5HDDA

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 800 fs to 1200 fs structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 31
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hddA00
4R70A 3HJIA 2PDRA 5G4ZA 2A24A 3BWLA 5HWVA 2VV7A 2A24B 1S1ZA 2P7JA 4HJ4A 3GDIA 2PR6A 3UE6A 1BYWA 5IS1A 1VB6A 2V0UA 5A8BA 4HH2A 2D02A 3BY8A 4HJ6A 3OLOA 4JGPA 3C8CA 1OTBA 5HWWA 1S67L 1DP6A 2INWA 1T1CA 3LIEA 4EESA 4EETB 1S4RA 4GHIA 4HY8A 3UB8A 2J80A 3IS2B 5F6AA 3VE3A 2GJ3A 1T18A 4I3AA 3MQQA 3F1PB 1UWNX 2B02A 2W27A 1GSXA 2ZOHA 3NOUC 5G4YA 2I9VA 3UB7A 2QJ7A 4EXOA 3MQOA 4BBTA 3NOTC 1TS7A 1S4SA 3K3DA 1OT6A 2WKRA 2JN7A 1XJ4A 2V9AA 1T1AA 3IBRA 1P97A 5HD3A 1XJ3A 3IS2A 3RH8B 3UB6A 1UWPX 3D72A 3MXQA 3LIDA 4LRZE 2ZBBA 3MJQA 1OTAA 3HJKA 2M1CA 2YKHA 5TBMA 1LT0A 3E4OA 3RTYA 4BBVA 3F1NA 2PYRA 4HP4A 4L9GA 1N9NA 3H7WA 3LIBA 4MN6A 4M4XA 5F69A 2Z6DA 5J4EA 1T19A 4I3JA 4HI4A 2VEAA 4I3IA 2PD7A 3E4PA 4H6JA 3LICA 4R3AA 4WF0A 3A0RA 5I5LA 3ULFA 4L9FA 1N9LA 3P7NA 5HDDA 2L4RA 3F1OA 3H82B 2H28A 3FG8A 5DJUA 4EW7A 2D01A 3LI8A 1MZUA 1LL8A 1D06A 1X0OA 4EERA 2HV1A 3BY9A 1OTIA 2VLGA 3H9WA 4I38A 5KIZA 3LIAA 3PYPA 3EEHA 4F3LA 1P0ZA 3K3CA 4HHDA 1F98A 3UB9A 5J7EA 5F5YA 1Y28A 2YKFA 3F1NB 3PHYA 4MN5A 4PKYG 2OWJA 1OJ5A 3CWFA 1T1BA 4HOIA 4K08A 4WUJA 5DKLA 2OOLA 4EEUA 3LI9A 2PYPA 3UMDA 1DRMA 3CLOA 2KDKA 3T50A 2V1AA 2W0NA 4F3LB 1KOUA 4EQ1A 3SW1A 4HP9A 3NJAA 4R6LA 5J3WA 3H7WB 2JHEA 2OWHA 3B33A 3FC7A 3A0SA 2VV8A 5DJTA 1LSVA 5TBMB 3ZQ5A 1DP9A 1D7EA 5HDCA 4GS9B 5HDSA 5HWTA 4GS9A 1OTEA 1XFNA 2PD8A 4HIAA 4WL9A 5AVEA 2BASA 5HD5A 1TS8A 2L0WA 4NXEA 4DJ3A 2ZOIA 5HZHA 3A0VA 2V0WA 4GCZA 3VOLA 3KX0X 3LUQA 4LLOB 2K7SA 1LSXA 4I5SA 4LRYC 3GECA 3UMEA 3F1PA 2QHKA 4I39A 2QKPA 4LPZA 2Z6CA 1WA9A 3G6OA 3ICYA 3NOPC 2CMNA 2PHYA 1TS6A 3MR0A 4KQDA 4KUOA 4HQAA 5DKKA 5AVFA 4GHIB 1S66L 1G28A 4H6JB 3VE4A 4L9EA 4NXGA 1N9OA 1ODVA 1NWZA 1V9ZA 4B9OA 4DJ2A 1OTDA 2KX6A 5IU1A 3MFXA 1V9YA 4NXFA 2VV6A 3F1OB 3H82A 4HH3A 3LYXA 3EWKA 4WN5A 2WKQA 3CAXA 5EFWA 5F68A 4BBUA 4JGRA 4NXBA 2V1BA 4PKYA 1XJ6A 1LSWA 1UGUA 1OT9A 2EA9A 4YWZA 4E04A 3LIFA 1GSVA 4JGQA 4XT2A 2L1MA 3E4QA 4XT2B 2QJ5A 3NHQA 4GW9A 2QWSA 4HNBA 4LRXC 2PR5A 2WKPA 4EEPA 1EW0A 1TS0A 4RQ9A 1XJ2A 4JGOA 4KUKA 3C2WA 4HJ3A 1JNUA 1GSWA 4WLAA 1DP8A 1S1YA 2R78A 4R38A 1OJGA 1XFQA 1F9IA 5HSQA
chains in the Genus database with same CATH superfamily
3PBTA 3NY4A 2VGKA 1NZOA 2HJEA 3BY8A 1FSWA 3KSHA 4WZ5A 5EPHA 4DJ3A 1PRQA 1MBLA 2W3HA 3MXRA 5GHYA 1T1AA 1P97A 3FZCA 2XK1A 3M6HA 5L10A 3SH7A 2JCHA 3CJMA 3R7WB 2ZQCA 3V39A 2ZC7A 4BBVA 1N9NA 2WKIA 2BTFP 4DXBA 3VP0A 4H6JA 2OV5A 3ZG9B 1N9LA 3P7NA 4HBTA 3BQ8A 4MDZA 1YSQA 2Y2JA 4GNUA 1D06A 4D60A 4I38A 3PYPA 4UHUA 2ZC6B 4HHDA 4C6YA 3W4QA 5F5YA 2YKFA 3HBRA 2H10A 3JVVA 3V3RA 4WELA 1PYYA 4P6BA 1FQGA 4R1GA 2Y2NA 3CHWP 5TBMB 5JYPA 1O07A 4GS9A 2PD8A 3G2YA 4FH4A 3OPRA 1BT5A 2ZJ9A 1ONGA 4XUZA 1ERQA 3HREA 3HLDA 4R4RA 1W63Q 5EVLA 1G28A 5FI6A 1IEMA 5HPFA 1V9ZA 5BOHA 5GHZA 1RGYA 5TFQA 5EVEA 1UGUA 2EX8A 5GLBA 3A3FA 3NHQA 2DCFA 3BRMA 4LENA 5CRFA 3VP2A 3V50A 3TOIA 5HSQA 1S0WA 5G4ZA 1S1ZA 4WZ5C 4IBXA 3LCEA 3PBRA 5EM1A 1SDNA 3K2NA 4OLGA 2XQZA 3T4OA 1HZOA 5EECA 5F6AA 2PU2A 1UWNX 3EGXC 4X55A 3K3DA 3DWZA 3VFHA 4E3LA 2GDNA 3CMZA 5M19A 4X6TA 1OTAA 2M1CA 4EQIA 1XGJA 3IXDA 4P6ZM 4IBRA 2XA7M 3FPWA 1K55A 2PRFA 1G68A 2PBDP 1D1JA 3PHYA 4B4ZA 4Y7PA 2O9AA 4EEUA 1CI8A 1DRMA 4QY6A 2WGVA 4OPZA 1K54A 3BFGA 2JKRM 4JLFA 3BYDA 4U0TA 1PNEA 1OTEA 3TG9A 1TS8A 5FI2A 3KYEA 1MPLA 5EUAA 3IX4A 3UMEA 2QYBA 4I39A 2WZXA 4LV1A 1QMFA 1P9RA 2W3FA 4FD8A 5GLDA 3NCKA 1SKOA 4DXCA 3EWKA 5TJJA 4WN5A 4Y17A 5DF9A 5AQAA 2HZ5A 3E4QA 1CEGA 1I2SA 4GDBA 2WADA 3UE0A 2EWVA 3MF0A 3MZDA 5HPIA 3BM6A 2GZAA 3LGOA 4CLCC 2A24B 1NYYA 1LHYA 4CJNA 4JGPA 3VE3A 4NEED 4LGWA 2ZOHA 3UO9A 1LLBA 1NRJA 3LR5A 2V9AA 1CEFA 3TE8A 5F69A 3R4KA 5GLCA 3HLBA 4I3IA 1SDEA 3ULFA 2J9OA 3PAEA 5EOOA 5HDDA 3T1RA 1VEUB 4JXGA 5A91A 3OC2A 3SS3A 5A93A 3QP1A 2MJ6A 3BY9A 4F3LA 4FTXA 5HX9A 1TF1A 1K56A 2G2UA 5J7EA 1E4DA 3LY4A 3CWFA 2Y2LA 4HOIA 5DKLA 4UEYA 5L09A 4S2LA 4IVKA 4QY5A 4EQ1A 2IWDA 2OLUA 1NLYA 3JYIA 1K6SA 2JHEA 2X01A 4S2NA 2VZWA 3OCLA 1MWUA 4YOFA 2ZC3B 3VFFA 4FOFA 3AGDA 3G2ZA 1SHVA 2HPBA 3A3IA 2PHYA 2A3UA 4O7DA 3B3XA 1KGFA 1OTDA 5KSCA 1TD5A 2XRNA 1I5QA 3CI6A 3F1OB 3OPPA 1GA9A 1XJ6A 3UY6A 5EV0A 1GSVA 3D4FA 4UQIM 2WKHA 2VGLS 1KE0A 4EBNA 1Q2QA 1XFQA 3HJIA 3MQ0A 2WAFA 2A24A 1LL5A 3GDIA 2D02A 1OTBA 1ZHHB 3IWOA 5FQKA 4GHIA 1JWZA 3ZNTA 5A90A 4PM6A 3IF6B 4PAUA 3UB7A 2I9VA 3S7NA 4L0LA 2JBFA 1GHPA 5HD3A 3IBRA 4OONA 3RH8B 1QMEA 1IELA 1AWIA 5F82A 3QHYA 2WZZA 3IXBA 4LV2A 2UWXA 1DJCA 2FZ0A 2PD7A 2H28A 2XD1A 4N92A 4MBKA 4DE3A 5GHXA 3IX8A 1P0ZA 5DTTA 3A3JA 1LI9A 1IYSA 1CQAA 4ZJ3A 5CEDA 4F3LB 3MS6A 2JKTI 2VK3A 2ZD8A 4KZ4A 1WYCA 3IHBA 5D3OA 1W63M 1GHMA 1MY8A 1YM1A 1YLPA 3LY3A 2V20A 2J7VA 3G6OA 3LFVA 5AVFA 4H6JB 1YLTA 4B88A 2ZQ8A 4MN7A 5CECA 2HDUA 2VV6A 2R9WA 3CAXA 3SS5A 3IH9A 1TEMA 5FQMA 1GCEA 3IX3A 4Q0HA 1MWTA 3I7JA 2P9VB 2W3EA 3OPLA 5U47A 4KZ6A 1BYWA 3DWKA 3QNCA 4LFUA 3LIEA 4EETB 3UB8A 3IS2B 4PPRA 3DTIA 