5HDBB

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 114
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5hdbB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5hdbB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5hdbB03
3K72A 4DMUB 3EFOB 1IDN1 1NA5A 2VDPB 1U0OC 3K6SB 5KYUA 1MF7A 1XDDA 4WK2B 2WW8A 1M1XB 3E2MA 1N9ZA 4O3TB 1QC5B 4G1EA 1M10A 2ADFA 4HQFA 1YUKA 3TW0A 1T6BY 4C2BA 1IJKA 1JEYA 3ZE0B 4WK4B 4Z7OB 3BQMB 5KYXB 4Z7QB 3HI6A 2M32A 4MMZA 1IDOA 3EGDA 4C2AA 4C29A 1YVRA 2QTVA 3TVYA 3EH1A 3IJEB 5BV8A 2O7NA 5ES4B 1RD4A 4HQOA 3M6FA 4G1MB 4MMXB 3OKWA 1JV2B 1SSLA 1PD1A 1PT6A 1SHTX 3EH2A 3V4PB 1M2OA 1YVPA 4G1EB 1XUOA 2IUEA 3NIGB 1M1XA 3AFCA 3Q3GE 2ODPA 3K72B 3PPYA 1PD0A 3IJEA 5E6RB 4Z7NB 1OLZA 2NUPB 4IGIA 4M76B 3ZDXB 2WINI 3RAGA 1Q0PA 3T3MB 4MMZB 3EGDB 4IXDA 3HXOA 1AO3A 3EFOA 4G1MA 3ZDYB 3ZE2B 3FCUB 3PPWA 3PPXA 4IHKA 5KYXA 3T3PB 3FCSB 3BN3A 1RRKA 3IBSA 4F1JA 3TCXB 5KYNA 1U8CB 4NENB 1SQ0A 3ZDZB 3NVQA 2VDOB 1AUQA 4HQLA 1OAKA 4FWWA 1AOXA 2XWJI 4WFQA 5HGJA 3AL8B 2VDQB 1MQAA 5KYWB 3EG9B 1DZIA 5HDBB 2B2XA 4F1KA 3NIDB 3K71A 3FCSA 4JX0A 4HQNA 1CQPA 2NUPA 5E6RA 4O02A 1JEQB 1UEXC 3EGXB 3ZQKA 2I6SA 5KYYB 5E6SA 4UM9D 1ZOOA 3NIFB 4K3JB 2I6QA 3PPVA 3EOAI 2XWBF 3OL2B 1JLMA 4MMYA 4WJKB 1L5GB 1ATZA 1N3YA 1V7PC 2ODQA 3K6SA 2NUTA 4CNBA 5KYUB 2VC2B 3EOBI 4NENA 3GXBA 3K71B 3EG9A 5LN1A 1M2VB 3F78A 1MQ9A 4GZ8A 2VDMB 5E6UB 3AL9A 1RTKA 1U0NA 2NVOA 1U8CA 1SHYB 4HQKA 3HXQA 1M1UA 2VDNB 1LFAA 2ICAA 4JDUA 1MHPA 2P28A 1RS0A 4CN8A 4PN7A 1SHUX 1IJBA 5HJ2A 1QCYA 5KYYA 4O3UB 4O02B 4CN9A 1DGQA 3VI4B 3N2NA 1MQ8B 3AL8A 1CK4A 1ZONA 2VDKB 1L5GA 2P26A 4MMYB 1BHQ1 1QC5A 3V4VB 4FX5A 3TXAA 1TYEB 5KYWA 2I91A 4MMXA 4NEHB 1PCXA 3VI3B 4XW2A 4UM8B 3BQNB 2NUTB 1M2VA 2VDLB 4BJ3A 3ZE1B 4UM9B 3EGXA 3QA3E 5E6UA 1JEYB 1BHO1 1T0PA 2X5NA 2XGGA 3F74A 1FE8A 4WK0B 1ZOPA 3OKYB 1JEQA 3OL2A 1FNSA 1XDGA 2VDRB 2UZYB 5E6SB 1MJNA 1JV2A 4A0QA
chains in the Genus database with same CATH superfamily
3ZSTA 2V9PA 4U7KA 5HTSA 1GZPA 2AXQA 5AVTB 2A5YB 2EVGA 3UWDA 3D3QA 3RJDA 1G6RL 3DDUA 1OW0A 2BI8A 3ROGA 3KZXA 1MFEL 2PUEA 1SCKA 3VNUA 1QZ1A 4ANUA 4BZXA 3U7FB 5JUWA 2R97A 4M43L 3SIRA 2IV7A 1YEDB 4LCIH 4U6VH 4ODXB 3DHWC 5T1MB 4RMBA 2ZT9C 1PLLA 3M1AA 3OOWA 3HCVA 3V6MA 2BMKB 2OBNA 5JD3A 2GI7A 1Y5LA 4Q4DA 1Z16A 5F3WB 3E0GA 4PCTA 1ZIOA 3MMPA 3T1NA 3U7QB 2JCYA 2XV6B 2Z64C 3DHNA 1IK6A 3A6FA 2A74C 3I6ZA 1P84K 1PJWA 5HSFA 4EN3D 2PF6A 2O7RA 4NRZB 4BV3A 3HN2A 2DM7A 3G9VA 4KK6D 4IH4A 5DI3B 2CLDX 4KKAC 3LI2A 3L4JA 3NIFE 3PLNA 1JZ5A 2X2FA 2JH3A 3ZWWA 1WFUA 1H2RS 4AENB 1K4CB 2QSQA 2JI7A 4BH7B 4W9NC 1MAMH 1L4EA 1UFUA 3P0IA 4XW2A 1OGJA 1D4FA 5TD4A 2WJ6A 5JOPE 3VR6A 1YR9A 1U7TA 3JWHA 5C0BB 3H0KA 1H4QA 4BUGA 5F33A 5I0WA 1PJSA 3JD1A 5LQNA 3FMIA 3NZHL 5BRPA 5LZ8A 2ZVJA 4NZ8A 3G49A 3GLIE 5DTFA 1E6JL 3MODL 3FFDB 1L6RA 4K9PA 1NCHA 1RDFA 2O0KA 4JK3A 1YTUA 2YD0A 3VO2A 1Q19A 4S2EA 4BKOA 2F9BT 3K5WA 3O73A 1KJ8A 3GUVA 3P9RA 4MAYC 3L5IA 4H0FA 1G8KA 4P83A 4CMIA 1C41A 3KC2A 4DRZA 3LZCA 3W39A 4NHUB 2FPSA 3F5MA 1FH2A 1AZBA 2BZSA 1KCRH 4BIKA 1L2TA 1NCDH 1CG9B 3O41B 1U8NB 5E4YA 4DLXA 4XE5B 4JBGA 3HEIB 2V5VA 1UMDA 1Q72H 5D7EA 1HQCA 4NOMA 3U6KA 4LJLA 5D4IA 1YZGA 5HHPB 1CUUA 3KVVA 4LJ6A 1W49A 3TYFB 2XNDD 2V37A 5IESH 3ZI0A 2EJCA 2H1CA 3FSGD 3D5OF 4P2RD 2YV4A 1U1EA 4MKRA 2IW1A 1WD8A 1YNOA 3L3OC 2AI2A 4ITUA 3VM5A 3GEPA 3G5UA 3B51X 1X9IA 3GUZA 4O25A 3GLTA 4J91A 1M53A 4WEMB 3M1BA 3K1ZA 2C3YA 3PL6B 4LSTH 1M2VA 1QLWA 4BJ3A 1EQWA 1SF3A 3KVPA 3NONA 1UKCA 4ZQGA 3N6XA 3VH8B 1Y6ZA 4JY6A 3O91A 4G2AA 1PGRB 4PG7A 1CS6A 3EYSL 3UX9B 1A88A 2B7CA 4DKAA 1R5VA 1WLYA 4G6JL 4DL9A 3VYTB 4ARZA 5AVYA 3QJ5A 2DHDA 1UJ2A 1OBCA 4GM1A 3TDKA 4YXKL 3FNGA 3PPYA 3UUFA 1ID5I 2EQ5A 1PWEA 4A04A 3REQB 4G4SO 4ELMB 3Q5DA 3VO1A 5GRZA 4MKHA 4ZYTA 2G1KA 5L2KE 5AJYA 1MFCL 4XVRA 5LMCA 3PWNB 1S7QA 3Q8EA 2GRAA 1EX9A 4LE8A 1CZNA 1T8SA 2NY6D 4XNMB 4ARZB 4CR8A 1FUYB 5U4XA 1NAML 1NKRA 1G2PA 2EQAA 4XWGA 3OIVA 3CNKA 1RZ7H 3K4DA 3EYQC 2NY1C 2J9FA 2WZAA 1TMYA 4L3FA 5FXCH 3SKNA 5LMZA 1KB9J 3IQZA 2QEQA 3FUTA 1JV5B 4JREB 1B0ZA 4FEGA 3DE6X 5KSBA 1JK8B 1F1JA 1KIRA 4PGFA 5A7HA 3DVGA 4D3CH 4Q7JB 4JQIH 43C9A 4JZNA 2QQGA 5I5RA 1A7NH 2HYDA 2FG6C 2XUZA 3HL4A 2VSMB 4Q93A 2OL3B 1S1CA 1AGCA 3TW4A 4BQNA 2EKBA 5KOMC 4N1EA 5DBOA 4E5PA 4XWKA 3V9FA 3IOBA 2NY7H 4ABUA 3PFIA 2QTLA 3PD0A 4HS6A 2YXEA 3STTA 1TK2A 3UG7A 4DC0A 1FVXA 1QABA 5DNAA 1B4TA 4COOA 1YT5A 4CDHA 4M1GH 2B82A 4TSAL 3NV9A 4MQ7A 4NBTA 3W0WB 3AWEA 4HNSA 2XCSB 1D7CA 3E53A 4DUGA 2L2QA 2WVAA 3PGXA 4ZZ1A 4AO8A 1GPYA 3MRNB 3BKML 5JDIC 1FNGB 3M2TA 4YX9A 1OAKL 3CUWA 4GVPA 4TWJA 4PRHD 4TLDA 1NCBH 3ZTJG 2E6PA 3VH3A 3VPAA 4D9IA 5JPNB 3L81A 5BQOA 3TH5A 4GMTL 2HHJA 5DISB 3LSOA 3CVBA 2J0EA 4FYVA 1NV8A 1UWEL 3EGWA 4BQ8A 2JJ1A 3BEOA 2EDFA 3BVDB 1ZA1A 1FUIA 4MIEA 5C5EA 4OIIH 2WDPA 1Q12A 3NCYP 2PWFA 2NQDA 1H69A 3PUYA 5K93A 5DTFB 4N2CA 3SXJA 3ZBTA 1U3HA 5AZUA 3D43A 4J7XA 1LO5A 5FUYA 2VZTA 5JHLL 3GK8L 4B3HA 3S6CA 3EJJX 1INDH 1SB9A 1CUIA 3BMNA 1UWVA 4V0LA 2HY7A 2QVMA 1PDWA 4PZYA 3FOCA 5I1HL 3NAGA 4JJGA 5BN5A 3LWNA 