5HDSA

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 3 ps structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 34
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hdsA00
2H28A 1WA9A 2QJ7A 2W27A 4EERA 2VEAA 1S66L 3LYXA 5I5LA 4EEPA 1XJ4A 5TBMB 2WKRA 5TBMA 3A0RA 1XFNA 3CLOA 3CWFA 3LIBA 3F1OB 4H6JB 2ZOHA 4NXGA 2OWHA 4WUJA 2B02A 3P7NA 2P7JA 5A8BA 5KIZA 2VV7A 1LSVA 3LI9A 4LRZE 2PYPA 2V0WA 3MQOA 4R3AA 4HJ4A 3T50A 5HDCA 3NHQA 3EEHA 1T19A 2ZOIA 5HWVA 4HOIA 5HDDA 4E04A 5F68A 4MN5A 3NOPC 2L4RA 4DJ3A 5G4ZA 2CMNA 1Y28A 1OTEA 3E4OA 1ODVA 3LIEA 4H6JA 4HY8A 4KUKA 3C2WA 3RTYA 4LRYC 2BASA 3IS2A 4GCZA 5AVFA 3A0VA 3E4QA 2D01A 2PD7A 4I38A 1GSXA 2V9AA 2VLGA 3ULFA 4RQ9A 3ICYA 3SW1A 4I3IA 1XJ6A 3H7WB 3ZQ5A 1S4RA 1OT9A 2VV8A 4K08A 2ZBBA 2QHKA 5G4YA 2A24A 4JGRA 1MZUA 3LI8A 1OTBA 3IS2B 1LSXA 5J4EA 4WLAA 4HP9A 1T18A 4GS9A 4HJ6A 2QKPA 4I3AA 4R6LA 4B9OA 4L9FA 1GSWA 4HHDA 3UMEA 3BY9A 4WL9A 1N9NA 1F98A 3UB7A 3LUQA 2D02A 5EFWA 3VE3A 4EQ1A 3A0SA 1TS8A 3UMDA 3UB6A 3H9WA 1DP8A 1OT6A 4HH2A 3F1OA 1UWPX 3LIFA 2EA9A 1DP9A 4LRXC 5IS1A 2A24B 3F1NA 1T1AA 1V9YA 3H82A 2PDRA 3NOTC 2JN7A 3VE4A 2OOLA 1OTAA 4LLOB 1XJ3A 2L0WA 1DP6A 4GHIB 1UWNX 1N9LA 4I5SA 2INWA 4HI4A 1GSVA 2PR5A 4L9EA 1X0OA 2Z6DA 1XJ2A 5J7EA 3PHYA 3G6OA 5HSQA 5DKLA 1XFQA 2W0NA 3F1NB 4I3JA 4R70A 3H82B 1OTDA 3B33A 5F6AA 2PR6A 2PHYA 5F69A 2R78A 4XT2B 4F3LA 1LL8A 2VV6A 4HJ3A 4WN5A 3D72A 1S67L 4PKYG 5HD5A 2OWJA 3RH8B 3UB9A 2HV1A 3H7WA 1OJGA 3F1PB 2PYRA 2PD8A 4HQAA 2GJ3A 1T1BA 3BWLA 3LIAA 3MXQA 1N9OA 1LSWA 2JHEA 4HH3A 2Z6CA 4BBTA 4DJ2A 4EW7A 4KUOA 1LT0A 4GS9B 4GW9A 1DRMA 3UB8A 1P0ZA 4F3LB 1F9IA 5AVEA 3CAXA 4NXBA 5DKKA 1D7EA 2J80A 1JNUA 2I9VA 2M1CA 2QJ5A 3FC7A 4MN6A 4KQDA 2WKQA 1P97A 1S4SA 2K7SA 3FG8A 2V1BA 3NJAA 2WKPA 4JGPA 4WF0A 3VOLA 1TS0A 4HP4A 1VB6A 3IBRA 2V1AA 3C8CA 3LIDA 3MFXA 3MJQA 4JGOA 