5HDNA

Crystal structure of heat shock factor1-dbd complex with ds-dna and ttt
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
101
Chain Sequence
HVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEVKPERDDTEFQHPCFLRGQEQLLENIKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HSF1-DBD crystal structure
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Heat shock factor protein 1
total genus 30
structure length 101
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hdnA00
1T6SA 1FSHA 3BWGA 2XHKA 4KN4X 5FFZA 5LGNA 3E3VA 4L9JA 4I7HA 2VC0A 3WE2A 3ZMSA 4YFXF 3HRTA 2P8TA 3ZP5A 3GFJA 3QP5A 2P5KA 2OQRA 3K2ZA 5D4RA 1MJBA 3WGIA 6PAXA 1R23A 2IA1A 1MZBA 2JSCA 2DI3A 1SD5A 1WSUA 1NHAA 1Z1DA 2K27A 1HW1A 2YX7A 5KK1A 5K5OA 3HYIA 1LVAA 4EM1A 5AIQA 2O03A 3G3ZA 5ICFA 3GFMA 2TDXA 3FXQA 2OBPA 5FD5A 3GX4X 1J59A 2WC2A 3ZMDA 3R4KA 4ESBA 2KKOA 2OU2A 5D6FA 3U2RA 3R0AA 2JPCA 2CG4A 1IF1A 1HBXG 1PDNC 1KGSA 1YG2A 4LK0F 2EV6A 2W24A 4PGGA 4KN7X 5ED4A 1PP7U 2ACJA 4YG2F 4N9IA 4G6QA 2LF7A 1J9IA 3SFZA 5LBQA 3KP5A 4KA4A 2FRHA 2EWNA 2WWYA 2HGCA 3IC7A 5KVRA 5FD6A 1K7AA 4XRFA 2BGCA 1FOKA 4KUMA 2IJLA 3GUDA 1TTYA 2EJRA 3SXYA 4U0WA 4ZZLA 1JHFA 4ZYDA 1A04A 4HF0A 4IRHA 3I71A 3T8RA 5H20A 2GWRA 2V1XA 1DPRA 2AXLA 3ZMTA 1STZA 5DEQA 4G9YA 4A5NA 3F72A 1FC3A 2V1DA 4HX7A 2BE5F 1ZH5A 2HQNA 3SZPA 2F2EA 2PEXA 4NQWA 1FYKA 3V8LA 1W7PB 1XDUA 5DV5A 3J80Z 5ICGA 2NAZA 2WTEA 3IWZA 3COAC 2RVCA 4KYWA 1GVJA 4M9SA 1FLIA 4P96A 4EGZA 3DKWA 2DK8A 2X4HA 3I64A 2F5DA 2HWVA 3WG9A 2ETHA 2A69F 4GCVA 1LQ1A 5E8GA 4K2EA 3QPTA 2QENA 4LGWA 3GYHX 2C6YA 2PG4A 4M9ZA 1CF7B 2HYFA 2RN7A 2JPBA 2FF4A 5ICEA 2O6GE 2DQRA 1P4WA 1X3UA 1BI3A 1G3TA 4PCQA 4YFKF 4HAMA 3FM3A 1REPC 4KDPA 5HS9A 4RB2C 3FXUA 1BC8C 3CO6C 1B9NA 4O6JA 4IVNA 1KQ0A 2Y0MA 2P5VA 3H3ZA 4Y13A 4XLNF 3BOQA 1IXRC 5F6FA 3GEZA 4EMSA 3P7NA 4EJTA 3V7SA 4Q5SF 1ZG1A 2HTJA 1BIBA 3ZMUA 5E1ZB 2GAUA 3BJOA 3IRRA 2VBWA 4ENJA 4WWCA 3F3XA 3P9IA 3R60A 3RPQA 3ZMZA 1R1UA 4ETSA 4GGGA 2RQPA 1U2WA 3GVAA 2AS5F 2KIFA 2L01A 1Z9CA 3BROA 5CJ9A 2UXXA 4G6DA 4R8HA 2JT1A 2DPUA 3EYIA 3L9FA 3HOTA 4RB1A 1C0WA 2Q8KA 3LWFA 1O7FA 2PQ8A 3HTSB 1LDJA 4IF4A 1ZRDA 5J8CA 1OYWA 5LHHA 1SFEA 2O0YA 5LRRA 3LQQA 5CVUA 2R7FA 4JQFA 5D6EA 5E18F 3M8FA 4EJOA 4JBAA 3F8FA 3PQKA 1QGPA 3MFKA 3IL2A 3RKYA 4GYIA 4KFCA 1T39A 5D5WB 4CZZA 3WE3A 3JAMK 2BEOA 5IT9Z 3HHHA 4L18B 5LHGA 3TQNA 4P9FA 4MEXF 2FBHA 3ZN1A 3MWMA 3E6BA 2QWWA 5HLGA 2XAGA 4L9NA 1T2KA 1J0RA 3K1MA 2STTA 3E5UA 2EV5A 3I59A 1T38A 2QLZA 4RS8A 3KLNA 4OIOF 3V4GA 4A6DA 2V6CA 2ZCWA 1YQAA 2RV8A 2ZNZA 5LLQA 2HQRA 3E6MA 4HZFA 1S7AA 4YFNF 2F5FA 1KYZA 1Z7UA 4L9VA 3G73A 5HDGA 1FWZA 3FF5A 2ZNYA 1TLHB 5HDKA 4LB5A 1G3YA 3ERED 4Q4ZF 1FSEA 1IRFA 1SD4A 1G4DA 3MAJA 1BC7C 5CVJA 2CO5A 1DP7P 3E5XA 3BPVA 1VTNC 1MDMB 3FM5A 3BJAA 4DQ2A 1BBYA 1SFUA 2DQLA 2QUFA 1GXPA 1MD0A 1H9GA 2M87A 3PFIA 2VONA 4G7OF 1IAWA 2IA2A 3WTSC 5J8FA 1XGNA 1HKSA 3RTRA 1RI7A 4EM0B 4LG0A 3EDPA 3FX3A 2D45A 2O61A 2M45A 1SD7A 2VXZA 4O5VA 2LKPA 3HSFA 2W84A 2VN2A 4EJVA 1FX7A 2QBYB 4ASNA 3CUQB 1ZRCA 3F23A 1HKQA 2XAFA 2K7LA 4EJUA 1ZYRF 5ILVA 1G3WA 2KJBA 3F6OA 1USTA 3JTHA 4ENKA 4LD5A 1YS6A 5K5RA 4UHTA 1ZARA 4O3MA 3RPUA 4JK1X 1ON2A 5IT9K 4LFUA 4ZH4F 2QM3A 3E6CC 4RGXA 5DCMB 3O2PE 4RGUA 3CUOA 2V1UA 3FWEA 3CLOA 1YW9A 2H09A 3HTUA 4OU0A 1HSTA 2UXNA 3WTWC 4KIFA 1E2XA 4AIHA 5JHUA 3K1NA 1O3SA 1ZLKA 5TJJA 4AIJA 3BZ6A 1LEBA 4KICA 2CW0F 2E1NA 3W6KB 1XSXA 2P5LC 4S04A 4HQMA 1R5HA 4RAZA 2EFQA 4BNCA 2F5EA 4U7BA 4UXNA 3ZPLA 4LMYA 2L3DA 1MKMA 1CF7A 3VB2A 2NYXA 4Q48A 2ZXJA 2VE8A 4S05A 4CHUA 5HLHA 3RYRA 5L3CA 1QQIA 1OR7A 3B73A 2HKXA 4OINF 3QAHA 2NNYA 3JTGA 1QZZA 3L00A 2ZFWA 2VBXA 3GXOA 2BYVE 4F7ZA 1SFXA 2E7XA 2JRTA 5JVTA 4CO8A 1O3RA 3GFIA 4L5JA 2DT5A 1KQ8A 4LB6B 1YS7A 4OMZA 2L4MA 2UZKA 3QP6A 1FZPB 1YO5C 4U88A 1ZG5A 4HV5A 2OQGA 1EH7A 3WTYC 4EJWA 3EUHA 4E70A 4RGSA 1F4KA 4M72A 2FXAA 1LDDA 1EH6A 1XMKA 5AONA 1RIOH 1MGTA 3R61A 1P4AA 5BPIA 3DFGA 4KIBA 4M6XA 2KIMA 4KNYA 3BJ6A 2DTRA 2K4BA 5D4SA 1U3EM 4ESJA 3LAPA 1ZGAA 4M9XA 1EH8A 3O3KA 3Q5FA 2Z9OA 4N0BA 1CGPA 2DPDA 2ESNA 1FT9A 1W5TA 3T0YA 1H0MA 3U9GA 4XSXF 1ZN2A 3F6VA 3NRVA 2QBYA 4UVCA 3CUQC 4UVAA 1IUYA 2VOPA 5AIPA 3KE2A 3DF8A 2Z3YA 3C1DA 1BI2A 3LAJA 2A68F 3RYPA 1MJAA 4QWQA 2EFWA 5F1RA 1UB9A 1WQ2A 2Q2EA 2RKHA 3WGHA 1LDKB 3CJNA 2FEZA 5H6RA 1R58A 4A0ZA 1T0FA 2W25A 3CUQA 3S2WA 1YYVA 3HSEA 1UCRA 3MEXA 3TGNA 3L2CA 1E17A 2FQ3A 2GZWA 2GA1A 1IXCA 4OMYA 3QPHA 2P7CB 5FGMA 3JW4A 1IN6A 3KP4A 5LEJA 3KP3A 5LGTA 1AOYA 3KP2A 1TW2A 2RGVA 2FNAA 2MC3A 4MEYF 5F64A 2HOEA 4AIKA 5DD4A 1P6RA 1B4AA 5IT3A 2CGPA 4CGZA 1Z91A 4YIFA 2J5PA 2OA4A 1FBSA 3IKVA 3E6DA 3HRSA 4OIRF 3DPLC 3WU0A 2PFBA 1R22A 3K69A 1F5TA 4KIGA 4UV8A 3VODA 3TKYA 2P6SA 5K1YA 2PN6A 1WKMA 2O8XA 4TV7A 3ZMVA 2HFHA 1DPUA 1PUEE 4BQAA 2ZJ2A 3MCZA 1BN5A 4HYEA 1ZRFA 2ZKZA 1SMTA 3KFWX 4P9UA 4M74A 2ZMEA 2PLYA 3ZQ7A 4R79A 4WXCA 4YIIA 4U7DA 3C7JA 5BS6A 2PI0A 1YTYA 1GHCA 2M1BA 3B02A 3TDZC 4UVBA 2OD5A 1TW3A 4M71A 3I58A 3SQNA 4HLXA 4BHBA 3K1PA 1RUNA 3REOA 2XASA 3NQOA 4ZYGA 3CTAA 2EB7A 2E7WA 5J6XA 1D8KA 2STWA 2PJPA 3WTTC 2PMHA 1TNTA 2OZ6A 5DUIA 4PDKA 4ON0A 4ENNA 4GXOA 1DDNA 5K5QA 1K6OA 2IP2A 3QRFF 2MH2A 2RC4A 3E97A 3R6SA 2A5YB 4HF1A 4HOBA 3P9CA 3GLXA 3F8NA 1HXDA 3BP8A 2GXBA 1FYLA 4FT8A 1FP2A 4B8XA 4M73A 2P4WA 1KA8A 1GXQA 2D2WA 3FMRA 2P6TA 2GXGA 2LF8A 4FX4A 4UNOA 1OYIA 3F22A 2V79A 2XKPA 3GFLA 2MA3A 3M1EA 2VODA 4PGHA 3ZN0A 1S8NA 2EK5A 2OZUA 3LA7A 2CYYA 3L09A 4KMUX 1W7PD 2QYOA 3MZHA 1XSDA 2IVMA 2VT3A 3I5UA 3IHUA 3HOSA 2V9VA 1WWXA 2R7DA 2XAJA 3M7GA 2L4AA 4IHTA 4LK1F 5BQTA 4MQVA 3WGGA 2XAQA 5HVQC 2FOKA 5HDNA 1TQIA 1O3TA 1PP8F 5L3EA 4L0ZB 3KLOA 5E17F 1O7LA 3LA2A 1U8RA 5HLIA 1QZYA 2P7VB 4XSZF 4N9HA 1U5TB 3H92A 3I53A 4CDGA 1XDSA 2EA2A 4B09A 2ISYA 1ZG3A 3RI4A 2HZTA 3VOEA 5L3BA 1P92A 3LFKA 1IN5A 3GWZA 5DYMA 1Z6RA 4A0XA 3Q9SA 5D8KB 3MQ0A 1J7KA 2DW4A 4RB3C 2MBFA 4KT5C 3V8JA 3V7CA 3TOBA 3ROUA 3PQJA 5CVVA 2PBIA 1BOAA 4A5MA 3DQVC 3E5QA 2G7UA 3ISPA 3M8EA 3C3WA 3K9TA 1UFMA 2DFIA 1IN4A 3RDIA 3HIFA 3KETA 5LHIA 5D8LB 3JAMZ 5EEHA 1G6NA 1MJ9A 4EVIA 4QLCU 1AWCA 2RDPA 2JTVA 3GZ6A 4DNCA 3CDHA 1KU9A 2WV0A 3KEOA 5ILSA 1ON1A 3WU1B 4NB5A 1D3YA 3LSTA 2FMYA 1U5TA 4EQQA 3F8MA 4WF2A 1D5VA 3BY6A 2DK5A 3HRMA 1F9NA 4UV9A 3Q9VA 2HKOA 2XRNA 2GIVA 3EYYA 2EFOA 1FNNA 1V4RA 2A6EF 4HX4A 3WTUC 2KRFA 1FYMA 5FFXA 3T1BA 2LDUA 2DAOA 4U0YA 2XGXA 2VOOA 1V3FA 3SHFA 5L3DA 5ERIA 3GF2A 3J81Z 1YW8A 1OKRA 2L02A 4MQ9F 1I6XA 4G7ZF 1IW7F 4Z2YA 1UHMA 2GA2A 4IHSA 4HW0A 4HX8A 3JSPA 2CQKA 4AD9A 3DXJF 2FMLA 4FHTA 2E1CA 3RIRA 3V8KA 4A0YA 5TRDA 1ZREA 2NS0A 1I1GA 4WK8F 1ZHFA 3GO5A 4MGRA 2KIUA 1KU7A 2MLKA 4XBFA 4CYDA 1Z05A 2NRAC 1XMAA 3I54A 1XGOA 4WCGA 3T5XA 1IXSB 5DD8A 1U5TC 2VBYA 1SAXA 1JE8A 2A3SA 2XROA 4BAYA 3J7AO 2K4JA 1S7OA 4HDVA 5CLSA 3TDUC 3ABTA 1I27A 3HRUA 3BPXA 3DV8A 2QQBA 4HLYA 2ELHA 4BYYA 1LNWA 2EFPA 1BIAA 1SD6A 4OOIA 2H94A 1K79A 1QO0D 2IT0A 1QPMA 5CYVA 1SMYF 2FSWA 2YPRA 4Q47A 2Y75A 3H3UA 1IRGA 3M9AA 5DCFA 4HDUA 2VBZA 2B0LA 2LSOA 1BM9A 4G8XA 3WTZA 5L3FA 1I1SA 1YLFA 4KMFA 3CO7C 5LGUA 4HV6A 2XUBA 5JI6A 2QQ9A 1KYWA 1HW2A 3RKXA 3ECHA 1TNSA 1OMIA 4XLPF 1ZGJA 1Z6TA 2DO7A 2YU3A 4GO1A 1K78A 3V7RA 1J5YA 5L3GA 2VT2A 4LLLA 4IRGA 3K0LA 4R1HA 3D0SA 4WXDA 3GW2A 3P9KA 4A6EA 3I4PA 2FE3A 2IA0A 2JZYA 3QU6A 2M5WA 3HHGA 1USSA 3TO6A 1MDMA 4HF2A 4AWXB 2Q0OA 2NNNA 1QBJA 1U6GA 4CICA 3I59B 4MTEA 5BMZA 1G3SA 2ADUA 3KEQA 3VFZA 3OOPA 2H6BA 4D0PA 1K78B 2A6HF 2HR3A 2HS5A 1FP1D 1R00A 3J81K 1B59A 3TOAA 1KQ9A 2O3FA 4L5IA 3N4MA 4BH9A 5D5VB 1ONVA 1TQPA 2CSOA 1OPCA 3EETA 5D5UB 4Y15A 1L0OC 2J5OA 2UWMA 4HA8A 1HQCA 1ZLJA 3KP7A 4OIPF 2FBIA 2YX4A 4EV0A 4BXUA 2M8EA 2R3SA 2EFNA 4NHJA 1P2FA 2HYGD 5HS8A 3RKWA 2M30A 1F1ZA 5A2QZ 1D8JA 3IKTA 1HW5A 2XKOA 2ISZA 1TBXA 4ZYEA 3NEUA 2ESHA 4MTDA 2LNBA 3L7WA 1QNTA 1IZ1A 2DBBA 1BJAA 3VEPA 1XCVA 2BBYA 3OV8A 3SZTA 3ECOA 3LA3A 5FO5A 3J80K 3F8CA 2HEOA 2D1VA 1XGMA 3KZYA 2K86A 3ELKA 3QOPA 1U78A 2OAZA 1B9MA 5FLXK 5DCMA 2BV6A 1HKTA 4LLNA 4L0YB 5E1WA 1JGSA 1BI0A 5E20A 2MLGA 1ULYA 3RJPA 1ODDA 1Y0UA 2MH9A 1IN7A 1YW7A 1LEAA 4I01A 3F21A 2Z5UA 2Z33A 2QVOA 5EEGA 2X0LA 4OIQF 5E8IA 3KZZA 3WTVC 1YIOA 1R36A 2QQAA 5CVIA 2CWEA 2YR2A 3WODF 3WTXC 4A2UA 4G94A 3T8TA 4ZYHA 2FNPA 1YFHA 2HDCA 4EM2A 2W57A 1LJ9A 1JXSA 4IPAA 1FPQA 2A61A 4IXAA 5D5XB 1WRJA 1H9TA 2L54A 2DU9A 3ULQB 1R1VA 3HUGA 1KU3A 4LG0B 2FA5A 4L9TA 5H6QA 5DDGA 4CXFA 2G9WA 5BOXA 4I0AA 2YSRA 2CFXA 1TQMA 2IW5A 3KP6A 3TO9A 1R1TA 1IN8A 5FLXZ 2XVCA 3W6JB 4WX9A 3GZ5A 4RAYA 4P55A 1W7PA 2IRFG 4LJZF 2A07F 4P5OA 1OYYA 4FX0A 3TO7A 1S29A 1B6AA 5FB2A 3FXRA 3D5LA 1XD7A 3KCCA 4IJAA 5DUKA 5ICCA 3FMQA 5LEKA 3EQLF 4I2OA 3O6BB 1LB2A 2K02A 2QZ8A 2ZMEB 4RGRA 2XV4S 4ESFA 1WI9A 4IRIA 2GQQA 4BHPA 1FBUA 3F8BA 1ZAOA 3DPTA 5BPDA 4HBLA 2VE9A 1R5GA 4UUVA 4PZJA 5A2QK 5JR3A 2G7HA 1R7JA 4U0VA 2FU4A 2XIGA 1B1BA 1RUOA 2COMA 1O57A 1P4XA 2EV0A 4I09A 1FY7A 4WXHA 5HS7A 2XAHA 3LQRA 2IPQX 3HSRA 2ZO4A 1RNLA 3IWFA 5E1XA 1FBQA 2EA4A 4HQEA 5JFRA 4GYGA 4Y17A 1DUXC 3IRQA 2RNJA 2HTSA 4I0BA 1T98A 4ENMA 3QU3A 1XCBA 3ML6A 2Y48A 1XSVA 1J2XA 1O3QA 2PMUA 2ZBKA 1I5ZA 2D1HA 3FMSA 2Z99A 3DEUA 4EGYA 1JHHA 4BHCA 2H6CA 5CVRA 2VC1A 5HOOA 3U1DA 5LRSA 4G7HF 4A12A 3JSOA 1J75A 3C18A 3N97A 2W85A 1Q1HA 1XB4A 1XN7A 4MNUA 4MHGA 4LLGF 1EV7A 3I0TA 1HSJA 1S3JA 3R0JA 3ABUA 3MZYA 4M6YA 4I02A 2FBKA 1BI1A 3FHZA 1L3LA 2KJCA 1S6LA 1XGSA 2MD5A 1W5SA 3DP7A 4ZZDA 4AVPA 5ILUA 3AAFA 3FZVA 1KU2A 1W4MA 1RZ4A 2H27A 3BDDA 2DLLA 4RB0A 2F5CA 4H0EA 4I98B 1UHWA
chains in the Genus database with same CATH superfamily
1UELB 1HOMA 1T6SA 2R5YB 1FSHA 3BWGA 3HC7A 3NWSA 4A3FJ 2DA4A 2XHKA 4KN4X 1JUPA 3S2HJ 5FFZA 5LGNA 3E3VA 3NWTA 4L9JA 2MGQA 1RKTA 4I7HA 3DU5A 2VC0A 3WE2A 3ZMSA 4YFXF 1IC8A 3HRTA 2P8TA 3ZP5A 3GFJA 3S3OA 3QP5A 3PJRA 5LFAA 2P5KA 2LBFB 3OS2A 2LREA 2JQ7A 3LSIA 4V19K 2OQRA 1X1CA 3K2ZA 5D4RA 5J1RA 1K83J 1MJBA 3WGIA 1MMDA 4FTHA 2Q2EB 1JT0A 4J01A 6PAXA 1EJ9A 4E7HA 1R23A 3A0HC 2IA1A 1BA5A 3OYLA 1MZBA 4M3GA 5K7HA 2JSCA 2DI3A 1SD5A 4LOCA 3BG9A 1WSUA 1NHAA 1Z1DA 2HU9A 5DM6F 1U9NA 2K27A 4KITB 1HW1A 2YX7A 3M3YJ 5KK1A 3OYBA 5K5OA 3HYIA 1LVAA 2R7WA 4EM1A 5AIQA 4X1EA 2O03A 3G3ZA 5ICFA 3GTMJ 3GFMA 2TDXA 1MSFC 2DDAA 3FXQA 2OBPA 4CCJA 4RM3A 1MH4A 5FD5A 3GX4X 1J59A 2WC2A 3ZMDA 3CCQI 3R4KA 2R5ZB 1AA7A 3W2WA 4ESBA 4DBQA 2KKOA 2BY1A 2R7VA 5M5WJ 3CDIA 2OU2A 5D6FA 3U2RA 2ZJPF 3BQYA 1D1AA 3R0AA 2JPCA 4M3EA 2CG4A 1IF1A 3BG3A 1HBXG 1PDNC 1KGSA 1YG2A 4LK0F 2EV6A 2W24A 4LG3A 4PGGA 3TMOA 3VSLA 4KN7X 4ZYAA 5ED4A 2ECCA 1PP7U 4CYCB 2ACJA 4HPQA 4NQWB 4YG2F 4D1QA 1OCCH 4N9IA 4PUSA 4G6QA 2CMPA 2JVHA 2LF7A 3VDXA 4BE2A 1RR7A 1FEXA 2DA6A 4Y33A 3DEEA 1J9IA 3SFZA 5KAFC 5LBQA 3KP5A 3FDYA 1AKHB 4KA4A 2FRHA 2FUG2 2EWNA 1FOXA 4C9YA 2WWYA 2NVQJ 2HGCA 3IC7A 1ETOA 4QPOA 4ZDLA 5KVRA 5FD6A 3CQZJ 1K7AA 1S7EA 1SVOA 1B8IB 4XRFA 4V2GA 2BGCA 1FOKA 2M34A 4ZTFA 2HVQA 4Q5SF 4N4OB 3OSFA 4KUMA 4Y4RA 3FBIB 1R5ID 2IJLA 2LD5A 1T56A 1TTYA 3GUDA 2EJRA 4BE1A 1ETKA 3DPUA 2KRCA 3U21A 3SXYA 3OIOA 4U0WA 4ZZLA 1JHFA 5FROA 4ZYDA 1A04A 4HF0A 3ZXSA 5DM7F 1S9HA 3OMYA 4IRHA 3I71A 3T8RA 5H20A 2WA0A 2EIMH 4KT6A 1OFCX 2GWRA 2V7FA 4A3CJ 2V1XA 2E5ZA 1DPRA 2AXLA 1XPXA 1MNEA 5JLXA 4G6TB 1STZA 3ZMTA 5DEQA 4G9YA 2IGNA 4A5NA 2VLAA 3F72A 1FC3A 2V1DA 4HX7A 1JT6A 2BE5F 1ZH5A 3GTLJ 2DCEA 2HQNA 3SZPA 4BXXJ 2F2EA 2PEXA 2BVMA 4XR6A 4NQWA 3S3NA 2DA2A 2VJ5A 3V8LA 1W7PB 1XDUA 5DV5A 3JR9A 1FYKA 3J80Z 3ABMH 5EZGA 5ICGA 2NAZA 1J09A 1I50J 2WTEA 3CCSI 3NAUA 3IWZA 3OL4A 3COAC 4RAFA 4EEFG 2E35A 2RVCA 3HBLA 2M8GX 4KYWA 1GVJA 4M9SA 1FLIA 4P96A 2B9SA 3GTKJ 3A0BC 4EGZA 3DKWA 3IP4B 2GOMA 2VKEA 2DK8A 3OWTA 2X4HA 3I64A 4E7ZA 2F5DA 2HWVA 5IY5H 3WG9A 2ETHA 2A69F 4GCVA 1LQ1A 5E8GA 4K2EA 3QPTA 2VB6A 2QENA 4LGWA 4BDZA 1Z0XA 3GYHX 