1IQWH 1G7LB 3D0KA 4P92A 3LHIA 2GM3A 3WAJA 3OMNB 3WIHA 3U1QA 1QZTA 4DY4A 2X4TA 3ROOB 2YC1A 4R90L 2Y7SA 3CN1A 3AG1B 2YJ4A 4F8YA 4GPTA 1WOMA 4QYIA 3EH1A 5HCNA 3T7DA 2B1HL 4NQXA 5EIQA 5LQBH 4H31A 3BPOB 4FYJA 3FB8A 2IA5A 4BJ5A 4U49A 3TLBA 2OVFA 4NZ9A 3U31A 4LPTA 4PC3A 5IFAL 1WXQA 3EVBA 1MC8A 1BMDA 2MTBA 2BNQE 5BOVA 3IMBA 4CJ1A 3PUIA 4KY2A 1KGJA 4I0CC 1AHHA 3H3XA 1E3ZA 1JAZA 4LLVA 4LHVA 4EG0A 1URIA 1ZFNA 4O2BA 3KAAA 3QXAB 3HJ0A 1BQ5A 4XNUH 2ROQA 5K5EA 4Q9JA 4KVFA 1WXXA 5KN5A 1QPBA 2OK8A 4ZPTB 4CF3A 2WU1A 1V3VA 3NIDE 2EADA 3HC3L 2PMDA 3EB9A 3ZWYA 1HXMA 3HVHA 1X13A 3TD9A 3GGDA 4Z4HA 3G8DA 3JQ6A 2ZQZA 4XWTA 3GXNA 5FOBB 2VC2B 1NDHA 3EZLA 4J3JA 2HRZA 1D4OA 2FFAA 1HE1C 3ASZA 3CDCA 16PKA 2VH5R 1OFUX 3E22A 3KPWA 4B60A 1JMVA 1U8KB 3DV6B 2Z3VA 4J6IA 3EC7A 1ZSDB 2UY6A 4OIIL 4IGBB 4B8ZA 1KSJA 3NRQA 2FMFA 3FKSA 2X5JO 5ICFA 4URZR 3BQNB 3HG1A 1W6WA 2BSEA 3WGZA 3R5FA 4BX8A 1X6LA 5L3QA 3UMJA 2XY2A 5F7NC 1OSZA 1KJZA 4W1RA 1FCJA 3S29A 3CFIC 1VL2A 5EUOA 3GBVA 2ONCA 1KC3A 2WIGA 3AUXA 4OD2B 2DQ4A 1E2NA 3HCCA 3IT1A 4BXOA 1Q5PA 2R56L 5G3YA 2H16A 5DB4A 3L07A 2XUIA 3KQPA 2RHEA 1MREH 4JL6A 1TJIH 1UOEA 5H4GA 2XYQA 5EPEA 2BR4A 4HGMA 2X28A 3N2EA 3H0TB 1DBJL 5I73C 1P0CA 2C2KA 2GFHA 3QTTA 1W581 1ATIA 4I5EA 1IBMB 1SMOA 1SQ5A 3SC6A 3ZWDA 1HQYE 5EBGA 3G04A 5K0CA 3CHSA 2ED9A 2R2HB 2ID9A 3QPCA 4NM8L 1IQ0A 3JRNA 1BX2A 4OLXL 1C7TA 4MQLA 1X5YA 4JH0A 1YQEA 3S2FA 2PCFB 3CLSD 2PABA 5KVGH 4AN1A 1QDEA 2X15A 4P4KA 5DRTA 1ECBA 4M9ZA 3GDHA 5CX4A 1E2GA 4O2BF 1BYUA 4X4XB 5JHDD 1Q22A 2DI7A 2W0FA 1QMGA 1A5TA 4AJ0A 2G4EA 1ZAYA 3TINA 4XN7A 4H6VA 1Q1AA 4A23A 4IIZA 4ERSL 2XUFA 4Z8XA 3PUXA 2YFOA 1FFGA 3FA2A 4XFDA 1CIUA 3QEOA 2JFVA 1JGDB 5BRZB 4HQQH 4ZMSA 4U1SA 2WWGA 4GVLA 1Y6MR 1JTOA 2BSDA 1XVVA 3OHMA 3BPLC 4B81A 4GZ6A 3GK8H 4ZVOA 5K45A 4P7JA 3VACA 2ZETA 4O2BB 3S1AB 4WAFA 4N2KA 3V0WH 1XGRB 1W80A 4OGXH 5ILQA 5B38B 2GCYA 1XQ4A 4P5RA 1JPEA 4Y5YA 1IB0A 2KZBA 2A1WL 2HVKB 5JPMC 2I1QA 4PJ7A 3UJIL 1C2TA 4KR7A 1RFDH 5D6DA 4FQLH 1NEZG 1DX6A 2YPKA 1AMXA 2P48B 2R2HA 1AO3A 3W1WA 1TO4A 2GN6A 4R81A 1CD1A 4TQAA 3ARFA 3HZVA 2P8PB 2QOEA 2GTZA 1N5OX 6PFKA 2KE5A 3UJ8A 3CFEB 5HDRA 2QZ5A 1FXUA 2FH5B 5B55A 2NVBA 4M9UA 2A30A 4C7OA 3EHEA 2V7BA 4JELA 2HLAB 5FQOA 1YB5A 3AI2A 2K7PA 4Y5XB 4L0MA 4IIDA 7REQA 2ZBFA 4D56A 3SE7A 4B5EA 4L95C 1H9CA 5GJTL 4CNBA 1PY4A 1FL9A 3FWPA 1AD0A 3N5AA 4H8WL 1LE9B 3A70A 5BVHB 2W6PA 1TT5B 3HZYA 1FBIH 4EMUA 1U2ZA 1PKQA 1CL7L 4BKRA 4ZGBA 4BAZA 1KV3A 4PYJA 2BVUA 1MFVA 5J63A 1RLMA 1JAXA 3B34A 1Z6QA 5K9QI 1LRLA 4X8HA 1I80A 3M33A 1XF4B 3WIBA 4ECNA 4Z3FA 5LWYH 3FGNA 3BQ9A 1DDIA 3S2SA 1J56A 2I67A 1H2AS 3IFOB 1KBGL 3I3DA 1YEHL 2X9LA 5HPYB 2BIMA 2PYFA 1J8MF 4FK8A 1WAMA 4C83A 1R16A 3R7LA 4NNYA 1DQMH 3PHQB 4IGBC 1W88B 1BRMA 3A6LA 4QEDA 1CLOH 3ZN2A 5AM1A 1PD1A 4QU5A 1JYVA 5DZOA 1FNEB 2A8YA 1E5YA 4LEBA 5HF5A 5DI9A 3SJVE 4G5ZL 4V0SA 3TEUA 1SGWA 3PEWA 4L78A 2E4UA 4G1MA 2QNBA 2VUKA 2QYHA 5DOVA 1YJ8A 4QODA 4X8MA 1N8NA 5KSVB 5B1BB 2ANBA 1ZHNA 3DI2B 1O4VA 4YCMA 2QM8A 4XIYA 1JG4A 2YSSA 1UBEA 2ITEA 2BGWA 1HH9B 5DD1H 4M93B 3T3MF 3HRZA 2Y36H 3RA7L 4DBLC 2ZCJA 3NJFA 4M1DH 1SD5A 4TRPL 1NBCA 5GOZA 5IFJB 5IJVB 5AVVB 1UB5A 2PUFA 3V0HA 4D7BA 4MV3A 2P3YA 2O2SA 4K8OA 1CP3A 4OLYL 4KFRA 4NBSA 2OTWA 1QCCA 4PBVC 2FZWA 1MAWA 3SZKC 3QC5X 2EJWA 5JCZA 2X13A 1KPUA 3L4YA 3QBVA 5HKOA 4RZCA 1LW6E 3GMMA 3ARDD 4JPWL 2WXGA 1VGVA 4LHZA 4FP9A 3QXVA 3V6LA 1QC5A 3KYOA 2VE6A 1U80A 1M34B 3TFOA 3A9WA 2YN2A 3TB6A 3H9GA 4P5TD 1I3GH 3L7NA 3N8NA 1N32B 2CJTA 2NX5E 4XMUA 3JBG7 2AEPL 2FPKA 1X87A 1INQB 4H5SB 1J18A 4L9LB 1N8ZB 3B9KC 3WDMA 1FZJA 3VI3A 4G5XA 4Y3UA 4MZ3A 4M7RA 1T04A 4XPTH 2XBZA 3CPUA 1NQXA 1K3ZA 1XTMA 3MLSH 5IC4A 3U44B 1R3JA 3GB9A 5EIBC 3B9KD 3EAGA 3GINA 1HZLA 2CLSA 3H1EA 1VEOA 1HUQA 5KOIA 4KKBD 1PZGA 3DROB 2IEIA 4BZZA 4OAQA 3FCXA 4GSDL 1FFTB 2QADC 4FUQA 4TVSa 1MCIA 1CLOL 3Q9QA 3DLPX 3LY5A 1YXMA 4CG1A 3DF9A 1KBVA 1QI4A 4E13A 4EI7A 1F2UA 4E70A 1OARH 1XAHA 1A7BA 3L4TA 2I0FA 3U4BH 2XWRA 5IVXA 4F38A 3HB1A 5BW7C 2QZ9A 1RJLB 2GA9A 4JM0A 2X6RA 1FS4A 3WGHA 3IDMB 5TPWL 4U39A 2B8EA 3SJVD 1EAJA 3ND5A 3UGKA 4P08A 3LZFH 1JEOA 1M57B 3EXFA 4N3NA 2Y6TE 4GI8A 2QKYA 3OMIB 3AADB 1W0VA 3IFOA 5EQTA 3T3HA 3L0DA 2D1RA 2O6LA 1T5TA 2WLSA 4RH3A 2E4XA 3U7HB 4AK2A 5AKZA 7PCYA 1P4RA 3A6BL 3PUZA 1F6LL 4QHPA 3TBTB 5KZCD 1GA6A 3OFND 2DWSA 2G4LA 4KPYA 2BFPA 3DM5A 3U4EB 1SXAA 3BO8A 5HI4D 3ZDYE 1J9GA 3WSQH 3JS5A 2C3HA 4PW9A 3WBBA 2I6UA 2Z4QA 2O6PA 2CM6A 3FFWA 4I9NA 4CM9D 4EPXA 3QLVC 4ZUVA 3ZHTA 2VSFA 4LLVB 1OAUH 2Y07H 4N3AA 3D5QA 5KSAB 2F53D 4BZYA 1AZWA 1W4LA 3C5WP 3L93A 3MJTA 3HZKB 3AHHA 4RZ2A 5IH7A 1N4XH 3QFTA 4I2XB 1Z2AA 2OV3A 1U7UA 4WN3A 3L3JA 1SVMA 4WGGA 3MERA 3O7WA 1FLDA 2WD7B 5LAXB 1JKXA 5CNIA 3WRWA 5SYNA 2N1TE 5IQ9A 4JQVA 5GJCA 1I3OA 4EQ6B 1Z0SA 1PZ3A 5ISZA 2YMLA 1X9RA 5HIIA 3RC3A 3ARBC 3MWGA 1M1YB 2E4FA 3KPLA 5ENZA 3EDJA 1IKOP 4NUGL 1IHPA 3LLSA 1PK9A 3DX9B 2Q9CA 3RKRA 3O6FB 3EQ7A 1G42A 1ZA3A 1REQB 1KMIY 4QRHA 3G68A 2P49B 1RJEA 2Q0HA 1OTXA 4Q9RH 4RIEA 4KWIA 3BYYA 3TB4A 3RU8H 4URVR 2MFNA 4N2BA 1T5BA 3IDXH 3VFDA 1F86A 