4NXEA 5HZHA 2QWSA 4EXOA 1TS6A 2V0UA 3GDIA 3HJIA 4NXFA 1KOUA 3E4PA 5F5YA 4M4XA 5IU1A 4EETB 3EWKA 3NOUC 4GHIA 4R38A 3BY8A 1UGUA 1EW0A 1G28A 3K3CA 3KX0X 2L1MA 4HNBA 4JGQA 2KDKA 4PKYA 1BYWA 5HWWA 2YKFA 3MQQA 4L9GA 1NWZA 5DJUA 1OTIA 3K3DA 1T1CA 1V9ZA 4LPZA 5J3WA 4XT2A 3OLOA 1S1YA 3PYPA 3UE6A 1OJ5A 5DJTA 5HWTA 4BBUA 5HD3A 3LICA 5HDSA 4EESA 3GECA 3HJKA 4I39A 3MR0A 3F1PA 1TS7A 4HIAA 2YKHA 4BBVA 4EEUA 4YWZA 1D06A 1S1ZA 2KX6A
chains in the Genus database with same CATH superfamily
1WA9A 1KGEA 5A91A 5I5LA 3PAEA 4LV2A 5TBMA 4WUJA 2OWHA 3BRMA 3O87A 4KZ8A 1Z6FA 2WUQA 5DF8A 1ES4A 3EEAA 4FOFA 4A5RA 3P01A 2KOIA 3GTCA 4HOIA 4BWIA 1ESIA 5E2HA 2W3GA 1BULA 3MFDA 3LIEA 4WBGA 4Q0JA 3V67A 4AFIA 2BASA 2ZMFA 4FH2A 1Y4OA 2WGIA 4LV3A 4M3KA 1YPRA 1CEGA 4JPMA 3FPVA 5GLAA 3SOIA 5FDSA 4GS9A 3VFHA 4ID4A 1NJ4A 1VETB 3UB7A 4EQ1A 3IWIA 4DE2A 1PYYA 3LIFA 2EA9A 4P6ZM 1WE4A 3KSGA 1MC0A 3G6OA 3F1NB 3GV9A 2PRFA 4Z9QA 3ZVWA 1VEUB 2ZM0A 5AQ7A 3BWLA 3RXXA 4P6BA 4HH3A 4PAUA 3IX3A 1LT0A 4S2MA 2EWWA 5DKKA 4Y0OA 2V1BA 2NUTC 3UY6A 1JTDA 4EXOA 3NDEA 4UQIS 2Y2GA 3EWKA 1SKOB 4CLCA 1BLCA 3IXGA 4OOLA 5DJUA 1S6RA 4GB7A 4K0XA 3LICA 1K55A 3LR4A 1TS7A 3ZVTA 3MZDA 4LCMA 2ZQ8A 2FZ0A 4NG2A 5CGXA 3RJUA 3S22A 1JWZA 4S2LA 5HAIA 3T1RA 4EBNA 3S7NA 2R9XA 4N1XA 2R9WA 4HJ4A 3O86A 2Y2IA 5EOEA 1H0MA 3LY3A 4R1GA 4H6JA 3SH8A 3C2WA 1P9WA 1W8QA 4E3LA 3BFEA 1GSXA 3D9YA 3PBTA 1TDGA 4K08A 1W7FA 4P85A 3HLGA 1MZUA 3RXWA 1K54C 1LI0A 4HP9A 2HF6A 3BYDA 4L9FA 4IJGA 3Q7VA 3UB6A 3H9WA 3HL9A 3F1NA 2JBFA 4OQIA 1KE4A 2RL3A 3SS4A 1ZG4A 3QP4A 5HSQA 2W0NA 1RGZA 3R7WA 2W3EA 3TRCA 4HJ3A 3L7HA 3ZG8B 2EWVA 4QPRA 3TJZC 2C5WB 2ZM8A 4X6TA 5M19A 3BEBA 4H8RA 2QJ5A 3VMAA 3ITBA 2K7SA 4JGPA 2WZXA 3S1YA 1IYSA 3HLBA 2V0UA 4ZAMA 3E4PA 1YLYA 1W63M 3KX0X 2G2UA 4E3OA 4OLDA 1MBLA 2J8YA 4L9GA 1NWZA 3M6HA 3HUMA 3FZCA 1JWVA 3KSIA 3ZG9B 