2C6YA 3QYEA 1SC7A 2PG4A 3HKZN 2JMWA 4M9ZA 2ZXHA 1CF7B 2EBIA 2HYFA 2RN7A 2JPBA 2FF4A 1ZK8A 5ICEA 1IRXA 2O6GE 2DQRA 1P4WA 5TGTA 1X3UA 1BI3A 2EINH 1G3TA 4PCQA 5F0CA 2P0WA 4YFKF 4HAMA 4XN0A 1ZR2A 2Z16A 1RC9A 3FM3A 2BOLA 4A3LJ 1REPC 1WZ2A 1D0XA 4KDPA 5HS9A 1WVRA 3LSKA 4RB2C 2X6YA 3FXUA 1BC8C 3U1KA 1FJLA 3SFIA 2HNHA 4BUPA 3CO6C 2I8DA 1BL0A 1B9NA 4O6JA 4IVNA 2WADA 1KQ0A 2Y0MA 2P5VA 3H3ZA 4Y13A 3HDDA 4XLNF 1YI2I 3CC4I 3BOQA 5KCMA 2HQAA 4MFEA 3GTQJ 1DGWY 2WAQN 1IXRC 1YOVB 5F6FA 2R7RA 1JKRC 3GEZA 4EMSA 3S1RJ 1JTXA 4NDLA 3P7NA 4EJTA 3V7SA 2EZLA 3ABKH 3ZQFA 3H5AA 2O5RA 2FJ1A 1ZG1A 2DJIA 2HTJA 1BIBA 2DOEA 2EH3A 3ZMUA 5E1ZB 4F93B 2OJED 2GAUA 4H4KC 3BJOA 1WJEA 5FRMA 3IRRA 2VBWA 3LSPA 4ENJA 4A3JJ 2IGOA 4WWCA 3KEYA 3F3XA 3P9IA 4XKVA 3R60A 3RPQA 3ZMZA 1R1UA 3JRGA 5E3OA 4IOCF 4ETSA 4GGGA 2LK2A 2NS8A 2RQPA 3FXLA 2PJRA 1U2WA 3GVAA 4E7JA 2XAUA 2AS5F 2KIFA 2DFHA 2L01A 1Z9CA 1IV6A 3BROA 2A5WA 3K4LA 2UXXA 5CJ9A 3MMYB 3UR3C 4G6DA 3H36A 2CW8A 4R8HA 2JT1A 2DPUA 3EYIA 2M4KA 2OPTA 3L9FA 3HOTA 3OYAA 4RB1A 2NVUB 2K3PA 1C0WA 2Q8KA 2XC7A 3LWFA 1N25A 1O7FA 1XC5A 2PQ8A 4ZC3A 2XPUA 1X3ZB 3GTGJ 3HTSB 1I39A 1LDJA 1JUSA 4IF4A 1MSEC 1ZRDA 5J8CA 2KFDA 2DMTA 1OYWA 5LHHA 1SFEA 2KPMA 1RESA 2O0YA 1AU7A 2O9LA 3HPGA 5LRRA 5F1JA 3LQQA 5CVUA 4LIUA 2R7FA 4JQFA 5D6EA 1W0TA 5E18F 1W0UA 1TWFJ 5J47A 3M8FA 4EJOA 5F27A 4JBAA 4YIRX 3F8FA 2BHZA 1FIPA 3PQKA 3L2UA 1YHQI 2R7SA 1QGPA 3MFKA 3IL2A 2QSHX 3RKYA 4GYIA 4KFCA 1TC3C 1T39A 2BVLA 5D5WB 3G2BA 4CZZA 3WE3A 2GXAA 3JAMK 1MNMC 3PO3J 2BEOA 2WB1N 1NK2P 5IT9Z 3CCVI 3HHHA 1W36C 4L18B 5LHGA 1A6QA 4NC8A 3TQNA 4P9FA 4MEXF 2FBHA 2DODA 2M0MA 3ZN1A 3DKYA 2FX0A 3MWMA 2CV2A 3E6BA 3LSHA 1E0EA 3A4CA 2QWWA 5HLGA 2XAGA 2LP0A 4L9NA 1T2KA 1J0RA 3K1MA 2STTA 3HOUJ 1SAUA 3E5UA 5E3NA 1JKOC 1WH7A 2EV5A 3K4KA 3I59A 4C2TA 4XKCA 1T38A 2QLZA 4RS8A 4QTRA 3M1CA 1ZTRA 3KLNA 4A69C 3I4NJ 4OIOF 5CPRB 3V4GA 3TEDA 4JYKA 3IAM2 4B44A 4A6DA 1EKEA 2V6CA 2ZCWA 1YQAA 3HPHA 4PK4A 2RV8A 1LE8A 2BW3A 1OCPA 2ZNZA 4AYBA 2HQRA 3E6MA 5LLQA 1RPWA 4Y7NJ 4HZFA 4HRIA 1BR4A 4XLAA 4A93J 1S7AA 1VQ7I 3P5JA 3B6AA 4IHYA 5CQGA 4YFNF 2F5FA 1KYZA 1Z7UA 1H89C 3BG5A 5BNGA 4CZCA 1Y6IA 2X1CA 4L9VA 2L7FP 5HDGA 1FWZA 1YX3A 3G73A 3HEFA 3LFUA 3FF5A 2QSFX 2ZNYA 1TLHB 5HDKA 2XPWA 4LB5A 1G3YA 3ERED 4Q4ZF 1FSEA 2N8GA 4PFPA 1IRFA 3AG2H 1QHGA 3BTCA 3HKZA 5KAIC 1SD4A 1G4DA 5CQEA 3MAJA 4ZDOA 1BC7C 5CVJA 2CO5A 1DP7P 2NOGA 3E5XA 3BPVA 3TBIA 1VTNC 1MDMB 2DXIA 4ABZA 1U8BA 2L9SA 3RSNA 1R9TJ 2PMZA 3FM5A 3BJAA 4DQ2A 2JA7J 3D5SC 3QYBA 1BBYA 2JVGA 1SFUA 2DQLA 1T08B 1G59A 1I6HJ 2VUMJ 2QUFA 5DTDA 3S16J 1GXPA 5C4JJ 4MO7A 2EIJH 2VPLA 1MD0A 4ANJA 3FKJA 2W7NA 4AIDA 1SVLA 1H9GA 2L7ZA 2M87A 3C2GA 5F0HA 3PFIA 2VONA 3KIOA 3ZQLA 2LY2A 3AKZA 3H9QA 4G7OF 2NS7A 1IAWA 2IA2A 4HSRA 3M4OJ 3WTSC 5J8FA 2VKVA 4MFDA 1XGNA 4JX6A 1HKSA 1PVEA 2IAIA 1RI7A 3RTRA 2JWTA 4EM0B 1X1BA 3HOXJ 4LG0A 4C2MJ 3EDPA 2ME0A 3FX3A 3TP3A 2D45A 2O61A 2BXYA 2M45A 1SD7A 2KQRA 2VXZA 4O5VA 2LKPA 3HSFA 2DA7A 2W84A 1A5JA 3JRAA 2VN2A 2CJJA 4EJVA 1FX7A 2QBYB 4ASNA 1WJDA 4RM2A 3CUQB 1ZRCA 3F23A 1HKQA 2XAFA 1SFKA 2K7LA 4EJUA 1ZYRF 1YRNA 2VJ4A 1ZR4A 4DYCA 4HNVA 5ILVA 4FQGA 1G3WA 1HLVA 2KJBA 3F6OA 1USTA 2CV0A 3JTHA 2ZB9A 4ENKA 4LD5A 3E0JB 2H1LA 1YS6A 5K5RA 4UHTA 4M3DA 1ZARA 4O3MA 3ZRGA 3RPUA 5B5EC 4D5CA 2QKLB 4JK1X 3S15J 1ON2A 5IT9K 2HOSA 4LFUA 4ZH4F 2QM3A 3E6CC 3RQ4A 1R4NB 4RGXA 5DCMB 3O2PE 2WV1A 4RGUA 1JJ8C 3CUOA 2V1UA 2GIZA 3FWEA 4OWRB 3CLOA 4NC6A 1YW9A 3S8PA 3HOYJ 2R7TA 2H09A 2Y0SN 4DZJA 1E3PA 3HTUA 4OU0A 1HSTA 5H2FC 1VQMI 2UXNA 4DYRA 3K4MA 5EZHA 4KIFA 3WTWC 2QGUA 1E2XA 4AIHA 5JHUA 3K1NA 1O3SA 1ZLKA 5TJJA 4B43A 3H0GJ 3L1PA 4AIJA 3BZ6A 4DZPA 3SYTA 1LEBA 5EDNA 4KICA 2CW0F 1UAAA 2E1NA 1VQ6I 2HVSA 3OYDA 2QKMB 1V54H 3DCFA 3W6KB 1XSXA 3KX2A 4A3MJ 4BU2A 2P5LC 3VYUB 4S04A 1TZLA 2KZVA 4HQMA 4Z6YA 1R5HA 3HGYA 4RAZA 2EFQA 2XSDC 4F92B 4BNCA 3PNTA 2F5EA 4U7BA 3TW7A 4UXNA 3ZPLA 4LMYA 5F04A 2L3DA 2Z1DA 3GTOJ 1MKMA 2EIKH 4PJLA 1CF7A 2WB1A 3BG7A 3CD6I 3HM5A 1HDDC 3VB2A 2CUJA 4ZJZA 3ESWB 2NYXA 4Q48A 2HQ5A 4I99C 2ZXJA 5FKOA 2VE8A 2CS3A 4II3A 2HDWA 4S05A 4CHUA 1TT5B 5HLHA 2F4IA 1ETQA 3C2HA 3RYRA 5L3CA 2VASA 4BQOA 2ZMEC 3PIPF 2LMDA 1QQIA 1OR7A 3B73A 2HKXA 5FJ8J 1V5FA 3DTEA 4D9JA 1HDPA 2K85A 4OINF 5B66C 1SFOJ 3QAHA 2NNYA 2XGDA 3JTGA 2BHYA 2X6XA 1QZZA 2VPRA 3L00A 3KYCB 2ZFWA 2VBXA 3GXOA 1D5YA 2BYVE 2LVSA 4F7ZA 1E3HA 3JCUC 1SFXA 2E19A 2E7XA 2JRTA 1LVKA 3IH4A 3MVPA 5JVTA 1FIAA 4CO8A 1O3RA 3QODA 1DU0A 3GFIA 4L5JA 2DT5A 4A3DJ 1KQ8A 3KYDB 4LB6B 1YS7A 1X2NA 4KJZA 4OMZA 2L4MA 2V9KA 3BQZA 2UZKA 3QP6A 1FZPB 1YO5C 4BACA 4IHXA 3TL4X 4U88A 1QU3A 1ZG5A 3OYEA 4HV5A 2OQGA 2K9SA 1EH7A 3WTYC 4EJWA 3EUHA 4E70A 4BS9A 1BW5A 4XLHA 4RGSA 4IOAF 3OYGA 3SZGA 2R7UA 3G1OA 1F4KA 4M72A 2FXAA 3SJMA 1LDDA 4GFBA 1EH6A 3JRFA 1XMKA 3DEWA 2VKHA 4XKWA 4IHWA 1M1EB 5AONA 2V26A 3RQIA 1RIOH 1MGTA 4DYQA 3R61A 2YUSA 2E34A 1GV2A 1P4AA 5FLVA 5BPIA 2LOOA 3DFGA 3ZGKA 4IQJA 4KIBA 4M6XA 2ZJQF 2KIMA 2R5ZA 3KZIC 4KNYA 3BJ6A 1OCTC 2EZIA 2BY2A 2DTRA 2HPMA 2K4BA 3VYSB 5D4SA 2ZXWH 1U3EM 3BR3A 4ESJA 1FOYA 1VQNI 2PMZN 3ZQCA 2DFFA 1ZQ3P 1P9QC 3S17J 3LAPA 1ZGAA 1D0ZA 1VZ0A 2F6CA 4M9XA 4C3JJ 1EH8A 3O3KA 3Q5FA 1FTTA 2Z9OA 4N0BA 1CGPA 2DPDA 2ESNA 4QSHA 1FT9A 1GDTA 1MW7A 1W5TA 3T0YA 4UY8I 1H0MA 2CQ7A 1XMXA 3U9GA 4XSXF 3VPRA 3CCUI 4XNFA 1X2MA 1ZN2A 2DA3A 5B1AH 4FCYA 1VQKI 2I10A 4E7KA 3F6VA 3NRVA 2QBYA 4UVCA 3CUQC 4UVAA 1IUYA 2VOPA 5AIPA 3KE2A 4YRVA 2X6OA 3DF8A 2OCCH 2Z3YA 3C1DA 1BI2A 1RETA 3JRIA 2L2OA 5HNHA 3LAJA 2A68F 2VI6A 2LC2A 2YU9J 3RYPA 2ZXIA 4XN3A 2JRMA 4XRSA 2OV7A 1MBGA 1MJAA 4IZZA 2K9LA 2LTPA 3V42A 1IGNA 1GLNA 4AYBN 4QWQA 2EFWA 5F1RA 1UB9A 3CCRI 1MBFA 3K70C 2L9NA 5M5YJ 1WQ2A 4L5EA 2Q2EA 3W2AA 3OYKA 1OLTA 4M3FA 2RKHA 2ZFUA 3WGHA 1LDKB 2R5YA 3CJNA 3QQAA 2FEZA 5H6RA 1R58A 4A0ZA 2DYRH 5CKTA 1ERDA 1T0FA 1Y8QB 2W25A 4BE0A 3CUQA 3S2WA 2PJRB 1TWGJ 1YYVA 3HSEA 1UCRA 3MEXA 4MLOA 3TGNA 5GAGJ 3L2CA 3CJQB 5C44J 1E17A 2FQ3A 2GZWA 2GA1A 4DIQA 2NVTJ 1IXCA 4OMYA 2M0CA 3QPHA 2P7CB 5FGMA 1CQTA 3JW4A 2MSYA 1IN6A 3KP4A 5LEJA 3OS0A 3KP3A 2K5CA 3CDLA 4B48A 5IPAA 5LGTA 3CP8A 1AOYA 3KP2A 1TW2A 2RGVA 2FNAA 1VF9A 2ECBA 2MC3A 4MEYF 5F64A 2HOEA 4AIKA 5DD4A 1P6RA 3Q0UA 1B4AA 2ID3A 3IH3A 5IT3A 2CGPA 4CGZA 2L9RA 4CSWA 3GCMA 3JREA 1Z91A 4CCLA 3LSGA 2MG4A 4YIFA 2L7MP 2J5PA 2RNGA 2OA4A 1FBSA 3IKVA 1WJAA 1X3WB 3E6DA 2R7QA 3CLQA 3HRSA 4OIRF 3DPLC 3WU0A 2ICWG 3H5RA 5IP7J 2PFBA 5E3MA 1HC8A 5B3SH 1R22A 3K69A 1F5TA 4KIGA 4UV8A 1N77A 3VODA 3TKYA 2P6SA 2ZJRF 1IV8A 4BBSJ 4HEA2 5K1YA 3BG6A 1X1DA 4OAZA 2PN6A 1WKMA 2O8XA 1TWAJ 4TV7A 4PFOA 3ZMVA 2HFHA 1DPUA 1MBEA 3FK7A 1PUEE 4BQAA 1OJLA 2ZJ2A 3Q0VA 2L7KA 2IBDA 3MCZA 1XG1A 2R92J 1BN5A 4JX5A 1EF4A 4HYEA 2EQRA 1ZRFA 2ZKZA 1LFUP 2E36A 4YELA 3BTIA 1SMTA 3GMEA 3KFWX 4P9UA 4M74A 3S3MA 5EG0A 2Y0SA 1QPIA 2ZMEA 3JRCA 2PLYA 3ZQ7A 1ETXA 3OOUA 4R79A 3OYCA 4WXCA 2E2HJ 4YIIA 3CMMA 4U7DA 3S93A 1X19A 3C7JA 1DQUA 5E79C 3HOWJ 2ZC2A 1Y1WJ 3RCOA 1O4XA 2IS2A 4PJNA 4JP0A 5BS6A 2PI0A 1YTYA 4J00A 3OR2C 3OSGA 3I3LA 2DDBA 1GHCA 2M1BA 1A6IA 4XIDA 1K4SA 2A05A 1BOBA 3W2VA 3B02A 3TDZC 3HGGA 4UVBA 1IRZA 4X6AJ 3A02A 2OD5A 1TW3A 1WFXA 4M71A 3I58A 3SQNA 4HLXA 4BHBA 3K1PA 1RUNA 4M6VA 2F48A 1MMGA 1YX5A 1S72I 3REOA 3CCJI 2DJNA 2XASA 3NQOA 4ZYGA 3CTAA 3MKWB 2DTZA 1Z67A 2EB7A 2E7WA 1GV5A 5J6XA 1D8KA 2STWA 2PJPA 3WTTC 1YIJI 2PMHA 1TNTA 2R0QC 2OZ6A 5DUIA 4PDKA 4DOZA 4XLEA 2R7XA 4ON0A 1Y8RB 4ENNA 4GXOA 2HXIA 1DDNA 2JA6J 5K5QA 1HF0A 4B4CA 3K10A 3D1NI 2K3FA 1K6OA 2DMUA 2IP2A 3OYMA 3QRFF 1Y0NA 1G8XA 3PM1A 2MH2A 1ETYA 2X51A 4CCKA 1NK3P 2RC4A 2XB0X 2XB5A 1VFCA 3E97A 3R6SA 5J1YA 2A5YB 2KL4A 1D1CA 4HF1A 4HOBA 1VQ4I 4D7NA 2VQHA 3P9CA 5M3FJ 3GLXA 4ZDPA 2CH0A 3F8NA 1HXDA 3BP8A 2GXBA 1FYLA 4XORA 1TWHJ 3A1YA 3MKLA 1FP2A 4FT8A 4B8XA 4FE4A 1A31A 2OTLI 5IYCJ 3L2QA 1DGRM 4M73A 1FMWA 4F52A 2P4WA 1KA8A 1GXQA 2D2WA 3FMRA 5JVGF 5FKMA 1JKQC 3MZ8A 2P6TA 1VQ5I 2GXGA 4C2UA 2LF8A 2LFBA 4FX4A 4UNOA 2VQGA 4CUGA 2EZKA 3TW6A 3BCBA 1OYIA 2JA8J 4RLQA 3S1MJ 3F22A 2V79A 2XKPA 3GFLA 2MA3A 3M1EA 2VODA 4PGHA 3ZN0A 3J7YJ 1S8NA 3SDGA 2EK5A 2GBYA 5J1UA 2JN6A 2OZUA 3LA7A 1IO2A 2CYYA 3L09A 4KMUX 1W7PD 2DFEA 3L2RA 2QYOA 3MZHA 3LL7A 4RA2A 5M5XJ 3HB9A 1XSDA 2IVMA 4BY1J 2VT3A 4GRIA 3I5UA 3IHUA 4A3IJ 3AG1H 5B1BH 3HOSA 2VQCA 4XRMA 2V9VA 1WWXA 2R7DA 2W4SA 1JJ6C 5EG0B 3AL0B 2IEKA 2XAJA 2E71A 1AHDP 2M4GA 3M7GA 4UB8C 2L4AA 4IHTA 3QYFA 5GADJ 1X4PA 3O8GA 4LK1F 3AFHA 1YJNI 5BQTA 3GZNB 1ETVA 1F36A 4MQVA 4A3GJ 3WGGA 2XAQA 5HVQC 2FOKA 2VJJA 2R7OA 2E2IJ 2OC6A 5HDNA 1TQIA 3CCYA 1QA6A 3OYHA 1O3TA 2FQ4A 2OCEA 1PP8F 5L3EA 2ZSHB 4L0ZB 3KLOA 4IEJA 5E17F 1O7LA 3LA2A 1U8RA 3K4NA 5HLIA 2WAEA 1QZYA 2P7VB 3PUBA 2JUGA 1V5GA 4XSZF 4N9HA 3S2DJ 1U5TB 1U9OA 1T33A 3H92A 3I53A 3O8HA 4CDGA 2JA5J 1ZELA 4AM3A 1XDSA 3ABLH 2EA2A 4B09A 5J40A 2ISYA 2LG4A 1LFPA 1ZG3A 3RI4A 2HZTA 3VOEA 1Y1VJ 2XPVA 1B8IA 5DS9A 5L3BA 2QEXI 1P92A 3LFKA 1IN5A 3GWZA 5DYMA 1YRNB 1Z6RA 4A0XA 3Q9SA 5D8KB 5GP9A 3MQ0A 3VSKA 4BJ5C 1J7KA 1MBHA 2DW4A 3PNVA 1A35A 4RB3C 2MBFA 2BY3A 1XTAA 4KT5C 4XOTA 3V8JA 3IUOA 4RLFA 3V7CA 4E7SA 3TOBA 3ROUA 3GBGA 3PQJA 2E1MC 3VWBA 3W6VA 3OYIA 5CVVA 2PBIA 5J4YA 1BOAA 4A5MA 1RR8C 3DQVC 4B1RA 2OUMA 3E5QA 1YJWI 5C4XJ 2G7UA 1T0FC 2KDOA 3ISPA 1VQLI 2WAFA 3CMEI 2K9QA 2F5VA 1F43A 2KHMA 3M8EA 4ZTJA 3C3WA 2Y69H 5IP6A 1BJZA 4IQ4A 3K9TA 4HNTA 3G1MA 2CW7A 4BJTA 1UFMA 2DFIA 3M8JA 3PSIA 2TRTA 1IN4A 3RDIA 3HIFA 3KETA 4E7IA 2L0KA 5F08A 3SEQA 2WBMA 5LHIA 5D8LB 3JAMZ 5EEHA 2D5VA 1G6NA 1MJ9A 4EVIA 2VL8A 2FOWA 3H35A 4QLCU 3OY9A 1AWCA 2RDPA 2JTVA 3HOVJ 3GZ6A 4B3AA 3CDHA 4DNCA 2RQQA 5JLWA 1UMQA 4XOPA 1YJ9I 1KU9A 2WV0A 3KEOA 5ILSA 1ON1A 3WU1B 2LY9A 2HVRA 9ANTA 4NB5A 2BY0A 1D3YA 3LSTA 4E6KG 1NH3A 1MMSA 2L5QA 1S5LC 2FMYA 1QVTA 1U5TA 3LOCA 3F8MA 3VYRB 4WF2A 4XRSG 4EQQA 1W36D 2WY7Q 2GLOA 1D5VA 3BY6A 1WJ5A 1P7IA 1POGA 1B72B 1RKWA 2DK5A 3HRMA 1F9NA 3F9KA 4UV9A 3Q9VA 2HKOA 2XRNA 4QIWN 5FLMJ 3BCAA 2GIVA 2HOAA 2JK3A 3EYYA 2EFOA 1FNNA 1V4RA 3I56I 3QPLA 1APLC 2A6EF 3OIQA 4FE7A 4HX4A 3WTUC 2KRFA 1TL8A 3BR6A 3BZKA 1FYMA 2MW8A 2DN0A 5FFXA 3RZOJ 3FXOA 3T1BA 1T95A 4MIMA 3HZJA 3OIPA 2LDUA 4EATA 2DAOA 5GTIC 4U0YA 2XGXA 5EYRA 2VOOA 4G12A 4RMNA 5K7FA 5JHFA 4PJMA 5J3LA 3AG3H 1V3FA 1NG6A 2CQXA 2IGMA 3SHFA 1KZHA 3VYTB 1K4TA 5L3DA 5ERIA 2JA2A 3EUAA 2WAQA 3GF2A 2KDZA 3J81Z 1YW8A 2QQ8A 1OKRA 2L02A 2Y9YA 3A2KA 2IS6A 2X9DA 3HOZJ 4MQ9F 1I6XA 4G7ZF 1IW7F 4Z2YA 1UHMA 3LSRA 1ZKGA 1IUFA 5EGOB 2ME6A 1UHSA 2GA2A 1XS9A 4IHSA 4HW0A 3PO2J 2E60A 4HX8A 4XKBA 2CQKA 3JSPA 4IX7A 4AD9A 3G6EI 3DXJF 2HOTA 1GVDA 1Z7LA 2G0EA 2FMLA 4FHTA 2E1CA 2CUEA 3F0CA 3DKXA 1ACIA 3A01A 3CJTB 3RIRA 4D5FA 3V8KA 4A0YA 5TRDA 1R6RA 1ZREA 2RAEA 3AL0C 2NS0A 1I1GA 4WK8F 1ZHFA 3M07A 2PX9A 1V5EA 2B63J 3H3VK 4IL6C 3GO5A 4MGRA 2KIUA 5KNLA 3DTKA 1LE8B 3EUKL 1KU7A 3CCMI 1Z21A 2MLKA 4BQQA 4XBFA 4U87A 3NARA 1OR7C 4CYDA 3UNGC 1FOWA 3WU2C 1Z05A 4FISA 3E7LA 3IH2A 2NRAC 1XMAA 3I54A 2XF6A 1D0YA 1XGOA 2HDDA 4WCGA 3T5XA 1IXSB 3S14J 3IAS2 5DD8A 4AU7A 1U5TC 2VBYA 2B7EA 1SAXA 1GUUA 3WHBA 3IV5A 1LPQA 2DMPA 1IDYA 2A3SA 1JE8A 2WY8Q 4XLCA 3K4JA 3LSMA 2LKXA 2LKSA 2XROA 4I98B 4BAYA 3SDBA 3J7AO 2K4JA 1S7OA 2MYSA 4A3KJ 1EA3A 4HDVA 5CLSA 2VXDA 3TDUC 2W1OA 3ABTA 1I27A 3HRUA 4PJJA 3BPXA 5GAHJ 3FKIJ 4UB6C 1IJWC 2V9PA 3DV8A 1R49A 3QPSA 1G2HA 2QQBA 2MABA 2O7OA 4DW6A 4HLYA 2KP6A 1JUMA 1TT0A 3OR1C 2ELHA 5FRNA 4BYYA 1UG0A 2AO9A 4NUBA 4UUSB 1LNWA 2EFPA 1BIAA 1SD6A 4OOIA 1T8IA 2E1MB 5EEAA 3PIOF 3BTLA 1R4MB 4BJ6C 2H94A 3OYNA 4RAGA 2AHQA 2A6TA 1K79A 3KPHA 2ELKA 1QO0D 1NTCA 2R7ZJ 2IS1A 2V4JC 2M7AA 2IT0A 1K6YA 2V1NA 4F91B 1V55H 1QPMA 2AXTC 2W48A 5CYVA 1SMYF 1WJFA 2FSWA 4HG2A 3MN2A 3GTJJ 2YPRA 4Q47A 2Y75A 3WG7H 3H3UA 1IRGA 3M9AA 3QWLA 5DCFA 2VBZA 2B0LA 4HDUA 