3NWOA 1KDOA 2B16A 2MPAH 1JQ5A 1LO2H 3WO3B 2UYOA 4F5EA 4IS6A 1NLFA 3I1FA 3KT6A 4HHAA 4H7IA 1H6BA 4UM9B 4QECA 4WTZG 1DWPA 2HFFB 1PBNA 3M7IA 4EI5B 3TLXA 4NP9A 4HMOA 1QHNA 2RAPA 4MBRA 3VMPA 4E6PA 4R4FL 5FAKA 3RVVC 3HC2A 2BDNL 1P4LA 3NIDF 5FBLB 1NC4A 3WJ1A 1Z07A 4G9FB 4U63A 5AW1B 2UXFA 1DKPA 4AKSA 3VXME 1U0FA 1DJOA 1EVQA 3OJOA 4UILH 2PMCA 3C8ZA 4HH3C 1UA7A 3IBGA 2PGDA 1DVRA 3UKOA 2JLZA 4Y2DA 3GIZH 2ZBRA 4JNXA 3VCLA 1C8VB 2EFYA 4JO1H 4F4HA 5IGXL 3QLJA 1W34A 4Y2YA 5HF6A 5HZKA 2OXGA 4MNGB 1R6TA 3STZB 1YR6A 2Z04A 1DG3A 2AP2A 1CY2A 1Z88A 1CTQA 4P5MB 4AQYB 4FNRA 5G3ZA 2PO6D 1VKXA 2VJBA 5BR1A 1FJ2A 2Y92A 1P2UA 1T9KA 4AITA 2ZGVA 1R0RE 3WS6C 1FK8A 3Q7PA 4RMNA 3JWJA 2DICA 5HW0A 5IFAH 2LDXA 5GSVA 1ZGLB 4UNNA 1WW3A 4YHNA 3BFWA 1Y8AA 3A58B 1OLLA 3KGTA 5IDQA 5B38G 1AGBB 1CNEA 1NWPA 3WJ2A 3IDAA 3RS4A 3FVRA 3TA4D 5IQLA 2FSUA 4S0ZA 1R0BA 2LWIA 4PJ8A 2MU1A 1T2CA 1NZFA 1SF5A 3U9UA 1C3OA 3MQ2A 4HWTA 1ERNA 4OIFA 1P6XA 4MS8D 4IRZH 2UZ0A 1J5DA 5TJWK 1I33A 1SM4A 1ONNA 3A4DA 3LOQA 4YV2A 1N8OE 2W60B 5DO2C 5EJGA 1K6XA 4AECA 4ZW5A 4AYWA 1IBYA 4C29A 3DVQX 1IPEA 4IILA 3ZMRA 2PBRA 3VR3A 2VDWA 4UAJA 4ABWA 4K6FA 3F7VA 4G63A 1Q95A 3PUWA 3NC4A 3F5QA 4XC1H 1FTSA 3BH8A 2HT4C 1RRFA 4TV8A 2VOTA 2IITA 1UOPA 1PD0A 1VHDA 4R2XA 2ECQA 5E8NB 2WLIB 1T03H 1V41E 3DX9A 5KNBA 4DY6A 1U0EA 4WZAB 3QHAA 4GKNA 5F0MB 4NMLA 2XWDA 3V4SA 2O1EA 1NFKA 1PSZA 3LV8A 2RK3A 5CEXA 5EUKB 3QNXA 4FWWA 3NYIA 3ECQA 3COWA 2F9LA 2YHAA 1VRCA 5DW3A 5KOVC 3ENVA 3IEPA 1GGUA 3R7BA 3RREA 3CX5K 1CXFA 4LJYA 3OKAA 4D4LA 1BWPA 2FO4B 2BW4A 3V4VA 3TJEH 3RUDA 3DLAA 3FO9B 4MD4A 1JGUL 3N44F 1I0LA 4C05A 3P02A 2ZE6A 2WF7A 2R65A 1R9NA 3BB1A 3VSDA 3NJNA 5LXTF 1DE4A 1JE6A 1N3IA 2XX0A 2GFQA 3PGCA 4BHUA 4NYJR 2IELA 3BZEA 3DF7A 1WABA 4KXBA 2XTLA 3KLAA 3TBVA 4J1QA 2IQ9H 2HYIC 1H1TA 5I24A 4AQ1C 5IFHH 1MJ8H 2ZIUB 1T0UA 3A2MA 2C34A 1P6UA 2J09A 2BEVA 4U1HA 2BKXA 3L9BA 2W43A 1AIPA 4OQTA 3RGGA 4NFBA 1SY6A 2BWDA 2PP7A 4LRIC 1P4AA 2OW7A 4BNIA 3I9KA 1PGJA 4FXPA 3H85A 1NC1A 1KTLB 5E4EC 1PJTA 2JEOA 1KJIA 4XD7A 1RZ8B 4KQ6A 2HIMA 5DFTA 5DRXA 1KGYE 2GEEA 1LK3H 1DP4A 2ALJA 2IVZA 4BYGA 2BBOA 1XN4A 2XZAH 5DZVA 3ASOB 3KM0A 3U1VA 5L4LA 3PWPB 3NVQA 3SBEA 5GISH 1CUFA 4YAQA 3KNZA 2WO2B 1J22A 1RMFH 3GMMB 3UZEC 1UG9A 3OZKA 5GSVB 4IWNA 1T03L 2JWYA 4JKPL 1SXNA 2WM8A 4OLWH 5DFAA 3PWUA 2IZZA 3VRJB 1BWMA 5JXEC 3MROA 4WTQA 1JYEA 1DCKA 1L5ZA 4PSKA 3RIAF 4XTRD 2PRJA 4AEIL 4WFGD 4UFPA 1B0UA 4L9LC 3KAKA 4LDLB 5TPWB 1YUKB 1FPTH 1OE1A 2CMGA 3F1LA 4TTVA 3NPZB 5HRCA 4S04A 2OYMA 1I24A 1ZIXA 2VI5A 3HKCB 1CYGA 2WU8A 5MI0B 3U36A 4GSUA 5B21A 4QO1B 4QAJA 5CR9A 5GIRA 1VA5A 2IOFK 4QYAA 1XTKA 1Y42X 2R79A 1DC8A 1VFBA 1NUNB 5F7BA 1T4KA 1IZYA 4D9NA 2WO4A 1NI5A 5FGBA 4Z2YA 3NP3A 3HYNA 1J39A 1P72A 3P7MA 4CC4A 3H3BC 2ZAHA 4QTTB 5C35A 4PJCE 1UQRA 2YGOA 4KKPA 2H1OA 5ITBL 2RFLA 4Z7QF 3MV11 4FQ2L 4QRPE 3U36B 3IQFA 4NX0A 4YP5A 1XQ6A 4YHML 4EG7A 3UA4A 3A0OA 1UT6A 3I84A 2H5JA 4G6FB 4QCIA 1PJ2A 4DEWA 2E7HA 4H7JA 4CCWA 3BMCA 2XHEA 3QOYA 4PJCA 3UC0H 3RJ9A 3IEXA 4BRVA 3ICOA 2G60H 2YUVA 4ZQKB 1B3RA 1VMIA 5DTQA 5BV7B 4CCYA 3CEPB 1FQ9C 3GSQA 2PYDA 3M6UA 2W5UA 4EHHA 3TJHD 3RHWK 3BCFA 5FAXA 1P3DA 5FPTA 4FTDA 3VAYA 1B93A 3HNVL 1LX6A 3MRCB 3Q06A 5CUSH 1CFNB 3ZK0A 1ISRA 4RKYA 4BBZA 2CKMA 3EOBI 4Q01A 5LYYA 1ABFA 3LRLA 2D54A 1RMFL 1NF9A 3KX2A 4GG6F 1H9VA 4ZAYA 1VHQA 4P2OC 4O3UB 1TVMA 2Z92B 3VNZA 1JXAA 1X7DA 4FJZA 2I60H 5JJIA 1O89A 4RKQA 3AQ4A 3FOLB 25C8H 4BEWA 4OCLC 4R8WH 4H17A 3I6MA 3GUCA 3GLAA 3NO4A 3V4VL 4PG9A 3IVAA 3ARGD 1QQAA 2IOOA 2ZYVX 3HHPA 1SOAA 2I5PO 2X53A 1S5PA 2C9OA 3FQ4A 2B14A 5K3DA 5KVFH 5DMIL 4U3JB 4A6YL 3B2UC 3HKFA 2VSKB 2F9FA 3IEVA 1Z73A 4B33A 2DMCA 1GMEA 1NC2A 2NO6A 2XQYA 1JH9A 2YUIA 4YSCA 4JMXA 4R9VA 4NAVA 4FCVA 1MO2A 2X9QA 5CPFA 4JNKA 1X7QA 4W1QA 3QE4A 2A14A 3AF4A 2J72A 1KYDA 5AOLA 4AXWA 1Q94A 3E7DA 3ROQA 3PVZA 4KXZI 4TXMA 1BXUA 1FV1A 3NX4A 4X63A 1TIBA 1WETA 5D3MA 2D73A 4TSFA 2K2QB 2XGJA 2F5AL 4P2QD 5IARA 2C20A 1IX2A 1UHVA 3L8GA 4C78A 1J86A 2L18A 3L45A 3CVJA 4INJA 4YXHL 2ATCA 3RRXA 5B7QA 2YA1A 1IGTA 3UK7A 4EZBA 2K4AA 2WJ4A 1IRIA 5KYWA 1UATA 2ENQA 1MAUA 3LY9A 1WLHA 3F05A 3WTUA 3S2EA 4HV8A 5LIPA 5T8KC 4NT6A 2PCLA 3R7WB 3OFSA 3MUY1 1Q1EA 3O3AA 2VJOA 4OCZA 3U9PL 1H6UA 2YD9A 2XTSA 4DDKA 4E51A 5I9SA 2P24B 4MB4A 5C8JA 4WJG3 1XZKA 1ZKMA 4L16A 1CWUA 4YP9A 4RKFA 3NG1A 3C3EA 1M1XA 2BBSA 3UEOA 4HVCA 4CVZA 1R10A 2XOXA 4WXMA 1BREA 2P5PA 3AS0A 2BFAA 5DDHA 2KLTA 3MCKA 3TLMA 2DH2A 4QDJA 3WL7A 2AC0A 3BN9C 3OTQA 3ICVA 2LCQA 3FPBA 2DERA 1S9XA 1OWOA 4HGNA 3C5SB 5C0NC 3ZC3A 1EXVA 1Z25A 5L7WA 3G7TA 4KTDL 3DXAB 1O95C 3C48A 3QS2A 5E2VL 2QZZA 5JYCA 2K7QA 3TA3A 1C3OB 1ZHFA 4LNAA 2BWJA 1UP6A 4YOKA 3LX9A 2W6OA 3NHMA 2BY2A 2V45A 1ZH2A 4G0MA 1KYZA 5DJDB 4C6TB 1IJBA 4DP0X 2VQ1B 3PNOA 1I1AA 1T1ZB 4MEBA 4KQ4H 1G8PA 1R5OA 2JBHA 3LH8A 1GCGA 1DSFL 1I7PA 2LPMA 2Q07A 2EU8A 1XGPB 2ZJYA 2R2EA 1I13A 1P1VA 4JS0A 1L5VA 4DWOA 1UOVA 2FMIA 2EYTA 3JTEA 2RHLA 3MC0A 2V7VA 4Y4FC 4U2ZA 1DBKH 2VW7A 4KBYA 3O8CA 3LUAA 2QLJA 4QICA 2FYYA 3JQPA 4Y1GA 3EARA 3WLSA 4K1LA 3AHIA 2OQ2A 2CRYA 1RQ5A 3LVQE 