5HARA 1EI5A 2ZQAA 2EFXA 3MQOA 3P01A 3BECA 1OT6A 4X53A 2Y91A 1HLUP 1DY6A 1W8YA 2GNXA 3UB6A 5HAIA 2ZQ7A 2PYRA 1K4EA 3LIBA 5FEFA 1H8MA 4OOYA 4B4XA 1T19A 3ITBA 3NDGA 4OPRA 3DW0A 3ZYTA 5HFOA 3EEHA 2OAQ1 2WGWA 1F98A 3VMAA 2EFUA 1VHMA 2JKRI 4OOLA 1NRFA 4KZAA 1PIOA 3OBFA 1KDSA 2VX8A 1BTLA 3NJAA 3PTEA 4OQHA 1F5MA 3VOYA 1LSVA 1D7EA 1BZAA 2BASA 4N1HA 1ES2A 4NXEA 2E8IA 3C7VA 3D9YA 3A0VA 4LLOB 2EX6A 1GA0A 1BLSA 2Z6CA 4LRYC 4E3KA 4HQAA 5HL1A 2XDMA 1N9OA 1NWZA 5IU1A 4NKPA 4NXFA 2WYXA 1VM1A 1FIKA 3VP4A 3Q1FA 3Q07A 3B47A 3S4XA 3T12B 1BSGA 1Y4OA 4JGOA 4R38A 4EESA 4WM9A 4CLCB 4HESA 4IUHA 1ALQA 4BQMA 2ZL1A 5A8BA 3W4OA 4QD4A 1DP6A 3WS0A 4JXWA 2VGLM 3F1PB 3IQAA 5G4YA 4K0XA 3BJNA 3HLWA 4R4SA 2WKRA 1EWZA 3IS2A 4KQQA 3FWLA 5GL9A 3RTYA 3UE3A 2A49A 4E3NA 3LEQA 4KG5A 5GLAA 4R3AA 3KYZA 4L9FA 5EOEA 3N7WA 4QHCA 5DJUA 4PMAA 4BWIA 1CK3A 1SKOB 2Y2IA 2WGIA 5F83A 3KO6A 3OPHA 4M3KA 3WS1A 2HGVA 2RL3A 3S22A 1W79A 4U3TA 4Z1WA 3UB5P 4ETZA 3HCYA 1MXOA 1G6AA 4Y15A 3DTEA 3L7HA 1KVMA 3WRZA 3B33A 4GOGA 5HDCA 3O86A 4HIAA 4OOMA 1ES5A 1XGIA 2ZOIA 4GCZA 2K7SA 1LSXA 2ZMAA 2XROA 1N4OA 1FCNA 4KQDA 4X25A 1W7FA 1S66L 3HUOA 3NI9A 4E3MA 1ODVA 1XA7A 2I72A 5FDHA 2EXAA 1W8QA 4DE1A 3FKVA 4HH3A 3LYXA 3FPVA 2NUPC 2XFSA 4E3OA 3EGDC 3E2LA 4HNBA 4IVIA 2DMWA 3N6IA 1F9IA 3BWLA 2VV7A 2KLIA 4BD0A 2V0UA 4HJ6A 4WZ4A 3PR6A 1T1CA 2M7VA 2Y2KA 2GJ3A 3EQVA 2B02A 3S7PA 4DE0A 3E0YA 2P74A 1XPBA 2XLNA 3S7QA 4OH0A 2IWBA 1WE4A 3OCNA 4LRZE 3HLEA 5E2EA 4N9LA 4MN6A 4M4XA 3W2ZA 2DNSA 2K31A 3BW6A 3E4PA 3LICA 4Y13A 1NY0A 3MZFA 2ZL1B 3ZFZA 3EEAA 4UA9A 3UB9A 3C4PA 4HBUA 4PKYG 5FQJA 4OVDA 2PYPA 2V1AA 2W0NA 3LR3A 4HP9A 4OQIA 4ESPA 3ZG5A 2JKTM 4KZBA 1SKFA 2L0WA 4MEZA 1NLZA 3QP8A 3LUQA 3C5AA 2ZLYA 1E3UD 1WA9A 3IF5A 3MR0A 3FV7A 3UN7A 3VE4A 2Y2HA 4NXGA 3IH8A 4A5RA 3VSKA 5EFWA 5FA7A 3ISGA 3DAVA 1YSPA 3SS4A 1K25A 4XT2B 4LRXC 1LL9A 2R9XA 3QP6A 1H3QA 1Y54A 5DTKA 1Z09A 4WLAA 1JNUA 3VOZA 1YLYA 2C5WB 1NXYA 4LV3A 3PBNA 4Y0TA 2OLVA 4ARZB 1GSXA 4EXOA 2XEPA 2QJ7A 2W3DA 4DE2A 3LO7A 4CQHA 2Z6DA 3ZG7B 4BLMA 1IYQA 3F1OA 2WKEA 1ACFA 5EVIC 5HL6A 4HEFA 2QZ6A 4IHQA 2A2LA 2P9VA 4Y3IA 3G35A 2OOLA 4BD1A 1FSYA 3LI9A 3MKFA 2HP9A 1GHIA 2ZQ9A 4NK3A 2B18A 4EWFA 4MLLA 4E3IA 3A3DA 4KQOA 3CG5A 1OPXA 5HWTA 5AVEA 5HD5A 1IOUA 5TR7A 1RGZA 3O3VA 3V3SA 1N9BA 5CTMA 4NG2A 2ZC4B 1TS6A 5DKKA 3T1XA 3MXSA 4GHIB 2E8JA 1MKMA 3NBLA 4FUWA 1ES4A 2JKGA 3ZG8B 5FASA 2Y2PA 2WKQA 4BBUA 1S6RA 1W5DA 1KVLA 4YWZA 2DRWA 4XT2A 4ZJ1A 5E43A 1ESIA 1XJ2A 3C2WA 4MBHA 1XX2A 3LEZA 4N1XA 4DMZA 3UE6A 3OLOA 3MSHA 4HY8A 4KZ7A 4Q8IA 2OSUA 4IUKA 1JTDA 4DDSA 5KZHA 1TS7A 4S2IA 1XJ4A 1H0MA 2HP6A 4E6WA 1UWPX 3N8RA 3BEBA 1FCOA 3QP2A 5J4EA 4HI4A 2O9BA 3UDIA 2PBYA 4G3WA 3ZNYA 5HW3A 2W1TB 4PM7A 2RCXA 4R3JA 5MC7A 3DTMA 4MN5A 4R0QA 4K08A 2ZM0A 1AXBA 4PM9A 4OKPA 3VSLA 4CLCE 5M18A 2G2WA 1CF0A 1G5UA 3BLMA 5DJTA 1OMEA 1PWGA 3ZQ5A 1YMXA 1BUEA 2VKSA 1VQQA 5CHUA 3GTCA 1YPRA 1CI9A 4I5SA 1FILA 4XUXA 1XXMA 4JXVA 2CMNA 4DKIA 4PHTA 1M40A 5DF7A 1G6OA 4DJ2A 3O87A 5TGFA 3RFBA 5LBRA 1KE3A 4NXBA 3KYQA 1WYBA 1PZOA 3PAGA 4S2JA 1FR6A 5J8XA 1L2SA 5FL3A 2WKPA 3ZVWA 4F94A 4GJ4A 5AQBA 3QNBA 4PM5A 4HJ4A 3W8KA 4ZDXA 4WYYA 4G3KA 4EBPA 2LB9A 2J80A 2EX2A 1PW1A 1K4FA 3KSFA 1T18A 4ZJ2A 3NOTC 2W1TA 2CC1A 3G34A 3V5MA 2JN7A 4Y2FA 3D72A 3E4OA 3NIAA 3NULA 1MWSA 1K54C 4WF0A 5JYOA 3Q7VA 3PXPA 5FSRA 2L4RA 4EW7A 2D01A 1MZUA 1X0OA 5EVIB 3EQUA 5KIZA 3QP4A 2B95A 3ITAA 3GR2A 2GX5A 1YLWA 3FKWA 4UAAA 5CHJA 4XXRA 1YLZA 2OWHA 2XH9A 3WS5A 3GSGA 3IHAA 3VOLA 4FCFA 2AVXA 3NOPC 3IWIA 4DF6A 1JTGA 1JWVA 3CPTB 5DVAA 2J9PA 4C3QA 4RVAA 2ACGA 3MFXA 3WWXA 3FYZA 2J3WA 2Y2OA 4X1MA 4JGRA 1MKIA 3G32A 1K6RA 1LSWA 1Q2PA 5IT5A 3GV9A 2Z2MB 3ZG0A 3KSGA 1M6KA 2QMIA 1ZC2A 1VETB 1S1YA 4L9EA 5C5KA 4EUZA 4KZ3A 5EE8A 1J9MA 1I2WA 2O9CA 3HLGA 1XP4A 3GMWA 4JBFA 2P08A 4GD8A 4JF6A 3MBZA 3ZDJA 1TDGA 3NC8A 4QWOA 1PFLA 3LIDA 3MJQA 5AQ9A 1K57C 4ZAMA 4L9GA 4FSFA 4CPKA 1CJFA 2W1RA 4P6ZS 3H82B 4JPMA 5CTNA 3TJZC 3MKEA 3H9WA 1NZUA 4BJPA 1BLHA 1TDLA 2OWJA 4KZ8A 3HUNA 4WMCD 3IWQA 3CLOA 3SW1A 3HUMA 5F1FA 3TRCA 3FC7A 3LR0A 2Y4AA 3E98A 4X1LA 1ZG4A 4GS9B 4ZBEA 1XFNA 4EBLA 4Y0OA 1LI0A 3CUEC 2V0WA 1KDWA 1BULA 3GECA 1ES3A 2J8YA 3ICYA 5HAPA 2HDQA 3ZVTA 5CGXA 3MFDA 1PI5A 2HJ9C 2Q0OA 4GKUA 4S2OA 3IF6A 1JWPA 1E3UA 4OP8A 5FI7A 2IA2A 2V8CA 5M1AA 2EA9A 3N4IA 2XR0A 4ZTKA 2BLSA 4GW9A 2QWSA 3QP5A 4WMCA 3S7OA 1HTZA 2KX6A 4OLDA 2PAVP 1IFQA 3G31A 4R3BA 4Q0IA 1VB6A 4KZ9A 5HWWA 1S67L 2XGNA 3T4TA 2Y55A 3MZEA 2C6WB 1MWRA 1ZKJA 2ZMVA 1U60A 4BBTA 3U4LP 1S4SA 2XA7S 2JKFA 1YAXA 4II7A 1RP5A 3IXGA 3BFEA 5CHMA 3F1NA 4OP5A 5A92A 5FAPA 4YFMA 3LI8A 4MBFA 4EERA 1JVJA 2O0YA 2Y2MA 2LB5A 2V8FA 3OZHA 4RA7A 1YLJA 2FFFB 5E2GA 5CXWA 1L0GA 1SCWA 4WL9A 3U2AA 2P04A 4GN2A 4P87A 2VGJA 3B42A 4LPZA 3DBAA 2WAEA 3C7UA 2JC7A 2ZQDA 4BENA 3H82A 3P98A 4WEJA 1XKZA 2V1BA 3RXXA 1OT9A 4RX3A 3UE1A 4Z9QA 1PI4A 4GB7A 4OPQA 4OPYA 2PR5A 4Q0JA 3N8LA 3T4LA 3Q7ZA 3P09A 2Y2GA 5E2FA 4R70A 4Y5FA 3ZGAB 3HLFA 3UNWA 3TW8A 5DFXA 5I94A 5FDSA 2Q9NA 3V67A 1PWDA 3SH8A 5F1GA 3C30A 1VETA 2HP5A 1XJ3A 2EWWA 4N9KA 3NDEA 1LT0A 