4DBRA 2H8WA 2LSOA 1BM9A 4G8XA 5KHDA 3WTZA 5L3FA 1I1SA 1YLFA 2KRHA 4KMFA 4BDYA 4DGWB 3MKZA 3HXLA 5LGUA 4HV6A 3CO7C 2BZTA 2XUBA 5JI6A 2QQ9A 4LITA 1KYWA 3PL8A 1HW2A 3RKXA 3ECHA 2XGEA 2HYJA 2DT6A 1TNSA 2UUZA 4NC7A 3TP0A 1OMIA 1FTZA 2EZHA 4XLPF 1ZGJA 1Z6TA 1QZEA 2DO7A 2YU3A 4GO1A 4A3EJ 3Q3SA 1A36A 3CCEI 1PYVA 1X4OA 1K78A 3V7RA 3BTJA 1J5YA 2CRGA 4BEHB 5L3GA 3G71I 2VT2A 4LLLA 4F55A 3Q0WA 4IRGA 4AVZA 3K0LA 1TP4A 5GAEJ 4R1HA 3OYFA 3CCLI 3QOEA 3D0SA 4WXDA 3DBLB 5FKKA 2Y9ZA 2K9MA 3FHNA 2XDVA 2X85A 3GW2A 3P9KA 4RBOA 4PSXA 1BW6A 3I4PA 4A6EA 3H0DA 3H9GA 3ASOH 2FE3A 2IA0A 1JKPC 3N05A 4PSWA 1MIJA 1ZGWA 4X0GA 2JZYA 2JSPA 3QU6A 1WCMJ 2M5WA 3K4BA 3PNYA 5IOYA 2CU7A 1USSA 3HHGA 3TO6A 5IOZA 2X1DA 1VQ8I 1MDMA 4HF2A 5FKNA 4AWXB 2Q0OA 2NNNA 1QBJA 1U6GA 5IP9J 5LD2C 2LBFA 4CCMA 2DMQA 4CICA 2KMUA 3I59B 2VJIA 4MTEA 5BMZA 4RDUA 2F4OB 1E3OC 1G3SA 2CFOA 4HNUA 2ADUA 3KEQA 3VFZA 3OOPA 2H6BA 2BW3B 3A03A 2FD5A 1NG7A 3EUHC 2BXZA 4D0PA 1K78B 2A6HF 3E1SA 3HUGB 2M7BA 2HR3A 2HS5A 1FP1D 1X58A 2QA4I 1R00A 2MFZA 3J81K 2JJ7A 4GDFA 2HI3A 1MNDA 1B59A 3CP2A 4KISA 3TOAA 1KQ9A 2O3FA 3ZOBA 4L5IA 4BQNA 3N4MA 1VNDA 1JTYA 3ASNH 3FIWA 4BH9A 2Q1ZB 5D5VB 2XF7A 4I76A 1ONVA 2AQEA 1TQPA 2CSOA 1WGXA 1OPCA 3EETA 4II2A 3JRDA 5IYDJ 5D5UB 5M3MJ 1HCRA 2ZSIB 3AG4H 4Y15A 1ORKA 2I5UA 1UJ8A 1H8AC 1L0OC 3S32A 3ZQQA 1YE9A 1JI8A 2J5OA 1GT0C 2UWMA 1IDZA 1BR2A 4HA8A 4CH7A 1HQCA 1ZLJA 3KP7A 3LMMA 4OIPF 2IXSA 4XM3A 2FBIA 2LLKA 2YX4A 4EV0A 3RPUD 1ETWA 1N75A 2M8EA 2R3SA 1QVUA 4BXUA 3OYJA 2EFNA 4NHJA 3S1NJ 1P2FA 2HYGD 2E2JJ 3BR2A 5HS8A 3RKWA 1DU6A 2Y2ZA 2M30A 2E1OA 1F1ZA 1Z3XA 1TWCJ 5A2QZ 3SEZA 3H1CA 1D8JA 2LYCA 3IKTA 1HW5A 2XKOA 2ISZA 1TBXA 3CF2A 2RREA 4ZYEA 2DOFA 3G1LA 3ONQA 1OISA 3NEUA 2ESHA 4MTDA 2LNBA 3L7WA 4J19A 1QNTA 1IZ1A 2DBBA 1BJAA 1FMVA 4CYCA 4XLFA 1Y39A 3VEPA 1UZCA 1XCVA 2BBYA 2GOXB 4BY7J 1IG7A 2XRLA 3OV8A 2QSGX 4XICA 3X2QH 3SZTA 2M3AA 3ECOA 3LA3A 3KYLA 3J7AY 3CZ6A 1OCOH 5FO5A 5HLTA 4IO9F 2KT0A 3J80K 2HZDA 3F8CA 2HEOA 1I3AA 2D1VA 1XGMA 3KZYA 4I6ZA 3RZDJ 1MMAA 4JX4A 3ZR8X 2K86A 3ELKA 4CCOA 3QOPA 1I3QJ 1U78A 4IKFA 1PUFA 1WI3A 2OAZA 1B9MA 2Y30A 4XMYA 4NBQA 3H9JA 5FLXK 2KLOA 2XF5A 5DCMA 2BV6A 1MBKA 2EPFA 1HKTA 4LLNA 5J4VA 1SEUA 4HSTA 5E1WA 4L0YB 1JGSA 1BI0A 2E5NA 3PUFA 4P1WA 2XGCA 5E20A 2W00A 1X1AA 2MD0A 3DBHB 5FKLA 2MLGA 2ELJA 2DOAA 1ULYA 4BBRJ 3RJPA 3K7AJ 2NOJB 3MD2A 1R71A 1ODDA 2X1EA 1Y0UA 3CC2I 4AUXA 3LNQA 2MH9A 1XX5A 3ZQHA 3FK6A 1IN7A 4C3HJ 1YW7A 1LEAA 3DWLE 1LFBA 2QCOA 4I01A 1Q1VA 3F21A 2Z5UA 2Z33A 1SANA 4S0HB 2M2EA 2XSJC 3OS1A 2QVOA 4YEJA 2CQNA 4BGDA 5EEGA 4AC0A 2X0LA 1HA8A 4OIQF 1WHUA 5E3LA 5E8IA 3KZZA 4E4HA 2CUZA 3H5NA 3WTVC 1YIOA 1R36A 2QQAA 5CVIA 2CWEA 2DA1A 2YR2A 3I9V2 5F0FA 3WODF 1QHHD 4C3IJ 2CV1A 3WTXC 1WPKA 4A2UA 4G94A 1Z77A 5IYBJ 2JUCA 4ITVA 3T8TA 2P81A 4ZYHA 2FNPA 1YFHA 2HDCA 2OTJI 2X6WA 1OCZH 4EM2A 3GLLA 3K2AA 2W57A 4JOMA 1KONA 1LJ9A 1X1PA 2IS4A 1JXSA 4IPAA 4BKXA 1FPQA 3FISA 3LSJA 2A61A 4IXAA 1WH5A 1VI0A 4LIVA 5D5XB 1WRJA 1VQ9I 1MH3A 1PUFB 1H9TA 2L54A 2DU9A 1WJBA 3ULQB 1R1VA 2DMNA 2W82A 1KU3A 3HUGA 2FA5A 4LG0B 4BL0B 3BR1A 4L9TA 5EJCA 3WHCA 5H6QA 2H8RA 2QF7A 4B3XA 2UV1A 2DA5A 3PFYA 3MKYB 5DDGA 4CXFA 2G9WA 4FETA 5BOXA 4XONA 5GPAA 2KISA 1Y56A 4I0AA 2YSRA 4W1UA 2CFXA 2TCTA 3DLLF 1TQMA 1K61A 2DYSH 1N78A 2OF7A 2IW5A 3KP6A 3TO9A 1R1TA 4D7MA 1IN8A 3HJEA 3UKGA 5FLXZ 1LUJB 2XVCA 3W6JB 4WX9A 3S1QJ 3GZ5A 3B6CA 4RAYA 4P55A 1W7PA 1U0JA 2IRFG 1WJCA 4LJZF 2A07F 2IGKA 4F3QA 3ERMA 1OYYA 1ENHA 4FX0A 4P5OA 3TO7A 3BLYA 1S29A 1OQYA 4M3BA 1B6AA 5FB2A 3FXRA 3D5LA 1XD7A 2VIXA 2NXNB 2Z2SB 3KCCA 4IJAA 3CJRB 2F4MB 5DUKA 5ICCA 3FMQA 4IHVA 5C3EJ 4UUTA 4FASD 5LEKA 2H1KA 2LH9A 3EQLF 4XL9A 2LRDA 3CC7I 4I2OA 3O6BB 3FBNB 3CMYA 2L9VA 1LB2A 5EGOA 2K02A 2QZ8A 3G4SI 2ZMEB 4RGRA 2K9NA 2XV4S 4E7LA 4ESFA 1WI9A 5HODA 3BC8A 4IRIA 2GQQA 3DTIA 3BR5A 3BR0A 4BHPA 1FBUA 3F8BA 1ZAOA 3DPTA 5BPDA 4HBLA 1W5CC 2ID6A 2VE9A 1R5GA 3DBRB 5GPCA 4UUVA 2DT7B 3C2BA 4PZJA 3HG9A 5A2QK 2CQQA 5JR3A 2G7HA 3L2VA 1R7JA 4U0VA 5GTHC 2FU4A 2XIGA 1LKXA 2KZGA 1B1BA 1RUOA 4OAYA 3CF5F 2EILH 2COMA 1H88C 1O57A 1P4XA 4B47A 2R93J 1YITI 2COBA 2EV0A 3J7ZI 2LY1A 3K4CA 4V2FA 4BEHA 3K6GA 3BT9A 4I09A 5HNFA 1FY7A 4UUSA 3D5RC 4WXHA 5HS7A 2XAHA 3LQRA 2IPQX 3HSRA 2R4GA 2ZO4A 4Y3OA 4CA0A 4N4NB 1RNLA 3K70D 3IWFA 3CMAI 5E1XA 1FBQA 2M9HA 4A3BJ 2EA4A 4HQEA 3CESA 5JFRA 1ITYA 4GYGA 4Y17A 1DUXC 2Y31A 3IRQA 2RNJA 2HTSA 4I0BA 4BXFA 1T98A 4ENMA 3QU3A 1XCBA 3FXJA 3ML6A 4CCNA 2HPIA 2Y48A 5TISC 3BZCA 1XSVA 1J2XA 1O3QA 2X48A 4Y52J 2KIQA 2PMUA 2ZBKA 1I5ZA 2D1HA 3FMSA 4XQFA 2Z99A 3DEUA 4EGYA 1JHHA 1QRYA 4W97A 3JRBA 4BHCA 2H6CA 5CVRA 2LR8A 2VC1A 1RRJA 5HOOA 3ZQGA 3U1DA 5K7ZA 5LRSA 4G7HF 3EPZA 1OCRH 3FXKA 3OL3A 4A12A 2MC4A 3DU6A 1MMNA 3JSOA 2HXOA 1VQOI 1UG2A 3RKQA 1J75A 3JRHA 1Z3YA 3C18A 2CUFA 3N97A 2W85A 1AKHA 3ZCOA 1Q1HA 1XB4A 1XN7A 4MNUA 4MHGA 3I4MJ 1MBJA 4LLGF 3GTPJ 3DLAA 1SVMA 1EV7A 3ZQIA 1PJRA 3I0TA 1HSJA 1B72A 1S3JA 3R0JA 3L2WA 3ABUA 4XK4A 1D1BA 3MZYA 2VQLA 4DJAA 4M6YA 2GM4A 4PJ0C 3W3CA 4I02A 2FBKA 1BI1A 2V6EA 2K40A 3FHZA 1VQPI 1L3LA 3HL2A 2KJCA 1S6LA 2VKDA 1XGSA 2MD5A 2YS9A 1W5SA 3DP7A 4NNJA 4ZZDA 4AVPA 4QPQA 3I55I 3FXMA 1W1WE 5ILUA 3AAFA 3FZVA 3PSFA 5EF6A 4C30A 1DP3A 1KU2A 2AQFA 2NVYJ 1JGGA 2NVXJ 1W4MA 1RZ4A 2H27A 3BDDA 3A01B 2DLLA 1P7JA 4RB0A 2O8KA 2F5CA 4H0EA 1BR1A 1UHWA
chains in the Genus database with same CATH topology
1T6SA 1FSHA 3BWGA 2XHKA 4KN4X 5FFZA 5LGNA 3E3VA 4L9JA 4I7HA 2VC0A 3WE2A 3ZMSA 4YFXF 3HRTA 2P8TA 3ZP5A 3GFJA 3QP5A 2P5KA 2OQRA 3K2ZA 5D4RA 1MJBA 3WGIA 6PAXA 1R23A 2IA1A 1MZBA 2JSCA 2DI3A 1SD5A 1WSUA 1NHAA 1Z1DA 2K27A 1HW1A 2YX7A 5KK1A 5K5OA 3HYIA 1LVAA 4EM1A 5AIQA 2O03A 3G3ZA 5ICFA 3GFMA 2TDXA 3FXQA 2OBPA 5FD5A 3GX4X 1J59A 2WC2A 3ZMDA 3R4KA 4ESBA 2KKOA 2OU2A 5D6FA 3U2RA 3R0AA 2JPCA 2CG4A 1IF1A 1HBXG 1PDNC 1KGSA 1YG2A 4LK0F 2EV6A 2W24A 4PGGA 4KN7X 5ED4A 1PP7U 2ACJA 4YG2F 4N9IA 4G6QA 2LF7A 1J9IA 3SFZA 5LBQA 3KP5A 4KA4A 2FRHA 2EWNA 2WWYA 2HGCA 3IC7A 5KVRA 5FD6A 1K7AA 4XRFA 2BGCA 1FOKA 4KUMA 2IJLA 3GUDA 1TTYA 2EJRA 3SXYA 4U0WA 4ZZLA 1JHFA 4ZYDA 1A04A 4HF0A 4IRHA 3I71A 3T8RA 5H20A 2GWRA 2V1XA 1DPRA 2AXLA 3ZMTA 1STZA 5DEQA 4G9YA 4A5NA 3F72A 1FC3A 2V1DA 4HX7A 2BE5F 1ZH5A 2HQNA 3SZPA 2F2EA 2PEXA 4NQWA 1FYKA 3V8LA 1W7PB 1XDUA 5DV5A 3J80Z 5ICGA 2NAZA 2WTEA 3IWZA 3COAC 2RVCA 4KYWA 1GVJA 4M9SA 1FLIA 4P96A 4EGZA 3DKWA 2DK8A 2X4HA 3I64A 2F5DA 2HWVA 3WG9A 2ETHA 2A69F 4GCVA 1LQ1A 5E8GA 4K2EA 3QPTA 2QENA 4LGWA 3GYHX 2C6YA 2PG4A 4M9ZA 1CF7B 2HYFA 2RN7A 2JPBA 2FF4A 5ICEA 2O6GE 2DQRA 1P4WA 1X3UA 1BI3A 1G3TA 4PCQA 4YFKF 4HAMA 3FM3A 1REPC 4KDPA 5HS9A 4RB2C 3FXUA 1BC8C 3CO6C 1B9NA 4O6JA 4IVNA 1KQ0A 2Y0MA 2P5VA 3H3ZA 4Y13A 4XLNF 3BOQA 1IXRC 5F6FA 3GEZA 4EMSA 3P7NA 4EJTA 3V7SA 4Q5SF 1ZG1A 2HTJA 1BIBA 3ZMUA 5E1ZB 2GAUA 3BJOA 3IRRA 2VBWA 4ENJA 4WWCA 3F3XA 3P9IA 3R60A 3RPQA 3ZMZA 1R1UA 4ETSA 4GGGA 2RQPA 1U2WA 3GVAA 2AS5F 2KIFA 2L01A 1Z9CA 3BROA 5CJ9A 2UXXA 4G6DA 4R8HA 2JT1A 2DPUA 3EYIA 3L9FA 3HOTA 4RB1A 1C0WA 2Q8KA 3LWFA 1O7FA 2PQ8A 3HTSB 1LDJA 4IF4A 1ZRDA 5J8CA 1OYWA 5LHHA 1SFEA 2O0YA 5LRRA 3LQQA 5CVUA 2R7FA 4JQFA 5D6EA 5E18F 3M8FA 4EJOA 4JBAA 3F8FA 3PQKA 1QGPA 3MFKA 3IL2A 3RKYA 4GYIA 4KFCA 1T39A 5D5WB 4CZZA 3WE3A 3JAMK 2BEOA 5IT9Z 3HHHA 4L18B 5LHGA 3TQNA 4P9FA 4MEXF 2FBHA 3ZN1A 3MWMA 3E6BA 2QWWA 5HLGA 2XAGA 4L9NA 1T2KA 1J0RA 3K1MA 2STTA 3E5UA 2EV5A 3I59A 1T38A 2QLZA 4RS8A 3KLNA 4OIOF 3V4GA 4A6DA 2V6CA 2ZCWA 1YQAA 2RV8A 2ZNZA 5LLQA 2HQRA 3E6MA 4HZFA 1S7AA 4YFNF 2F5FA 1KYZA 1Z7UA 4L9VA 3G73A 5HDGA 1FWZA 3FF5A 2ZNYA 1TLHB 5HDKA 4LB5A 1G3YA 3ERED 4Q4ZF 1FSEA 1IRFA 1SD4A 1G4DA 3MAJA 1BC7C 5CVJA 2CO5A 1DP7P 3E5XA 3BPVA 1VTNC 1MDMB 3FM5A 3BJAA 4DQ2A 1BBYA 1SFUA 2DQLA 2QUFA 1GXPA 1MD0A 1H9GA 2M87A 3PFIA 2VONA 4G7OF 1IAWA 2IA2A 3WTSC 5J8FA 1XGNA 1HKSA 3RTRA 1RI7A 4EM0B 4LG0A 3EDPA 3FX3A 2D45A 2O61A 2M45A 1SD7A 2VXZA 4O5VA 2LKPA 3HSFA 2W84A 2VN2A 4EJVA 1FX7A 2QBYB 4ASNA 3CUQB 1ZRCA 3F23A 1HKQA 2XAFA 2K7LA 4EJUA 1ZYRF 5ILVA 1G3WA 2KJBA 3F6OA 1USTA 3JTHA 4ENKA 4LD5A 1YS6A 5K5RA 4UHTA 1ZARA 4O3MA 3RPUA 4JK1X 1ON2A 5IT9K 4LFUA 4ZH4F 2QM3A 3E6CC 4RGXA 5DCMB 3O2PE 4RGUA 3CUOA 2V1UA 3FWEA 3CLOA 1YW9A 2H09A 3HTUA 4OU0A 1HSTA 2UXNA 3WTWC 4KIFA 1E2XA 4AIHA 5JHUA 3K1NA 1O3SA 1ZLKA 5TJJA 4AIJA 3BZ6A 1LEBA 4KICA 2CW0F 2E1NA 3W6KB 1XSXA 2P5LC 4S04A 4HQMA 1R5HA 4RAZA 2EFQA 4BNCA 2F5EA 4U7BA 4UXNA 3ZPLA 4LMYA 2L3DA 1MKMA 1CF7A 3VB2A 2NYXA 4Q48A 2ZXJA 2VE8A 4S05A 4CHUA 5HLHA 3RYRA 5L3CA 1QQIA 1OR7A 3B73A 2HKXA 4OINF 3QAHA 2NNYA 3JTGA 1QZZA 3L00A 2ZFWA 2VBXA 3GXOA 2BYVE 4F7ZA 1SFXA 2E7XA 2JRTA 5JVTA 4CO8A 1O3RA 3GFIA 4L5JA 2DT5A 1KQ8A 4LB6B 1YS7A 4OMZA 2L4MA 2UZKA 3QP6A 1FZPB 1YO5C 4U88A 1ZG5A 4HV5A 2OQGA 1EH7A 3WTYC 4EJWA 3EUHA 4E70A 4RGSA 1F4KA 4M72A 2FXAA 1LDDA 1EH6A 1XMKA 5AONA 1RIOH 1MGTA 3R61A 1P4AA 5BPIA 3DFGA 4KIBA 4M6XA 2KIMA 4KNYA 3BJ6A 2DTRA 2K4BA 5D4SA 1U3EM 4ESJA 3LAPA 1ZGAA 4M9XA 1EH8A 3O3KA 3Q5FA 2Z9OA 4N0BA 1CGPA 2DPDA 2ESNA 1FT9A 1W5TA 3T0YA 1H0MA 3U9GA 4XSXF 1ZN2A 3F6VA 3NRVA 2QBYA 4UVCA 3CUQC 4UVAA 1IUYA 2VOPA 5AIPA 3KE2A 3DF8A 2Z3YA 3C1DA 1BI2A 3LAJA 2A68F 3RYPA 1MJAA 4QWQA 2EFWA 5F1RA 1UB9A 1WQ2A 2Q2EA 2RKHA 3WGHA 1LDKB 3CJNA 2FEZA 5H6RA 1R58A 4A0ZA 1T0FA 2W25A 3CUQA 3S2WA 1YYVA 3HSEA 1UCRA 3MEXA 3TGNA 3L2CA 1E17A 2FQ3A 2GZWA 2GA1A 1IXCA 4OMYA 3QPHA 2P7CB 5FGMA 3JW4A 1IN6A 3KP4A 5LEJA 3KP3A 5LGTA 1AOYA 3KP2A 1TW2A 2RGVA 2FNAA 2MC3A 4MEYF 5F64A 2HOEA 4AIKA 5DD4A 1P6RA 1B4AA 5IT3A 2CGPA 4CGZA 1Z91A 4YIFA 2J5PA 2OA4A 1FBSA 3IKVA 3E6DA 3HRSA 4OIRF 3DPLC 3WU0A 2PFBA 1R22A 3K69A 1F5TA 4KIGA 4UV8A 3VODA 3TKYA 2P6SA 5K1YA 2PN6A 1WKMA 2O8XA 4TV7A 3ZMVA 2HFHA 1DPUA 1PUEE 4BQAA 2ZJ2A 3MCZA 1BN5A 4HYEA 1ZRFA 2ZKZA 1SMTA 3KFWX 4P9UA 4M74A 2ZMEA 2PLYA 3ZQ7A 4R79A 4WXCA 4YIIA 4U7DA 3C7JA 5BS6A 2PI0A 1YTYA 1GHCA 2M1BA 3B02A 3TDZC 4UVBA 2OD5A 1TW3A 4M71A 3I58A 3SQNA 4HLXA 4BHBA 3K1PA 1RUNA 3REOA 2XASA 3NQOA 4ZYGA 3CTAA 2EB7A 2E7WA 5J6XA 1D8KA 2STWA 2PJPA 3WTTC 2PMHA 1TNTA 2OZ6A 5DUIA 4PDKA 4ON0A 4ENNA 4GXOA 1DDNA 5K5QA 1K6OA 2IP2A 3QRFF 2MH2A 2RC4A 3E97A 3R6SA 2A5YB 4HF1A 4HOBA 3P9CA 3GLXA 3F8NA 1HXDA 3BP8A 2GXBA 1FYLA 4FT8A 1FP2A 4B8XA 4M73A 2P4WA 1KA8A 1GXQA 2D2WA 3FMRA 2P6TA 2GXGA 2LF8A 4FX4A 4UNOA 1OYIA 3F22A 2V79A 2XKPA 3GFLA 2MA3A 3M1EA 2VODA 4PGHA 3ZN0A 1S8NA 2EK5A 2OZUA 3LA7A 2CYYA 3L09A 4KMUX 1W7PD 2QYOA 3MZHA 1XSDA 2IVMA 2VT3A 3I5UA 3IHUA 3HOSA 2V9VA 1WWXA 2R7DA 2XAJA 3M7GA 2L4AA 4IHTA 4LK1F 5BQTA 4MQVA 3WGGA 2XAQA 5HVQC 2FOKA 5HDNA 1TQIA 1O3TA 1PP8F 5L3EA 4L0ZB 3KLOA 5E17F 1O7LA 3LA2A 1U8RA 5HLIA 1QZYA 2P7VB 4XSZF 4N9HA 1U5TB 3H92A 3I53A 4CDGA 1XDSA 2EA2A 4B09A 2ISYA 1ZG3A 3RI4A 2HZTA 3VOEA 5L3BA 1P92A 3LFKA 1IN5A 3GWZA 5DYMA 1Z6RA 4A0XA 3Q9SA 5D8KB 3MQ0A 1J7KA 2DW4A 4RB3C 2MBFA 4KT5C 3V8JA 3V7CA 3TOBA 3ROUA 3PQJA 5CVVA 2PBIA 1BOAA 4A5MA 3DQVC 3E5QA 2G7UA 3ISPA 3M8EA 3C3WA 3K9TA 1UFMA 2DFIA 1IN4A 3RDIA 3HIFA 3KETA 5LHIA 5D8LB 3JAMZ 5EEHA 1G6NA 1MJ9A 4EVIA 4QLCU 1AWCA 2RDPA 2JTVA 3GZ6A 4DNCA 3CDHA 1KU9A 2WV0A 3KEOA 5ILSA 1ON1A 3WU1B 4NB5A 1D3YA 3LSTA 2FMYA 1U5TA 4EQQA 3F8MA 4WF2A 1D5VA 3BY6A 2DK5A 3HRMA 1F9NA 4UV9A 3Q9VA 2HKOA 2XRNA 2GIVA 3EYYA 2EFOA 1FNNA 1V4RA 2A6EF 4HX4A 3WTUC 2KRFA 1FYMA 5FFXA 3T1BA 2LDUA 2DAOA 4U0YA 2XGXA 2VOOA 1V3FA 3SHFA 5L3DA 5ERIA 3GF2A 3J81Z 1YW8A 1OKRA 2L02A 4MQ9F 1I6XA 4G7ZF 1IW7F 4Z2YA 1UHMA 2GA2A 4IHSA 4HW0A 4HX8A 3JSPA 2CQKA 4AD9A 3DXJF 2FMLA 4FHTA 2E1CA 3RIRA 3V8KA 4A0YA 5TRDA 1ZREA 2NS0A 1I1GA 4WK8F 1ZHFA 3GO5A 4MGRA 2KIUA 1KU7A 2MLKA 4XBFA 4CYDA 1Z05A 2NRAC 1XMAA 3I54A 1XGOA 4WCGA 3T5XA 1IXSB 5DD8A 1U5TC 2VBYA 1SAXA 1JE8A 2A3SA 2XROA 4BAYA 3J7AO 2K4JA 1S7OA 4HDVA 5CLSA 3TDUC 3ABTA 1I27A 3HRUA 3BPXA 3DV8A 2QQBA 