3T0WA 3E38A 2JIOA 1HCVA 2J6IA 1ZC3A 3IAS1 4E5VA 1U0GA 3FB6B 1YVLA 3KLKA 2AK4A 2WHYA 4NBKA 1RIUH 1RI5A 4F45A 1PUIA 3L1HA 2VP4A 1AGNA 4WF7A 5HGBB 1MRSA 1GAWA 3D5EA 1WY7A 4FFVA 3TIEB 1RM0A 2G76A 4RMQA 3OEHA 4YR6A 1EXUA 2DQUH 2JI6A 5EUOF 4KLRA 3DC7A 2NSMA 4QYWA 3ZU6A 3N05A 5JA8B 1ADQA 1ZJBA 1ZW1A 1A6UH 1NIDA 2JATA 3IFLH 1NR7A 4GNKB 2RC5A 2VQUA 4K3GA 4AP9A 3DSNB 3O8BA 4AKTA 4QEGA 4RRPM 3VUFA 3ADDA 2MCAA 4Y9BA 2WP0A 3O3EA 1WUYA 2D4HA 1J33A 1NAIA 3G0OA 3QIVA 5SWZE 5JNSA 5J06A 3CB4A 5C7XL 4Z76B 3ZCVA 4HAXA 4H88L 3OOSA 4YALA 3K1AA 1E1CB 2OSYA 4QOSA 2XECA 3N8GA 5T1LA 2WTXA 4ETWA 3CTPA 2NPIA 2PMKA 3WRYC 2FR4A 4ERSH 3LT5A 3R1GH 2NR6D 3WEMA 2HPAA 4Y8AA 1NSYA 3U3OA 1PMYA 4FE4A 1XL1A 2R7LA 4OBBA 3SCMD 4NDAA 4ENTA 5HHOD 3OIYA 1TCVA 4Z7QB 4BSWA 1XJWA 2BFCB 2Q3JA 5I5MA 1ILWA 2JNZA 3QX9A 1E4VA 3IMRA 1NVBA 3LZNA 4DJFC 1MH1A 1QX4A 4PCUA 4DGVL 3MD0A 3CFKA 4WRRA 5BVPL 4B3RB 4R2LA 4WI2A 1J0YA 2K1MA 1RYHA 1F2DA 2G0KA 2G9HB 3R9XA 3C5VA 4C9BA 2J20A 3RJZA 2FGKA 5IG7A 2WYTA 2V58A 3IP1A 5T5FA 4UYPA 2X9GA 3AR6A 5DP1A 5B2ZA 2XVXA 4LYDA 4HG4K 3ODPA 2CMHA 2I5YH 4FZRA 1GS6X 2BS9A 2QLTA 2J4WH 3FZQA 3MBEA 2XQKA 2CLRA 4GBJA 3PJGA 1QI5A 4PHHA 4DP4X 1I1FA 4V38A 4NRXB 5IAJA 2PRIA 1C08A 2Q2VA 5A9RA 3RGBA 1PD6A 4L4TB 4Y4FD 4JROA 3B12A 1V37A 4Z0XB 1FO0L 3PXXA 1ULTA 4FTVA 5GZ3A 2QVBA 4XZUA 4F8NA 1GRRA 4PJ6A 3X3HA 5HJBA 2FAUA 1Z35A 3CQPA 5L3SA 4X5LA 5MEPB 4FSHA 3UCXA 1RZFH 1JR4A 3BH0A 3AY0A 1CICB 1BH6A 3L6RA 3BMQA 1P7QB 1Z5OA 3HWRA 3G0GA 4F6LA 3BDAA 2E3VA 5LL6P 3P9LB 2O07A 1GZ5A 1ZJ6A 1CF2O 4J0KA 1XF1A 2AQSA 3PRJA 1UT9A 2A0FA 3EF0A 1KGCE 3TZCA 2BDEA 2G7ZA 2H2GA 4JQVC 5I15H 3JTTA 4EF5A 1DQVA 4CNIB 4FQ1H 2B15A 1OB1B 4NAQA 4O3FA 1QZ3A 4MW9A 2KLHA 3AOEC 3RS3A 1F38A 3FB4A 3LL4A 5FB3A 4BO8A 3LA8A 1COZA 4NDZA 1N1EA 4JRYA 3FYEB 2O1XA 2OFFA 3A7DA 5JADA 3IP7A 4OF5A 4WEBL 4I4CA 3TT1L 1AF7A 3KJZA 4DUVA 5BY2A 1KXVC 3WFDH 4LZKA 2BFMA 4UAGA 3BWXA 2HRCA 5SY4A 4MMXC 1RPKA 2C2WA 4J3OD 2XV1A 3HSYA 4CQLB 5GRUH 3TJPA 5C0EA 1A9XB 3DTVB 1DEEB 1RHHB 1RQ2A 1BD2B 4LKXA 1C9DB 4FLEA 3G2KA 2ODNA 2FMKA 1YY9D 5LGJA 3QTBA 7FABL 3TV8A 3CA8A 1M34A 1UJ5A 2FATH 3IPYA 4F1ZA 3PR1A 5PGMA 1RUMH 4NECA 1KSHA 2W2QA 5IPFA 4F4IA 1YBFA 2DWQA 3TVTA 4BMXA 4IIVA 3IJRA 3L9EA 1YAZA 2XT1B 1Y3BE 4D9QD 4QU9A 4R1NA 3NEOA 1XQVA 3K0HA 2O8NA 4LOJA 1MWAA 4CQLA 4J3WA 4P04A 3I02B 1N0HA 4W9HC 1V8HA 1AJEA 1ZOPA 3KPMB 3IWUA 3DDZX 3R8FA 1U9ZA 3QNUA 4B17A 2YBGA 1MJFA 3HS0B 2XWBA 3G6WA 2CXTA 1LI4A 2IPMA 2XMBA 1H2FA 4GUQA 5IQ9B 4IHOA 1TIUA 2O5RA 3EZ6A 3WFCH 1KEPA 3MXWL 5JPMB 2I2BA 3KPRE 1ADBA 3F49S 4KVAA 5AMXA 2YRFA 5F5LA 2CXQA 1L0YA 2H8PA 4X8GA 4HLQB 1KAGA 1UBGA 1FFAA 5LIRA 3ZKMD 3PGJA 1JD9A 3K7UA 4UNRA 2KBEA 3S2GA 2ADMA 1TFHA 2VDRL 2QT1A 1KE2A 1ODCA 4WCYH 1LA2A 3L7FA 3MX0B 2N7BA 2JELH 5ERWA 1TEGA 1GARA 2EDOA 3BUQA 2O4UX 3SKYA 4GKOA 3P2EA 1GGMA 3DVFA 4TYMA 2VHVA 5JC8A 1SEQH 1O8CA 3OXRB 1DQRA 4J2TA 4HISA 4U9HS 3H3PL 3N1PC 2BVYA 4ALNA 5EZYF 5BT9A 4DA0A 2QV2A 5IMSA 3QBDA 3LQ4A 3HZVB 1OTSD 4AQ8A 2Z95A 5DMXA 4H2AA 4GPBA 4UU7A 3S36H 3SWWA 5JYMA 5CKGA 2QPLA 1AYRA 1NL0L 4Q9QL 3SC3A 4MQTB 4G8EA 4YO0B 3GC6A 2QZQA 2G7MC 2GPNA 2GK6A 5C1IA 3LKPB 4Q4CA 3QA3E 1OB2A 2WJ3A 2B59A 5MGBA 1N2RB 4QHNB 2XETA 1SCBA 3GWZA 2WSSD 2DFDA 1U8FO 4MHTA 2WWIA 2QXYA 2WPGA 4IMJB 1A6WL 4G1EA 1EFVA 3FB5A 1KU0A 3RC7A 4F24A 3LG2A 1SOSA 3SQMA 2Y6SC 5E95A 4YFLF 1V16B 5DQ9B 4ZW7A 5EEGA 3ZYZA 2UUDH 4HPOH 4QA9A 2QKIB 4TQIA 4JP3A 3VR4A 3USCS 1X5GA 3PQ8A 1P60A 3LN4B 1SOWA 3HB7A 2NY7L 2PZ8A 4FGLA 4HADA 3IXTB 2OC4A 4OGGA 1Z4IA 3H13A 4K9QA 3KYMA 4DNLA 1QP0A 4K73A 1ONOA 4XB2A 3VD5A 3B5TA 1LTHR 4UATA 3X1FA 2F54A 3HCVB 1JHPA 1JQKA 4HUKB 2IFFL 4BRSA 4Q5IA 4JZJC 2EDWA 1GJRA 4BGVA 3FWKA 1PV1A 3RFCA 4LRNH 3BWDD 3IB3A 4PJXA 5H37A 3FFBA 1I7NA 3A0RB 4B97A 4Y4FB 2L19A 2ZR9A 4ES8A 4F2MA 4PN7A 4P2OB 3QG5A 4W6WB 4KK8D 4KKLC 3LC2O 3TLAA 4P06A 4LXHA 4OQ1A 4PCLA 1WD9A 3RIMA 1AI1L 2MSCB 2LABA 4LHWA 3GXDA 1J0CA 3JSXA 4CR7A 1DEKA 4LSPL 1HEHC 2EEDA 3SDDB 1P6WA 4UULA 3PP3K 3GNQA 2PUDA 1TU4A 4Y2XA 4KFZC 2FQYA 3LT4A 1CLZH 3KG5A 4KTEL 3W5HA 3N0PB 4KX3A 4N3UA 4OXYA 4OZIB 1DAMA 1KYQA 4FQJL 5JVDA 2WLYA 4MQ6A 3H4MA 1WA0X 3VZSA 2KQMA 2EX1A 1TC2A 1DQLL 2R69H 4Q56A 1K08A 3EZ9A 1THTA 4GPIB 4UAVA 4S24A 5FFNA 1ZK1A 4EK9A 2Q3MA 4F8OA 1DLFL 1N5DA 2WBXA 1MW3A 2VCHA 3GLUA 4BBJA 2AC7A 1RKRA 3F1KA 4FWBA 1E58A 1DLHB 2JRLA 1FG9C 1HT0A 1A1OB 3QIBD 1WVIA 1I3NA 3I05A 3SKOB 3ZRCC 2C4HA 1HQRB 2YWRA 4YFYA 1PCSA 5I1JL 4Q3NA 4MVXA 4GEGA 5TRTA 4HJSA 1JVKA 4R8SA 3K15A 5BOSA 3OE7D 4DB2A 4PJGF 5F7KC 3DMPA 3PL6D 3KPMA 4YWGH 2C83A 5KINB 2MINA 4Q16A 1KF0A 1YQ2A 4YLEA 4DCQA 3E05A 3RSZA 4YMVA 4O2AB 5IYZB 3ROLB 5ALTA 4ODIA 4EPYA 4YAGA 3NUZA 1UZMA 4BNYA 5L2KD 1XB2A 2OXEA 4GMFA 4UBMA 1D5CA 4ZRMA 3QCTH 3DTYA 4P23D 5GOTA 5D1ZC 2O5YH 2C4XA 5LBVA 4IFBA 4F15C 4JLPA 4QYIB 4EG4A 1DIAA 5HILA 3BCUA 2IEAA 2RTTA 1SBNE 4GI9A 5ACMA 1DTEA 2VTKA 2NNXA 4FYMA 4K28A 5C0RL 3N2KA 2WTRB 4E2XA 2ICEC 2O2ZA 2ZCZA 3QRGH 4L5IA 4C06A 3LW8A 3WLJA 1TFPA 2XWXA 3DHJA 2ETVA 1OI7A 1LLFA 1C0IA 2DF8A 1S9XB 5E2TL 2Y7OA 3OQRA 1HTTA 2AK4D 