4C75A 2KOIA 2VEAA 1ERMA 3A0RA 4B93A 3C38A 4DN0A 4O0PA 1TVFA 5K5BA 3D3OA 4G3VA 2HV1A 3M2JA 1NJ4A 2VLGA 4Y0UA 3SH9A 4KG2A 1K56D 1Y28A 3ZCZA 3BFDA 4IEDA 1OJ5A 1T1BA 5CX7A 5FAOA 1SZVA 1KOUA 5L07A 2QPNA 4QJGA 4R6LA 3BLSA 4OQGA 2V2FF 1K0KA 3Q7VB 3UPPA 3VV4A 5HZHA 3IT9A 4JXSA 3R7WA 4MCWA 3RXWA 3HLCA 2IWCA 4KZ5A 2Y79A 1IKGA 3WS2A 4S2NC 5F68A 4KENB 4X69A 5AJGA 4E04A 1XA1A 4E6XA 4LCMA 4EEPA 1EW0A 4RQ9A 2EX9A 1K57A 3T4JA 1A0KA 3WS4A 4D2OA 4MMNA 3M2KA 4LV0A 5CERA 5HWVA 3KSIA 2PR6A 2FFYA 3C8CA 2INWA 1S4RA 1IYOA 3HVFA 3MQQA 2WGWB 4H8RA 1PWCA 3TSGA 2WUQA 4DRTA 1E25A 3HJKA 2YKHA 3O88A 4ME4A 4HP4A 1O7EA 5EM0A 3BFFA 4S2PA 4KG6A 4I3JA 4ZRRA 4P0MA 2K2NA 1LL8A 4ID4A 2X02A 3K3CA 3F1NB 4UA7A 1H8YA 4JF4A 5IHVA 2UV0E 3UMDA 2KDKA 3T50A 3Q82A 1L3LA 4QPRA 4EU0A 5J3WA 4ARZA 1IYPA 3O5YA 1DP9A 5FQIA 1YKDA 2O99A 2Y59A 5KSHA 3IBJA 1ZG6A 4UQIS 3CUEA 5CEBA 2B5RA 2QKPA 2PT7A 1VEUA 3T4QA 3BFCA 3GQZA 3PBOA 1ESUA 1NYMA 4B9OA 5FEGA 3AGEA 3HL9A 3IF6C 4P85A 5KMWA 3EOIA 4K0WA 4BL2A 3M6BA 1YT4A 1MC0A 1YMSA 3LR4A 2Z2LB 3T4SA 5DTSA 3UDXA 4YINA 1TS0A 2VJWA 4HJ3A 3DTKA 4PKYA 3VP3A 5IS1A 1EROA 4HH2A 4O01A 1PZPA 4U0XA 5FQ9A 3CITA 4EUVA 3G30A 4YNRA 1YQSA 4I3AA 3NOUC 4JKTA 4BMWA 3C4OA 3JPUA 2G7UA 1IKIA 3MXQA 2ZBBA 4GDNA 2FH5A 3E2KA 1BLCA 2H0YA 3FG8A 3UPOA 3WRTA 4X68A 1J3WA 2EXBA 4QU3A 3BQAA 5HAQA 5CGWA 3LIAA 3T1SA 4EV4A 4KQRA 2V1ZA 4IJGA 2XSSA 5FAQA 1ZTUA 1KGEA 1BLPA 1HD8A 4WUJA 3RJUA 1L0FA 5FQQA 2ZM8A 1PW8A 3SZTA 3W4PA 2Y8HA 2VV8A 3A0SA 4X56A 5HDSA 3NECA 4GD6A 2XFTA 3JVUA 3UPNA 3G4PA 3KX0X 5DF8A 1P9WA 3F1PA 2QHKA 3GRJA 4ETXA 4KUOA 4OQ0A 3ZHHA 5AQ7A 3CZDA 3OOVA 4O8GA 1C3BA 3L9KA 1FR1A 3PBQA 2JE5A 2PU4A 2WK0A 4K91A 2HDSA 5L8MA 3LIFA 4FH2A 1K38A 4JGQA 4BL3A 2H0TA 2QJ5A 3CPTA 4KUKA 3A3EA 2ZC5B 4E3JA 1GSWA 5CGSA 3N8SA 2PDRA 2P7JA 4PM8A 3MMHA 2J3TC 1RCJA 2HF6A 3VP1A 5L2FA 2W27A 1Z6FA 4GLQA 1ONHA 5FATA 2NUTC 5DFYA 3Q81A 4AFIA 2VA0A 1KGGA 5TBMA 1FOFA 1L0EA 1L0DA 3H7WA 3SOIA 2Y2QA 4CLCD 3IXHA 3PBSA 4MNRA 5I5LA 4CLCA 3AGFA 1H8ZA 2ZM2A 4QB8A 3T1QB 4WBGA 1OTIA 4NETA 2W3GA 1F2KA 1H5XA 2XD5A 5G18A 4S2KA 3T4KA 2H5SA 4LCLA 2XF3A 3H7WB 3UDFA 4S2MA 1DJAA 4R23A 4RX2A 2BG1A 2HDRA 2Q9MA 1STZA 5EVIA 5EVID 4GZBA 4WEKA 1KE4A 4JF5A 4UA6A 1HVBA 1V9YA 5E2HA 2OAP1 2X71A 4DDYA 2M7UA 2J3TD 3GVBA 4RYEA 2ZMFA 1FCMA 2L1MA 1K55C 1DJBA 1DP8A 3S1YA 2R78A 1OJGA
chains in the Genus database with same CATH topology
3PBTA 4R70A 4Y5FA 4DMZA 3UE6A 1BYWA 2HJEA 3KSHA 3BY8A 3OLOA 3TW8A 5DFXA 3LIEA 4EETB 3UB8A 4HY8A 3IS2B 4DJ3A 4IUKA 2W3HA 3MQOA 3V67A 3P01A 1TS7A 3C30A 1OT6A 1XJ4A 1T1AA 1P97A 1XJ3A 2EWWA 3UB6A 1UWPX 2GNXA 1LT0A 3R7WB 4BBVA 2PYRA 1N9NA 3LIBA 1H8MA 5J4EA 2KOIA 1T19A 4HI4A 2VEAA 4H6JA 3A0RA 4B93A 1N9LA 2O9BA 3P7NA 3BQ8A 3C38A 4G3WA 4MDZA 3ZYTA 4DN0A 1YSQA 2W1TB 4O0PA 5K5BA 1D06A 3D3OA 4G3VA 2HV1A 4I38A 2VLGA 3PYPA 3EEHA 2OAQ1 4HHDA 1F98A 5MC7A 5F5YA 1Y28A 2YKFA 4MN5A 1VHMA 4K08A 1OJ5A 2JKRI 1T1BA 3JVVA 5CX7A 4WELA 4OOLA 1KOUA 3OBFA 2VX8A 4CLCE 4R6LA 3NJAA 1F5MA 5DJTA 1LSVA 5TBMB 3ZQ5A 1D7EA 4GS9A 2PD8A 2VKSA 2BASA 4NXEA 3VV4A 5HZHA 3A0VA 4LLOB 4I5SA 3R7WA 2Z6CA 4LRYC 2CMNA 4HQAA 4PHTA 4MCWA 1W63Q 1G28A 5HPFA 1G6OA 1N9OA 1NWZA 1V9ZA 4DJ2A 2Y79A 5IU1A 4NKPA 3RFBA 5LBRA 4NXFA 5F68A 4NXBA 1UGUA 3KYQA 3B47A 5AJGA 4E04A 3NHQA 5FL3A 2WKPA 4EEPA 1EW0A 4RQ9A 4JGOA 4GJ4A 3T4JA 5HSQA 4MMNA 4R38A 4EESA 5G4ZA 4CLCB 5HWVA 4IUHA 1S1ZA 3KSIA 4HJ4A 2PR6A 5A8BA 3PBRA 3C8CA 1DP6A 2INWA 3K2NA 4G3KA 1S4RA 2LB9A 2J80A 5F6AA 3T4OA 2VGLM 3KSFA 1T18A 3MQQA 3F1PB 1UWNX 5G4YA 3BJNA 3EGXC 3NOTC 2W1TA 2WKRA 3K3DA 2JN7A 4Y2FA 3IS2A 3D72A 1OTAA 3HJKA 2M1CA 2YKHA 3RTYA 3E4OA 3UE3A 4ME4A 4HP4A 4I3JA 4WF0A 4R3AA 4ZRRA 3KYZA 4L9FA 4P6ZM 3PXPA 2L4RA 5DJUA 4BWIA 4EW7A 2D01A 2XA7M 2K2NA 1MZUA 1LL8A 1X0OA 3FPWA 3EQUA 3KO6A 5KIZA 3K3CA 2HGVA 3F1NB 3PHYA 4Z1WA 4ETZA 3HCYA 2O9AA 4EEUA 3UMDA 1DRMA 2GX5A 2KDKA 3T50A 4QPRA 4EU0A 5J3WA 2JKRM 2OWHA 3B33A 4ARZA 3O5YA 1DP9A 5HDCA 1YKDA 2O99A 1OTEA 4HIAA 1TS8A 4OOMA 5KSHA 2ZOIA 3IBJA 4GCZA 3VOLA 2K7SA 1LSXA 4UQIS 2XROA 3CUEA 3UMEA 2QYBA 4I39A 2QKPA 2PT7A 3T4QA 3NOPC 4KQDA 1P9RA 1S66L 2W3FA 3PBOA 1ODVA 4B9OA 3MFXA 4HH3A 2J3WA 3LYXA 3EWKA 3FPVA 3EOIA 4WN5A 5TJJA 2NUPC 4JGRA 1LSWA 3EGDC 1MC0A 3LR4A 5IT5A 5DF9A 3T4SA 3E4QA 4HNBA 3KSGA 1TS0A 2EWVA 3MF0A 2VJWA 5HPIA 2DMWA 4HJ3A 2GZAA 1S1YA 4PKYA 4L9EA 1F9IA 5C5KA 3BWLA 2VV7A 2A24B 4CLCC 5IS1A 2KLIA 2V0UA 4HH2A 4HJ6A 4JGPA 2O9CA 4O01A 3PR6A 1T1CA 2M7VA 3CITA 4EUVA 3VE3A 2GJ3A 2P08A 3EQVA 4I3AA 4NEED 4YNRA 2ZOHA 2B02A 3S7PA 3NOUC 3E0YA 1NRJA 3LR5A 4BMWA 3S7QA 2G7UA 2V9AA 3TE8A 3OCNA 3MXQA 4LRZE 3LIDA 2ZBBA 3MJQA 4L9GA 4MN6A 5F69A 4M4XA 4FSFA 2FH5A 3W2ZA 3R4KA 2K31A 4I3IA 3BW6A 3E4PA 3LICA 3ULFA 2W1RA 4P6ZS 5HDDA 3H82B 3FG8A 3OC2A 3TJZC 2MJ6A 3BY9A 3BQAA 3H9WA 3LIAA 4F3LA 3EEAA 4BJPA 1TF1A 3UB9A 5J7EA 4IJGA 2XSSA 4PKYG 1ZTUA 2OWJA 3CWFA 4HOIA 4WUJA 5DKLA 4UEYA 2PYPA 3CLOA 2V1AA 2W0NA 4EQ1A 3SW1A 3LR3A 4HP9A 1NLYA 2JHEA 3TRCA 3FC7A 2Y8HA 2VV8A 3A0SA 3LR0A 3E98A 4GS9B 2VZWA 3OCLA 5HDSA 1XFNA 2JKTM 3JVUA 2L0WA 1NLZA 4YOFA 