4HLYA 2ELHA 4BYYA 1LNWA 2EFPA 1BIAA 1SD6A 4OOIA 2H94A 1K79A 1QO0D 2IT0A 1QPMA 5CYVA 1SMYF 2FSWA 2YPRA 4Q47A 2Y75A 3H3UA 1IRGA 3M9AA 5DCFA 4HDUA 2VBZA 2B0LA 2LSOA 1BM9A 4G8XA 3WTZA 5L3FA 1I1SA 1YLFA 4KMFA 3CO7C 5LGUA 4HV6A 2XUBA 5JI6A 2QQ9A 1KYWA 1HW2A 3RKXA 3ECHA 1TNSA 1OMIA 4XLPF 1ZGJA 1Z6TA 2DO7A 2YU3A 4GO1A 1K78A 3V7RA 1J5YA 5L3GA 2VT2A 4LLLA 4IRGA 3K0LA 4R1HA 3D0SA 4WXDA 3GW2A 3P9KA 4A6EA 3I4PA 2FE3A 2IA0A 2JZYA 3QU6A 2M5WA 3HHGA 1USSA 3TO6A 1MDMA 4HF2A 4AWXB 2Q0OA 2NNNA 1QBJA 1U6GA 4CICA 3I59B 4MTEA 5BMZA 1G3SA 2ADUA 3KEQA 3VFZA 3OOPA 2H6BA 4D0PA 1K78B 2A6HF 2HR3A 2HS5A 1FP1D 1R00A 3J81K 1B59A 3TOAA 1KQ9A 2O3FA 4L5IA 3N4MA 4BH9A 5D5VB 1ONVA 1TQPA 2CSOA 1OPCA 3EETA 5D5UB 4Y15A 1L0OC 2J5OA 2UWMA 4HA8A 1HQCA 1ZLJA 3KP7A 4OIPF 2FBIA 2YX4A 4EV0A 4BXUA 2M8EA 2R3SA 2EFNA 4NHJA 1P2FA 2HYGD 5HS8A 3RKWA 2M30A 1F1ZA 5A2QZ 1D8JA 3IKTA 1HW5A 2XKOA 2ISZA 1TBXA 4ZYEA 3NEUA 2ESHA 4MTDA 2LNBA 3L7WA 1QNTA 1IZ1A 2DBBA 1BJAA 3VEPA 1XCVA 2BBYA 3OV8A 3SZTA 3ECOA 3LA3A 5FO5A 3J80K 3F8CA 2HEOA 2D1VA 1XGMA 3KZYA 2K86A 3ELKA 3QOPA 1U78A 2OAZA 1B9MA 5FLXK 5DCMA 2BV6A 1HKTA 4LLNA 4L0YB 5E1WA 1JGSA 1BI0A 5E20A 2MLGA 1ULYA 3RJPA 1ODDA 1Y0UA 2MH9A 1IN7A 1YW7A 1LEAA 4I01A 3F21A 2Z5UA 2Z33A 2QVOA 5EEGA 2X0LA 4OIQF 5E8IA 3KZZA 3WTVC 1YIOA 1R36A 2QQAA 5CVIA 2CWEA 2YR2A 3WODF 3WTXC 4A2UA 4G94A 3T8TA 4ZYHA 2FNPA 1YFHA 2HDCA 4EM2A 2W57A 1LJ9A 1JXSA 4IPAA 1FPQA 2A61A 4IXAA 5D5XB 1WRJA 1H9TA 2L54A 2DU9A 3ULQB 1R1VA 3HUGA 1KU3A 4LG0B 2FA5A 4L9TA 5H6QA 5DDGA 4CXFA 2G9WA 5BOXA 4I0AA 2YSRA 2CFXA 1TQMA 2IW5A 3KP6A 3TO9A 1R1TA 1IN8A 5FLXZ 2XVCA 3W6JB 4WX9A 3GZ5A 4RAYA 4P55A 1W7PA 2IRFG 4LJZF 2A07F 4P5OA 1OYYA 4FX0A 3TO7A 1S29A 1B6AA 5FB2A 3FXRA 3D5LA 1XD7A 3KCCA 4IJAA 5DUKA 5ICCA 3FMQA 5LEKA 3EQLF 4I2OA 3O6BB 1LB2A 2K02A 2QZ8A 2ZMEB 4RGRA 2XV4S 4ESFA 1WI9A 4IRIA 2GQQA 4BHPA 1FBUA 3F8BA 1ZAOA 3DPTA 5BPDA 4HBLA 2VE9A 1R5GA 4UUVA 4PZJA 5A2QK 5JR3A 2G7HA 1R7JA 4U0VA 2FU4A 2XIGA 1B1BA 1RUOA 2COMA 1O57A 1P4XA 2EV0A 4I09A 1FY7A 4WXHA 5HS7A 2XAHA 3LQRA 2IPQX 3HSRA 2ZO4A 1RNLA 3IWFA 5E1XA 1FBQA 2EA4A 4HQEA 5JFRA 4GYGA 4Y17A 1DUXC 3IRQA 2RNJA 2HTSA 4I0BA 1T98A 4ENMA 3QU3A 1XCBA 3ML6A 2Y48A 1XSVA 1J2XA 1O3QA 2PMUA 2ZBKA 1I5ZA 2D1HA 3FMSA 2Z99A 3DEUA 4EGYA 1JHHA 4BHCA 2H6CA 5CVRA 2VC1A 5HOOA 3U1DA 5LRSA 4G7HF 4A12A 3JSOA 1J75A 3C18A 3N97A 2W85A 1Q1HA 1XB4A 1XN7A 4MNUA 4MHGA 4LLGF 1EV7A 3I0TA 1HSJA 1S3JA 3R0JA 3ABUA 3MZYA 4M6YA 4I02A 2FBKA 1BI1A 3FHZA 1L3LA 2KJCA 1S6LA 1XGSA 2MD5A 1W5SA 3DP7A 4ZZDA 4AVPA 5ILUA 3AAFA 3FZVA 1KU2A 1W4MA 1RZ4A 2H27A 3BDDA 2DLLA 4RB0A 2F5CA 4H0EA 4I98B 1UHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6S A;  1FSH A;  3BWG A;  2XHK A;  4KN4 X;  5FFZ A;  5LGN A;  3E3V A;  4L9J A;  4I7H A;  2VC0 A;  3WE2 A;  3ZMS A;  4YFX F;  3HRT A;  2P8T A;  3ZP5 A;  3GFJ A;  3QP5 A;  2P5K A;  2OQR A;  3K2Z A;  5D4R A;  1MJB A;  3WGI A;  6PAX A;  1R23 A;  2IA1 A;  1MZB A;  2JSC A;  2DI3 A;  1SD5 A;  1WSU A;  1NHA A;  1Z1D A;  2K27 A;  1HW1 A;  2YX7 A;  5KK1 A;  5K5O A;  3HYI A;  1LVA A;  4EM1 A;  5AIQ A;  2O03 A;  3G3Z A;  5ICF A;  3GFM A;  2TDX A;  3FXQ A;  2OBP A;  5FD5 A;  3GX4 X;  1J59 A;  2WC2 A;  3ZMD A;  3R4K A;  4ESB A;  2KKO A;  2OU2 A;  5D6F A;  3U2R A;  3R0A A;  2JPC A;  2CG4 A;  1IF1 A;  1HBX G;  1PDN C;  1KGS A;  1YG2 A;  4LK0 F;  2EV6 A;  2W24 A;  4PGG A;  4KN7 X;  5ED4 A;  1PP7 U;  2ACJ A;  4YG2 F;  4N9I A;  4G6Q A;  2LF7 A;  1J9I A;  3SFZ A;  5LBQ A;  3KP5 A;  4KA4 A;  2FRH A;  2EWN A;  2WWY A;  2HGC A;  3IC7 A;  5KVR A;  5FD6 A;  1K7A A;  4XRF A;  2BGC A;  1FOK A;  4KUM A;  2IJL A;  3GUD A;  1TTY A;  2EJR A;  3SXY A;  4U0W A;  4ZZL A;  1JHF A;  4ZYD A;  1A04 A;  4HF0 A;  4IRH A;  3I71 A;  3T8R A;  5H20 A;  2GWR A;  2V1X A;  1DPR A;  2AXL A;  3ZMT A;  1STZ A;  5DEQ A;  4G9Y A;  4A5N A;  3F72 A;  1FC3 A;  2V1D A;  4HX7 A;  2BE5 F;  1ZH5 A;  2HQN A;  3SZP A;  2F2E A;  2PEX A;  4NQW A;  1FYK A;  3V8L A;  1W7P B;  1XDU A;  5DV5 A;  3J80 Z;  5ICG A;  2NAZ A;  2WTE A;  3IWZ A;  3COA C;  2RVC A;  4KYW A;  1GVJ A;  4M9S A;  1FLI A;  4P96 A;  4EGZ A;  3DKW A;  2DK8 A;  2X4H A;  3I64 A;  2F5D A;  2HWV A;  3WG9 A;  2ETH A;  2A69 F;  4GCV A;  1LQ1 A;  5E8G A;  4K2E A;  3QPT A;  2QEN A;  4LGW A;  3GYH X;  2C6Y A;  2PG4 A;  4M9Z A;  1CF7 B;  2HYF A;  2RN7 A;  2JPB A;  2FF4 A;  5ICE A;  2O6G E;  2DQR A;  1P4W A;  1X3U A;  1BI3 A;  1G3T A;  4PCQ A;  4YFK F;  4HAM A;  3FM3 A;  1REP C;  4KDP A;  5HS9 A;  4RB2 C;  3FXU A;  1BC8 C;  3CO6 C;  1B9N A;  4O6J A;  4IVN A;  1KQ0 A;  2Y0M A;  2P5V A;  3H3Z A;  4Y13 A;  4XLN F;  3BOQ A;  1IXR C;  5F6F A;  3GEZ A;  4EMS A;  3P7N A;  4EJT A;  3V7S A;  4Q5S F;  1ZG1 A;  2HTJ A;  1BIB A;  3ZMU A;  5E1Z B;  2GAU A;  3BJO A;  3IRR A;  2VBW A;  4ENJ A;  4WWC A;  3F3X A;  3P9I A;  3R60 A;  3RPQ A;  3ZMZ A;  1R1U A;  4ETS A;  4GGG A;  2RQP A;  1U2W A;  3GVA A;  2AS5 F;  2KIF A;  2L01 A;  1Z9C A;  3BRO A;  5CJ9 A;  2UXX A;  4G6D A;  4R8H A;  2JT1 A;  2DPU A;  3EYI A;  3L9F A;  3HOT A;  4RB1 A;  1C0W A;  2Q8K A;  3LWF A;  1O7F A;  2PQ8 A;  3HTS B;  1LDJ A;  4IF4 A;  1ZRD A;  5J8C A;  1OYW A;  5LHH A;  1SFE A;  2O0Y A;  5LRR A;  3LQQ A;  5CVU A;  2R7F A;  4JQF A;  5D6E A;  5E18 F;  3M8F A;  4EJO A;  4JBA A;  3F8F A;  3PQK A;  1QGP A;  3MFK A;  3IL2 A;  3RKY A;  4GYI A;  4KFC A;  1T39 A;  5D5W B;  4CZZ A;  3WE3 A;  3JAM K;  2BEO A;  5IT9 Z;  3HHH A;  4L18 B;  5LHG A;  3TQN A;  4P9F A;  4MEX F;  2FBH A;  3ZN1 A;  3MWM A;  3E6B A;  2QWW A;  5HLG A;  2XAG A;  4L9N A;  1T2K A;  1J0R A;  3K1M A;  2STT A;  3E5U A;  2EV5 A;  3I59 A;  1T38 A;  2QLZ A;  4RS8 A;  3KLN A;  4OIO F;  3V4G A;  4A6D A;  2V6C A;  2ZCW A;  1YQA A;  2RV8 A;  2ZNZ A;  5LLQ A;  2HQR A;  3E6M A;  4HZF A;  1S7A A;  4YFN F;  2F5F A;  1KYZ A;  1Z7U A;  4L9V A;  3G73 A;  5HDG A;  1FWZ A;  3FF5 A;  2ZNY A;  1TLH B;  5HDK A;  4LB5 A;  1G3Y A;  3ERE D;  4Q4Z F;  1FSE A;  1IRF A;  1SD4 A;  1G4D A;  3MAJ A;  1BC7 C;  5CVJ A;  2CO5 A;  1DP7 P;  3E5X A;  3BPV A;  1VTN C;  1MDM B;  3FM5 A;  3BJA A;  4DQ2 A;  1BBY A;  1SFU A;  2DQL A;  2QUF A;  1GXP A;  1MD0 A;  1H9G A;  2M87 A;  3PFI A;  2VON A;  4G7O F;  1IAW A;  2IA2 A;  3WTS C;  5J8F A;  1XGN A;  1HKS A;  3RTR A;  1RI7 A;  4EM0 B;  4LG0 A;  3EDP A;  3FX3 A;  2D45 A;  2O61 A;  2M45 A;  1SD7 A;  2VXZ A;  4O5V A;  2LKP A;  3HSF A;  2W84 A;  2VN2 A;  4EJV A;  1FX7 A;  2QBY B;  4ASN A;  3CUQ B;  1ZRC A;  3F23 A;  1HKQ A;  2XAF A;  2K7L A;  4EJU A;  1ZYR F;  5ILV A;  1G3W A;  2KJB A;  3F6O A;  1UST A;  3JTH A;  4ENK A;  4LD5 A;  1YS6 A;  5K5R A;  4UHT A;  1ZAR A;  4O3M A;  3RPU A;  4JK1 X;  1ON2 A;  5IT9 K;  4LFU A;  4ZH4 F;  2QM3 A;  3E6C C;  4RGX A;  5DCM B;  3O2P E;  4RGU A;  3CUO A;  2V1U A;  3FWE A;  3CLO A;  1YW9 A;  2H09 A;  3HTU A;  4OU0 A;  1HST A;  2UXN A;  3WTW C;  4KIF A;  1E2X A;  4AIH A;  5JHU A;  3K1N A;  1O3S A;  1ZLK A;  5TJJ A;  4AIJ A;  3BZ6 A;  1LEB A;  4KIC A;  2CW0 F;  2E1N A;  3W6K B;  1XSX A;  2P5L C;  4S04 A;  4HQM A;  1R5H A;  4RAZ A;  2EFQ A;  4BNC A;  2F5E A;  4U7B A;  4UXN A;  3ZPL A;  4LMY A;  2L3D A;  1MKM A;  1CF7 A;  3VB2 A;  2NYX A;  4Q48 A;  2ZXJ A;  2VE8 A;  4S05 A;  4CHU A;  5HLH A;  3RYR A;  5L3C A;  1QQI A;  1OR7 A;  3B73 A;  2HKX A;  4OIN F;  3QAH A;  2NNY A;  3JTG A;  1QZZ A;  3L00 A;  2ZFW A;  2VBX A;  3GXO A;  2BYV E;  4F7Z A;  1SFX A;  2E7X A;  2JRT A;  5JVT A;  4CO8 A;  1O3R A;  3GFI A;  4L5J A;  2DT5 A;  1KQ8 A;  4LB6 B;  1YS7 A;  4OMZ A;  2L4M A;  2UZK A;  3QP6 A;  1FZP B;  1YO5 C;  4U88 A;  1ZG5 A;  4HV5 A;  2OQG A;  1EH7 A;  3WTY C;  4EJW A;  3EUH A;  4E70 A;  4RGS A;  1F4K A;  4M72 A;  2FXA A;  1LDD A;  1EH6 A;  1XMK A;  5AON A;  1RIO H;  1MGT A;  3R61 A;  1P4A A;  5BPI A;  3DFG A;  4KIB A;  4M6X A;  2KIM A;  4KNY A;  3BJ6 A;  2DTR A;  2K4B A;  5D4S A;  1U3E M;  4ESJ A;  3LAP A;  1ZGA A;  4M9X A;  1EH8 A;  3O3K A;  3Q5F A;  2Z9O A;  4N0B A;  1CGP A;  2DPD A;  2ESN A;  1FT9 A;  1W5T A;  3T0Y A;  1H0M A;  3U9G A;  4XSX F;  1ZN2 A;  3F6V A;  3NRV A;  2QBY A;  4UVC A;  3CUQ C;  4UVA A;  1IUY A;  2VOP A;  5AIP A;  3KE2 A;  3DF8 A;  2Z3Y A;  3C1D A;  1BI2 A;  3LAJ A;  2A68 F;  3RYP A;  1MJA A;  4QWQ A;  2EFW A;  5F1R A;  1UB9 A;  1WQ2 A;  2Q2E A;  2RKH A;  3WGH A;  1LDK B;  3CJN A;  2FEZ A;  5H6R A;  1R58 A;  4A0Z A;  1T0F A;  2W25 A;  3CUQ A;  3S2W A;  1YYV A;  3HSE A;  1UCR A;  3MEX A;  3TGN A;  3L2C A;  1E17 A;  2FQ3 A;  2GZW A;  2GA1 A;  1IXC A;  4OMY A;  3QPH A;  2P7C B;  5FGM A;  3JW4 A;  1IN6 A;  3KP4 A;  5LEJ A;  3KP3 A;  5LGT A;  1AOY A;  3KP2 A;  1TW2 A;  2RGV A;  2FNA A;  2MC3 A;  4MEY F;  5F64 A;  2HOE A;  4AIK A;  5DD4 A;  1P6R A;  1B4A A;  5IT3 A;  2CGP A;  4CGZ A;  1Z91 A;  4YIF A;  2J5P A;  2OA4 A;  1FBS A;  3IKV A;  3E6D A;  3HRS A;  4OIR F;  3DPL C;  3WU0 A;  2PFB A;  1R22 A;  3K69 A;  1F5T A;  4KIG A;  4UV8 A;  3VOD A;  3TKY A;  2P6S A;  5K1Y A;  2PN6 A;  1WKM A;  2O8X A;  4TV7 A;  3ZMV A;  2HFH A;  1DPU A;  1PUE E;  4BQA A;  2ZJ2 A;  3MCZ A;  1BN5 A;  4HYE A;  1ZRF A;  2ZKZ A;  1SMT A;  3KFW X;  4P9U A;  4M74 A;  2ZME A;  2PLY A;  3ZQ7 A;  4R79 A;  4WXC A;  4YII A;  4U7D A;  3C7J A;  5BS6 A;  2PI0 A;  1YTY A;  1GHC A;  2M1B A;  3B02 A;  3TDZ C;  4UVB A;  2OD5 A;  1TW3 A;  4M71 A;  3I58 A;  3SQN A;  4HLX A;  4BHB A;  3K1P A;  1RUN A;  3REO A;  2XAS A;  3NQO A;  4ZYG A;  3CTA A;  2EB7 A;  2E7W A;  5J6X A;  1D8K A;  2STW A;  2PJP A;  3WTT C;  2PMH A;  1TNT A;  2OZ6 A;  5DUI A;  4PDK A;  4ON0 A;  4ENN A;  4GXO A;  1DDN A;  5K5Q A;  1K6O A;  2IP2 A;  3QRF F;  2MH2 A;  2RC4 A;  3E97 A;  3R6S A;  2A5Y B;  4HF1 A;  4HOB A;  3P9C A;  3GLX A;  3F8N A;  1HXD A;  3BP8 A;  2GXB A;  1FYL A;  4FT8 A;  1FP2 A;  4B8X A;  4M73 A;  2P4W A;  1KA8 A;  1GXQ A;  2D2W A;  3FMR A;  2P6T A;  2GXG A;  2LF8 A;  4FX4 A;  4UNO A;  1OYI A;  3F22 A;  2V79 A;  2XKP A;  3GFL A;  2MA3 A;  3M1E A;  2VOD A;  4PGH A;  3ZN0 A;  1S8N A;  2EK5 A;  2OZU A;  3LA7 A;  2CYY A;  3L09 A;  4KMU X;  1W7P D;  2QYO A;  3MZH A;  1XSD A;  2IVM A;  2VT3 A;  3I5U A;  3IHU A;  3HOS A;  2V9V A;  1WWX A;  2R7D A;  2XAJ A;  3M7G A;  2L4A A;  4IHT A;  4LK1 F;  5BQT A;  4MQV A;  3WGG A;  2XAQ A;  5HVQ C;  2FOK A;  5HDN A;  1TQI A;  1O3T A;  1PP8 F;  5L3E A;  4L0Z B;  3KLO A;  5E17 F;  1O7L A;  3LA2 A;  1U8R A;  5HLI A;  1QZY A;  2P7V B;  4XSZ F;  4N9H A;  1U5T B;  3H92 A;  3I53 A;  4CDG A;  1XDS A;  2EA2 A;  4B09 A;  2ISY A;  1ZG3 A;  3RI4 A;  2HZT A;  3VOE A;  5L3B A;  1P92 A;  3LFK A;  1IN5 A;  3GWZ A;  5DYM A;  1Z6R A;  4A0X A;  3Q9S A;  5D8K B;  3MQ0 A;  1J7K A;  2DW4 A;  4RB3 C;  2MBF A;  4KT5 C;  3V8J A;  3V7C A;  3TOB A;  3ROU A;  3PQJ A;  5CVV A;  2PBI A;  1BOA A;  4A5M A;  3DQV C;  3E5Q A;  2G7U A;  3ISP A;  3M8E A;  3C3W A;  3K9T A;  1UFM A;  2DFI A;  1IN4 A;  3RDI A;  3HIF A;  3KET A;  5LHI A;  5D8L B;  3JAM Z;  5EEH A;  1G6N A;  1MJ9 A;  4EVI A;  4QLC U;  1AWC A;  2RDP A;  2JTV A;  3GZ6 A;  4DNC A;  3CDH A;  1KU9 A;  2WV0 A;  3KEO A;  5ILS A;  1ON1 A;  3WU1 B;  4NB5 A;  1D3Y A;  3LST A;  2FMY A;  1U5T A;  4EQQ A;  3F8M A;  4WF2 A;  1D5V A;  3BY6 A;  2DK5 A;  3HRM A;  1F9N A;  4UV9 A;  3Q9V A;  2HKO A;  2XRN A;  2GIV A;  3EYY A;  2EFO A;  1FNN A;  1V4R A;  2A6E F;  4HX4 A;  3WTU C;  2KRF A;  1FYM A;  5FFX A;  3T1B A;  2LDU A;  2DAO A;  4U0Y A;  2XGX A;  2VOO A;  1V3F A;  3SHF A;  5L3D A;  5ERI A;  3GF2 A;  3J81 Z;  1YW8 A;  1OKR A;  2L02 A;  4MQ9 F;  1I6X A;  4G7Z F;  1IW7 F;  4Z2Y A;  1UHM A;  2GA2 A;  4IHS A;  4HW0 A;  4HX8 A;  3JSP A;  2CQK A;  4AD9 A;  3DXJ F;  2FML A;  4FHT