3GUFA 5I9QC 3FPXA 4TUUA 3QXHA 1TYZA 4JRWA 1AD2A 2TYSB 3VH2A 4N20A 4Y88A 1Y82A 3LRXA 1ACLA 2HIGA 4Z9BA 1J8KA 3WVNA 4EJ2A 2DFVA 2WGXA 3D7LA 4UW9A 3U9SA 4KQ9A 3H5AA 1O54A 4DA6A 1FG2A 1IAIH 2JA2A 4P4NA 3EFBA 4GC9A 4ND5A 1QZZA 1VZ3A 3LY7A 2PW2B 4UTBL 1YMUA 4JENA 5JNTA 3ZJUA 3PKIA 4DIKA 3QCUH 3SU8A 2WQ6A 2ECKA 3U9TA 3NCXA 1H2YA 3GZNB 3KV3O 4PZPA 3GW8A 2X1OA 4POAA 4ALKA 2ILLA 3BMQB 3QEHA 4BCYA 1QG3A 5D7LB 2YAOA 1QHQA 4B6RA 3L08A 3ETJA 1BWSA 3UMMA 3C5JB 2WMPA 4II3A 2BFGA 4YZFF 3F2IA 5JROA 1EA5A 1CC3A 2H9GB 2VXTL 1W8IA 2APVA 3ZHVA 2FP4B 2AJ3B 1YSCA 2OKGA 5I6OA 3EGXA 3NFYA 1T1WB 4HNTA 2CCWA 4ZN6A 3MRIB 3KB6A 3VUEA 3EUDA 5KC8A 1B0RB 5AVRB 1S7XA 4R97C 5DZPA 3TPUA 1Q1QA 2J1WA 2ZATA 3CZUB 1L7TL 2VYCA 2Y99A 1M72A 3S8FB 4OM8A 4RM3A 5I16A 3TH2T 2V2XB 4RDBA 2QR2A 1JR6A 5CNKA 4MV1A 1UWCA 4YJFB 5D51S 4ZK6A 4L4TE 1GZPB 5BYAA 4WTOA 2ZBEA 3VNYA 4HNRA 2GJ6A 1N0IA 2A83B 2E7LC 5AOAA 5ABDE 3FOZA 4U1LB 3U7YL 2X4OA 3GJTA 4DIXA 2H47C 1PNTA 4L4VA 2CR0A 8PAZA 1G3MA 3NHFA 1U95B 3EFOA 1TT7A 4UKDA 1UZAA 2NY0B 3CRNA 5AKGA 4R05A 1CU1A 1FUKA 1BQKA 2IYSA 4XVUC 1T0MA 2OMTA 1F3LA 2GAAA 2GKSA 3AXHA 3D4YA 1WMDA 2P9CA 2EABA 4OJYA 2IDUA 5CK5A 2E3JA 2CFOA 1FUUA 2UXDB 3RADC 4LEOA 3NCYS 2F9MA 3SC2A 4R7NB 3TXXA 4PYQA 1FAKT 3RUHA 1HSAB 2DYPB 3G5LA 4CTMA 1KMNA 4BO3A 2RG7A 4TZ6A 2V7NB 2AI1A 4ORGA 1N2CB 2PKEA 4NT6B 3H9BA 2B1OA 4WJZA 1WEJL 1NPUA 1Y63A 4EB6B 1EGJA 1H0SA 4RSHA 5KHAA 2G5BA 1JXJA 2ZWLT 4YRJA 1XPOA 4HTAA 1IH8A 1H0KA 3RI5K 3IFNH 3FF7A 1IEWA 2XWEA 4NZUH 5JHBA 3WELA 3PJEA 1IKNA 5JAUA 4KXVA 5FYKL 4NICA 4AJPA 4YDSA 2GO7A 4WADA 3Q2VA 1N2GA 1L5QA 4Y5XC 4LVNB 4L0QA 1WMBA 4UJ5A 4JI5B 2WAAA 3RFRA 3BVTA 3FPKA 4YAIA 3OGOE 1ML3A 1F3DH 5C97A 4Z4EA 3MGGA 3I2IA 3IQGX 4EG1A 2MPVA 3ZU3A 1C3XA 1YFLA 3GROA 4V0OA 4D0CB 1O96B 4K71C 1U2GC 1M8JA 1F2XK 2CLKB 3G7SA 2R27A 2ATEA 4AT1A 2W2LD 5JMTA 2FHCA 3MV7B 4A2FA 2RH5A 4NABA 2J48A 2ONYA 1SJXA 2WQAA 2IWGA 3QKWA 3NJHA 3SDAD 3S2UA 4PJ5B 1KG0A 1LDMA 2O2DA 1TZHA 4X0EA 1MJ8L 3SDYH 5GRJL 2IH3A 3ML1A 3AU8A 3WLKX 4UFNA 4EI5C 2NW3A 1VLHA 3O4VA 1AC0A 1II4E 3C75A 3GRFA 4I3RH 3DK2A 4F5WA 1C1XA 1KYVA 2NUAB 1QDLB 1Z5ZA 1XR9A 3GSRA 1J2TA 2QQNH 4NQED 1O6ZA 3ID6C 1D5XA 3TH4T 4D6PA 4RY0A 1NLUA 5AKSA 1DBRA 4IBZA 2GNPA 3QEQA 2J6BA 3I3SR 3RE1A 2ZAMA 1IAIM 5HHOB 5HJ5A 1Z0DA 1D8AA 1VACB 3LSOB 4IBUA 3RRBA 3WHE1 4WK0B 4KRPD 5DGRA 2G63A 2OTCA 2QQ5A 4KR3A 5D1XB 2IOQA 3V97A 1GDTA 4EAQA 4L5FE 2O8FA 3QBJA 1LJ8A 3WR5A 1KAEA 1HKHA 2NY4D 2AMYA 4M93C 1MJUL 3TV3L 4PIVA 3MMNA 5J1SC 4UF7C 1R9JA 1EAMA 5L3QB 1GHFH 4DTGH 2AJXL 1XQYA 1FBIL 4PWZA 2CLLB 3PL1A 3FCBA 4J5VA 1GC1C 2YWDA 4OT1H 3QF7A 3EO1A 2OTPA 3B8YA 1P8JA 3H9CA 3FPHA 4IRJB 5A0TA 3QEHB 1ZMTA 3M7FB 2AQNA 4G9DB 4IDEA 3EJQA 1OCRB 3PHOA 1KPHA 1KEEB 4U9UA 2IAND 2W0LA 4HBZA 4W5TA 4Q24A 2ORWA 4PSDA 3FWZA 3G0DA 3FTCA 4DKFH 1ONPA 3CVIH 5HKAA 4IKNA 1ZISA 2WXRA 1Z8HA 3P2JA 4PAWA 5IQ7H 4E3WA 1E2DA 5GZNA 3EO1B 1FMTA 3EYAA 2XB4A 3IODA 5IF0B 4QGGA 4ENSA 4H4DA 5BSKA 5TDHA 4AAYA 1FU7A 2P43B 5ICEA 4ZIRB 2GJ9A 1OE2A 3CDFA 1KDIA 1ZCRA 1ODIA 4B0MM 1U1FA 3JV0A 4P46A 2WFLB 3NTOA 4W1PA 3W8NA 2YPLD 1OGTB 1UPBA 2ZJAA 3MACH 2IP4A 2O2EA 4UU0A 1I2AA 3ULUC 1IXRC 5DRWB 4P35A 4D4MA 1Y4UA 3TSAA 3NQIA 5T1KB 3LPDA 1E40A 1L7BA 3TW8B 1OOAA 4HF5L 5E8OB 1NMAH 3WP0A 3STXA 2BKVA 2C4NA 2QIPA 4Y2OB 2QN6A 4Q37A 1O7DC 2C5AA 3K8QA 2OZKA 2A1TS 3JQ9A 2XVAA 2OBYA 1L7IL 5KG9B 1TPXB 3NFNA 2JQAA 4G0UA 4CL8A 3X1WA 3BSYA 2WLKA 1P1ZB 1B16A 3C7AA 2VDNH 1XRPA 5JRJA 1UZ8B 3NTCH 1VKXB 4GW4B 4PYNA 2FX3A 5E7BA 4L5CA 1YLBB 3CZMA 3NHBA 4DW2L 5EHNA 1NJ8A 1A02N 2DSTA 4V2BA 3V4OA 3OCWA 3P45A 1W1IA 3PQYE 1LDPL 1IJ9A 1FDOA 4QRBA 3PXEA 1A8QA 2KPNA 2MCG1 4RJLA 3IN0A 4Q03A 2GILA 2GHRA 4FHJA 2EW2A 2JVJA 4NVRA 2C78A 4AJIA 2QXUA 3OAYK 4AM0A 1BXXA 5I7EA 3K4QA 1NT2A 3O2VL 3IE0A 4Y0VA 2CGRH 2WMNB 3KPSE 2NXYB 4GY4A 5KJRL 4BNVA 3SNKA 5CSGA 2QWXA 1T5XA 2J3SA 1MRNA 2HJKA 4GSRA 1VG9B 3GFGA 5EESA 1GXEA 3DIVA 2H41A 4GRMB 3LZRA 1BX2B 3FL7A 1W5AA 3B5GA 4YHLH 4Q9RL 4KYVA 1E7MA 1K9TA 3LIIA 2RI6A 4HJXA 5IVZA 1BZ8A 3WGNA 3HV2A 1QP8A 3T65A 1ZSDA 4LSSL 2C9PA 3Q44A 5E4FA 2F7PA 2NOYA 3FMFA 2WUCL 1YQUA 4LWZA 5F9HA 4CMMA 1TUBB 5D3ZA 3BQUA 3DX8B 3IMWA 1V48A 3CRVA 5CP8A 1Z4OA 5BOPA 2GB2A 4U1NB 5E6IC 2BS71 4ZICA 3X1KA 2DR3A 4RAUB 5ECJE 1YQVL 1ISFA 3I9LA 3W3AH 3KT3A 3WJJA 4LJ5A 5ALOA 1WIUA 2YHGA 3C8MA 3T15A 1KIQA 1A4UA 3GNLA 2G25A 4BWYA 3JQ8B 4FYKA 4X1YA 1NF8A 4RD6A 1CDDA 5EO0B 3IBEA 5GJSL 1SLVA 2P90A 4G7VH 1HE8A 2V17L 3BXNA 2EZUA 3RVLA 4A26A 1Z8NA 3WA6A 2ZXGA 1AXEA 4MI1A 5AWNL 4HL6A 4ZEOA 3H2HA 4ZYZA 3L4CA 5FCDA 4X80L 3D4ZA 5CEZE 3E4CA 3OWRA 3ECBA 2QT6A 3R7FA 3UV7A 4DJEC 4I5GA 2RH9B 2ENUA 4EJFA 2NXZB 1JE1A 5H9WA 1ZM9A 4P3YA 2GJKA 2XDQA 1KXQA 3I42A 1R8JA 4XX1A 4N8SA 4UDTA 2PUAA 5TQ2A 2GBTA 3CSBA 4AQAA 1QOPB 5IMLB 1ZXXA 1Q6YA 1M2OB 4B3FX 3VAAA 1BHO1 3HMQA 5FUMA 2DX7A 1YS7A 3DBIA 5E8NA 4CKWB 3ZZTA 1A4CA 1D1QA 2HCBA 4F04A 5CYPA 3IR6A 1O7VA 4FR2A 5LU9A 4XGRA 4OGYL 2C26A 2WYVA 1JAEA 1NOIA 2V7XA 2WNSA 4WLUA 5T5NF 3Q7RA 5D7IB 1HSZA 1HEZA 1Y3AA 3HM2A 1XLVA 3PKZA 4MAUL 2V97A 3O4GA 1ZNWA 