2FJFA 3WENA 5F12A 4TT3D 4IOSA 2RHHA 3W0WE 1PDKA 2YKKA 3L4BC 5CS7A 3L6UA 1D0VA 1T9GS 2VHZA 1Z8FA 1T8RA 4GRMB 3AOEC 3ONDA 4S1WA 2HDOA 4DN3L 1SQ5A 3VHQA 3AI3A 1DQKA 3GUFA 1HF3A 1AC0A 3S2UA 1PYOA 4GOMD 1YDPB 2VM4A 3ZE6A 1SAYA 3OTHA 3QTTA 5DEFB 1NUSA 1R8XA 2J67A 1RK1A 5ISZE 2D6FA 1C1DA 5INCB 2K0RA 3KPSB 2HADA 1L7TL 4OM7A 2Q62A 1NM5A 4GNKA 4UCWA 2JI6A 3MLXL 3T8XA 1G9NH 3QHZH 1T2NA 5SWZA 1F4AA 2Q3AA 1DBML 1VIWA 1Z3RA 1G8FA 4Z8FL 4IKKA 2IEZA 1NCOA 1S2DA 1PX0A 1W8OA 3OR6A 1CQJB 4JG0L 4OH1A 5A40E 4IDBA 4G0YA 2VZ3A 4AENB 1FPTH 5GGXA 3WGVA 2WXGA 4Q37A 2WOYA 1E4XL 4BHUA 3V80A 4TUYF 4F85A 2SBTA 2O1XA 1CU4H 1KLUB 4YCBA 4Q4JA 1RPNA 2PXYC 2OBYA 3RWHA 2N0SA 3BPOC 4XVUC 1KC5H 1GZDA 2PY6A 3EWAA 4ZXBD 2JLWA 1FTSA 3E05A 4LQLA 4BP1A 1QGZA 4QQKA 5I0ZA 3A6CH 1CCWA 5BCAA 1MEXH 3V1MA 2FTKE 3FTSA 2VATA 3THML 4RUKA 1PZ2A 2NUTA 1ID8A 5IZ4A 5CNHA 2D7NA 1HNZB 3RYHA 2SEBB 3QCUH 4AMGA 1SUEA 4AS1A 1OP5K 5HZGA 3Q0TA 2ZI6A 3WLJA 1CIVA 1F6WA 3UBGA 5HYEA 1U7XA 3UM9A 4CT5A 2EXYC 5TE6H 1NCBL 12E8L 2P4QA 3AIMA 2DQDH 1HKLH 2N1MA 5IB2A 3FH7A 3R7QA 2IPUK 3OZ7A 3PQ6A 2YJ5A 2OUKA 3S2GA 1X39A 5T6MA 6PAZA 3EHEA 2FUQA 4Y1RB 3IT3A 3GMDA 4KXBA 1LTQA 1PSKL 1EHYA 1U7PA 3C60C 2CK3D 1VCIA 2HRHA 4HUVB 3UMBA 1QONA 5EFIB 4EGJA 1OXUA 4DFHA 4WWKD 1ZWLA 4LZWA 2E4WA 3B3FA 2GJ6B 4TTTS 3OAYK 1RFLA 1JI2A 2QPDB 1L5SA 4FI3C 1JV2B 4IRZL 3RSFA 4CTKA 2OCAA 2DM4A 2R69L 4ECEA 2CL7X 5DUBA 5HHNA 4ZNEE 3FZQA 2W60A 2ZVJA 5IW1A 3GNTA 3UTPE 1GG5A 3S5UA 3CRW1 4G07A 4B50A 2DZDA 4JVOA 3B7YA 1C0PA 1QHQA 4KROB 5EP4A 4LISA 4ZZIA 4FXLA 3NJRA 5DK4A 1C7SA 2HNBA 2PO6D 2QU8A 1VE3A 4ORGA 3CH1B 4X42A 3RQSA 2Z5FA 4RACA 1EAPA 1GZPA 3H2WA 1UWLA 4PEVA 1KE2A 1FH2A 4DTGL 5AQ0A 1UMCB 3DSNA 4ZVKA 2VXTH 3QDJD 4R6WA 2FATL 3QLTA 1TF5A 1NGQL 5D7JD 5B1KA 4JSTA 4QKXB 5GRVK 4OL9A 5L8KB 3DO8A 1MU0A 2LW3A 2CRYA 4LIQL 1IBBA 3OIWA 3W9EB 5JJCA 5JTTA 3DPIA 3DZCA 1MPTA 1GYVA 5EZYF 5TGZA 5EVCA 3NVQA 1WYJA 3QFFA 4LYEA 1A9TA 3ETJA 3ZE7A 5IC4A 1U3HC 3VFRB 1QGOA 2AXGB 1WUIS 4YFLF 4HX9A 4NC2B 3ZYCA 5IQMA 3KLHC 1M73E 4ODVL 3HB3C 3HUFA 1IK6A 1G7MB 1KS9A 1FJHA 1GYWA 4OI9A 3H4MA 1ORVA 4ZQTA 4YDLB 4MD5A 2C82A 3GNSA 4JJOA 2X5PA 4FE3A 2ICEA 5JO5A 4V38A 1H6UA 4H44C 1FYFA 3W6PA 3B6MA 2QA5A 2Y25A 2JHAA 4B7XA 3G9UA 1A7RH 5ESVA 2YJNA 4YAGA 4D4LA 4J8RA 1A1NA 4LLVB 5IH7A 4KJYB 3WKMH 1XJCA 1KPUA 4IHAA 2DWYA 1BQHB 2M83A 2WWTA 4XN5A 4AW9A 4UZGA 4A36A 4BX9A 4WOBA 1UC8A 1MJUH 3S3BB 1WAEA 4RD0A 2DJMA 1S7SB 1RBMA 3VM7A 5AL8A 3KLMX 4DLZA 2ESVE 4JJ8A 1L4BA 5P21A 4RIIA 5FECA 1B2YA 4D3DA 2W93A 2OHFA 3SE9H 4B4WA 4U3SA 3Q5DA 3TBSA 3V6MA 3MGCA 2J8HA 2DPGA 2BNRB 1HOTA 4B9KC 3AL8A 1LS6A 1SXIA 4OV5A 4PUBH 1MT0A 1JWAB 1UQTA 1KR5A 1A1MA 4CM9A 5T5NG 3VGBA 3AHFA 4RNCA 3FO2B 3WB9A 4B3MB 2UXDB 3JQGB 2CLZB 4HJSA 1ZBQA 3AKZA 3SFVA 5D71H 3W5MA 1KFCB 3D3EA 2HSWA 4WI2A 2QEQA 4U9HS 2WVVB 3WNZA 2F74A 4ZVMA 2QN9A 4DCCA 2NAPA 4TUYB 3L3GB 3U9UA 5JORA 2PUCA 5KYKA 1SF5A 1TNNA 1RH8A 1JZSA 4HCFA 3MRNB 2XCMC 4MJ5A 2ILTA 3CSBA 5DO2D 3LT0A 3ALPA 1FFWA 4QF1B 2XGOA 3NIWA 3E81A 1DWQA 1N6QH 2IP4A 3DV9A 5JDSB 4N6QA 2A5LA 4NS1A 3QKRB 2XXBA 1JUFA 4MJ7A 3MMPA 3P9QA 5GS0C 3O1HB 4DYDA 2DM7A 4PNPA 4XCCL 1T36B 2WP3O 4XODA 4Q56A 1FAIL 1HXYA 1M6NA 4AMWA 1RU9L 3TL5A 1XROA 1PFCA 3O4VA 3GBNH 4KPGA 1IM5A 2AN3A 1ENOA 4IMIB 2PP9A 3P2MA 3T7SA 3QAQA 3UJDA 4KMSA 5A6VA 4LXHA 4NNXA 2W6JA 1X3DA 3H5IA 5DDIP 2WABA 4YPJA 2WMPA 1QSEA 4DVBB 2OULB 4R96A 1VYTA 1PJ9A 2AQQA 5A71A 4WKNA 4JY5L 4WFIA 2ZKHL 2WXPA 2ZRGA 3WWZA 5ICCA 4ZOCA 4FOMA 4LJYA 3FCYA 5AVRA 3CJQA 1U8IA 1RLOA 2OE2A 4K0OA 5EJ7A 4GAGH 4PTYA 4HW6A 1QFUL 2ZXGA 1N2CB 4UDUA 2YQZA 1WAAA 1VFPA 2NPOA 1OPXA 5JIPA 2D0IA 4S12A 3IVKB 3U4HA 4EGSA 5JBIA 2OYRA 2N0MA 3LH8A 4OZHB 1E0DA 3PQ5A 4CZ2A 5CXUA 2FWIA 3EVBA 3TZEA 2A4ZA 4IG4A 4Z7AA 2Z4TA 3U16A 3GBMH 1KOFA 3QQDA 2CT8A 2ECKA 2EXXA 4C4KT 1AD9A 3AREA 1ZMOA 5KSBF 2ZX8A 4KROC 3V79C 1P1ZB 2G0NA 1AO7D 4KIJA 1BGXH 3EXHB 3PNWB 3P0JA 1KBPA 2AI1A 4HZGA 3KPMA 1EVZA 1QZTA 3E1KA 2AK4A 5E7QA 1CXHA 2BZCA 4CEHB 3CD4A 4ZK2A 4REQA 4GAAA 3E9DA 5ESXA 2ZT9C 2OV3A 2PWEA 1U8YA 3QNYA 4AP9A 3ZTJG 3E9ZA 2O3JA 5BOSA 3I52A 5LQSA 5L4NA 4U1JA 3LTEA 2HNAA 3GRAA 5IMOB 3HUUA 3H4TA 1VJTA 4HNUA 3DLCA 2D5IA 1WD5A 1WP9A 1QGUB 4XB3A 3QYPA 2X9ZA 1C1EH 1BD4A 1FXUA 2OSVA 1YDMA 1EFVA 1QD0A 4BH7A 4FFZH 5EEYA 9LDBA 1A2BA 1WC7B 5LU9A 5FCSH 5DJYB 1U8MB 3GLHB 2QI9C 5IDWA 3LHDA 1QQ6A 2QRVB 4YDLC 1U58A 1XPUA 1B6RA 1UPBA 2IY7A 1HXKA 3WRVA 2PU7A 1DUZA 3RREA 4DUXA 2VAAA 1CUXA 1EKXA 3C15C 4H60A 4K94C 3IKMB 5L2KA 4JY6A 3VU9A 1MCPL 2B8JA 1FNCA 4LGCA 1EUDA 1OLUB 1XZNA 5ECWA 4QU5A 1TM4E 2Z31A 2P8MB 2C98A 3ICWA 3KSBC 4KWTA 3D0AA 3ECBB 3D6MA 1RLBA 2HEIA 5JOQA 2F43B 3D69A 2DJ4A 2VUTA 3NH9A 1EAMA 3CBJB 3GXFA 2H8KA 5BP7A 5EOCH