A;  2E1C A;  3RIR A;  3V8K A;  4A0Y A;  5TRD A;  1ZRE A;  2NS0 A;  1I1G A;  4WK8 F;  1ZHF A;  3GO5 A;  4MGR A;  2KIU A;  1KU7 A;  2MLK A;  4XBF A;  4CYD A;  1Z05 A;  2NRA C;  1XMA A;  3I54 A;  1XGO A;  4WCG A;  3T5X A;  1IXS B;  5DD8 A;  1U5T C;  2VBY A;  1SAX A;  1JE8 A;  2A3S A;  2XRO A;  4BAY A;  3J7A O;  2K4J A;  1S7O A;  4HDV A;  5CLS A;  3TDU C;  3ABT A;  1I27 A;  3HRU A;  3BPX A;  3DV8 A;  2QQB A;  4HLY A;  2ELH A;  4BYY A;  1LNW A;  2EFP A;  1BIA A;  1SD6 A;  4OOI A;  2H94 A;  1K79 A;  1QO0 D;  2IT0 A;  1QPM A;  5CYV A;  1SMY F;  2FSW A;  2YPR A;  4Q47 A;  2Y75 A;  3H3U A;  1IRG A;  3M9A A;  5DCF A;  4HDU A;  2VBZ A;  2B0L A;  2LSO A;  1BM9 A;  4G8X A;  3WTZ A;  5L3F A;  1I1S A;  1YLF A;  4KMF A;  3CO7 C;  5LGU A;  4HV6 A;  2XUB A;  5JI6 A;  2QQ9 A;  1KYW A;  1HW2 A;  3RKX A;  3ECH A;  1TNS A;  1OMI A;  4XLP F;  1ZGJ A;  1Z6T A;  2DO7 A;  2YU3 A;  4GO1 A;  1K78 A;  3V7R A;  1J5Y A;  5L3G A;  2VT2 A;  4LLL A;  4IRG A;  3K0L A;  4R1H A;  3D0S A;  4WXD A;  3GW2 A;  3P9K A;  4A6E A;  3I4P A;  2FE3 A;  2IA0 A;  2JZY A;  3QU6 A;  2M5W A;  3HHG A;  1USS A;  3TO6 A;  1MDM A;  4HF2 A;  4AWX B;  2Q0O A;  2NNN A;  1QBJ A;  1U6G A;  4CIC A;  3I59 B;  4MTE A;  5BMZ A;  1G3S A;  2ADU A;  3KEQ A;  3VFZ A;  3OOP A;  2H6B A;  4D0P A;  1K78 B;  2A6H F;  2HR3 A;  2HS5 A;  1FP1 D;  1R00 A;  3J81 K;  1B59 A;  3TOA A;  1KQ9 A;  2O3F A;  4L5I A;  3N4M A;  4BH9 A;  5D5V B;  1ONV A;  1TQP A;  2CSO A;  1OPC A;  3EET A;  5D5U B;  4Y15 A;  1L0O C;  2J5O A;  2UWM A;  4HA8 A;  1HQC A;  1ZLJ A;  3KP7 A;  4OIP F;  2FBI A;  2YX4 A;  4EV0 A;  4BXU A;  2M8E A;  2R3S A;  2EFN A;  4NHJ A;  1P2F A;  2HYG D;  5HS8 A;  3RKW A;  2M30 A;  1F1Z A;  5A2Q Z;  1D8J A;  3IKT A;  1HW5 A;  2XKO A;  2ISZ A;  1TBX A;  4ZYE A;  3NEU A;  2ESH A;  4MTD A;  2LNB A;  3L7W A;  1QNT A;  1IZ1 A;  2DBB A;  1BJA A;  3VEP A;  1XCV A;  2BBY A;  3OV8 A;  3SZT A;  3ECO A;  3LA3 A;  5FO5 A;  3J80 K;  3F8C A;  2HEO A;  2D1V A;  1XGM A;  3KZY A;  2K86 A;  3ELK A;  3QOP A;  1U78 A;  2OAZ A;  1B9M A;  5FLX K;  5DCM A;  2BV6 A;  1HKT A;  4LLN A;  4L0Y B;  5E1W A;  1JGS A;  1BI0 A;  5E20 A;  2MLG A;  1ULY A;  3RJP A;  1ODD A;  1Y0U A;  2MH9 A;  1IN7 A;  1YW7 A;  1LEA A;  4I01 A;  3F21 A;  2Z5U A;  2Z33 A;  2QVO A;  5EEG A;  2X0L A;  4OIQ F;  5E8I A;  3KZZ A;  3WTV C;  1YIO A;  1R36 A;  2QQA A;  5CVI A;  2CWE A;  2YR2 A;  3WOD F;  3WTX C;  4A2U A;  4G94 A;  3T8T A;  4ZYH A;  2FNP A;  1YFH A;  2HDC A;  4EM2 A;  2W57 A;  1LJ9 A;  1JXS A;  4IPA A;  1FPQ A;  2A61 A;  4IXA A;  5D5X B;  1WRJ A;  1H9T A;  2L54 A;  2DU9 A;  3ULQ B;  1R1V A;  3HUG A;  1KU3 A;  4LG0 B;  2FA5 A;  4L9T A;  5H6Q A;  5DDG A;  4CXF A;  2G9W A;  5BOX A;  4I0A A;  2YSR A;  2CFX A;  1TQM A;  2IW5 A;  3KP6 A;  3TO9 A;  1R1T A;  1IN8 A;  5FLX Z;  2XVC A;  3W6J B;  4WX9 A;  3GZ5 A;  4RAY A;  4P55 A;  1W7P A;  2IRF G;  4LJZ F;  2A07 F;  4P5O A;  1OYY A;  4FX0 A;  3TO7 A;  1S29 A;  1B6A A;  5FB2 A;  3FXR A;  3D5L A;  1XD7 A;  3KCC A;  4IJA A;  5DUK A;  5ICC A;  3FMQ A;  5LEK A;  3EQL F;  4I2O A;  3O6B B;  1LB2 A;  2K02 A;  2QZ8 A;  2ZME B;  4RGR A;  2XV4 S;  4ESF A;  1WI9 A;  4IRI A;  2GQQ A;  4BHP A;  1FBU A;  3F8B A;  1ZAO A;  3DPT A;  5BPD A;  4HBL A;  2VE9 A;  1R5G A;  4UUV A;  4PZJ A;  5A2Q K;  5JR3 A;  2G7H A;  1R7J A;  4U0V A;  2FU4 A;  2XIG A;  1B1B A;  1RUO A;  2COM A;  1O57 A;  1P4X A;  2EV0 A;  4I09 A;  1FY7 A;  4WXH A;  5HS7 A;  2XAH A;  3LQR A;  2IPQ X;  3HSR A;  2ZO4 A;  1RNL A;  3IWF A;  5E1X A;  1FBQ A;  2EA4 A;  4HQE A;  5JFR A;  4GYG A;  4Y17 A;  1DUX C;  3IRQ A;  2RNJ A;  2HTS A;  4I0B A;  1T98 A;  4ENM A;  3QU3 A;  1XCB A;  3ML6 A;  2Y48 A;  1XSV A;  1J2X A;  1O3Q A;  2PMU A;  2ZBK A;  1I5Z A;  2D1H A;  3FMS A;  2Z99 A;  3DEU A;  4EGY A;  1JHH A;  4BHC A;  2H6C A;  5CVR A;  2VC1 A;  5HOO A;  3U1D A;  5LRS A;  4G7H F;  4A12 A;  3JSO A;  1J75 A;  3C18 A;  3N97 A;  2W85 A;  1Q1H A;  1XB4 A;  1XN7 A;  4MNU A;  4MHG A;  4LLG F;  1EV7 A;  3I0T A;  1HSJ A;  1S3J A;  3R0J A;  3ABU A;  3MZY A;  4M6Y A;  4I02 A;  2FBK A;  1BI1 A;  3FHZ A;  1L3L A;  2KJC A;  1S6L A;  1XGS A;  2MD5 A;  1W5S A;  3DP7 A;  4ZZD A;  4AVP A;  5ILU A;  3AAF A;  3FZV A;  1KU2 A;  1W4M A;  1RZ4 A;  2H27 A;  3BDD A;  2DLL A;  4RB0 A;  2F5C A;  4H0E A;  4I98 B;  1UHW A; 
#chains in the Genus database with same CATH topology
 1UEL B;  1HOM A;  1T6S A;  2R5Y B;  1FSH A;  3BWG A;  3HC7 A;  3NWS A;  4A3F J;  2DA4 A;  2XHK A;  4KN4 X;  1JUP A;  3S2H J;  5FFZ A;  5LGN A;  3E3V A;  3NWT A;  4L9J A;  2MGQ A;  1RKT A;  4I7H A;  3DU5 A;  2VC0 A;  3WE2 A;  3ZMS A;  4YFX F;  1IC8 A;  3HRT A;  2P8T A;  3ZP5 A;  3GFJ A;  3S3O A;  3QP5 A;  3PJR A;  5LFA A;  2P5K A;  2LBF B;  3OS2 A;  2LRE A;  2JQ7 A;  3LSI A;  4V19 K;  2OQR A;  1X1C A;  3K2Z A;  5D4R A;  5J1R A;  1K83 J;  1MJB A;  3WGI A;  1MMD A;  4FTH A;  2Q2E B;  1JT0 A;  4J01 A;  6PAX A;  1EJ9 A;  4E7H A;  1R23 A;  3A0H C;  2IA1 A;  1BA5 A;  3OYL A;  1MZB A;  4M3G A;  5K7H A;  2JSC A;  2DI3 A;  1SD5 A;  4LOC A;  3BG9 A;  1WSU A;  1NHA A;  1Z1D A;  2HU9 A;  5DM6 F;  1U9N A;  2K27 A;  4KIT B;  1HW1 A;  2YX7 A;  3M3Y J;  5KK1 A;  3OYB A;  5K5O A;  3HYI A;  1LVA A;  2R7W A;  4EM1 A;  5AIQ A;  4X1E A;  2O03 A;  3G3Z A;  5ICF A;  3GTM J;  3GFM A;  2TDX A;  1MSF C;  2DDA A;  3FXQ A;  2OBP A;  4CCJ A;  4RM3 A;  1MH4 A;  5FD5 A;  3GX4 X;  1J59 A;  2WC2 A;  3ZMD A;  3CCQ I;  3R4K A;  2R5Z B;  1AA7 A;  3W2W A;  4ESB A;  4DBQ A;  2KKO A;  2BY1 A;  2R7V A;  5M5W J;  3CDI A;  2OU2 A;  5D6F A;  3U2R A;  2ZJP F;  3BQY A;  1D1A A;  3R0A A;  2JPC A;  4M3E A;  2CG4 A;  1IF1 A;  3BG3 A;  1HBX G;  1PDN C;  1KGS A;  1YG2 A;  4LK0 F;  2EV6 A;  2W24 A;  4LG3 A;  4PGG A;  3TMO A;  3VSL A;  4KN7 X;  4ZYA A;  5ED4 A;  2ECC A;  1PP7 U;  4CYC B;  2ACJ A;  4HPQ A;  4NQW B;  4YG2 F;  4D1Q A;  1OCC H;  4N9I A;  4PUS A;  4G6Q A;  2CMP A;  2JVH A;  2LF7 A;  3VDX A;  4BE2 A;  1RR7 A;  1FEX A;  2DA6 A;  4Y33 A;  3DEE A;  1J9I A;  3SFZ A;  5KAF C;  5LBQ A;  3KP5 A;  3FDY A;  1AKH B;  4KA4 A;  2FRH A;  2FUG 2;  2EWN A;  1FOX A;  4C9Y A;  2WWY A;  2NVQ J;  2HGC A;  3IC7 A;  1ETO A;  4QPO A;  4ZDL A;  5KVR A;  5FD6 A;  3CQZ J;  1K7A A;  1S7E A;  1SVO A;  1B8I B;  4XRF A;  4V2G A;  2BGC A;  1FOK A;  2M34 A;  4ZTF A;  2HVQ A;  4Q5S F;  4N4O B;  3OSF A;  4KUM A;  4Y4R A;  3FBI B;  1R5I D;  2IJL A;  2LD5 A;  1T56 A;  1TTY A;  3GUD A;  2EJR A;  4BE1 A;  1ETK A;  3DPU A;  2KRC A;  3U21 A;  3SXY A;  3OIO A;  4U0W A;  4ZZL A;  1JHF A;  5FRO A;  4ZYD A;  1A04 A;  4HF0 A;  3ZXS A;  5DM7 F;  1S9H A;  3OMY A;  4IRH A;  3I71 A;  3T8R A;  5H20 A;  2WA0 A;  2EIM H;  4KT6 A;  1OFC X;  2GWR A;  2V7F A;  4A3C J;  2V1X A;  2E5Z A;  1DPR A;  2AXL A;  1XPX A;  1MNE A;  5JLX A;  4G6T B;  1STZ A;  3ZMT A;  5DEQ A;  4G9Y A;  2IGN A;  4A5N A;  2VLA A;  3F72 A;  1FC3 A;  2V1D A;  4HX7 A;  1JT6 A;  2BE5 F;  1ZH5 A;  3GTL J;  2DCE A;  2HQN A;  3SZP A;  4BXX J;  2F2E A;  2PEX A;  2BVM A;  4XR6 A;  4NQW A;  3S3N A;  2DA2 A;  2VJ5 A;  3V8L A;  1W7P B;  1XDU A;  5DV5 A;  3JR9 A;  1FYK A;  3J80 Z;  3ABM H;  5EZG A;  5ICG A;  2NAZ A;  1J09 A;  1I50 J;  2WTE A;  3CCS I;  3NAU A;  3IWZ A;  3OL4 A;  3COA C;  4RAF A;  4EEF G;  2E35 A;  2RVC A;  3HBL A;  2M8G X;  4KYW A;  1GVJ A;  4M9S A;  1FLI A;  4P96 A;  2B9S A;  3GTK J;  3A0B C;  4EGZ A;  3DKW A;  3IP4 B;  2GOM A;  2VKE A;  2DK8 A;  3OWT A;  2X4H A;  3I64 A;  4E7Z A;  2F5D A;  2HWV A;  5IY5 H;  3WG9 A;  2ETH A;  2A69 F;  4GCV A;  1LQ1 A;  5E8G A;  4K2E A;  3QPT A;  2VB6 A;  2QEN A;  4LGW A;  4BDZ A;  1Z0X A;  3GYH X;  2C6Y A;  3QYE A;  1SC7 A;  2PG4 A;  3HKZ N;  2JMW A;  4M9Z A;  2ZXH A;  1CF7 B;  2EBI A;  2HYF A;  2RN7 A;  2JPB A;  2FF4 A;  1ZK8 A;  5ICE A;  1IRX A;  2O6G E;  2DQR A;  1P4W A;  5TGT A;  1X3U A;  1BI3 A;  2EIN H;  1G3T A;  4PCQ A;  5F0C A;  2P0W A;  4YFK F;  4HAM A;  4XN0 A;  1ZR2 A;  2Z16 A;  1RC9 A;  3FM3 A;  2BOL A;  4A3L J;  1REP C;  1WZ2 A;  1D0X A;  4KDP A;  5HS9 A;  1WVR A;  3LSK A;  4RB2 C;  2X6Y A;  3FXU A;  1BC8 C;  3U1K A;  1FJL A;  3SFI A;  2HNH A;  4BUP A;  3CO6 C;  2I8D A;  1BL0 A;  1B9N A;  4O6J A;  4IVN A;  2WAD A;  1KQ0 A;  2Y0M A;  2P5V A;  3H3Z A;  4Y13 A;  3HDD A;  4XLN F;  1YI2 I;  3CC4 I;  3BOQ A;  5KCM A;  2HQA A;  4MFE A;  3GTQ J;  1DGW Y;  2WAQ N;  1IXR C;  1YOV B;  5F6F A;  2R7R A;  1JKR C;  3GEZ A;  4EMS A;  3S1R J;  1JTX A;  4NDL A;  3P7N A;  4EJT A;  3V7S A;  2EZL A;  3ABK H;  3ZQF A;  3H5A A;  2O5R A;  2FJ1 A;  1ZG1 A;  2DJI A;  2HTJ A;  1BIB A;  2DOE A;  2EH3 A;  3ZMU A;  5E1Z B;  4F93 B;  2OJE D;  2GAU A;  4H4K C;  3BJO A;  1WJE A;  5FRM A;  3IRR A;  2VBW A;  3LSP A;  4ENJ A;  4A3J J;  2IGO A;  4WWC A;  3KEY A;  3F3X A;  3P9I A;  4XKV A;  3R60 A;  3RPQ A;  3ZMZ A;  1R1U A;  3JRG A;  5E3O A;  4IOC F;  4ETS A;  4GGG A;  2LK2 A;  2NS8 A;  2RQP A;  3FXL A;  2PJR A;  1U2W A;  3GVA A;  4E7J A;  2XAU A;  2AS5 F;  2KIF A;  2DFH A;  2L01 A;  1Z9C A;  1IV6 A;  3BRO A;  2A5W A;  3K4L A;  2UXX A;  5CJ9 A;  3MMY B;  3UR3 C;  4G6D A;  3H36 A;  2CW8 A;  4R8H A;  2JT1 A;  2DPU A;  3EYI A;  2M4K A;  2OPT A;  3L9F A;  3HOT A;  3OYA A;  4RB1 A;  2NVU B;  2K3P A;  1C0W A;  2Q8K A;  2XC7 A;  3LWF A;  1N25 A;  1O7F A;  1XC5 A;  2PQ8 A;  4ZC3 A;  2XPU A;  1X3Z B;  3GTG J;  3HTS B;  1I39 A;  1LDJ A;  1JUS A;  4IF4 A;  1MSE C;  1ZRD A;  5J8C A;  2KFD A;  2DMT A;  1OYW A;  5LHH A;  1SFE A;  2KPM A;  1RES A;  2O0Y A;  1AU7 A;  2O9L A;  3HPG A;  5LRR A;  5F1J A;  3LQQ A;  5CVU A;  4LIU A;  2R7F A;  4JQF A;  5D6E A;  1W0T A;  5E18 F;  1W0U A;  1TWF J;  5J47 A;  3M8F A;  4EJO A;  5F27 A;  4JBA A;  4YIR X;  3F8F A;  2BHZ A;  1FIP A;  3PQK A;  3L2U A;  1YHQ I;  2R7S A;  1QGP A;  3MFK A;  3IL2 A;  2QSH X;  3RKY A;  4GYI A;  4KFC A;  1TC3 C;  1T39 A;  2BVL A;  5D5W B;  3G2B A;  4CZZ A;  3WE3 A;  2GXA A;  3JAM K;  1MNM C;  3PO3 J;  2BEO A;  2WB1 N;  1NK2 P;  5IT9 Z;  3CCV I;  3HHH A;  1W36 C;  4L18 B;  5LHG A;  1A6Q A;  4NC8 A;  3TQN A;  4P9F A;  4MEX F;  2FBH A;  2DOD A;  2M0M A;  3ZN1 A;  3DKY A;  2FX0 A;  3MWM A;  2CV2 A;  3E6B A;  3LSH A;  1E0E A;  3A4C A;  2QWW A;  5HLG A;  2XAG A;  2LP0 A;  4L9N A;  1T2K A;  1J0R A;  3K1M A;  2STT A;  3HOU J;  1SAU A;  3E5U A;  5E3N A;  1JKO C;  1WH7 A;  2EV5 A;  3K4K A;  3I59 A;  4C2T A;  4XKC A;  1T38 A;  2QLZ A;  4RS8 A;  4QTR A;  3M1C A;  1ZTR A;  3KLN A;  4A69 C;  3I4N J;  4OIO F;  5CPR B;  3V4G A;  3TED A;  4JYK A;  3IAM 2;  4B44 A;  4A6D A;  1EKE A;  2V6C A;  2ZCW A;  1YQA A;  3HPH A;  4PK4 A;  2RV8 A;  1LE8 A;  2BW3 A;  1OCP A;  2ZNZ A;  4AYB A;  2HQR A;  3E6M A;  5LLQ A;  1RPW A;  4Y7N J;  4HZF A;  4HRI A;  1BR4 A;  4XLA A;  4A93 J;  1S7A A;  1VQ7 I;  3P5J A;  3B6A A;  4IHY A;  5CQG A;  4YFN F;  2F5F A;  1KYZ A;  1Z7U A;  1H89 C;  3BG5 A;  5BNG A;  4CZC A;  1Y6I A;  2X1C A;  4L9V A;  2L7F P;  5HDG A;  1FWZ A;  1YX3 A;  3G73 A;  3HEF A;  3LFU A;  3FF5 A;  2QSF X;  2ZNY A;  1TLH B;  5HDK A;  2XPW A;  4LB5 A;  1G3Y A;  3ERE D;  4Q4Z F;  1FSE A;  2N8G A;  4PFP A;  1IRF A;  3AG2 H;  1QHG A;  3BTC A;  3HKZ A;  5KAI C;  1SD4 A;  1G4D A;  5CQE A;  3MAJ A;  4ZDO A;  1BC7 C;  5CVJ A;  2CO5 A;  1DP7 P;  2NOG A;  3E5X A;  3BPV A;  3TBI A;  1VTN C;  1MDM B;  2DXI A;  4ABZ A;  1U8B A;  2L9S A;  3RSN A;  1R9T J;  2PMZ A;  3FM5 A;  3BJA A;  4DQ2 A;  2JA7 J;  3D5S C;  3QYB A;  1BBY A;  2JVG A;  1SFU A;  2DQL A;  1T08 B;  1G59 A;  1I6H J;  2VUM J;  2QUF A;  5DTD A;  3S16 J;  1GXP A;  5C4J J;  4MO7 A;  2EIJ H;  2VPL A;  1MD0 A;  4ANJ A;  3FKJ A;  2W7N A;  4AID A;  1SVL A;  1H9G A;  2L7Z A;  2M87 A;  3C2G A;  5F0H A;  3PFI A;  2VON A;  3KIO A;  3ZQL A;  2LY2 A;  3AKZ A;  3H9Q A;  4G7O F;  2NS7 A;  1IAW A;  2IA2 A;  4HSR A;  3M4O J;  3WTS C;  5J8F A;  2VKV A;  4MFD A;  1XGN A;  4JX6 A;  1HKS A;  1PVE A;  2IAI A;  1RI7 A;  3RTR A;  2JWT A;  4EM0 B;  1X1B A;  3HOX J;  4LG0 A;  4C2M J;  3EDP A;  2ME0 A;  3FX3 A;  3TP3 A;  2D45 A;  2O61 A;  2BXY A;  2M45 A;  1SD7 A;  2KQR A;  2VXZ A;  4O5V A;  2LKP A;  3HSF A;  2DA7 A;  2W84 A;  1A5J A;  3JRA A;  2VN2 A;  2CJJ A;  4EJV A;  1FX7 A;  2QBY B;  4ASN A;  1WJD A;  4RM2 A;  3CUQ B;  1ZRC A;  3F23 A;  1HKQ A;  2XAF A;  1SFK A;  2K7L A;  4EJU A;  1ZYR F;  1YRN A;  2VJ4 A;  1ZR4 A;  4DYC A;  4HNV A;  5ILV A;  4FQG A;  1G3W A;  1HLV A;  2KJB A;  3F6O A;  1UST A;  2CV0 A;  3JTH A;  2ZB9 A;  4ENK A;  4LD5 A;  3E0J B;  2H1L A;  1YS6 A;  5K5R A;  4UHT A;  4M3D A;  1ZAR A;  4O3M A;  3ZRG A;  3RPU A;  5B5E C;  4D5C A;  2QKL B;  4JK1 X;  3S15 J;  1ON2 A;  5IT9 K;  2HOS A;  4LFU A;  4ZH4 F;  2QM3 A;  3E6C C;  3RQ4 A;  1R4N B;  4RGX A;  5DCM B;  3O2P E;  2WV1 A;  4RGU A;  1JJ8 C;  3CUO A;  2V1U A;  2GIZ A;  3FWE A;  4OWR B;  3CLO A;  4NC6 A;  1YW9 A;  3S8P A;  3HOY J;  2R7T A;  2H09 A;  2Y0S N;  4DZJ A;  1E3P A;  3HTU A;  4OU0 A;  1HST A;  5H2F C;  1VQM I;  2UXN A;  4DYR A;  3K4M A;  5EZH A;  4KIF A;  3WTW C;  2QGU A;  1E2X A;  4AIH A;  5JHU A;  3K1N A;  1O3S A;  1ZLK A;  5TJJ A;  4B43 A;  3H0G J;  3L1P A;  4AIJ A;  3BZ6 A;  4DZP A;  3SYT A;  1LEB A;  5EDN A;  4KIC A;  2CW0 F;  1UAA A;  2E1N A;  1VQ6 I;  2HVS A;  3OYD A;  2QKM B;  1V54 H;  3DCF A;  3W6K B;  1XSX A;  3KX2 A;  4A3M J;  4BU2 A;  2P5L C;  3VYU B;  4S04 A;  1TZL A;  2KZV A;  4HQM A;  4Z6Y A;  1R5H A;  3HGY A;  4RAZ A;  2EFQ A;  2XSD C;  4F92 B;  4BNC A;  3PNT A;  2F5E A;  4U7B A;  3TW7 A;  4UXN A;  3ZPL A;  4LMY A;  5F04 A;  2L3D A;  2Z1D A;  3GTO J;  1MKM A;  2EIK H;  4PJL A;  1CF7 A;  2WB1 A;  3BG7 A;  3CD6 I;  3HM5 A;  1HDD C;  3VB2 A;  2CUJ A;  4ZJZ A;  3ESW B;  2NYX A;  4Q48 A;  2HQ5 A;  4I99 C;  2ZXJ A;  5FKO A;  2VE8 A;  2CS3 A;  4II3 A;  2HDW A;  4S05 A;  4CHU A;  1TT5 B;  5HLH A;  2F4I A;  1ETQ A;  3C2H A;  3RYR A;  5L3C A;  2VAS A;  4BQO A;  2ZME C;  3PIP F;  2LMD A;  1QQI A;  1OR7 A;  3B73 A;  2HKX A;  5FJ8 J;  1V5F A;  3DTE A;  4D9J A;  1HDP A;  2K85 A;  4OIN F;  5B66 C;  1SFO J;  3QAH A;  2NNY A;  2XGD A;  3JTG A;  2BHY A;  2X6X A;  1QZZ A;  2VPR A;  3L00 A;  3KYC B;  2ZFW A;  2VBX A;  3GXO A;  1D5Y A;  2BYV E;  2LVS A;  4F7Z A;  1E3H A;  3JCU C;  1SFX A;  2E19 A;  2E7X A;  2JRT A;  1LVK A;  3IH4 A;  3MVP A;  5JVT A;  1FIA A;  4CO8 A;  1O3R A;  3QOD A;  1DU0 A;  3GFI A;  4L5J A;  2DT5 A;  4A3D J;  1KQ8 A;  3KYD B;  4LB6 B;  1YS7 A;  1X2N A;  4KJZ A;  4OMZ A;  2L4M A;  2V9K A;  3BQZ A;  2UZK A;  3QP6 A;  1FZP B;  1YO5 C;  4BAC A;  4IHX A;  3TL4 X;  4U88 A;  1QU3 A;  1ZG5 A;  3OYE A;  4HV5 A;  2OQG A;  2K9S A;  1EH7 A;  3WTY C;  4EJW A;  3EUH A;  4E70 A;  4BS9 A;  1BW5 A;  4XLH A;  4RGS A;  4IOA F;  3OYG A;  3SZG A;  2R7U A;  3G1O A;  1F4K A;  4M72 A;  2FXA A;  3SJM A;  1LDD A;  4GFB A;  1EH6 A;  3JRF A;  1XMK A;  3DEW A;  2VKH A;  4XKW A;  4IHW A;  1M1E B;  5AON A;  2V26 A;  3RQI A;  1RIO H;  1MGT A;  4DYQ A;  3R61 A;  2YUS A;  2E34 A;  1GV2 A;  1P4A A;  5FLV A;  5BPI A;  2LOO A;  3DFG A;  3ZGK A;  4IQJ A;  4KIB A;  4M6X A;  2ZJQ F;  2KIM A;  2R5Z A;  3KZI C;  4KNY A;  3BJ6 A;  1OCT C;  2EZI A;  2BY2 A;  2DTR A;  2HPM A;  2K4B A;  3VYS B;  5D4S A;  2ZXW H;  1U3E M;  3BR3 A;  4ESJ A;  1FOY A;  1VQN I;  2PMZ N;  3ZQC A;  2DFF A;  1ZQ3 P;  1P9Q C;  3S17 J;  3LAP A;  1ZGA A;  1D0Z A;  1VZ0 A;  2F6C A;  4M9X A;  4C3J J;  1EH8 A;  3O3K A;  3Q5F A;  1FTT A;  2Z9O A;  4N0B A;  1CGP A;  2DPD A;  2ESN A;  4QSH A;  1FT9 A;  1GDT A;  1MW7 A;  1W5T A;  3T0Y A;  4UY8 I;  1H0M A;  2CQ7 A;  1XMX A;  3U9G A;  4XSX F;  3VPR A;  3CCU I;  4XNF A;  1X2M A;  1ZN2 A;  2DA3 A;  5B1A H;  4FCY A;  1VQK I;  2I10 A;  4E7K A;  3F6V A;  3NRV A;  2QBY A;  4UVC A;  3CUQ C;  4UVA A;  1IUY A;  2VOP A;  5AIP A;  3KE2 A;  4YRV A;  2X6O A;  3DF8 A;  2OCC H;  2Z3Y A;  3C1D A;  1BI2 A;  1RET A;  3JRI A;  2L2O A;  5HNH A;  3LAJ A;  2A68 F;  2VI6 A;  2LC2 A;  2YU9 J;  3RYP A;  2ZXI A;  4XN3 A;  2JRM A;  4XRS A;  2OV7 A;  1MBG A;  1MJA A;  4IZZ A;  2K9L A;  2LTP A;  3V42 A;  1IGN A;  1GLN A;  4AYB N;  4QWQ A;  2EFW A;  5F1R A;  1UB9 A;  3CCR I;  1MBF A;  3K70 C;  2L9N A;  5M5Y J;  1WQ2 A;  4L5E A;  2Q2E A;  3W2A A;  3OYK A;  1OLT A;  4M3F A;  2RKH A;  2ZFU A;  3WGH A;  1LDK B;  2R5Y A;  3CJN A;  3QQA A;  2FEZ A;  5H6R A;  1R58 A;  4A0Z A;  2DYR H;  5CKT A;  1ERD A;  1T0F A;  1Y8Q B;  2W25 A;  4BE0 A;  3CUQ A;  3S2W A;  2PJR B;  1TWG J;  1YYV A;  3HSE A;  1UCR A;  3MEX A;  4MLO A;  3TGN A;  5GAG J;  3L2C A;  3CJQ B;  5C44 J;  1E17 A;  2FQ3 A;  2GZW A;  2GA1 A;  4DIQ A;  2NVT J;  1IXC A;  4OMY A;  2M0C A;  3QPH A;  2P7C B;  5FGM A;  1CQT A;  3JW4 A;  2MSY A;  1IN6 A;  3KP4 A;  5LEJ A;  3OS0 A;  3KP3 A;  2K5C A;  3CDL A;  4B48 A;  5IPA A;  5LGT A;  3CP8 A;  1AOY A;  3KP2 A;  1TW2 A;  2RGV A;  2FNA A;  1VF9 A;  2ECB A;  2MC3 A;  4MEY F;  5F64 A;  2HOE A;  4AIK A;  5DD4 A;  1P6R A;  3Q0U A;  1B4A A;  2ID3 A;  3IH3 A;  5IT3 A;  2CGP A;  4CGZ A;  2L9R A;  4CSW A;  3GCM A;  3JRE A;  1Z91 A;  4CCL A;  3LSG A;  2MG4 A;  4YIF A;  2L7M P;  2J5P A;  2RNG A;  2OA4 A;  1FBS A;  3IKV A;  1WJA A;  1X3W B;  3E6D A;  2R7Q A;  3CLQ A;  3HRS A;  4OIR F;  3DPL C;  3WU0 A;  2ICW G;  3H5R A;  5IP7 J;  2PFB A;  5E3M A;  1HC8 A;  5B3S H;  1R22 A;  3K69 A;  1F5T A;  4KIG A;  4UV8 A;  1N77 A;  3VOD A;  3TKY A;  2P6S A;  2ZJR F;  1IV8 A;  4BBS J;  4HEA 2;  5K1Y A;  3BG6 A;  1X1D A;  4OAZ A;  2PN6 A;  1WKM A;  2O8X A;  1TWA J;  4TV7 A;  4PFO A;  3ZMV A;  2HFH A;  1DPU A;  1MBE A;  3FK7 A;  1PUE E;  4BQA A;  1OJL A;  2ZJ2 A;  3Q0V A;  2L7K A;  2IBD A;  3MCZ A;  1XG1 A;  2R92 J;  1BN5 A;  4JX5 A;  1EF4 A;  4HYE A;  2EQR A;  1ZRF A;  2ZKZ A;  1LFU P;  2E36 A;  4YEL A;  3BTI A;  1SMT A;  3GME A;  3KFW X;  4P9U A;  4M74 A;  3S3M A;  5EG0 A;  2Y0S A;  1QPI A;  2ZME A;  3JRC A;  2PLY A;  3ZQ7 A;  1ETX A;  3OOU A;  4R79 A;  3OYC A;  4WXC A;  2E2H J;  4YII A;  3CMM A;  4U7D A;  3S93 A;  1X19 A;  3C7J A;  1DQU A;  5E79 C;  3HOW J;  2ZC2 A;  1Y1W J;  3RCO A;  1O4X A;  2IS2 A;  4PJN A;  4JP0 A;  5BS6 A;  2PI0 A;  1YTY A;  4J00 A;  3OR2 C;  3OSG A;  3I3L A;  2DDB A;  1GHC A;  2M1B A;  1A6I A;  4XID A;  1K4S A;  2A05 A;  1BOB A;  3W2V A;  3B02 A;  3TDZ C;  3HGG A;  4UVB A;  1IRZ A;  4X6A J;  3A02 A;  2OD5 A;  1TW3 A;  1WFX A;  4M71 A;  3I58 A;  3SQN A;  4HLX A;  4BHB A;  3K1P A;  1RUN A;  4M6V A;  2F48 A;  1MMG A;  1YX5 A;  1S72 I;  3REO A;  3CCJ I;  2DJN A;  2XAS A;  3NQO A;  4ZYG A;  3CTA A;  3MKW B;  2DTZ A;  1Z67 A;  2EB7 A;  2E7W A;  1GV5 A;  5J6X A;  1D8K A;  2STW A;  2PJP A;  3WTT C;  1YIJ I;  2PMH A;  1TNT A;  2R0Q C;  2OZ6 A;  5DUI A;  4PDK A;  4DOZ A;  4XLE A;  2R7X A;  4ON0 A;  1Y8R B;  4ENN A;  4GXO A;  2HXI A;  1DDN A;  2JA6 J;  5K5Q A;  1HF0 A;  4B4C A;  3K10 A;  3D1N I;  2K3F A;  1K6O A;  2DMU A;  2IP2 A;  3OYM A;  3QRF F;  1Y0N A;  1G8X A;  3PM1 A;  2MH2 A;  1ETY A;  2X51 A;  4CCK A;  1NK3 P;  2RC4 A;  2XB0 X;  2XB5 A;  1VFC A;  3E97 A;  3R6S A;  5J1Y A;  2A5Y B;  2KL4 A;  1D1C A;  4HF1 A;  4HOB A;  1VQ4 I;  4D7N A;  2VQH A;  3P9C A;  5M3F J;  3GLX A;  4ZDP A;  2CH0 A;  3F8N A;  1HXD A;  3BP8 A;  2GXB A;  1FYL A;  4XOR A;  1TWH J;  3A1Y A;  3MKL A;  1FP2 A;  4FT8 A;  4B8X A;  4FE4 A;  1A31 A;  2OTL I;  5IYC J;  3L2Q A;  1DGR M;  4M73 A;  1FMW A;  4F52 A;  2P4W A;  1KA8 A;  1GXQ A;  2D2W A;  3FMR A;  5JVG F;  5FKM A;  1JKQ C;  3MZ8 A;  2P6T A;  1VQ5 I;  2GXG A;  4C2U A;  2LF8 A;  2LFB A;  4FX4 A;  4UNO A;  2VQG A;  4CUG A;  2EZK A;  3TW6 A;  3BCB A;  1OYI A;  2JA8 J;  4RLQ A;  3S1M J;  3F22 A;  2V79 A;  2XKP A;  3GFL A;  2MA3 A;  3M1E A;  2VOD A;  4PGH A;  3ZN0 A;  3J7Y J;  1S8N A;  3SDG A;  2EK5 A;  2GBY A;  5J1U A;  2JN6 A;  2OZU A;  3LA7 A;  1IO2 A;  2CYY A;  3L09 A;  4KMU X;  1W7P D;  2DFE A;  3L2R A;  2QYO A;  3MZH A;  3LL7 A;  4RA2 A;  5M5X J;  3HB9 A;  1XSD A;  2IVM A;  4BY1 J;  2VT3 A;  4GRI A;  3I5U A;  3IHU A;  4A3I J;  3AG1 H;  5B1B H;  3HOS A;  2VQC A;  4XRM A;  2V9V A;  1WWX A;  2R7D A;  2W4S A;  1JJ6 C;  5EG0 B;  3AL0 B;  2IEK A;  2XAJ A;  2E71 A;  1AHD P;  2M4G A;  3M7G A;  4UB8 C;  2L4A A;  4IHT A;  3QYF A;  5GAD J;  1X4P A;  3O8G A;  4LK1 F;  3AFH A;  1YJN I;  5BQT A;  3GZN B;  1ETV A;  1F36 A;  4MQV A;  4A3G J;  3WGG A;  2XAQ A;  5HVQ C;  2FOK A;  2VJJ A;  2R7O A;  2E2I J;  2OC6 A;  5HDN A;  1TQI A;  3CCY A;  1QA6 A;  3OYH A;  1O3T A;  2FQ4 A;  2OCE A;  1PP8 F;  5L3E A;  2ZSH B;  4L0Z B;  3KLO A;  4IEJ A;  5E17 F;  1O7L A;  3LA2 A;  1U8R A;  3K4N A;  5HLI A;  2WAE A;  1QZY A;  2P7V B;  3PUB A;  2JUG A;  1V5G A;  4XSZ F;  4N9H A;  3S2D J;  1U5T B;  1U9O A;  1T33 A;  3H92 A;  3I53 A;  3O8H A;  4CDG A;  2JA5 J;  1ZEL A;  4AM3 A;  1XDS A;  3ABL H;  2EA2 A;  4B09 A;  5J40 A;  2ISY A;  2LG4 A;  1LFP A;  1ZG3 A;  3RI4 A;  2HZT A;  3VOE A;  1Y1V J;  2XPV A;  1B8I A;  5DS9 A;  5L3B A;  2QEX I;  1P92 A;  3LFK A;  1IN5 A;  3GWZ A;  5DYM A;  1YRN B;  1Z6R A;  4A0X A;  3Q9S A;  5D8K B;  5GP9 A;  3MQ0 A;  3VSK A;  4BJ5 C;  1J7K A;  1MBH A;  2DW4 A;  3PNV A;  1A35 A;  4RB3 C;  2MBF A;  2BY3 A;  1XTA A;  4KT5 C;  4XOT A;  3V8J A;  3IUO A;  4RLF A;  3V7C A;  4E7S A;  3TOB A;  3ROU A;  3GBG A;  3PQJ A;  2E1M C;  3VWB A;  3W6V A;  3OYI A;  5CVV A;  2PBI A;  5J4Y A;  1BOA A;  4A5M A;  1RR8 C;  3DQV C;  4B1R A;  2OUM A;  3E5Q A;  1YJW I;  5C4X J;  2G7U A;  1T0F C;  2KDO A;  3ISP A;  1VQL I;  2WAF A;  3CME I;  2K9Q A;  2F5V A;  1F43 A;  2KHM A;  3M8E A;  4ZTJ A;  3C3W A;  2Y69 H;  5IP6 A;  1BJZ A;  4IQ4 A;  3K9T A;  4HNT A;  3G1M A;  2CW7 A;  4BJT A;  1UFM A;  2DFI A;  3M8J A;  3PSI A;  2TRT A;  1IN4 A;  3RDI A;  3HIF A;  3KET A;  4E7I A;  2L0K A;  5F08 A;  3SEQ A;  2WBM A;  5LHI A;  5D8L B;  3JAM Z;  5EEH A;  2D5V A;  1G6N A;  1MJ9 A;  4EVI A;  2VL8 A;  2FOW A;  3H35 A;  4QLC U;  3OY9 A;  1AWC A;  2RDP A;  2JTV A;  3HOV J;  3GZ6 A;  4B3A A;  3CDH A;  4DNC A;  2RQQ A;  5JLW A;  1UMQ A;  4XOP A;  1YJ9 I;  1KU9 A;  2WV0 A;  3KEO A;  5ILS A;  1ON1 A;  3WU1 B;  2LY9 A;  2HVR A;  9ANT A;  4NB5 A;  2BY0 A;  1D3Y A;  3LST A;  4E6K G;  1NH3 A;  1MMS A;  2L5Q A;  1S5L C;  2FMY A;  1QVT A;  1U5T A;  3LOC A;  3F8M A;  3VYR B;  4WF2 A;  4XRS G;  4EQQ A;  1W36 D;  2WY7 Q;  2GLO A;  1D5V A;  3BY6 A;  1WJ5 A;  1P7I A;  1POG A;  1B72 B;  1RKW A;  2DK5 A;  3HRM A;  1F9N A;  3F9K A;  4UV9 A;  3Q9V A;  2HKO A;  2XRN A;  4QIW N;  5FLM J;  3BCA A;  2GIV A;  2HOA A;  2JK3 A;  3EYY A;  2EFO A;  1FNN A;  1V4R A;  3I56 I;  3QPL A;  1APL C;  2A6E F;  3OIQ A;  4FE7 A;  4HX4 A;  3WTU C;  2KRF A;  1TL8 A;  3BR6 A;  3BZK A;  1FYM A;  2MW8 A;  2DN0 A;  5FFX A;  3RZO J;  3FXO A;  3T1B A;  1T95 A;  4MIM A;  3HZJ A;  3OIP A;  2LDU A;  4EAT A;  2DAO A;  5GTI C;  4U0Y A;  2XGX A;  5EYR A;  2VOO A;  4G12 A;  4RMN A;  5K7F A;  5JHF A;  4PJM A;  5J3L A;  3AG3 H;  1V3F A;  1NG6 A;  2CQX A;  2IGM A;  3SHF A;  1KZH A;  3VYT B;  1K4T A;  5L3D A;  5ERI A;  2JA2 A;  3EUA A;  2WAQ A;  3GF2 A;  2KDZ A;  3J81 Z;  1YW8 A;  2QQ8 A;  1OKR A;  2L02 A;  2Y9Y A;  3A2K A;  2IS6 A;  2X9D A;  3HOZ J;  4MQ9 F;  1I6X A;  4G7Z F;  1IW7 F;  4Z2Y A;  1UHM A;  3LSR A;  1ZKG A;  1IUF A;  5EGO B;  2ME6 A;  1UHS A;  2GA2 A;  1XS9 A;  4IHS A;  4HW0 A;  3PO2 