1Z0ZA 2X0DA 4A66A 4GDMA 1SXCA 5D9SA 3DYIA 3STZA 1UXLA 4YPGB 3IQEA 1S2OA 1CZUA 1GGIH 1UR5A 1PLKA 3FLBA 4U00A 4QDGA 1O7SA 3JQ7A 3L92A 3RUEA 1BCSA 2WSLA 4MKGA 2K6ZA 1N64H 4DQOL 3B9VA 1XEAA 1Y6GA 4ARCA 2ET6A 1XTUA 3MRDA 3GJ0A 1FEZA 4U0QB 1UKZA 1KENL 3SDXB 3JWNH 4HGYA 3RS7A 1T2QL 2JTDA 3DPDA 3THXB 1E1YA 4QREA 5JWRA 5K8JB 2VLRB 2X9WA 4AXBA 3VB8A 3OPNA 4X1IB 4I50A 2H0AA 3IOEA 1C16A 2FECI 3O41A 3ZUNC 3U17A 3V0IA 3FUCA 4GSLA 2XSZA 4WXYB 5LN1A 3FLAA 2ZCVA 4LOUC 3AXTA 4GYJA 4KFMA 3AQDA 1K4YA 5AICA 1R4XA 1GEGA 1UMCA 4GW5A 2QEJA 1UBLS 3ZH9B 1MLCA 1Q83A 5NULA 5DBIA 4D2NA 1EGVB 4HEPG 4U7GA 3SICE 3IAAA 3WBKA 1QPPA 2FWIA 4JZOB 3HBMA 3KJ4C 4RM2A 5T3ZD 4YR9A 5J6GA 2XDYA 2J9ZB 1GJIA 4R5HA 4KLNA 2CZNA 3ABOB 2ODIA 1HEZB 4OYHA 2QMKA 1M6OA 4FULA 3EIEA 5D5QA 3VPCA 4XUDA 4WKXA 3S3DB 4JI1B 1UDWA 3NDIA 3PK0A 1KFCB 3FGOA 3ET9F 3ESRA 3B2DC 3T4UA 3K2UH 2ZANA 2WWWA 2HHHB 3ZNQA 4YNBA 3VU9A 5ITSA 4NUJA 1YO4A 4G5ZH 1OREA 3KSAC 3G2IA 3D6GA 2QM7A 1CN4A 1GGTA 3CHPA 3QUZB 3TWCL 2W8BA 1YEWA 1TOAA 1YDFA 5FGRA 1KJ9A 3OCVA 5GGYA 3PHBE 3EYVB 4X5XB 3B60A 2A6DA 5ICSA 1T22B 4UT7H 4OR1A 5IVPA 3HBNA 2J8UA 3W5MA 4CT0A 3G1TA 3K8YA 4N0EA 3ATDA 4XVTL 1FIUA 2EKPA 4OBRA 1WO8A 2YQ4A 4IZHA 1BIHA 2A2QT 5TDPB 5CH5A 3MNFA 5H4HA 4ZSOA 2Z43A 3PCXA 3K6NA 3AEUB 1LJLA 2C58A 3KTDA 1LQUA 2LE9A 4LBEB 3D2AA 5EQDA 1RXVA 2A6IB 2BMKA 2PTUA 1W30A 5TC4A 3ISRA 2FDCA 4UU9A 4Q6IA 2HJFA 4OHZA 3OPYA 1F18A 3I64A 4AJWA 1UZLA 3MLPA 2VERA 2VZLA 4F60A 1H3XA 5L6YL 1X1EA 4B50A 3T0EC 4H6WA 4LF7B 4TV3A 3KVRA 1M6EX 4ZTPL 1LK5A 4U4AA 3PEUA 1OPOA 2KHAA 4LXYA 1A9RA 1Z9NA 3O4OB 4BFWA 2R8YA 4KNVA 3IXTA 4DPLA 3BZFA 2C1OB 1UBRS 3FDZB 3RS9A 1ZT7A 1U3CA 5K51A 3TQCA 4FFBB 5FL3A 2VJYA 1SBSH 3GSXB 4CKQA 2H2SD 2A2ZA 4N39A 1F8FA 3KW7A 3GX1A 3I73A 1RWPA 2AQ3A 1GAEO 4YT5A 4AEEA 4FQ7A 4V11A 1GPNA 5HD8D 4AYBA 4YHLL 3P94A 2Z7YA 3KHOA 5TPZD 3CNNA 3DE7X 3AM8A 5JS6A 1RAAA 5KYNA 2X8WA 5FUOL 4G11A 2DI9A 2W2LA 2XMZA 1VYUA 3H3FA 3A67L 1OAXH 4AMVA 1YK0A 4HH0A 3F7VB 3D0LA 3SBRA 3CUSA 1QFWL 1PLAA 1L8AA 3COZA 3DMDA 2JQZA 3WXWL 3J81A 4CMIB 5I1DB 3DV2A 3SGJC 3D54D 3F9IA 1ZIPA 1TQ2A 1T3SA 4L5BA 3O93A 4KVCL 3WWEA 13PKA 2DF3A 2NZUG 3FR8A 4PLFA 3JAWB 2WSSA 4BLQA 4R8RA 1PZSA 5D5MB 3IAEA 4OMCA 3KCWA 5FWAA 2HTLC 5JJLA 4YHNB 4ZRNA 1OZUA 3ZGNA 2BCMA 5ARBA 3A1NA 3W9SA 1IY8A 4FZEH 4OG2A 1L4UA 3DI3B 5TGTA 4K46A 3I50H 2ESVB 3CRZA 5FI0B 3WKQA 4Q2ZA 2XADA 4MX7A 2A9JA 3S3SA 3HLAB 3ZJ4A 3GXUB 4Q9BA 4E9LA 4K2UH 4M48H 1KI1A 4J2HA 2C4FT 3C2SA 1IXKA 1OAUL 1J2EA 3VJ6A 2BOCA 1QHIA 3IKVA 1TZCA 1A6VL 4F7CB 1M9NA 3C85A 3LXMA 4JB0A 2NYRA 3RCBA 4IJVA 3SVTA 4PLTA 1GQSA 4HAWA 1NXVA 2YC1B 1FA9A 1KJVA 3T4YB 3F71A 3EJZC 4IQGA 1FP5A 1EFRA 2JFFA 1IC0A 3UT5B 1QSFB 1YS4A 5HIMA 1G20A 2AUTA 1HZJA 3WN5C 1FRQA 3HACA 4BB6A 2JXMA 1CY7A 1WW8A 3T12A 1HYSD 2AOWA 2RMKA 1WQVT 4ZDJA 5BT8A 2DTXA 5TK2A 3K4ZA 3NH7L 1VE7A 5BR7A 3GSNA 3OT1B 2X40A 2GK4A 1LW7A 4GAJL 5YASA 3F98A 3RVOA 1URZA 2OJZL 1NBVL 2IU4A 1Z22A 4M87A 4Z6AT 2HWUA 4B9PA 5GRYA 2IWFA 5ALVA 4XAWL 3ZV4A 1YUNA 1KBKA 2FECL 1ZHNB 4FX2A 1QMPA 1DEEA 2VLRD 3W2DH 2YSSB 4ZALA 2WKRA 3DOOA 5C92A 1OH6A 2CF6A 5I15L 5I76A 4LSUH 3VSTA 2JLSA 3FG9A 4YCJA 4NBLA 4D3DA 4XVUA 2HIAA 3QHZL 4BJ1A 1XC7A 4U1GB 2IV8A 1U3GA 3QU2A 2IX3A 2MQCA 5E9JA 1DKMA 5FBZA 1ULZA 2FV8A 3TRHA 3VXOB 3TIVA 2NR6C 4U2DA 1BAPA 2GB4A 4M0LA 5C51B 5T5FL 2XUDA 3CEHA 1JSRA 1P9OA 3K1YA 1DAGA 1TDJA 2DWUA 2Q1WA 4PFSA 3EW3B 4UQIM 2Z1NA 1N19A 3U4QA 3SO5A 1VOTA 2VYQA 5CA0A 2O8BB 3NNDA 2XWJA 1DPGA 3GKWH 3ZDXF 3WWCA 3WEXB 1UANA 4Y6OA 3TO4A 2AGVA 1JG7A 3LQYA 1A3LH 3ETHA 3VX3A 5LP6A 2OESA 4AROA 1J0BA 1ZSHA 4HJEA 3FHCB 3BISA 1I9RL 3U1SH 2CFRA 1HKFA 2ZX8A 4BY9E 3BWAA 4O02A 1U1DA 4QBIA 1EAQA 1WTGT 1M71B 4Y0AA 4Y16D 4NBNA 2BSTA 1OOWA 5JHDB 3U3XA 3INGA 3ZX5A 5BO1H 3NIWA 5D4QA 3Q12A 3FOMB 3FUVA 3VR5A 3FUHA 3FKSD 3VI4B 2OXFA 4OBSA 1KTCA 5SZJA 5B1KA 2AEQL 1SJEB 5K0EA 1JYSA 3R6GA 1GGCH 2Y1XA 2WYUA 4Z0NA 4GP8B 3E8XA 3E27A 4U6YB 2C9VA 4KPGA 1F4PA 3F65A 5HDOA 3BRWA 2I80A 3SOPA 3LX6A 2FAXA 1RBQA 4ETYA 3OKDB 1EB8A 2V8BA 2A5FA 3AM3A 1UC8A 3T0GA 2JXMB 3RASA 3FCTA 4B9KC 3HN3A 1K8ZB 3GRWL 3APCA 4EDHA 2R8OA 3TQIA 2ZTSA 4EZMA 3GVPA 2V3CC 1CTMA 3BP6B 4RY9A 5L8VA 4X4YB 2F3RA 1E5AA 1TJMA 1RHQA 4MJ6B 3L1IA 2I2AA 5AVKA 2J5WA 1EVZA 1Y7IA 2WZ0A 1TJHL 4BMCA 4HULB 1ECPA 3PA6A 4NNOA 2CFIA 1B0AA 3B1XA 4N76A 3PHQA 3GLEA 3SHVA 1YNKH 1LDSA 5DCLA 2EO7A 4M7KH 4J6EA 4O4IF 4RV9A 3VQTA 4I2XA 5EHFA 2XQBL 1X9HA 4A8JA 1A9OA 5AKVA 5I0ZA 2UVEA 1UEXC 3FOMA 4FP8H 5A4AA 4RGMC 4B7AA 3KWTA 2DHEA 3OVMA 1XH2A 3DO3A 4LVEA 3CWQA 5IJCC 5DBHX 4DZRA 4YUXA 3AITA 4AK9A 2Y7QB 2YD3A 2VM9A 3B3IA 3E6HA 3PXJA 4B2YA 3JZ7A 3O8DA 2YIHA 4AU1A 5DD5H 1E9CA 1C8BA 4L9WA 2OWDA 3EXIB 4OHWA 1RQRA 4TSKA 3ARBD 2BCJQ 4ZEMA 2AZTA 2P30A 3N7UA 2PETA 5FULA 4IUYA 2AI0L 4FMVA 5AO9A 5L88H 5F1SA 3FIUA 4YJ2F 1AR1B 1GPOL 4WK4B 4EY8A 2GABA 1UYWH 2CL5A 5ITWA 4E36A 2Z2YA 2EW1A 3OCJA 2I07B 1UC6A 3OHXB 2QIOA 1W8EA 3PQCA 4Q00A 3QRFM 2JIZA 2HUEA 3VO0A 1OSZB 1LP9E 1A5BB 4ZFZB 3VG0H 2W83A 5E0FA 4N24A 3GKZA 1RK1B 2FUG6 4Y5YB 4F71A 4B46A 3SM3A 4WMLA 