3CUEC 2V0WA 3KX0X 3LUQA 3GECA 4FOFA 1P9WA 3F1PA 2QHKA 1WA9A 3ICYA 4ETXA 2PHYA 3MR0A 4KUOA 2HJ9C 3VE4A 4NXGA 3OOVA 1OTDA 1TD5A 2XRNA 3CI6A 3F1OB 4O8GA 5EFWA 2IA2A 3PBQA 1XJ6A 2EA9A 1YSPA 3LIFA 1GSVA 5L8MA 4JGQA 4UQIM 4XT2B 2QJ5A 2VGLS 4GW9A 2QWSA 4LRXC 4KUKA 1H3QA 3S7OA 4WLAA 1JNUA 1GSWA 2KX6A 1XFQA 3HJIA 2PDRA 3MQ0A 2A24A 1IFQA 2P7JA 3GDIA 3MMHA 4Q0IA 2J3TC 1VB6A 2HF6A 2D02A 5HWWA 1OTBA 1ZHHB 1S67L 4GHIA 3T4TA 3PBNA 4ARZB 2W27A 1GSXA 2ZMVA 4PAUA 3UB7A 2I9VA 4EXOA 2QJ7A 4BBTA 4GLQA 2NUTC 3S7NA 1S4SA 2W3DA 4L0LA 2XA7S 5DFYA 5HD3A 4AFIA 3IBRA 1YAXA 4II7A 3RH8B 2VA0A 5TBMA 3F1NA 4CQHA 3H7WA 2Z6DA 2FZ0A 2PD7A 4CLCD 5I5LA 3PBSA 4CLCA 3F1OA 2H28A 3LI8A 4EERA 5HL6A 1OTIA 1P0ZA 4IHQA 2A2LA 2O0YA 2W3GA 2LB5A 4Y3IA 2OOLA 3LI9A 4F3LB 3T4KA 2JKTI 2B18A 3H7WB 4KQOA 1OPXA 5HWTA 5AVEA 4WL9A 5HD5A 3U2AA 1IOUA 1W63M 2P04A 1STZA 4WEKA 3B42A 4LPZA 3G6OA 3DBAA 3LFVA 1TS6A 5DKKA 5AVFA 4GHIB 1MKMA 4H6JB 4MN7A 1V9YA 2VV6A 3H82A 2OAP1 2WKQA 4WEJA 3CAXA 4BBUA 2M7UA 2V1BA 2J3TD 1OT9A 4YWZA 2ZMFA 4XT2A 2L1MA 2PR5A 4Q0JA 3T4LA 1XJ2A 3C2WA 4Q0HA 1DP8A 2R78A 1OJGA 2W3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R70 A;  3HJI A;  2PDR A;  5G4Z A;  2A24 A;  3BWL A;  5HWV A;  2VV7 A;  2A24 B;  1S1Z A;  2P7J A;  4HJ4 A;  3GDI A;  2PR6 A;  3UE6 A;  1BYW A;  5IS1 A;  1VB6 A;  2V0U A;  5A8B A;  4HH2 A;  2D02 A;  3BY8 A;  4HJ6 A;  3OLO A;  4JGP A;  3C8C A;  1OTB A;  5HWW A;  1S67 L;  1DP6 A;  2INW A;  1T1C A;  3LIE A;  4EES A;  4EET B;  1S4R A;  4GHI A;  4HY8 A;  3UB8 A;  2J80 A;  3IS2 B;  5F6A A;  3VE3 A;  2GJ3 A;  1T18 A;  4I3A A;  3MQQ A;  3F1P B;  1UWN X;  2B02 A;  2W27 A;  1GSX A;  2ZOH A;  3NOU C;  5G4Y A;  2I9V A;  3UB7 A;  2QJ7 A;  4EXO A;  3MQO A;  4BBT A;  3NOT C;  1TS7 A;  1S4S A;  3K3D A;  1OT6 A;  2WKR A;  2JN7 A;  1XJ4 A;  2V9A A;  1T1A A;  3IBR A;  1P97 A;  5HD3 A;  1XJ3 A;  3IS2 A;  3RH8 B;  3UB6 A;  1UWP X;  3D72 A;  3MXQ A;  3LID A;  4LRZ E;  2ZBB A;  3MJQ A;  1OTA A;  3HJK A;  2M1C A;  2YKH A;  5TBM A;  1LT0 A;  3E4O A;  3RTY A;  4BBV A;  3F1N A;  2PYR A;  4HP4 A;  4L9G A;  1N9N A;  3H7W A;  3LIB A;  4MN6 A;  4M4X A;  5F69 A;  2Z6D A;  5J4E A;  1T19 A;  4I3J A;  4HI4 A;  2VEA A;  4I3I A;  2PD7 A;  3E4P A;  4H6J A;  3LIC A;  4R3A A;  4WF0 A;  3A0R A;  5I5L A;  3ULF A;  4L9F A;  1N9L A;  3P7N A;  5HDD A;  2L4R A;  3F1O A;  3H82 B;  2H28 A;  3FG8 A;  5DJU A;  4EW7 A;  2D01 A;  3LI8 A;  1MZU A;  1LL8 A;  1D06 A;  1X0O A;  4EER A;  2HV1 A;  3BY9 A;  1OTI A;  2VLG A;  3H9W A;  4I38 A;  5KIZ A;  3LIA A;  3PYP A;  3EEH A;  4F3L A;  1P0Z A;  3K3C A;  4HHD A;  1F98 A;  3UB9 A;  5J7E A;  5F5Y A;  1Y28 A;  2YKF A;  3F1N B;  3PHY A;  4MN5 A;  4PKY G;  2OWJ A;  1OJ5 A;  3CWF A;  1T1B A;  4HOI A;  4K08 A;  4WUJ A;  5DKL A;  2OOL A;  4EEU A;  3LI9 A;  2PYP A;  3UMD A;  1DRM A;  3CLO A;  2KDK A;  3T50 A;  2V1A A;  2W0N A;  4F3L B;  1KOU A;  4EQ1 A;  3SW1 A;  4HP9 A;  3NJA A;  4R6L A;  5J3W A;  3H7W B;  2JHE A;  2OWH A;  3B33 A;  3FC7 A;  3A0S A;  2VV8 A;  5DJT A;  1LSV A;  5TBM B;  3ZQ5 A;  1DP9 A;  1D7E A;  5HDC A;  4GS9 B;  5HDS A;  5HWT A;  4GS9 A;  1OTE A;  1XFN A;  2PD8 A;  4HIA A;  4WL9 A;  5AVE A;  2BAS A;  5HD5 A;  1TS8 A;  2L0W A;  4NXE A;  4DJ3 A;  2ZOI A;  5HZH A;  3A0V A;  2V0W A;  4GCZ A;  3VOL A;  3KX0 X;  3LUQ A;  4LLO B;  2K7S A;  1LSX A;  4I5S A;  4LRY C;  3GEC A;  3UME A;  3F1P A;  2QHK A;  4I39 A;  2QKP A;  4LPZ A;  2Z6C A;  1WA9 A;  3G6O A;  3ICY A;  3NOP C;  2CMN A;  2PHY A;  1TS6 A;  3MR0 A;  4KQD A;  4KUO A;  4HQA A;  5DKK A;  5AVF A;  4GHI B;  1S66 L;  1G28 A;  4H6J B;  3VE4 A;  4L9E A;  4NXG A;  1N9O A;  1ODV A;  1NWZ A;  1V9Z A;  4B9O A;  4DJ2 A;  1OTD A;  2KX6 A;  5IU1 A;  3MFX A;  1V9Y A;  4NXF A;  2VV6 A;  3F1O B;  3H82 A;  4HH3 A;  3LYX A;  3EWK A;  4WN5 A;  2WKQ A;  3CAX A;  5EFW A;  5F68 A;  4BBU A;  4JGR A;  4NXB A;  2V1B A;  4PKY A;  1XJ6 A;  1LSW A;  1UGU A;  1OT9 A;  2EA9 A;  4YWZ A;  4E04 A;  3LIF A;  1GSV A;  4JGQ A;  4XT2 A;  2L1M A;  3E4Q A;  4XT2 B;  2QJ5 A;  3NHQ A;  4GW9 A;  2QWS A;  4HNB A;  4LRX C;  2PR5 A;  2WKP A;  4EEP A;  1EW0 A;  1TS0 A;  4RQ9 A;  1XJ2 A;  4JGO A;  4KUK A;  3C2W A;  4HJ3 A;  1JNU A;  1GSW A;  4WLA A;  1DP8 A;  1S1Y A;  2R78 A;  4R38 A;  1OJG A;  1XFQ A;  1F9I A;  5HSQ A; 
#chains in the Genus database with same CATH topology