J;  2E60 A;  4HX8 A;  4XKB A;  2CQK A;  3JSP A;  4IX7 A;  4AD9 A;  3G6E I;  3DXJ F;  2HOT A;  1GVD A;  1Z7L A;  2G0E A;  2FML A;  4FHT A;  2E1C A;  2CUE A;  3F0C A;  3DKX A;  1ACI A;  3A01 A;  3CJT B;  3RIR A;  4D5F A;  3V8K A;  4A0Y A;  5TRD A;  1R6R A;  1ZRE A;  2RAE A;  3AL0 C;  2NS0 A;  1I1G A;  4WK8 F;  1ZHF A;  3M07 A;  2PX9 A;  1V5E A;  2B63 J;  3H3V K;  4IL6 C;  3GO5 A;  4MGR A;  2KIU A;  5KNL A;  3DTK A;  1LE8 B;  3EUK L;  1KU7 A;  3CCM I;  1Z21 A;  2MLK A;  4BQQ A;  4XBF A;  4U87 A;  3NAR A;  1OR7 C;  4CYD A;  3UNG C;  1FOW A;  3WU2 C;  1Z05 A;  4FIS A;  3E7L A;  3IH2 A;  2NRA C;  1XMA A;  3I54 A;  2XF6 A;  1D0Y A;  1XGO A;  2HDD A;  4WCG A;  3T5X A;  1IXS B;  3S14 J;  3IAS 2;  5DD8 A;  4AU7 A;  1U5T C;  2VBY A;  2B7E A;  1SAX A;  1GUU A;  3WHB A;  3IV5 A;  1LPQ A;  2DMP A;  1IDY A;  2A3S A;  1JE8 A;  2WY8 Q;  4XLC A;  3K4J A;  3LSM A;  2LKX A;  2LKS A;  2XRO A;  4I98 B;  4BAY A;  3SDB A;  3J7A O;  2K4J A;  1S7O A;  2MYS A;  4A3K J;  1EA3 A;  4HDV A;  5CLS A;  2VXD A;  3TDU C;  2W1O A;  3ABT A;  1I27 A;  3HRU A;  4PJJ A;  3BPX A;  5GAH J;  3FKI J;  4UB6 C;  1IJW C;  2V9P A;  3DV8 A;  1R49 A;  3QPS A;  1G2H A;  2QQB A;  2MAB A;  2O7O A;  4DW6 A;  4HLY A;  2KP6 A;  1JUM A;  1TT0 A;  3OR1 C;  2ELH A;  5FRN A;  4BYY A;  1UG0 A;  2AO9 A;  4NUB A;  4UUS B;  1LNW A;  2EFP A;  1BIA A;  1SD6 A;  4OOI A;  1T8I A;  2E1M B;  5EEA A;  3PIO F;  3BTL A;  1R4M B;  4BJ6 C;  2H94 A;  3OYN A;  4RAG A;  2AHQ A;  2A6T A;  1K79 A;  3KPH A;  2ELK A;  1QO0 D;  1NTC A;  2R7Z J;  2IS1 A;  2V4J C;  2M7A A;  2IT0 A;  1K6Y A;  2V1N A;  4F91 B;  1V55 H;  1QPM A;  2AXT C;  2W48 A;  5CYV A;  1SMY F;  1WJF A;  2FSW A;  4HG2 A;  3MN2 A;  3GTJ J;  2YPR A;  4Q47 A;  2Y75 A;  3WG7 H;  3H3U A;  1IRG A;  3M9A A;  3QWL A;  5DCF A;  2VBZ A;  2B0L A;  4HDU A;  4DBR A;  2H8W A;  2LSO A;  1BM9 A;  4G8X A;  5KHD A;  3WTZ A;  5L3F A;  1I1S A;  1YLF A;  2KRH A;  4KMF A;  4BDY A;  4DGW B;  3MKZ A;  3HXL A;  5LGU A;  4HV6 A;  3CO7 C;  2BZT A;  2XUB A;  5JI6 A;  2QQ9 A;  4LIT A;  1KYW A;  3PL8 A;  1HW2 A;  3RKX A;  3ECH A;  2XGE A;  2HYJ A;  2DT6 A;  1TNS A;  2UUZ A;  4NC7 A;  3TP0 A;  1OMI A;  1FTZ A;  2EZH A;  4XLP F;  1ZGJ A;  1Z6T A;  1QZE A;  2DO7 A;  2YU3 A;  4GO1 A;  4A3E J;  3Q3S A;  1A36 A;  3CCE I;  1PYV A;  1X4O A;  1K78 A;  3V7R A;  3BTJ A;  1J5Y A;  2CRG A;  4BEH B;  5L3G A;  3G71 I;  2VT2 A;  4LLL A;  4F55 A;  3Q0W A;  4IRG A;  4AVZ A;  3K0L A;  1TP4 A;  5GAE J;  4R1H A;  3OYF A;  3CCL I;  3QOE A;  3D0S A;  4WXD A;  3DBL B;  5FKK A;  2Y9Z A;  2K9M A;  3FHN A;  2XDV A;  2X85 A;  3GW2 A;  3P9K A;  4RBO A;  4PSX A;  1BW6 A;  3I4P A;  4A6E A;  3H0D A;  3H9G A;  3ASO H;  2FE3 A;  2IA0 A;  1JKP C;  3N05 A;  4PSW A;  1MIJ A;  1ZGW A;  4X0G A;  2JZY A;  2JSP A;  3QU6 A;  1WCM J;  2M5W A;  3K4B A;  3PNY A;  5IOY A;  2CU7 A;  1USS A;  3HHG A;  3TO6 A;  5IOZ A;  2X1D A;  1VQ8 I;  1MDM A;  4HF2 A;  5FKN A;  4AWX B;  2Q0O A;  2NNN A;  1QBJ A;  1U6G A;  5IP9 J;  5LD2 C;  2LBF A;  4CCM A;  2DMQ A;  4CIC A;  2KMU A;  3I59 B;  2VJI A;  4MTE A;  5BMZ A;  4RDU A;  2F4O B;  1E3O C;  1G3S A;  2CFO A;  4HNU A;  2ADU A;  3KEQ A;  3VFZ A;  3OOP A;  2H6B A;  2BW3 B;  3A03 A;  2FD5 A;  1NG7 A;  3EUH C;  2BXZ A;  4D0P A;  1K78 B;  2A6H F;  3E1S A;  3HUG B;  2M7B A;  2HR3 A;  2HS5 A;  1FP1 D;  1X58 A;  2QA4 I;  1R00 A;  2MFZ A;  3J81 K;  2JJ7 A;  4GDF A;  2HI3 A;  1MND A;  1B59 A;  3CP2 A;  4KIS A;  3TOA A;  1KQ9 A;  2O3F A;  3ZOB A;  4L5I A;  4BQN A;  3N4M A;  1VND A;  1JTY A;  3ASN H;  3FIW A;  4BH9 A;  2Q1Z B;  5D5V B;  2XF7 A;  4I76 A;  1ONV A;  2AQE A;  1TQP A;  2CSO A;  1WGX A;  1OPC A;  3EET A;  4II2 A;  3JRD A;  5IYD J;  5D5U B;  5M3M J;  1HCR A;  2ZSI B;  3AG4 H;  4Y15 A;  1ORK A;  2I5U A;  1UJ8 A;  1H8A C;  1L0O C;  3S32 A;  3ZQQ A;  1YE9 A;  1JI8 A;  2J5O A;  1GT0 C;  2UWM A;  1IDZ A;  1BR2 A;  4HA8 A;  4CH7 A;  1HQC A;  1ZLJ A;  3KP7 A;  3LMM A;  4OIP F;  2IXS A;  4XM3 A;  2FBI A;  2LLK A;  2YX4 A;  4EV0 A;  3RPU D;  1ETW A;  1N75 A;  2M8E A;  2R3S A;  1QVU A;  4BXU A;  3OYJ A;  2EFN A;  4NHJ A;  3S1N J;  1P2F A;  2HYG D;  2E2J J;  3BR2 A;  5HS8 A;  3RKW A;  1DU6 A;  2Y2Z A;  2M30 A;  2E1O A;  1F1Z A;  1Z3X A;  1TWC J;  5A2Q Z;  3SEZ A;  3H1C A;  1D8J A;  2LYC A;  3IKT A;  1HW5 A;  2XKO A;  2ISZ A;  1TBX A;  3CF2 A;  2RRE A;  4ZYE A;  2DOF A;  3G1L A;  3ONQ A;  1OIS A;  3NEU A;  2ESH A;  4MTD A;  2LNB A;  3L7W A;  4J19 A;  1QNT A;  1IZ1 A;  2DBB A;  1BJA A;  1FMV A;  4CYC A;  4XLF A;  1Y39 A;  3VEP A;  1UZC A;  1XCV A;  2BBY A;  2GOX B;  4BY7 J;  1IG7 A;  2XRL A;  3OV8 A;  2QSG X;  4XIC A;  3X2Q H;  3SZT A;  2M3A A;  3ECO A;  3LA3 A;  3KYL A;  3J7A Y;  3CZ6 A;  1OCO H;  5FO5 A;  5HLT A;  4IO9 F;  2KT0 A;  3J80 K;  2HZD A;  3F8C A;  2HEO A;  1I3A A;  2D1V A;  1XGM A;  3KZY A;  4I6Z A;  3RZD J;  1MMA A;  4JX4 A;  3ZR8 X;  2K86 A;  3ELK A;  4CCO A;  3QOP A;  1I3Q J;  1U78 A;  4IKF A;  1PUF A;  1WI3 A;  2OAZ A;  1B9M A;  2Y30 A;  4XMY A;  4NBQ A;  3H9J A;  5FLX K;  2KLO A;  2XF5 A;  5DCM A;  2BV6 A;  1MBK A;  2EPF A;  1HKT A;  4LLN A;  5J4V A;  1SEU A;  4HST A;  5E1W A;  4L0Y B;  1JGS A;  1BI0 A;  2E5N A;  3PUF A;  4P1W A;  2XGC A;  5E20 A;  2W00 A;  1X1A A;  2MD0 A;  3DBH B;  5FKL A;  2MLG A;  2ELJ A;  2DOA A;  1ULY A;  4BBR J;  3RJP A;  3K7A J;  2NOJ B;  3MD2 A;  1R71 A;  1ODD A;  2X1E A;  1Y0U A;  3CC2 I;  4AUX A;  3LNQ A;  2MH9 A;  1XX5 A;  3ZQH A;  3FK6 A;  1IN7 A;  4C3H J;  1YW7 A;  1LEA A;  3DWL E;  1LFB A;  2QCO A;  4I01 A;  1Q1V A;  3F21 A;  2Z5U A;  2Z33 A;  1SAN A;  4S0H B;  2M2E A;  2XSJ C;  3OS1 A;  2QVO A;  4YEJ A;  2CQN A;  4BGD A;  5EEG A;  4AC0 A;  2X0L A;  1HA8 A;  4OIQ F;  1WHU A;  5E3L A;  5E8I A;  3KZZ A;  4E4H A;  2CUZ A;  3H5N A;  3WTV C;  1YIO A;  1R36 A;  2QQA A;  5CVI A;  2CWE A;  2DA1 A;  2YR2 A;  3I9V 2;  5F0F A;  3WOD F;  1QHH D;  4C3I J;  2CV1 A;  3WTX C;  1WPK A;  4A2U A;  4G94 A;  1Z77 A;  5IYB J;  2JUC A;  4ITV A;  3T8T A;  2P81 A;  4ZYH A;  2FNP A;  1YFH A;  2HDC A;  2OTJ I;  2X6W A;  1OCZ H;  4EM2 A;  3GLL A;  3K2A A;  2W57 A;  4JOM A;  1KON A;  1LJ9 A;  1X1P A;  2IS4 A;  1JXS A;  4IPA A;  4BKX A;  1FPQ A;  3FIS A;  3LSJ A;  2A61 A;  4IXA A;  1WH5 A;  1VI0 A;  4LIV A;  5D5X B;  1WRJ A;  1VQ9 I;  1MH3 A;  1PUF B;  1H9T A;  2L54 A;  2DU9 A;  1WJB A;  3ULQ B;  1R1V A;  2DMN A;  2W82 A;  1KU3 A;  3HUG A;  2FA5 A;  4LG0 B;  4BL0 B;  3BR1 A;  4L9T A;  5EJC A;  3WHC A;  5H6Q A;  2H8R A;  2QF7 A;  4B3X A;  2UV1 A;  2DA5 A;  3PFY A;  3MKY B;  5DDG A;  4CXF A;  2G9W A;  4FET A;  5BOX A;  4XON A;  5GPA A;  2KIS A;  1Y56 A;  4I0A A;  2YSR A;  4W1U A;  2CFX A;  2TCT A;  3DLL F;  1TQM A;  1K61 A;  2DYS H;  1N78 A;  2OF7 A;  2IW5 A;  3KP6 A;  3TO9 A;  1R1T A;  4D7M A;  1IN8 A;  3HJE A;  3UKG A;  5FLX Z;  1LUJ B;  2XVC A;  3W6J B;  4WX9 A;  3S1Q J;  3GZ5 A;  3B6C A;  4RAY A;  4P55 A;  1W7P A;  1U0J A;  2IRF G;  1WJC A;  4LJZ F;  2A07 F;  2IGK A;  4F3Q A;  3ERM A;  1OYY A;  1ENH A;  4FX0 A;  4P5O A;  3TO7 A;  3BLY A;  1S29 A;  1OQY A;  4M3B A;  1B6A A;  5FB2 A;  3FXR A;  3D5L A;  1XD7 A;  2VIX A;  2NXN B;  2Z2S B;  3KCC A;  4IJA A;  3CJR B;  2F4M B;  5DUK A;  5ICC A;  3FMQ A;  4IHV A;  5C3E J;  4UUT A;  4FAS D;  5LEK A;  2H1K A;  2LH9 A;  3EQL F;  4XL9 A;  2LRD A;  3CC7 I;  4I2O A;  3O6B B;  3FBN B;  3CMY A;  2L9V A;  1LB2 A;  5EGO A;  2K02 A;  2QZ8 A;  3G4S I;  2ZME B;  4RGR A;  2K9N A;  2XV4 S;  4E7L A;  4ESF A;  1WI9 A;  5HOD A;  3BC8 A;  4IRI A;  2GQQ A;  3DTI A;  3BR5 A;  3BR0 A;  4BHP A;  1FBU A;  3F8B A;  1ZAO A;  3DPT A;  5BPD A;  4HBL A;  1W5C C;  2ID6 A;  2VE9 A;  1R5G A;  3DBR B;  5GPC A;  4UUV A;  2DT7 B;  3C2B A;  4PZJ A;  3HG9 A;  5A2Q K;  2CQQ A;  5JR3 A;  2G7H A;  3L2V A;  1R7J A;  4U0V A;  5GTH C;  2FU4 A;  2XIG A;  1LKX A;  2KZG A;  1B1B A;  1RUO A;  4OAY A;  3CF5 F;  2EIL H;  2COM A;  1H88 C;  1O57 A;  1P4X A;  4B47 A;  2R93 J;  1YIT I;  2COB A;  2EV0 A;  3J7Z I;  2LY1 A;  3K4C A;  4V2F A;  4BEH A;  3K6G A;  3BT9 A;  4I09 A;  5HNF A;  1FY7 A;  4UUS A;  3D5R C;  4WXH A;  5HS7 A;  2XAH A;  3LQR A;  2IPQ X;  3HSR A;  2R4G A;  2ZO4 A;  4Y3O A;  4CA0 A;  4N4N B;  1RNL A;  3K70 D;  3IWF A;  3CMA I;  5E1X A;  1FBQ A;  2M9H A;  4A3B J;  2EA4 A;  4HQE A;  3CES A;  5JFR A;  1ITY A;  4GYG A;  4Y17 A;  1DUX C;  2Y31 A;  3IRQ A;  2RNJ A;  2HTS A;  4I0B A;  4BXF A;  1T98 A;  4ENM A;  3QU3 A;  1XCB A;  3FXJ A;  3ML6 A;  4CCN A;  2HPI A;  2Y48 A;  5TIS C;  3BZC A;  1XSV A;  1J2X A;  1O3Q A;  2X48 A;  4Y52 J;  2KIQ A;  2PMU A;  2ZBK A;  1I5Z A;  2D1H A;  3FMS A;  4XQF A;  2Z99 A;  3DEU A;  4EGY A;  1JHH A;  1QRY A;  4W97 A;  3JRB A;  4BHC A;  2H6C A;  5CVR A;  2LR8 A;  2VC1 A;  1RRJ A;  5HOO A;  3ZQG A;  3U1D A;  5K7Z A;  5LRS A;  4G7H F;  3EPZ A;  1OCR H;  3FXK A;  3OL3 A;  4A12 A;  2MC4 A;  3DU6 A;  1MMN A;  3JSO A;  2HXO A;  1VQO I;  1UG2 A;  3RKQ A;  1J75 A;  3JRH A;  1Z3Y A;  3C18 A;  2CUF A;  3N97 A;  2W85 A;  1AKH A;  3ZCO A;  1Q1H A;  1XB4 A;  1XN7 A;  4MNU A;  4MHG A;  3I4M J;  1MBJ A;  4LLG F;  3GTP J;  3DLA A;  1SVM A;  1EV7 A;  3ZQI A;  1PJR A;  3I0T A;  1HSJ A;  1B72 A;  1S3J A;  3R0J A;  3L2W A;  3ABU A;  4XK4 A;  1D1B A;  3MZY A;  2VQL A;  4DJA A;  4M6Y A;  2GM4 A;  4PJ0 C;  3W3C A;  4I02 A;  2FBK A;  1BI1 A;  2V6E A;  2K40 A;  3FHZ A;  1VQP I;  1L3L A;  3HL2 A;  2KJC A;  1S6L A;  2VKD A;  1XGS A;  2MD5 A;  2YS9 A;  1W5S A;  3DP7 A;  4NNJ A;  4ZZD A;  4AVP A;  4QPQ A;  3I55 I;  3FXM A;  1W1W E;  5ILU A;  3AAF A;  3FZV A;  3PSF A;  5EF6 A;  4C30 A;  1DP3 A;  1KU2 A;  2AQF A;  2NVY J;  1JGG A;  2NVX J;  1W4M A;  1RZ4 A;  2H27 A;  3BDD A;  3A01 B;  2DLL A;  1P7J A;  4RB0 A;  2O8K A;  2F5C A;  4H0E A;  1BR1 A;  1UHW A; 
#chains in the Genus database with same CATH homology
 1T6S A;  1FSH A;  3BWG A;  2XHK A;  4KN4 X;  5FFZ A;  5LGN A;  3E3V A;  4L9J A;  4I7H A;  2VC0 A;  3WE2 A;  3ZMS A;  4YFX F;  3HRT A;  2P8T A;  3ZP5 A;  3GFJ A;  3QP5 A;  2P5K A;  2OQR A;  3K2Z A;  5D4R A;  1MJB A;  3WGI A;  6PAX A;  1R23 A;  2IA1 A;  1MZB A;  2JSC A;  2DI3 A;  1SD5 A;  1WSU A;  1NHA A;  1Z1D A;  2K27 A;  1HW1 A;  2YX7 A;  5KK1 A;  5K5O A;  3HYI A;  1LVA A;  4EM1 A;  5AIQ A;  2O03 A;  3G3Z A;  5ICF A;  3GFM A;  2TDX A;  3FXQ A;  2OBP A;  5FD5 A;  3GX4 X;  1J59 A;  2WC2 A;  3ZMD A;  3R4K A;  4ESB A;  2KKO A;  2OU2 A;  5D6F A;  3U2R A;  3R0A A;  2JPC A;  2CG4 A;  1IF1 A;  1HBX G;  1PDN C;  1KGS A;  1YG2 A;  4LK0 F;  2EV6 A;  2W24 A;  4PGG A;  4KN7 X;  5ED4 A;  1PP7 U;  2ACJ A;  4YG2 F;  4N9I A;  4G6Q A;  2LF7 A;  1J9I A;  3SFZ A;  5LBQ A;  3KP5 A;  4KA4 A;  2FRH A;  2EWN A;  2WWY A;  2HGC A;  3IC7 A;  5KVR A;  5FD6 A;  1K7A A;  4XRF A;  2BGC A;  1FOK A;  4KUM A;  2IJL A;  3GUD A;  1TTY A;  2EJR A;  3SXY A;  4U0W A;  4ZZL A;  1JHF A;  4ZYD A;  1A04 A;  4HF0 A;  4IRH A;  3I71 A;  3T8R A;  5H20 A;  2GWR A;  2V1X A;  1DPR A;  2AXL A;  3ZMT A;  1STZ A;  5DEQ A;  4G9Y A;  4A5N A;  3F72 A;  1FC3 A;  2V1D A;  4HX7 A;  2BE5 F;  1ZH5 A;  2HQN A;  3SZP A;  2F2E A;  2PEX A;  4NQW A;  1FYK A;  3V8L A;  1W7P B;  1XDU A;  5DV5 A;  3J80 Z;  5ICG A;  2NAZ A;  2WTE A;  3IWZ A;  3COA C;  2RVC A;  4KYW A;  1GVJ A;  4M9S A;  1FLI A;  4P96 A;  4EGZ A;  3DKW A;  2DK8 A;  2X4H A;  3I64 A;  2F5D A;  2HWV A;  3WG9 A;  2ETH A;  2A69 F;  4GCV A;  1LQ1 A;  5E8G A;  4K2E A;  3QPT A;  2QEN A;  4LGW A;  3GYH X;  2C6Y A;  2PG4 A;  4M9Z A;  1CF7 B;  2HYF A;  2RN7 A;  2JPB A;  2FF4 A;  5ICE A;  2O6G E;  2DQR A;  1P4W A;  1X3U A;  1BI3 A;  1G3T