3VM7A 2DWDB 1I9JL 3RSHA 1FXSA 1LDGA 1JL8A 3WLNA 3VYNA 1ZVYA 3JVVA 5C5DA 3EKCA 3L9XA 4HUTA 4WEBH 4HIXH 3OM3B 1KIMA 3P9MA 4K87A 4YJ3B 1LTQA 1FFSA 3P52A 5EHQA 1IEBA 4K0OA 3C3AA 4HDIB 3EJUA 5FOXA 3MNVA 3LEVL 3NJKA 3T7JA 1RURL 4MJIA 4UUJA 3RS5A 5F6IC 2IUUA 3T77A 3WBDA 3RWDB 1SIUA 2A9KA 1F3JB 1QGUB 1IU9A 3SEFA 3NV7A 5KIAA 5CFHA 5JOEA 1S5HA 4HIJA 3Q1LA 5HGGS 1EM6A 1MI5E 2A77H 2FATL 4IEFA 3TFWA 3KSUA 3WDSA 4XNXL 2HJ9A 3SZGA 1U8HA 1Q9OB 4HAZA 2XN9D 2R00C 3A9VA 3PFGA 2C2ZA 2W9EL 2BMVA 4KQHA 4DDMA 4DMFA 4YUYA 1DANU 5E24E 4AI6A 3K2UL 2Z4SA 1DAHA 1O97D 4KKBC 5GHWL 5J5AA 1AY0A 5HK8A 4IM7A 4X4ME 1KXZA 1RLOA 3ALXA 2OZ4A 2WQZA 1OPGL 2TAAA 1MB4A 1E0OB 2OHVA 3DSFH 1FZMA 3DJRA 1KOFA 5DX8A 4E9TA 2ZZUT 3RBAA 4PV8B 1HFKA 5F12A 4MR7B 4IS3A 2GZRA 2DGDA 4WLCA 5B1JA 3BUSA 3HA7A 5IMMB 3DYBA 1LBEA 4JFWA 2IGLA 1DJYA 1Q20A 4AMKH 3AEZA 4JHWH 5MEQA 3UAOA 2HWKA 3WLQA 4N0CC 3C6EA 1UBKS 3B13B 4MEJA 3QYAA 2AXEA 2FTAA 3DE0X 1U2HA 2NUAA 3U6XS 1AGRA 4PY7B 3PF9A 2B0SH 1Z4QA 3MWEA 1IHOA 4G1FA 2ZM5A 2ZKLA 4JW3A 4XB7A 4IIYA 3IERA 2XE8A 3K9WA 2PKDA 3SSGA 1OKEA 4KKQA 3SYNA 4S1RH 1IU1A 3FHQA 2GBLC 4LX8A 4O2EB 2VK1A 2XA1A 2A9NH 2P8LB 4PCYA 4UQBA 1BD4A 5KTKA 3SYKA 1EEYB 2Z93B 4RQQB 3M88A 2N59A 1N6LA 2IU0A 2VN6A 3C8DA 1JHVA 3EGEA 2PXYA 1JPST 1YE5A 1YVEI 4LNVA 2XQBH 1D09A 1N6NA 4MQEB 4FDWA 1FDWA 1G55A 4XR4A 1PL3A 2VBFA 2RCSL 2TSAA 4DFHA 1LEGB 3T3PF 2G17A 5I01A 1NG1A 2JGAA 2Z1DA 4OL9A 4WZBE 5TLSA 2E89A 1SHKA 1UBFA 1NU8A 4IDJH 3RX8A 3WNOA 4G0ZA 4Y6GB 3VRIB 1XCBA 3PJNA 3BZEB 4MP6A 3VOBA 4NBVA 3HNTL 3MV8D 1B6GA 3FYUB 1TI7A 4KTYA 3O4RA 5AJHA 2WT8A 3JYQA 1FSKC 2QUKA 4KN5A 5GGXA 5JFOA 4DLYA 1NXSA 3OJMB 1Z9PA 4PYKA 1NM9A 3U4AA 5ACLA 3EVEA 4I1UA 2WVTA 3BS4A 4X4KA 3RWIA 3TSZA 4GRLA 2WWTA 4GKJB 2VMEA 3MZ0A 2VDOB 2YMOA 2G72A 4NKDA 1N7JA 5HGBA 5TF4A 2II6A 3ABLB 4PBSA 5LOVA 3JWNG 5B4MC 1IG0A 1NVGA 3WK5A 2IBTA 5DEFB 2BSSB 3MZTA 3N91A 1JWBB 2D2CC 3HE6C 2WPDA 2J33A 5EQJB 4NXMB 1G94A 4KROD 3Q3EA 5LDGA 3WKCA 5FDFA 1R3IL 3VU0A 1TZ2A 3H9UA 1QHYA 3VDMA 4N8UA 2HK6A 3CWGA 1O58A 3AY6A 2B92A 5JIDA 4R7VA 1G60A 3HBAA 4QTYA 5EBMA 4ND7A 1EGJL 2KZWA 1W0JD 4LVHB 3FTDA 4KQ0A 3VC2A 4MTLA 3PREA 2NNAA 2TMDA 4W4OA 1JKJB 5TGDA 1CUDA 2FL5A 5T1LD 3EWNA 3CBJB 4OZIA 5FO9A 4EUPA 1SVSA 4JO2L 1Z0AA 1FVOA 4MHHI 1XNRB 4BDSA 4Z9KB 5FWRA 3FOLA 3L6FA 4WEEA 1D04A 1T6BY 1GA4A 4D4JA 2VN7A 3H9JA 1I7RA 2BC9A 4NZOA 2D7QA 1X92A 3N8HA 3ZHKA 3QI2A 1T0NB 1T43A 1H3WM 3UQYS 3QBTA 1SXSA 4S1OA 4K3VA 2ZXAA 5HHPA 1ZGCA 3IDGA 2R4RL 1NMXA 1WU8A 4CVNA 2K2WA 2OFXA 3B1KA 1JF1B 4WSOA 5HM8A 4HLUA 3GT0A 5JZSA 4BO9A 2AK3A 4F3YA 4AF6A 1ZN8A 1ZMYA 2FJUA 4EMTA 2EZ0C 1T20A 5E2VH 1UB6B 5HA5A 3KJGA 1R33A 3MXWH 1BW8A 2VDQB 3H6HA 4NE2A 4RA6A 5DHUA 5E2UL 3GBSA 1KI8A 3AR3A 5JZ7D 3KJ6H 4D0SA 3C09C 2OE2A 2ZOUA 2G80A 3CVOA 2R2BB 4A0GA 1BCRA 3VXRD 2DWXA 1WUKS 1NAMB 4KQ4L 2ZI9A 1BXRA 4AZ3A 1TQCB 1T13A 3RX9A 1KQNA 4GOKA 2WN2A 4BSVA 3VE0B 1BVZA 4YGVB 3QW4B 3MA9L 4EN3B 2CY0A 3IAS6 1EFVB 5KSPA 3FD8A 5GZNC 5FIUA 3E58A 1BRTA 4HCRH 2R2BA 3L0OA 2IH5A 1XAKA 4RMHA 4ZQIA 3HHRB 1A1MB 1FXWF 2J6CA 2YUTA 2ZRDA 2GESA 4PG2A 3U9UB 2DRIA 3VPBA 4YDKL 4LBWA 3WGLA 1TLLA 4LQLA 2WT4A 1K5WA 1OBFO 3L5JA 4Q6BA 3HC0B 3TC9A 1A6AA 5KCMA 2CDFB 4P2CG 2DCMA 2ENJA 2YGPA 1FXWA 1MVOA 3DTVD 5DHQA 4HBGA 1EJ2A 2HWYA 4NKOA 1BDYA 4OLZL 4FU0A 3QU7A 1JT2A 3FUWA 2XW6A 1XX9C 4DDUA 3ZKND 1LQSR 3ME5A 2YW9A 1MENA 2JLCA 5ICCA 1HQ4A 3TMYA 3V9AA 5DYYA 1J2YA 4KNTA 5G1NA 4OP2A 1V8ZA 1PLGL 3VFMA 4IDFA 1GMIA 1G18A 5L2KB 1VI5A 4X94A 3KZKA 4JG1L 3OZSA 1ZR4A 5F1YA 1AIFB 1DN0B 2BI7A 5IJKC 1GYPA 4RZHA 3M3DA 1P7ZA 4F2FA 3NJ4A 2Z5FA 5CUQA 1V54B 2QQLH 2GZMA 3ATBA 4LOHA 2DBQA 1Q9OA 4ZKDA 1KEGL 1TPYA 3MJHA 3AREA 2OCPA 1FO0A 4Q05A 1UEYA 1GFZA 1WUZA 1WEKA 2MMXA 2R7EA 4D44A 1JTTA 5E6UA 3PAUA 4L8GA 4ZZIA 4MDIA 2GBFA 1ZA3B 1IVTA 3K70B 2FFHA 3ETTA 4V1DE 1OOEA 2QRZA 3KT0A 1PVOA 3Q8KA 1N9GA 1CDZA 1R0YA 5AVXA 4FA8A 3P96A 3VR3D 1D9KB 4RQBA 4EKEA 3SXUA 3ZCRA 1P2SA 3S0JA 5LOVB 3AREB 4IDLA 2VNIA 4EL0A 5BQPA 4FJ6A 3VXPB 1E8NA 2ZVPX 2P68A 2JKTM 3QFSA 4HVLA 4TTIA 4KVCH 2ODEA 4DCPA 4E11A 5GSRA 2D31A 4JRFA 2ACWA 2IH4A 3X13B 5CHYA 2B4TO 1BQLL 3GO1H 1NKOA 3ADKA 3P2BA 2CXXA 5DXWA 221PA 2ZT6A 1NRXA 4Y7CA 3VPHA 2GLXA 2HLEB 3W0WA 4Y2UA 1KY2A 1QHOA 1HHIB 4HJJL 4XODA 3DX7B 1YULA 3DMGA 3B7UX 2JHFA 2C3VA 4K6HA 1B4LA 2V2TA 3NZUA 4GG1A 3D8HA 4CN4A 2KB0A 3CZGA 3HGQA 1QNZL 3TE7A 5LD2B 4EY4A 1RVV1 4TRPH 2GGSA 1NAKH 3QE2A 1IM2A 3WGJA 2PIAA 4XVQA 2EDLA 1SG6A 1PG7W 1WKVA 2Q5JA 4D2IA 2VC2L 1UFKA 2PFSA 4XTRC 3JV5A 4KV5E 4UDUB 2CNYA 5KSAA 1PO7A 5A1TA 1S0UA 2X70B 1SOXA 4AC2A 1E9EA 1KAQA 3TGWA 3MGTB 1I5EA 4ILKA 1YS2X 1WW2A 4V2CB 2WTAA 5INCA 2P9TA 3BGFC 4ARUA 2DFNA 5IHUL 4OI7A 4Z7UF 1YYMH 3VFTA 5A6VA 4PTUB 3QM1A 3UAJD 1K0UA 1ANUA 4JHAL 3IQIX 4UB0H 1O95A 1WO2A 4UTAA 2JZCA 3EGVA 2PLAA 2YJNA 4F0JA 1HEIA 2MSPA 1GZHB 5C2BL 2AVFA 1EX6A 4WV1A 1G7JA 4FHCA 4W8OA 2V4LA 4NKDB 3HVIA 5JYBA 4RGBA 4UIMA 2PBFA 2GARA 2AJZA 5B8CB 2R1XA 3FNHA 3BIKA 1CJSA 2IUYA 2Y22A 2BSCA 4OZHF 3SLKA 1PI3A 1OLXB 3LKOB 1CK0H 3SY6A 2YR0A 1PJAA 5HD8C 4V0ME 5IUSA 