 3PBT A;  3NY4 A;  2VGK A;  1NZO A;  2HJE A;  3BY8 A;  1FSW A;  3KSH A;  4WZ5 A;  5EPH A;  4DJ3 A;  1PRQ A;  1MBL A;  2W3H A;  3MXR A;  5GHY A;  1T1A A;  1P97 A;  3FZC A;  2XK1 A;  3M6H A;  5L10 A;  3SH7 A;  2JCH A;  3CJM A;  3R7W B;  2ZQC A;  3V39 A;  2ZC7 A;  4BBV A;  1N9N A;  2WKI A;  2BTF P;  4DXB A;  3VP0 A;  4H6J A;  2OV5 A;  3ZG9 B;  1N9L A;  3P7N A;  4HBT A;  3BQ8 A;  4MDZ A;  1YSQ A;  2Y2J A;  4GNU A;  1D06 A;  4D60 A;  4I38 A;  3PYP A;  4UHU A;  2ZC6 B;  4HHD A;  4C6Y A;  3W4Q A;  5F5Y A;  2YKF A;  3HBR A;  2H10 A;  3JVV A;  3V3R A;  4WEL A;  1PYY A;  4P6B A;  1FQG A;  4R1G A;  2Y2N A;  3CHW P;  5TBM B;  5JYP A;  1O07 A;  4GS9 A;  2PD8 A;  3G2Y A;  4FH4 A;  3OPR A;  1BT5 A;  2ZJ9 A;  1ONG A;  4XUZ A;  1ERQ A;  3HRE A;  3HLD A;  4R4R A;  1W63 Q;  5EVL A;  1G28 A;  5FI6 A;  1IEM A;  5HPF A;  1V9Z A;  5BOH A;  5GHZ A;  1RGY A;  5TFQ A;  5EVE A;  1UGU A;  2EX8 A;  5GLB A;  3A3F A;  3NHQ A;  2DCF A;  3BRM A;  4LEN A;  5CRF A;  3VP2 A;  3V50 A;  3TOI A;  5HSQ A;  1S0W A;  5G4Z A;  1S1Z A;  4WZ5 C;  4IBX A;  3LCE A;  3PBR A;  5EM1 A;  1SDN A;  3K2N A;  4OLG A;  2XQZ A;  3T4O A;  1HZO A;  5EEC A;  5F6A A;  2PU2 A;  1UWN X;  3EGX C;  4X55 A;  3K3D A;  3DWZ A;  3VFH A;  4E3L A;  2GDN A;  3CMZ A;  5M19 A;  4X6T A;  1OTA A;  2M1C A;  4EQI A;  1XGJ A;  3IXD A;  4P6Z M;  4IBR A;  2XA7 M;  3FPW A;  1K55 A;  2PRF A;  1G68 A;  2PBD P;  1D1J A;  3PHY A;  4B4Z A;  4Y7P A;  2O9A A;  4EEU A;  1CI8 A;  1DRM A;  4QY6 A;  2WGV A;  4OPZ A;  1K54 A;  3BFG A;  2JKR M;  4JLF A;  3BYD A;  4U0T A;  1PNE A;  1OTE A;  3TG9 A;  1TS8 A;  5FI2 A;  3KYE A;  1MPL A;  5EUA A;  3IX4 A;  3UME A;  2QYB A;  4I39 A;  2WZX A;  4LV1 A;  1QMF A;  1P9R A;  2W3F A;  4FD8 A;  5GLD A;  3NCK A;  1SKO A;  4DXC A;  3EWK A;  5TJJ A;  4WN5 A;  4Y17 A;  5DF9 A;  5AQA A;  2HZ5 A;  3E4Q A;  1CEG A;  1I2S A;  4GDB A;  2WAD A;  3UE0 A;  2EWV A;  3MF0 A;  3MZD A;  5HPI A;  3BM6 A;  2GZA A;  3LGO A;  4CLC C;  2A24 B;  1NYY A;  1LHY A;  4CJN A;  4JGP A;  3VE3 A;  4NEE D;  4LGW A;  2ZOH A;  3UO9 A;  1LLB A;  1NRJ A;  3LR5 A;  2V9A A;  1CEF A;  3TE8 A;  5F69 A;  3R4K A;  5GLC A;  3HLB A;  4I3I A;  1SDE A;  3ULF A;  2J9O A;  3PAE A;  5EOO A;  5HDD A;  3T1R A;  1VEU B;  4JXG A;  5A91 A;  3OC2 A;  3SS3 A;  5A93 A;  3QP1 A;  2MJ6 A;  3BY9 A;  4F3L A;  4FTX A;  5HX9 A;  1TF1 A;  1K56 A;  2G2U A;  5J7E A;  1E4D A;  3LY4 A;  3CWF A;  2Y2L A;  4HOI A;  5DKL A;  4UEY A;  5L09 A;  4S2L A;  4IVK A;  4QY5 A;  4EQ1 A;  2IWD A;  2OLU A;  1NLY A;  3JYI A;  1K6S A;  2JHE A;  2X01 A;  4S2N A;  2VZW A;  3OCL A;  1MWU A;  4YOF A;  2ZC3 B;  3VFF A;  4FOF A;  3AGD A;  3G2Z A;  1SHV A;  2HPB A;  3A3I A;  2PHY A;  2A3U A;  4O7D A;  3B3X A;  1KGF A;  1OTD A;  5KSC A;  1TD5 A;  2XRN A;  1I5Q A;  3CI6 A;  3F1O B;  3OPP A;  1GA9 A;  1XJ6 A;  3UY6 A;  5EV0 A;  1GSV A;  3D4F A;  4UQI M;  2WKH A;  2VGL S;  1KE0 A;  4EBN A;  1Q2Q A;  1XFQ A;  3HJI A;  3MQ0 A;  2WAF A;  2A24 A;  1LL5 A;  3GDI A;  2D02 A;  1OTB A;  1ZHH B;  3IWO A;  5FQK A;  4GHI A;  1JWZ A;  3ZNT A;  5A90 A;  4PM6 A;  3IF6 B;  4PAU A;  3UB7 A;  2I9V A;  3S7N A;  4L0L A;  2JBF A;  1GHP A;  5HD3 A;  3IBR A;  4OON A;  3RH8 B;  1QME A;  1IEL A;  1AWI A;  5F82 A;  3QHY A;  2WZZ A;  3IXB A;  4LV2 A;  2UWX A;  1DJC A;  2FZ0 A;  2PD7 A;  2H28 A;  2XD1 A;  4N92 A;  4MBK A;  4DE3 A;  5GHX A;  3IX8 A;  1P0Z A;  5DTT A;  3A3J A;  1LI9 A;  1IYS A;  1CQA A;  4ZJ3 A;  5CED A;  4F3L B;  3MS6 A;  2JKT I;  2VK3 A;  2ZD8 A;  4KZ4 A;  1WYC A;  3IHB A;  5D3O A;  1W63 M;  1GHM A;  1MY8 A;  1YM1 A;  1YLP A;  3LY3 A;  2V20 A;  2J7V A;  3G6O A;  3LFV A;  5AVF A;  4H6J B;  1YLT A;  4B88 A;  2ZQ8 A;  4MN7 A;  5CEC A;  2HDU A;  2VV6 A;  2R9W A;  3CAX A;  3SS5 A;  3IH9 A;  1TEM A;  5FQM A;  1GCE A;  3IX3 A;  4Q0H A;  1MWT A;  3I7J A;  2P9V B;  2W3E A;  3OPL A;  5U47 A;  4KZ6 A;  1BYW A;  3DWK A;  3QNC A;  4LFU A;  3LIE A;  4EET B;  3UB8 A;  3IS2 B;  4PPR A;  3DTI A;  5HAR A;  1EI5 A;  2ZQA A;  2EFX A;  3MQO A;  3P01 A;  3BEC A;  1OT6 A;  4X53 A;  2Y91 A;  1HLU P;  1DY6 A;  1W8Y A;  2GNX A;  3UB6 A;  5HAI A;  2ZQ7 A;  2PYR A;  1K4E A;  3LIB A;  5FEF A;  1H8M A;  4OOY A;  4B4X A;  1T19 A;  3ITB A;  3NDG A;  4OPR A;  3DW0 A;  3ZYT A;  5HFO A;  3EEH A;  2OAQ 1;  2WGW A;  1F98 A;  3VMA A;  2EFU A;  1VHM A;  2JKR I;  4OOL A;  1NRF A;  4KZA A;  1PIO A;  3OBF A;  1KDS A;  2VX8 A;  1BTL A;  3NJA A;  3PTE A;  4OQH A;  1F5M A;  3VOY A;  1LSV A;  1D7E A;  1BZA A;  2BAS A;  4N1H A;  1ES2 A;  4NXE A;  2E8I A;  3C7V A;  3D9Y A;  3A0V A;  4LLO B;  2EX6 A;  1GA0 A;  1BLS A;  2Z6C A;  4LRY C;  4E3K A;  4HQA A;  5HL1 A;  2XDM A;  1N9O A;  1NWZ A;  5IU1 A;  4NKP A;  4NXF A;  2WYX A;  1VM1 A;  1FIK A;  3VP4 A;  3Q1F A;  3Q07 A;  3B47 A;  3S4X A;  3T12 B;  1BSG A;  1Y4O A;  4JGO A;  4R38 A;  4EES A;  4WM9 A;  4CLC B;  4HES A;  4IUH A;  1ALQ A;  4BQM A;  2ZL1 A;  5A8B A;  3W4O A;  4QD4 A;  1DP6 A;  3WS0 A;  4JXW A;  2VGL M;  3F1P B;  3IQA A;  5G4Y A;  4K0X A;  3BJN A;  3HLW A;  4R4S A;  2WKR A;  1EWZ A;  3IS2 A;  4KQQ A;  3FWL A;  5GL9 A;  3RTY A;  3UE3 A;  2A49 A;  4E3N A;  3LEQ A;  4KG5 A;  5GLA A;  4R3A A;  3KYZ A;  4L9F A;  5EOE A;  3N7W A;  4QHC A;  5DJU A;  4PMA A;  4BWI A;  1CK3 A;  1SKO B;  2Y2I A;  2WGI A;  5F83 A;  3KO6 A;  3OPH A;  4M3K A;  3WS1 A;  2HGV A;  2RL3 A;  3S22 A;  1W79 A;  4U3T A;  4Z1W A;  3UB5 P;  4ETZ A;  3HCY A;  1MXO A;  1G6A A;  4Y15 A;  3DTE A;  3L7H A;  1KVM A;  3WRZ A;  3B33 A;  4GOG A;  5HDC A;  3O86 A;  4HIA A;  4OOM A;  1ES5 A;  1XGI A;  2ZOI A;  4GCZ A;  2K7S A;  1LSX A;  2ZMA A;  2XRO A;  1N4O A;  1FCN A;  4KQD A;  4X25 A;  1W7F A;  