A;  4PCQ A;  4YFK F;  4HAM A;  3FM3 A;  1REP C;  4KDP A;  5HS9 A;  4RB2 C;  3FXU A;  1BC8 C;  3CO6 C;  1B9N A;  4O6J A;  4IVN A;  1KQ0 A;  2Y0M A;  2P5V A;  3H3Z A;  4Y13 A;  4XLN F;  3BOQ A;  1IXR C;  5F6F A;  3GEZ A;  4EMS A;  3P7N A;  4EJT A;  3V7S A;  4Q5S F;  1ZG1 A;  2HTJ A;  1BIB A;  3ZMU A;  5E1Z B;  2GAU A;  3BJO A;  3IRR A;  2VBW A;  4ENJ A;  4WWC A;  3F3X A;  3P9I A;  3R60 A;  3RPQ A;  3ZMZ A;  1R1U A;  4ETS A;  4GGG A;  2RQP A;  1U2W A;  3GVA A;  2AS5 F;  2KIF A;  2L01 A;  1Z9C A;  3BRO A;  5CJ9 A;  2UXX A;  4G6D A;  4R8H A;  2JT1 A;  2DPU A;  3EYI A;  3L9F A;  3HOT A;  4RB1 A;  1C0W A;  2Q8K A;  3LWF A;  1O7F A;  2PQ8 A;  3HTS B;  1LDJ A;  4IF4 A;  1ZRD A;  5J8C A;  1OYW A;  5LHH A;  1SFE A;  2O0Y A;  5LRR A;  3LQQ A;  5CVU A;  2R7F A;  4JQF A;  5D6E A;  5E18 F;  3M8F A;  4EJO A;  4JBA A;  3F8F A;  3PQK A;  1QGP A;  3MFK A;  3IL2 A;  3RKY A;  4GYI A;  4KFC A;  1T39 A;  5D5W B;  4CZZ A;  3WE3 A;  3JAM K;  2BEO A;  5IT9 Z;  3HHH A;  4L18 B;  5LHG A;  3TQN A;  4P9F A;  4MEX F;  2FBH A;  3ZN1 A;  3MWM A;  3E6B A;  2QWW A;  5HLG A;  2XAG A;  4L9N A;  1T2K A;  1J0R A;  3K1M A;  2STT A;  3E5U A;  2EV5 A;  3I59 A;  1T38 A;  2QLZ A;  4RS8 A;  3KLN A;  4OIO F;  3V4G A;  4A6D A;  2V6C A;  2ZCW A;  1YQA A;  2RV8 A;  2ZNZ A;  5LLQ A;  2HQR A;  3E6M A;  4HZF A;  1S7A A;  4YFN F;  2F5F A;  1KYZ A;  1Z7U A;  4L9V A;  3G73 A;  5HDG A;  1FWZ A;  3FF5 A;  2ZNY A;  1TLH B;  5HDK A;  4LB5 A;  1G3Y A;  3ERE D;  4Q4Z F;  1FSE A;  1IRF A;  1SD4 A;  1G4D A;  3MAJ A;  1BC7 C;  5CVJ A;  2CO5 A;  1DP7 P;  3E5X A;  3BPV A;  1VTN C;  1MDM B;  3FM5 A;  3BJA A;  4DQ2 A;  1BBY A;  1SFU A;  2DQL A;  2QUF A;  1GXP A;  1MD0 A;  1H9G A;  2M87 A;  3PFI A;  2VON A;  4G7O F;  1IAW A;  2IA2 A;  3WTS C;  5J8F A;  1XGN A;  1HKS A;  3RTR A;  1RI7 A;  4EM0 B;  4LG0 A;  3EDP A;  3FX3 A;  2D45 A;  2O61 A;  2M45 A;  1SD7 A;  2VXZ A;  4O5V A;  2LKP A;  3HSF A;  2W84 A;  2VN2 A;  4EJV A;  1FX7 A;  2QBY B;  4ASN A;  3CUQ B;  1ZRC A;  3F23 A;  1HKQ A;  2XAF A;  2K7L A;  4EJU A;  1ZYR F;  5ILV A;  1G3W A;  2KJB A;  3F6O A;  1UST A;  3JTH A;  4ENK A;  4LD5 A;  1YS6 A;  5K5R A;  4UHT A;  1ZAR A;  4O3M A;  3RPU A;  4JK1 X;  1ON2 A;  5IT9 K;  4LFU A;  4ZH4 F;  2QM3 A;  3E6C C;  4RGX A;  5DCM B;  3O2P E;  4RGU A;  3CUO A;  2V1U A;  3FWE A;  3CLO A;  1YW9 A;  2H09 A;  3HTU A;  4OU0 A;  1HST A;  2UXN A;  3WTW C;  4KIF A;  1E2X A;  4AIH A;  5JHU A;  3K1N A;  1O3S A;  1ZLK A;  5TJJ A;  4AIJ A;  3BZ6 A;  1LEB A;  4KIC A;  2CW0 F;  2E1N A;  3W6K B;  1XSX A;  2P5L C;  4S04 A;  4HQM A;  1R5H A;  4RAZ A;  2EFQ A;  4BNC A;  2F5E A;  4U7B A;  4UXN A;  3ZPL A;  4LMY A;  2L3D A;  1MKM A;  1CF7 A;  3VB2 A;  2NYX A;  4Q48 A;  2ZXJ A;  2VE8 A;  4S05 A;  4CHU A;  5HLH A;  3RYR A;  5L3C A;  1QQI A;  1OR7 A;  3B73 A;  2HKX A;  4OIN F;  3QAH A;  2NNY A;  3JTG A;  1QZZ A;  3L00 A;  2ZFW A;  2VBX A;  3GXO A;  2BYV E;  4F7Z A;  1SFX A;  2E7X A;  2JRT A;  5JVT A;  4CO8 A;  1O3R A;  3GFI A;  4L5J A;  2DT5 A;  1KQ8 A;  4LB6 B;  1YS7 A;  4OMZ A;  2L4M A;  2UZK A;  3QP6 A;  1FZP B;  1YO5 C;  4U88 A;  1ZG5 A;  4HV5 A;  2OQG A;  1EH7 A;  3WTY C;  4EJW A;  3EUH A;  4E70 A;  4RGS A;  1F4K A;  4M72 A;  2FXA A;  1LDD A;  1EH6 A;  1XMK A;  5AON A;  1RIO H;  1MGT A;  3R61 A;  1P4A A;  5BPI A;  3DFG A;  4KIB A;  4M6X A;  2KIM A;  4KNY A;  3BJ6 A;  2DTR A;  2K4B A;  5D4S A;  1U3E M;  4ESJ A;  3LAP A;  1ZGA A;  4M9X A;  1EH8 A;  3O3K A;  3Q5F A;  2Z9O A;  4N0B A;  1CGP A;  2DPD A;  2ESN A;  1FT9 A;  1W5T A;  3T0Y A;  1H0M A;  3U9G A;  4XSX F;  1ZN2 A;  3F6V A;  3NRV A;  2QBY A;  4UVC A;  3CUQ C;  4UVA A;  1IUY A;  2VOP A;  5AIP A;  3KE2 A;  3DF8 A;  2Z3Y A;  3C1D A;  1BI2 A;  3LAJ A;  2A68 F;  3RYP A;  1MJA A;  4QWQ A;  2EFW A;  5F1R A;  1UB9 A;  1WQ2 A;  2Q2E A;  2RKH A;  3WGH A;  1LDK B;  3CJN A;  2FEZ A;  5H6R A;  1R58 A;  4A0Z A;  1T0F A;  2W25 A;  3CUQ A;  3S2W A;  1YYV A;  3HSE A;  1UCR A;  3MEX A;  3TGN A;  3L2C A;  1E17 A;  2FQ3 A;  2GZW A;  2GA1 A;  1IXC A;  4OMY A;  3QPH A;  2P7C B;  5FGM A;  3JW4 A;  1IN6 A;  3KP4 A;  5LEJ A;  3KP3 A;  5LGT A;  1AOY A;  3KP2 A;  1TW2 A;  2RGV A;  2FNA A;  2MC3 A;  4MEY F;  5F64 A;  2HOE A;  4AIK A;  5DD4 A;  1P6R A;  1B4A A;  5IT3 A;  2CGP A;  4CGZ A;  1Z91 A;  4YIF A;  2J5P A;  2OA4 A;  1FBS A;  3IKV A;  3E6D A;  3HRS A;  4OIR F;  3DPL C;  3WU0 A;  2PFB A;  1R22 A;  3K69 A;  1F5T A;  4KIG A;  4UV8 A;  3VOD A;  3TKY A;  2P6S A;  5K1Y A;  2PN6 A;  1WKM A;  2O8X A;  4TV7 A;  3ZMV A;  2HFH A;  1DPU A;  1PUE E;  4BQA A;  2ZJ2 A;  3MCZ A;  1BN5 A;  4HYE A;  1ZRF A;  2ZKZ A;  1SMT A;  3KFW X;  4P9U A;  4M74 A;  2ZME A;  2PLY A;  3ZQ7 A;  4R79 A;  4WXC A;  4YII A;  4U7D A;  3C7J A;  5BS6 A;  2PI0 A;  1YTY A;  1GHC A;  2M1B A;  3B02 A;  3TDZ C;  4UVB A;  2OD5 A;  1TW3 A;  4M71 A;  3I58 A;  3SQN A;  4HLX A;  4BHB A;  3K1P A;  1RUN A;  3REO A;  2XAS A;  3NQO A;  4ZYG A;  3CTA A;  2EB7 A;  2E7W A;  5J6X A;  1D8K A;  2STW A;  2PJP A;  3WTT C;  2PMH A;  1TNT A;  2OZ6 A;  5DUI A;  4PDK A;  4ON0 A;  4ENN A;  4GXO A;  1DDN A;  5K5Q A;  1K6O A;  2IP2 A;  3QRF F;  2MH2 A;  2RC4 A;  3E97 A;  3R6S A;  2A5Y B;  4HF1 A;  4HOB A;  3P9C A;  3GLX A;  3F8N A;  1HXD A;  3BP8 A;  2GXB A;  1FYL A;  4FT8 A;  1FP2 A;  4B8X A;  4M73 A;  2P4W A;  1KA8 A;  1GXQ A;  2D2W A;  3FMR A;  2P6T A;  2GXG A;  2LF8 A;  4FX4 A;  4UNO A;  1OYI A;  3F22 A;  2V79 A;  2XKP A;  3GFL A;  2MA3 A;  3M1E A;  2VOD A;  4PGH A;  3ZN0 A;  1S8N A;  2EK5 A;  2OZU A;  3LA7 A;  2CYY A;  3L09 A;  4KMU X;  1W7P D;  2QYO A;  3MZH A;  1XSD A;  2IVM A;  2VT3 A;  3I5U A;  3IHU A;  3HOS A;  2V9V A;  1WWX A;  2R7D A;  2XAJ A;  3M7G A;  2L4A A;  4IHT A;  4LK1 F;  5BQT A;  4MQV A;  3WGG A;  2XAQ A;  5HVQ C;  2FOK A;  5HDN A;  1TQI A;  1O3T A;  1PP8 F;  5L3E A;  4L0Z B;  3KLO A;  5E17 F;  1O7L A;  3LA2 A;  1U8R A;  5HLI A;  1QZY A;  2P7V B;  4XSZ F;  4N9H A;  1U5T B;  3H92 A;  3I53 A;  4CDG A;  1XDS A;  2EA2 A;  4B09 A;  2ISY A;  1ZG3 A;  3RI4 A;  2HZT A;  3VOE A;  5L3B A;  1P92 A;  3LFK A;  1IN5 A;  3GWZ A;  5DYM A;  1Z6R A;  4A0X A;  3Q9S A;  5D8K B;  3MQ0 A;  1J7K A;  2DW4 A;  4RB3 C;  2MBF A;  4KT5 C;  3V8J A;  3V7C A;  3TOB A;  3ROU A;  3PQJ A;  5CVV A;  2PBI A;  1BOA A;  4A5M A;  3DQV C;  3E5Q A;  2G7U A;  3ISP A;  3M8E A;  3C3W A;  3K9T A;  1UFM A;  2DFI A;  1IN4 A;  3RDI A;  3HIF A;  3KET A;  5LHI A;  5D8L B;  3JAM Z;  5EEH A;  1G6N A;  1MJ9 A;  4EVI A;  4QLC U;  1AWC A;  2RDP A;  2JTV A;  3GZ6 A;  4DNC A;  3CDH A;  1KU9 A;  2WV0 A;  3KEO A;  5ILS A;  1ON1 A;  3WU1 B;  4NB5 A;  1D3Y A;  3LST A;  2FMY A;  1U5T A;  4EQQ A;  3F8M A;  4WF2 A;  1D5V A;  3BY6 A;  2DK5 A;  3HRM A;  1F9N A;  4UV9 A;  3Q9V A;  2HKO A;  2XRN A;  2GIV A;  3EYY A;  2EFO A;  1FNN A;  1V4R A;  2A6E F;  4HX4 A;  3WTU C;  2KRF A;  1FYM A;  5FFX A;  3T1B A;  2LDU A;  2DAO A;  4U0Y A;  2XGX A;  2VOO A;  1V3F A;  3SHF A;  5L3D A;  5ERI A;  3GF2 A;  3J81 Z;  1YW8 A;  1OKR A;  2L02 A;  4MQ9 F;  1I6X A;  4G7Z F;  1IW7 F;  4Z2Y A;  1UHM A;  2GA2 A;  4IHS A;  4HW0 A;  4HX8 A;  3JSP A;  2CQK A;  4AD9 A;  3DXJ F;  2FML A;  4FHT A;  2E1C A;  3RIR A;  3V8K A;  4A0Y A;  5TRD A;  1ZRE A;  2NS0 A;  1I1G A;  4WK8 F;  1ZHF A;  3GO5 A;  4MGR A;  2KIU A;  1KU7 A;  2MLK A;  4XBF A;  4CYD A;  1Z05 A;  2NRA C;  1XMA A;  3I54 A;  1XGO A;  4WCG A;  3T5X A;  1IXS B;  5DD8 A;  1U5T C;  2VBY A;  1SAX A;  1JE8 A;  2A3S A;  2XRO A;  4BAY A;  3J7A O;  2K4J A;  1S7O A;  4HDV A;  5CLS A;  3TDU C;  3ABT A;  1I27 A;  3HRU A;  3BPX A;  3DV8 A;  2QQB A;  4HLY A;  2ELH A;  4BYY A;  1LNW A;  2EFP A;  1BIA A;  1SD6 A;  4OOI A;  2H94 A;  1K79 A;  1QO0 D;  2IT0 A;  1QPM A;  5CYV A;  1SMY F;  2FSW A;  2YPR A;  4Q47 A;  2Y75 A;  3H3U A;  1IRG A;  3M9A A;  5DCF A;  4HDU A;  2VBZ A;  2B0L A;  2LSO A;  1BM9 A;  4G8X A;  3WTZ A;  5L3F A;  1I1S A;  1YLF A;  4KMF A;  3CO7 C;  5LGU A;  4HV6 A;  2XUB A;  5JI6 A;  2QQ9 A;  1KYW A;  1HW2 A;  3RKX A;  3ECH A;  1TNS A;  1OMI A;  4XLP F;  1ZGJ A;  1Z6T A;  2DO7 A;  2YU3 A;  4GO1 A;  1K78 A;  3V7R A;  1J5Y A;  5L3G A;  2VT2 A;  4LLL A;  4IRG A;  3K0L A;  4R1H A;  3D0S A;  4WXD A;  3GW2 A;  3P9K A;  4A6E A;  3I4P A;  2FE3 A;  2IA0 A;  2JZY A;  3QU6 A;  2M5W A;  3HHG A;  1USS A;  3TO6 A;  1MDM A;  4HF2 A;  4AWX B;  2Q0O A;  2NNN A;  1QBJ A;  1U6G A;  4CIC A;  3I59 B;  4MTE A;  5BMZ A;  1G3S A;  2ADU A;  3KEQ A;  3VFZ A;  3OOP A;  2H6B A;  4D0P A;  1K78 B;  2A6H F;  2HR3 A;  2HS5 A;  1FP1 D;  1R00 A;  3J81 K;  1B59 A;  3TOA A;  1KQ9 A;  2O3F A;  4L5I A;  3N4M A;  4BH9 A;  5D5V B;  1ONV A;  1TQP A;  2CSO A;  1OPC A;  3EET A;  5D5U B;  4Y15 A;  1L0O C;  2J5O A;  2UWM A;  4HA8 A;  1HQC A;  1ZLJ A;  3KP7 A;  4OIP F;  2FBI A;  2YX4 A;  4EV0 A;  4BXU A;  2M8E A;  2R3S A;  2EFN A;  4NHJ A;  1P2F A;  2HYG D;  5HS8 A;  3RKW A;  2M30 A;  1F1Z A;  5A2Q Z;  1D8J A;  3IKT A;  1HW5 A;  2XKO A;  2ISZ A;  1TBX A;  4ZYE A;  3NEU A;  2ESH A;  4MTD A;  2LNB A;  3L7W A;  1QNT A;  1IZ1 A;  2DBB A;  1BJA A;  3VEP A;  1XCV A;  2BBY A;  3OV8 A;  3SZT A;  3ECO A;  3LA3 A;  5FO5 A;  3J80 K;  3F8C A;  2HEO A;  2D1V A;  1XGM A;  3KZY A;  2K86 A;  3ELK A;  3QOP A;  1U78 A;  2OAZ A;  1B9M A;  5FLX K;  5DCM A;  2BV6 A;  1HKT A;  4LLN A;  4L0Y B;  5E1W A;  1JGS A;  1BI0 A;  5E20 A;  2MLG A;  1ULY A;  3RJP A;  1ODD A;  1Y0U A;  2MH9 A;  1IN7 A;  1YW7 A;  1LEA A;  4I01 A;  3F21 A;  2Z5U A;  2Z33 A;  2QVO A;  5EEG A;  2X0L A;  4OIQ F;  5E8I A;  3KZZ A;  3WTV C;  1YIO A;  1R36 A;  2QQA A;  5CVI A;  2CWE A;  2YR2 A;  3WOD F;  3WTX C;  4A2U A;  4G94 A;  3T8T A;  4ZYH A;  2FNP A;  1YFH A;  2HDC A;  4EM2 A;  2W57 A;  1LJ9 A;  1JXS A;  4IPA A;  1FPQ A;  2A61 A;  4IXA A;  5D5X B;  1WRJ A;  1H9T A;  2L54 A;  2DU9 A;  3ULQ B;  1R1V A;  3HUG A;  1KU3 A;  4LG0 B;  2FA5 A;  4L9T A;  5H6Q A;  5DDG A;  4CXF A;  2G9W A;  5BOX A;  4I0A A;  2YSR A;  2CFX A;  1TQM A;  2IW5 A;  3KP6 A;  3TO9 A;  1R1T A;  1IN8 A;  5FLX Z;  2XVC A;  3W6J B;  4WX9 A;  3GZ5 A;  4RAY A;  4P55 A;  1W7P A;  2IRF G;  4LJZ F;  2A07 F;  4P5O A;  1OYY A;  4FX0 A;  3TO7 A;  1S29 A;  1B6A A;  5FB2 A;  3FXR A;  3D5L A;  1XD7 A;  3KCC A;  4IJA A;  5DUK A;  5ICC A;  3FMQ A;  5LEK A;  3EQL F;  4I2O A;  3O6B B;  1LB2 A;  2K02 A;  2QZ8 A;  2ZME B;  4RGR A;  2XV4 S;  4ESF A;  1WI9 A;  4IRI A;  2GQQ A;  4BHP A;  1FBU A;  3F8B A;  1ZAO A;  3DPT A;  5BPD A;  4HBL A;  2VE9 A;  1R5G A;  4UUV A;  4PZJ A;  5A2Q K;  5JR3 A;  2G7H A;  1R7J A;  4U0V A;  2FU4 A;  2XIG A;  1B1B A;  1RUO A;  2COM A;  1O57 A;  1P4X A;  2EV0 A;  4I09 A;  1FY7 A;  4WXH A;  5HS7 A;  2XAH A;  3LQR A;  2IPQ X;  3HSR A;  2ZO4 A;  1RNL A;  3IWF A;  5E1X A;  1FBQ A;  2EA4 A;  4HQE A;  5JFR A;  4GYG A;  4Y17 A;  1DUX C;  3IRQ A;  2RNJ A;  2HTS A;  4I0B A;  1T98 A;  4ENM A;  3QU3 A;  1XCB A;  3ML6 A;  2Y48 A;  1XSV A;  1J2X A;  1O3Q A;  2PMU A;  2ZBK A;  1I5Z A;  2D1H A;  3FMS A;  2Z99 A;  3DEU A;  4EGY A;  1JHH A;  4BHC A;  2H6C A;  5CVR A;  2VC1 A;  5HOO A;  3U1D A;  5LRS A;  4G7H F;  4A12 A;  3JSO A;  1J75 A;  3C18 A;  3N97 A;  2W85 A;  1Q1H A;  1XB4 A;  1XN7 A;  4MNU A;  4MHG A;  4LLG F;  1EV7 A;  3I0T A;  1HSJ A;  1S3J A;  3R0J A;  3ABU A;  3MZY A;  4M6Y A;  4I02 A;  2FBK A;  1BI1 A;  3FHZ A;  1L3L A;  2KJC A;  1S6L A;  1XGS A;  2MD5 A;  1W5S A;  3DP7 A;  4ZZD A;  4AVP A;  5ILU A;  3AAF A;  3FZV A;  1KU2 A;  1W4M A;  1RZ4 A;  2H27 A;  3BDD A;  2DLL A;  4RB0 A;  2F5C A;  4H0E A;  4I98 B;  1UHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...