4OGAC 1BV8A 4G8GE 1BZ7B 1OD7A 1EUZA 1EDDA 4KSYA 1G7MB 1RTTA 1ODLA 3EAKA 2GRJA 4PYRA 3IM1A 1V1RA 5FOJA 4MLSA 2XZLA 4L1SA 4JJEA 1V5WA 1X8LA 2Y9RT 1SKYB 1O94A 5IJBC 3KH3A 3IX7A 5T3ZH 3EDMA 3GSVB 3F7RA 5HKBA 1RCFA 4ZI8A 5EC8A 1ZHLA 1UZ6E 1YAJA 4G2NA 3ADBA 4TNWK 2D0IA 1E61A 3P0YH 3FTYA 3NUGA 3IU4L 1DT3A 2O23A 1CF9A 4TYYA 2OR3A 2VDKB 1VLQA 4NQCE 4XPFH 3WRXC 3V52L 4OIMA 1UM6H 2ZSAA 2GJ6E 2RH0A 3A6HA 2HH9A 5LBIA 5F9DC 3KFXA 4HB2A 4QPDA 4U2EA 4Q6YA 3D69B 2BGUA 5B3JC 5KYKA 1MDFA 2RGXA 1ORTA 3A6DA 2QZSA 5IM4F 3QUXD 3M4XA 4JM4H 4EFDA 3QNZA 5JORA 2YZ7A 4Y19A 1N2ZA 4HOXA 1AQ8A 5HOQA 1E9PA 2XIJA 1ZVQA 2BN4A 2H63A 2IHBA 5TMBA 1SBTA 4JIGA 1JJAA 1FYTD 3SAJA 3TM5A 3PGLA 5FO0A 2DEYX 1X86B 2VF7A 4CKZA 5LWHA 3H4IA 5CD5C 5GVSA 4F33A 1Z28A 2SHKA 2KZKA 3VR2D 4I9XA 1FFOB 4C07A 3ND9A 4IX1A 3BH7A 3WHLA 1ZH6A 5BO1L 2VSYA 4NUGH 2UZIL 3O2SB 2WIJA 3Q2LA 1GGBH 2KLBA 3KQOA 2G36A 3WFHA 2QLLA 5I1LB 4HLEA 1RU9H 3CVHH 3WRYA 2AUMA 2RGCA 1HL8A 2VR8A 4CVUA 3RZWA 3HS8A 4L9RA 5JD5A 1INEH 1DQNA 3UTSB 2FR1A 1VFAB 1VACA 2VN8A 1T66C 3B53X 2EBHX 2BMWA 3B3FA 4YNYA 4W63A 1GVNB 3EODA 5BO5A 2ZZNA 5G4OA 5IV2A 2IQ5A 5CD3A 5EO9A 3QIWA 2AZXA 1KDTA 5FYKU 3PL6A 3DEJA 4KU1A 2N0SA 2FYVA 2AK4E 5K9JH 1PJ4A 1C4KA 3S9DB 3NHUA 2A6JA 2P80D 5IJ9B 1WDTA 4GW3A 1O4WA 4EHDA 5BQ7B 2OMUA 1KEWA 5GXBB 4LT7A 3TNFA 4ZI7F 4CC0A 5JJCA 4QDZA 3Q15C 1EIBA 1N2IA 5LQKA 2P5ED 3NORA 4YUAA 3TYXA 4X5PA 1H8ED 2PRZA 4NCNA 4IMPA 5KAQG 1VKNA 3MRTA 3FU0A 3EZFA 3CSSA 4OUKX 2XMGA 3I50L 2APFA 2A92A 2NT1A 2PXYC 4X6DE 1B3IA 5B39A 4QOKD 4QY8A 4L3AA 4MICA 4A8JC 3E2IA 1WCIA 4HLCA 4ZHQA 3H9SB 2RALA 4H0GA 2ZCKL 2HMVA 4XWOA 2GEBA 2CA3A 2VQ1A 4OU3A 4PQEA 3KPTA 1DBAL 3WDIA 1B2YA 3BVXA 2DJ4A 2FW1A 2G83A 3QWRA 3GLGA 3EYUL 3RBVA 5LNK6 1FVEB 3CSTA 1CD8A 1AO7A 6REQA 2YHUA 3W3AD 1B4JL 2VT2A 5LUMA 1XIWC 4KXAA 1SU6A 3IL2A 4GRLD 2F53E 4XMLL 1L9PA 3GGSA 5KAMA 3A67H 1BTOA 2QHLA 5I0DA 5GGSA 3P3TA 2GN4A 1RACA 4IFEA 2OGUA 5BS0E 1JH8A 3OP4A 4MQEA 1ESOA 1E89A 3IJSB 4BH7A 1L5NA 4Y16B 3HWSA 5EIIA 1AOZA 3LKDA 1MUJB 3F6RA 4B7IA 3NWEA 4A2WA 4J3FA 1M5TA 3AY7A 1LDNA 3GLIA 3VGBA 5TTRA 2CWWA 3AYXB 5DJ0A 3O8NA 3NVKI 2ZRPA 3RWEB 1BHQ1 5M34A 2VQ4A 1RQPA 4LVOB 2GEQA 3RHWF 2DM3A 4WJ5A 3EG5A 3OUUA 1LO0H 3CW9A 4U7HA 4KYTA 2UWEB 3ARGB 1CUYA 2Z31D 4URFA 4YAOA 4D74A 3K0EA 2W2KB 1OXXK 1G1OA 4B3SB 1JK9A 3I9PA 5EP1A 4GRWH 1GGKA 3DFFA 2H0RA 4Z1MD 5EXTA 2NOAA 2QRVA 3TUIC 2R3SA 2ZNWA 2G6BA 3WE6A 5ALEA 4DGQA 3TSOA 3WBJA 2WSKA 2X4NA 1EUTA 5CNMA 1H6AA 4ZFQA 1V8FA 1D9XA 3DL4A 4LV6A 3CJRA 5ANMA 3CH5A 1KKLA 5HDLA 4LMQI 1FBNA 3H83A 1P45A 2YKLL 1DR9A 2J71A 2I9TB 4EHJA 1N0UA 5IK2A 4UZGA 1WP4A 5D87A 5TXGA 4XMPL 4RVUA 2W37A 2QMZA 3A25A 3HVDA 2GA8A 2FR8A 4PJEE 1E5TA 3DDNA 1IG3A 2ZBGA 3WXMA 1T2EA 4BQEA 1X14A 4PVDA 4HDSA 3SJZA 3GLDA 4YHIA 4GXUM 5L6YH 3DMFA 3T3NA 2BHUA 5JHDE 3FFAA 3ZTEA 3KB2A 3MCG1 1F8TH 4FHKA 3CNBA 2QVGA 3FQUA 3H5LA 4IIXA 4Y1RA 2DY0A 5T3YA 2PMBA 1G4RA 5D1XA 1RC0A 3MMZA 3V8RA 2G2NA 1FRGL 2V1UA 4NFLA 3RVKA 3Q6IA 4U7FA 1ASPA 2AFVA 4IIJB 2XFXB 5LYJF 1JHOA 5DEIA 3I3OA 4RTMA 2VP0A 5DMKB 2WF6A 2DIJA 4NZNA 4IPTA 2VQ3A 2VCOA 1PEKE 5E9DD 3RL1B 3UXFA 2UZYB 4UTOA 3ZR4B 3LBFA 1J23A 3ULVH 4EQZA 1W8OA 1YCSA 4GG6E 3QZMA 3QJTB 3SSOA 4FOLA 3ASNB 4HLZH 4PQGA 2N7SA 4X7SH 3ONNA 2RHGB 4HWBH 3ZQ4A 5LBSA 2GT1A 1GZ4A 2J3QA 2VT7A 4DV7B 3CH1A 5FUCC 1DBQA 1J70A 5EXPA 2A9AA 3GJ5A 3SSMA 3FCUB 1TZIA 1K3FA 2IMMA 1VYVA 3SO3B 2PS9A 4UYQA 2I9LB 1A0QL 1B0GB 5TPWH 3DGCR 2Y0CA 4AD8A 5IQNA 5A02A 3OJFA 4JP8A 2VNKA 1GDDA 4JP2A 3MEQA 4PPGA 4XOBA 4L1TA 4PH8A 4QRRD 1RRCA 1G9ML 3ZJYA 1FN4B 3AR7A 1SD2A 1OL0A 2NG1A 3AEXA 1FL5A 2JCVA 1X42A 4AQZA 1F06A 3EXIA 2WQSA 4OUDA 3DURA 3EPLA 1S3IA 3M34A 2D0DA 4RVNA 3HEAA 3IT3A 3K5HA 3LNIA 1F90L 3C3PA 4TNFA 3R8QA 3DH0A 1L1EA 2BFEB 2FMXA 3BDVA 3WLLA 4W5JA 1R74A 4YSEA 1CFVL 1IY9A 2F54B 3FQ2A 3Q2CA 1A3CA 3M49A 2Z7UA 3FB8B 3TNJA 4CF7A 4HWRA 1TQDA 4X84A 3DYVA 3FU3A 3G2MA 3IT8D 4LF3A 4FJ0A 5FC9A 3N39C 1TVCA 4L4VD 5AG8A 2V2WB 3FT2A 3CEAA 3P9YA 4LZWA 3E8MA 2PRSA 4PB9L 1U0HC 1GY1A 1N5RA 1KN4H 3P0HA 5IOPB 1GO2A 5L6LB 3S7GA 4E09A 4TL7A 3ZCUA 3S6JA 4W1TA 3R7WA 1IL1B 2ZKXA 1MV8A 1UM4L 4LYJA 4BFXA 2GPYA 3QNMA 4BK5A 4DQXA 1NW8A 2FLWA 3MCAA 1F6AB 3CMCO 3G6DH 4WK6A 3AJ8A 2ISQA 3GMRB 2X3BA 1TTQB 4B6JA 3L13A 3UG5A 4AJKA 2OJZH 3G79A 3FRUB 2BP0B 3RWCA 2J3LA 1AA6A 2IOHA 3CN4A 1OSEA 4URHA 5JSYA 4ZOCA 4KIUA 1KVSA 4EG8A 4QNPF 1O7DE 2R68A 3GAAA 4PSUA 2HO5A 4JWKA 1W5TA 3A1VA 4ZPVB 1L4KA 5BO0D 8ABPA 1ZHKB 3H8JA 2O6EA 3OZEA 4BFVA 4ANWA 2AG1A 2YXWA 4ODWA 4JX9A 2ZBDA 5DT1L 1LO4H 1MCNA 5GZND 4F3TA 4NKIH 4ZTOH 2UZYA 2H11A 5JXGA 1IAQA 2G5CA 3IPRA 5L51A 5DHDA 2A5UA 2VPTA 3ON5A 4XFKA 4EA6A 2VWQA 3HNRA 1SEBB 1XD9A 4XCYB 4KO1S 4UXHA 4UMFA 2ZUFA 5C0AD 4MCJA 4DUYB 4PG5A 1Z3GL 3LVEA 4RFNB 1JDAA 3GB7B 3ULVF 4D8WA 4OXIA 3MGBA 3SHFA 1U2TA 3D4LA 4XPGH 5AW8A 4D26A 3WKNA 4EKXA 4HZ1A 1WXFA 2R48A 4JYZA 2YJGA 4V2UA 2PR9A 3LS5H 4P2AA 1ZCAA 3ZT7A 3IAPA 2CGZA 4KROC 1GP2A 3GAMA 5HGHB 4X5WB 4D8PB 3RB8A 2VK4A 1R12A 1G1CA 5KSAC 4YDQA 1IQDA 1LWNA 1UA6H 4DT1A 4C0QC 1II8B 1PJZA 2Q5FA 1L5OA