1S66 L;  3HUO A;  3NI9 A;  4E3M A;  1ODV A;  1XA7 A;  2I72 A;  5FDH A;  2EXA A;  1W8Q A;  4DE1 A;  3FKV A;  4HH3 A;  3LYX A;  3FPV A;  2NUP C;  2XFS A;  4E3O A;  3EGD C;  3E2L A;  4HNB A;  4IVI A;  2DMW A;  3N6I A;  1F9I A;  3BWL A;  2VV7 A;  2KLI A;  4BD0 A;  2V0U A;  4HJ6 A;  4WZ4 A;  3PR6 A;  1T1C A;  2M7V A;  2Y2K A;  2GJ3 A;  3EQV A;  2B02 A;  3S7P A;  4DE0 A;  3E0Y A;  2P74 A;  1XPB A;  2XLN A;  3S7Q A;  4OH0 A;  2IWB A;  1WE4 A;  3OCN A;  4LRZ E;  3HLE A;  5E2E A;  4N9L A;  4MN6 A;  4M4X A;  3W2Z A;  2DNS A;  2K31 A;  3BW6 A;  3E4P A;  3LIC A;  4Y13 A;  1NY0 A;  3MZF A;  2ZL1 B;  3ZFZ A;  3EEA A;  4UA9 A;  3UB9 A;  3C4P A;  4HBU A;  4PKY G;  5FQJ A;  4OVD A;  2PYP A;  2V1A A;  2W0N A;  3LR3 A;  4HP9 A;  4OQI A;  4ESP A;  3ZG5 A;  2JKT M;  4KZB A;  1SKF A;  2L0W A;  4MEZ A;  1NLZ A;  3QP8 A;  3LUQ A;  3C5A A;  2ZLY A;  1E3U D;  1WA9 A;  3IF5 A;  3MR0 A;  3FV7 A;  3UN7 A;  3VE4 A;  2Y2H A;  4NXG A;  3IH8 A;  4A5R A;  3VSK A;  5EFW A;  5FA7 A;  3ISG A;  3DAV A;  1YSP A;  3SS4 A;  1K25 A;  4XT2 B;  4LRX C;  1LL9 A;  2R9X A;  3QP6 A;  1H3Q A;  1Y54 A;  5DTK A;  1Z09 A;  4WLA A;  1JNU A;  3VOZ A;  1YLY A;  2C5W B;  1NXY A;  4LV3 A;  3PBN A;  4Y0T A;  2OLV A;  4ARZ B;  1GSX A;  4EXO A;  2XEP A;  2QJ7 A;  2W3D A;  4DE2 A;  3LO7 A;  4CQH A;  2Z6D A;  3ZG7 B;  4BLM A;  1IYQ A;  3F1O A;  2WKE A;  1ACF A;  5EVI C;  5HL6 A;  4HEF A;  2QZ6 A;  4IHQ A;  2A2L A;  2P9V A;  4Y3I A;  3G35 A;  2OOL A;  4BD1 A;  1FSY A;  3LI9 A;  3MKF A;  2HP9 A;  1GHI A;  2ZQ9 A;  4NK3 A;  2B18 A;  4EWF A;  4MLL A;  4E3I A;  3A3D A;  4KQO A;  3CG5 A;  1OPX A;  5HWT A;  5AVE A;  5HD5 A;  1IOU A;  5TR7 A;  1RGZ A;  3O3V A;  3V3S A;  1N9B A;  5CTM A;  4NG2 A;  2ZC4 B;  1TS6 A;  5DKK A;  3T1X A;  3MXS A;  4GHI B;  2E8J A;  1MKM A;  3NBL A;  4FUW A;  1ES4 A;  2JKG A;  3ZG8 B;  5FAS A;  2Y2P A;  2WKQ A;  4BBU A;  1S6R A;  1W5D A;  1KVL A;  4YWZ A;  2DRW A;  4XT2 A;  4ZJ1 A;  5E43 A;  1ESI A;  1XJ2 A;  3C2W A;  4MBH A;  1XX2 A;  3LEZ A;  4N1X A;  4DMZ A;  3UE6 A;  3OLO A;  3MSH A;  4HY8 A;  4KZ7 A;  4Q8I A;  2OSU A;  4IUK A;  1JTD A;  4DDS A;  5KZH A;  1TS7 A;  4S2I A;  1XJ4 A;  1H0M A;  2HP6 A;  4E6W A;  1UWP X;  3N8R A;  3BEB A;  1FCO A;  3QP2 A;  5J4E A;  4HI4 A;  2O9B A;  3UDI A;  2PBY A;  4G3W A;  3ZNY A;  5HW3 A;  2W1T B;  4PM7 A;  2RCX A;  4R3J A;  5MC7 A;  3DTM A;  4MN5 A;  4R0Q A;  4K08 A;  2ZM0 A;  1AXB A;  4PM9 A;  4OKP A;  3VSL A;  4CLC E;  5M18 A;  2G2W A;  1CF0 A;  1G5U A;  3BLM A;  5DJT A;  1OME A;  1PWG A;  3ZQ5 A;  1YMX A;  1BUE A;  2VKS A;  1VQQ A;  5CHU A;  3GTC A;  1YPR A;  1CI9 A;  4I5S A;  1FIL A;  4XUX A;  1XXM A;  4JXV A;  2CMN A;  4DKI A;  4PHT A;  1M40 A;  5DF7 A;  1G6O A;  4DJ2 A;  3O87 A;  5TGF A;  3RFB A;  5LBR A;  1KE3 A;  4NXB A;  3KYQ A;  1WYB A;  1PZO A;  3PAG A;  4S2J A;  1FR6 A;  5J8X A;  1L2S A;  5FL3 A;  2WKP A;  3ZVW A;  4F94 A;  4GJ4 A;  5AQB A;  3QNB A;  4PM5 A;  4HJ4 A;  3W8K A;  4ZDX A;  4WYY A;  4G3K A;  4EBP A;  2LB9 A;  2J80 A;  2EX2 A;  1PW1 A;  1K4F A;  3KSF A;  1T18 A;  4ZJ2 A;  3NOT C;  2W1T A;  2CC1 A;  3G34 A;  3V5M A;  2JN7 A;  4Y2F A;  3D72 A;  3E4O A;  3NIA A;  3NUL A;  1MWS A;  1K54 C;  4WF0 A;  5JYO A;  3Q7V A;  3PXP A;  5FSR A;  2L4R A;  4EW7 A;  2D01 A;  1MZU A;  1X0O A;  5EVI B;  3EQU A;  5KIZ A;  3QP4 A;  2B95 A;  3ITA A;  3GR2 A;  2GX5 A;  1YLW A;  3FKW A;  4UAA A;  5CHJ A;  4XXR A;  1YLZ A;  2OWH A;  2XH9 A;  3WS5 A;  3GSG A;  3IHA A;  3VOL A;  4FCF A;  2AVX A;  3NOP C;  3IWI A;  4DF6 A;  1JTG A;  1JWV A;  3CPT B;  5DVA A;  2J9P A;  4C3Q A;  4RVA A;  2ACG A;  3MFX A;  3WWX A;  3FYZ A;  2J3W A;  2Y2O A;  4X1M A;  4JGR A;  1MKI A;  3G32 A;  1K6R A;  1LSW A;  1Q2P A;  5IT5 A;  3GV9 A;  2Z2M B;  3ZG0 A;  3KSG A;  1M6K A;  2QMI A;  1ZC2 A;  1VET B;  1S1Y A;  4L9E A;  5C5K A;  4EUZ A;  4KZ3 A;  5EE8 A;  1J9M A;  1I2W A;  2O9C A;  3HLG A;  1XP4 A;  3GMW A;  4JBF A;  2P08 A;  4GD8 A;  4JF6 A;  3MBZ A;  3ZDJ A;  1TDG A;  3NC8 A;  4QWO A;  1PFL A;  3LID A;  3MJQ A;  5AQ9 A;  1K57 C;  4ZAM A;  4L9G A;  4FSF A;  4CPK A;  1CJF A;  2W1R A;  4P6Z S;  3H82 B;  4JPM A;  5CTN A;  3TJZ C;  3MKE A;  3H9W A;  1NZU A;  4BJP A;  1BLH A;  1TDL A;  2OWJ A;  4KZ8 A;  3HUN A;  4WMC D;  3IWQ A;  3CLO A;  3SW1 A;  3HUM A;  5F1F A;  3TRC A;  3FC7 A;  3LR0 A;  2Y4A A;  3E98 A;  4X1L A;  1ZG4 A;  4GS9 B;  4ZBE A;  1XFN A;  4EBL A;  4Y0O A;  1LI0 A;  3CUE C;  2V0W A;  1KDW A;  1BUL A;  3GEC A;  1ES3 A;  2J8Y A;  3ICY A;  5HAP A;  2HDQ A;  3ZVT A;  5CGX A;  3MFD A;  1PI5 A;  2HJ9 C;  2Q0O A;  4GKU A;  4S2O A;  3IF6 A;  1JWP A;  1E3U A;  4OP8 A;  5FI7 A;  2IA2 A;  2V8C A;  5M1A A;  2EA9 A;  3N4I A;  2XR0 A;  4ZTK A;  2BLS A;  4GW9 A;  2QWS A;  3QP5 A;  4WMC A;  3S7O A;  1HTZ A;  2KX6 A;  4OLD A;  2PAV P;  1IFQ A;  3G31 A;  4R3B A;  4Q0I A;  1VB6 A;  4KZ9 A;  5HWW A;  1S67 L;  2XGN A;  3T4T A;  2Y55 A;  3MZE A;  2C6W B;  1MWR A;  1ZKJ A;  2ZMV A;  1U60 A;  4BBT A;  3U4L P;  1S4S A;  2XA7 S;  2JKF A;  1YAX A;  4II7 A;  1RP5 A;  3IXG A;  3BFE A;  5CHM A;  3F1N A;  4OP5 A;  5A92 A;  5FAP A;  4YFM A;  3LI8 A;  4MBF A;  4EER A;  1JVJ A;  2O0Y A;  2Y2M A;  2LB5 A;  2V8F A;  3OZH A;  4RA7 A;  1YLJ A;  2FFF B;  5E2G A;  5CXW A;  1L0G A;  1SCW A;  4WL9 A;  3U2A A;  2P04 A;  4GN2 A;  4P87 A;  2VGJ A;  3B42 A;  4LPZ A;  3DBA A;  2WAE A;  3C7U A;  2JC7 A;  2ZQD A;  4BEN A;  3H82 A;  3P98 A;  4WEJ A;  1XKZ A;  2V1B A;  3RXX A;  1OT9 A;  4RX3 A;  3UE1 A;  4Z9Q A;  1PI4 A;  4GB7 A;  4OPQ A;  4OPY A;  2PR5 A;  4Q0J A;  3N8L A;  3T4L A;  3Q7Z A;  3P09 A;  2Y2G A;  5E2F A;  4R70 A;  4Y5F A;  3ZGA B;  3HLF A;  3UNW A;  3TW8 A;  5DFX A;  5I94 A;  5FDS A;  2Q9N A;  3V67 A;  1PWD A;  3SH8 A;  5F1G A;  3C30 A;  1VET A;  2HP5 A;  1XJ3 A;  2EWW A;  4N9K A;  3NDE A;  1LT0 A;  4C75 A;  2KOI A;  2VEA A;  1ERM A;  3A0R A;  4B93 A;  3C38 A;  4DN0 A;  4O0P A;  1TVF A;  5K5B A;  3D3O A;  4G3V A;  2HV1 A;  3M2J A;  1NJ4 A;  2VLG A;  4Y0U A;  3SH9 A;  4KG2 A;  1K56 D;  1Y28 A;  3ZCZ A;  3BFD A;  4IED A;  1OJ5 A;  1T1B A;  5CX7 A;  5FAO A;  1SZV A;  1KOU A;  5L07 A;  2QPN A;  4QJG A;  4R6L A;  3BLS A;  4OQG A;  2V2F F;  1K0K A;  3Q7V B;  3UPP A;  3VV4 A;  5HZH A;  3IT9 A;  4JXS A;  3R7W A;  4MCW A;  3RXW A;  3HLC A;  2IWC A;  4KZ5 A;  2Y79 A;  1IKG A;  3WS2 A;  4S2N C;  5F68 A;  4KEN B;  4X69 A;  5AJG A;  4E04 A;  1XA1 A;  4E6X A;  4LCM A;  4EEP A;  1EW0 A;  4RQ9 A;  2EX9 A;  1K57 A;  3T4J A;  1A0K A;  3WS4 A;  4D2O A;  4MMN A;  3M2K A;  4LV0 A;  5CER A;  5HWV A;  3KSI A;  2PR6 A;  2FFY A;  3C8C A;  2INW A;  1S4R A;  1IYO A;  3HVF A;  3MQQ A;  2WGW B;  4H8R A;  1PWC A;  3TSG A;  2WUQ A;  4DRT A;  1E25 A;  3HJK A;  2YKH A;  3O88 A;  4ME4 A;  4HP4 A;  1O7E A;  5EM0 A;  3BFF A;  4S2P A;  4KG6 A;  4I3J A;  4ZRR A;  4P0M A;  2K2N A;  1LL8 A;  4ID4 A;  2X02 A;  3K3C A;  3F1N B;  4UA7 A;  1H8Y A;  4JF4 A;  5IHV A;  2UV0 E;  3UMD A;  2KDK A;  3T50 A;  3Q82 A;  1L3L A;  4QPR A;  4EU0 A;  5J3W A;  4ARZ A;  1IYP A;  3O5Y A;  1DP9 A;  5FQI A;  1YKD A;  2O99 A;  2Y59 A;  5KSH A;  3IBJ A;  1ZG6 A;  4UQI S;  3CUE A;  5CEB A;  2B5R A;  2QKP A;  2PT7 A;  1VEU A;  3T4Q A;  3BFC A;  3GQZ A;  3PBO A;  1ESU A;  1NYM A;  4B9O A;  5FEG A;  3AGE A;  3HL9 A;  3IF6 C;  4P85 A;  5KMW A;  3EOI A;  4K0W A;  4BL2 A;  3M6B A;  1YT4 A;  1MC0 A;  1YMS A;  3LR4 A;  2Z2L B;  3T4S A;  5DTS A;  3UDX A;  4YIN A;  1TS0 A;  2VJW A;  4HJ3 A;  3DTK A;  4PKY A;  3VP3 A;  5IS1 A;  1ERO A;  4HH2 A;  4O01 A;  1PZP A;  4U0X A;  5FQ9 A;  3CIT A;  4EUV A;  3G30 A;  4YNR A;  1YQS A;  4I3A A;  3NOU C;  4JKT A;  4BMW A;  3C4O A;  3JPU A;  2G7U A;  1IKI A;  3MXQ A;  2ZBB A;  4GDN A;  2FH5 A;  3E2K A;  1BLC A;  2H0Y A;  3FG8 A;  3UPO A;  3WRT A;  4X68 A;  1J3W A;  2EXB A;  4QU3 A;  3BQA A;  5HAQ A;  5CGW A;  3LIA A;  3T1S A;  4EV4 A;  4KQR A;  2V1Z A;  4IJG A;  2XSS A;  5FAQ A;  1ZTU A;  1KGE A;  1BLP A;  1HD8 A;  4WUJ A;  3RJU A;  1L0F A;  5FQQ A;  2ZM8 A;  1PW8 A;  3SZT A;  3W4P A;  2Y8H A;  2VV8 A;  3A0S A;  4X56 A;  5HDS A;  3NEC A;  4GD6 A;  2XFT A;  3JVU A;  3UPN A;  3G4P A;  3KX0 X;  5DF8 A;  1P9W A;  3F1P A;  2QHK A;  3GRJ A;  4ETX A;  4KUO A;  4OQ0 A;  3ZHH A;  5AQ7 A;  3CZD A;  3OOV A;  4O8G A;  1C3B A;  3L9K A;  1FR1 A;  3PBQ A;  2JE5 A;  2PU4 A;  2WK0 A;  4K91 A;  2HDS A;  5L8M A;  3LIF A;  4FH2 A;  1K38 A;  4JGQ A;  4BL3 A;  2H0T A;  2QJ5 A;  3CPT A;  4KUK A;  3A3E A;  2ZC5 B;  4E3J A;  1GSW A;  5CGS A;  3N8S A;  2PDR A;  2P7J A;  4PM8 A;  3MMH A;  2J3T C;  1RCJ A;  2HF6 A;  3VP1 A;  5L2F A;  2W27 A;  1Z6F A;  4GLQ A;  1ONH A;  5FAT A;  2NUT C;  5DFY A;  3Q81 A;  4AFI A;  2VA0 A;  1KGG A;  5TBM A;  1FOF A;  1L0E A;  1L0D A;  3H7W A;  3SOI A;  2Y2Q A;  4CLC D;  3IXH A;  3PBS A;  4MNR A;  5I5L A;  4CLC A;  3AGF A;  1H8Z A;  2ZM2 A;  4QB8 A;  3T1Q B;  4WBG A;  1OTI A;  4NET A;  2W3G A;  1F2K A;  1H5X A;  2XD5 A;  5G18 A;  4S2K A;  3T4K A;  2H5S A;  4LCL A;  2XF3 A;  3H7W B;  3UDF A;  4S2M A;  1DJA A;  4R23 A;  4RX2 A;  2BG1 A;  2HDR A;  2Q9M A;  1STZ A;  5EVI A;  5EVI D;  4GZB A;  4WEK A;  1KE4 A;  4JF5 A;  4UA6 A;  1HVB A;  1V9Y A;  5E2H A;  2OAP 1;  2X71 A;  4DDY A;  2M7U A;  2J3T D;  3GVB A;  4RYE A;  2ZMF A;  1FCM A;  2L1M A;  1K55 C;  1DJB A;  1DP8 A;  3S1Y A;  2R78 A;  1OJG A; 
#chains in the Genus database with same CATH homology
 3PBT A;  4R70 A;  4Y5F A;  4DMZ A;  3UE6 A;  1BYW A;  2HJE A;  3KSH A;  3BY8 A;  3OLO A;  3TW8 A;  5DFX A;  3LIE A;  4EET B;  3UB8 A;  4HY8 A;  3IS2 B;  4DJ3 A;  4IUK A;  2W3H A;  3MQO A;  3V67 A;  3P01 A;  1TS7 A;  3C30 A;  1OT6 A;  1XJ4 A;  1T1A A;  1P97 A;  1XJ3 A;  2EWW A;  3UB6 A;  1UWP X;  2GNX A;  1LT0 A;  3R7W B;  4BBV A;  2PYR A;  1N9N A;  3LIB A;  1H8M A;  5J4E A;  2KOI A;  1T19 A;  4HI4 A;  2VEA A;  4H6J A;  3A0R A;  4B93 A;  1N9L A;  2O9B A;  3P7N A;  3BQ8 A;  3C38 A;  4G3W A;  4MDZ A;  3ZYT A;  4DN0 A;  1YSQ A;  2W1T B;  4O0P A;  5K5B A;  1D06 A;  3D3O A;  4G3V A;  2HV1 A;  4I38 A;  2VLG A;  3PYP A;  3EEH A;  2OAQ 1;  4HHD A;  1F98 A;  5MC7 A;  5F5Y A;  1Y28 A;  2YKF A;  4MN5 A;  1VHM A;  4K08 A;  1OJ5 A;  2JKR I;  1T1B A;  3JVV A;  5CX7 A;  4WEL A;  4OOL A;  1KOU A;  3OBF A;  2VX8 A;  4CLC E;  4R6L A;  3NJA A;  1F5M A;  5DJT A;  1LSV A;  5TBM B;  3ZQ5 A;  1D7E A;  4GS9 A;  2PD8 A;  2VKS A;  2BAS A;  4NXE A;  3VV4 A;  5HZH A;  3A0V A;  4LLO B;  4I5S A;  3R7W A;  2Z6C A;  4LRY C;  2CMN A;  4HQA A;  4PHT A;  4MCW A;  1W63 Q;  1G28 A;  5HPF A;  1G6O A;  1N9O A;  1NWZ A;  1V9Z A;  4DJ2 A;  2Y79 A;  5IU1 A;  4NKP A;  3RFB A;  5LBR A;  4NXF A;  5F68 A;  4NXB A;  1UGU A;  3KYQ A;  3B47 A;  5AJG A;  4E04 A;  3NHQ A;  5FL3 A;  2WKP A;  4EEP A;  1EW0 A;  4RQ9 A;  4JGO A;  4GJ4 A;  3T4J A;  5HSQ A;  4MMN A;  4R38 A;  4EES A;  5G4Z A;  4CLC B;  5HWV A;  4IUH A;  1S1Z A;  3KSI A;  4HJ4 A;  2PR6 A;  5A8B A;  3PBR A;  3C8C A;  1DP6 A;  2INW A;  3K2N A;  4G3K A;  1S4R A;  2LB9 A;  2J80 A;  5F6A A;  3T4O A;  2VGL M;  3KSF A;  1T18 A;  3MQQ A;  3F1P B;  1UWN X;  5G4Y A;  3BJN A;  3EGX C;  3NOT C;  2W1T A;  2WKR A;  3K3D A;  2JN7 A;  4Y2F A;  3IS2 A;  3D72 A;  1OTA A;  3HJK A;  2M1C A;  2YKH A;  3RTY A;  3E4O A;  3UE3 A;  4ME4 A;  4HP4 A;  4I3J A;  4WF0 A;  4R3A A;  4ZRR A;  3KYZ A;  4L9F A;  4P6Z M;  3PXP A;  2L4R A;  5DJU A;  4BWI A;  4EW7 A;  2D01 A;  2XA7 M;  2K2N A;  1MZU A;  1LL8 A;  1X0O A;  3FPW A;  3EQU A;  3KO6 A;  5KIZ A;  3K3C A;  2HGV A;  3F1N B;  3PHY A;  4Z1W A;  4ETZ A;  3HCY A;  2O9A A;  4EEU A;  3UMD A;  1DRM A;  2GX5 A;  2KDK A;  3T50 A;  4QPR A;  4EU0 A;  5J3W A;  2JKR M;  2OWH A;  3B33 A;  4ARZ A;  3O5Y A;  1DP9 A;  5HDC A;  1YKD A;  2O99 A;  1OTE A;  4HIA A;  1TS8 A;  4OOM A;  5KSH A;  2ZOI A;  3IBJ A;  4GCZ A;  3VOL A;  2K7S A;  1LSX A;  4UQI S;  2XRO A;  3CUE A;  3UME A;  2QYB A;  4I39 A;  2QKP A;  2PT7 A;  3T4Q A;  3NOP C;  4KQD A;  1P9R A;  1S66 L;  2W3F A;  3PBO A;  1ODV A;  4B9O A;  3MFX A;  4HH3 A;  2J3W A;  3LYX A;  3EWK A;  3FPV A;  3EOI A;  4WN5 A;  5TJJ A;  2NUP C;  4JGR A;  1LSW A;  3EGD C;  1MC0 A;  3LR4 A;  5IT5 A;  5DF9 A;  3T4S A;  3E4Q A;  4HNB A;  3KSG A;  1TS0 A;  2EWV A;  3MF0 A;  2VJW A;  5HPI A;  2DMW A;  4HJ3 A;  2GZA A;  1S1Y A;  4PKY A;  4L9E A;  1F9I A;  5C5K A;  3BWL A;  2VV7 A;  2A24 B;  4CLC C;  5IS1 A;  2KLI A;  2V0U A;  4HH2 A;  4HJ6 A;  4JGP A;  2O9C A;  4O01 A;  3PR6 A;  1T1C A;  2M7V A;  3CIT A;  4EUV A;  3VE3 A;  2GJ3 A;  2P08 A;  3EQV A;  4I3A A;  4NEE D;  4YNR A;  2ZOH A;  2B02 A;  3S7P A;  3NOU C;  3E0Y A;  1NRJ A;  3LR5 A;  4BMW A;  3S7Q A;  2G7U A;  2V9A A;  3TE8 A;  3OCN A;  3MXQ A;  4LRZ E;  3LID A;  2ZBB A;  3MJQ A;  4L9G A;  4MN6 A;  5F69 A;  4M4X A;  4FSF A;  2FH5 A;  3W2Z A;  3R4K A;  2K31 A;  4I3I A;  3BW6 A;  3E4P A;  3LIC A;  3ULF A;  2W1R A;  4P6Z S;  5HDD A;  3H82 B;  3FG8 A;  3OC2 A;  3TJZ C;  2MJ6 A;  3BY9 A;  3BQA A;  3H9W A;  3LIA A;  4F3L A;  3EEA A;  4BJP A;  1TF1 A;  3UB9 A;  5J7E A;  4IJG A;  2XSS A;  4PKY G;  1ZTU A;  2OWJ A;  3CWF A;  4HOI A;  4WUJ A;  5DKL A;  4UEY A;  2PYP A;  3CLO A;  2V1A A;  2W0N A;  4EQ1 A;  3SW1 A;  3LR3 A;  4HP9 A;  1NLY A;  2JHE A;  3TRC A;  3FC7 A;  2Y8H A;  2VV8 A;  3A0S A;  3LR0 A;  3E98 A;  4GS9 B;  2VZW A;  3OCL A;  5HDS A;  1XFN A;  2JKT M;  3JVU A;  2L0W A;  1NLZ A;  4YOF A;  3CUE C;  2V0W A;  3KX0 X;  3LUQ A;  3GEC A;  4FOF A;  1P9W A;  3F1P A;  2QHK A;  1WA9 A;  3ICY A;  4ETX A;  2PHY A;  3MR0 A;  4KUO A;  2HJ9 C;  3VE4 A;  4NXG A;  3OOV A;  1OTD A;  1TD5 A;  2XRN A;  3CI6 A;  3F1O B;  4O8G A;  5EFW A;  2IA2 A;  3PBQ A;  1XJ6 A;  2EA9 A;  1YSP A;  3LIF A;  1GSV A;  5L8M A;  4JGQ A;  4UQI M;  4XT2 B;  2QJ5 A;  2VGL S;  4GW9 A;  2QWS A;  4LRX C;  4KUK A;  1H3Q A;  3S7O A;  4WLA A;  1JNU A;  1GSW A;  2KX6 A;  1XFQ A;  3HJI A;  2PDR A;  3MQ0 A;  2A24 A;  1IFQ A;  2P7J A;  3GDI A;  3MMH A;  4Q0I A;  2J3T C;  1VB6 A;  2HF6 A;  2D02 A;  5HWW A;  1OTB A;  1ZHH B;  1S67 L;  4GHI A;  3T4T A;  3PBN A;  4ARZ B;  2W27 A;  1GSX A;  2ZMV A;  4PAU A;  3UB7 A;  2I9V A;  4EXO A;  2QJ7 A;  4BBT A;  4GLQ A;  2NUT C;  3S7N A;  1S4S A;  2W3D A;  4L0L A;  2XA7 S;  5DFY A;  5HD3 A;  4AFI A;  3IBR A;  1YAX A;  4II7 A;  3RH8 B;  2VA0 A;  5TBM A;  3F1N A;  4CQH A;  3H7W A;  2Z6D A;  2FZ0 A;  2PD7 A;  4CLC D;  5I5L A;  3PBS A;  4CLC A;  3F1O A;  2H28 A;  3LI8 A;  4EER A;  5HL6 A;  1OTI A;  1P0Z A;  4IHQ A;  2A2L A;  2O0Y A;  2W3G A;  2LB5 A;  4Y3I A;  2OOL A;  3LI9 A;  4F3L B;  3T4K A;  2JKT I;  2B18 A;  3H7W B;  4KQO A;  1OPX A;  5HWT A;  5AVE A;  4WL9 A;  5HD5 A;  3U2A A;  1IOU A;  1W63 M;  2P04 A;  1STZ A;  4WEK A;  3B42 A;  4LPZ A;  3G6O A;  3DBA A;  3LFV A;  1TS6 A;  5DKK A;  5AVF A;  4GHI B;  1MKM A;  4H6J B;  4MN7 A;  1V9Y A;  2VV6 A;  3H82 A;  2OAP 1;  2WKQ A;  4WEJ A;  3CAX A;  4BBU A;  2M7U A;  2V1B A;  2J3T D;  1OT9 A;  4YWZ A;  2ZMF A;  4XT2 A;  2L1M A;  2PR5 A;  4Q0J A;  3T4L A;  1XJ2 A;  3C2W A;  4Q0H A;  1DP8 A;  2R78 A;  1OJG A;  2W3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...