1D06A 3ZG7B 1VM1A 4E3KA 5EOOA 2V1ZA 3A0RA 3W4QA 1MWTA 4H6JB 5L8MA 3NY4A 5A8BA 1G5UA 3HLFA 3HVFA 4JLFA 3ZDJA 2JKFA 3NOPC 2XFSA 2WAEA 3DWZA 2XEPA 3K2NA 3IS2A 1QMEA 1BLHA 2VK3A 2VV8A 1K38A 4KZ7A 5F82A 3JVVA 4PPRA 2FFYA 4WL9A 4LV1A 1TS8A 3KYEA 1K4FA 4EQIA 1NRJA 3PBSA 1FSWA 1NLZA 1FSYA 1J3WA 1PWCA 4DE1A 3LO7A 2W3FA 3E98A 3KSFA 2ZQ7A 2Y2JA 4CJNA 4WZ4A 1ZKJA 4I3JA 3H82B 2VV6A 2ZC4B 4PKYG 3KSHA 2HV1A 3E2LA 4EW7A 3QP5A 3PR6A 4YINA 3QP1A 4E3JA 3A3DA 3UB8A 1PIOA 2HP5A 1CJFA 3IXBA 5TBMB 1YMSA 1JNUA 4OPZA 4XUXA 4BL2A 5L09A 1S4SA 4LV0A 5L10A 4C75A 3VOLA 1VB6A 4HBTA 2NUPC 4ETZA 1G28A 1LL9A 1XGIA 3MQQA 1H8ZA 1I2SA 3E0YA 3VFFA 2OSUA 3OOVA 3SS3A 3LYXA 4DE0A 3F1OB 4JF5A 3IWOA 4P0MA 2WKEA 5TJJA 3DWKA 1FR6A 1TEMA 4QHCA 4KG5A 1FQGA 5EVEA 4GNUA 4NEED 5M1AA 5BOHA 2WGWB 4OOMA 4LGWA 1F2KA 2PD7A 1MWUA 4IHQA 3Q1FA 1G6OA 1VEUA 2JKGA 2J3WA 4JXGA 3NC8A 3UMEA 1MKIA 3UDFA 3A0SA 4CLCC 4HH2A 3S7OA 5DTTA 2CC1A 3SH7A 3H82A 2PDRA 2Y2KA 1DJBA 4GDNA 4I5SA 2HGVA 2Y2OA 4OONA 1PW8A 5F69A 4F3LA 1AXBA 2Y91A 3C4PA 1S67L 3H7WA 3LY4A 4UQIM 2PYRA 3UE1A 5CEBA 1IYPA 5K5BA 4N1HA 2O0YA 4GS9B 1DJAA 3LCEA 4MN6A 4KQDA 3FG8A 3V39A 1YAXA 4NKPA 5HZHA 4NXEA 2G7UA 3GDIA 4KENB 3N8LA 3D3OA 3ZNYA 3NOUC 4B93A 4RVAA 2M7VA 1CK3A 1OTIA 1D1JA 1FILA 5CHUA 4QD4A 4XT2A 1NLYA 5HWTA 3BJNA 1H3QA 3GECA 3MR0A 5FAPA 3FPWA 2UWXA 1SZVA 1PWDA 2ZQCA 3QP8A 1S1ZA 3S4XA 4S2OA 3DTEA 3ITAA 4UEYA 5EVID 3CWFA 2AVXA 5HDDA 4E04A 2WKHA 1XA1A 4S2PA 1ERMA 1SKOA 4HY8A 1WYBA 3HBRA 4S2NC 4KQRA 2ZL1A 3C7UA 3KYQA 2A49A 4DDSA 3SH9A 2ZQAA 4B9OA 2ZD8A 3WRTA 1F98A 1I2WA 3IH9A 3UMDA 3G2YA 4OKPA 5A93A 4JXVA 4BENA 3VOZA 3MZEA 4E3IA 3B42A 2PR5A 3TW8A 5HX9A 3MXQA 4DJ2A 2JHEA 4WMCA 5F83A 3LEQA 1E3UA 1ZHHB 4X68A 5AVEA 1D7EA 1XP4A 5DF9A 5E2GA 3UE0A 4DMZA 4N92A 2JKTM 3MFXA 4P87A 4WMCD 3T1SA 1K55C 2QWSA 4GHIA 2XH9A 4WLAA 5CGWA 4KZ3A 1NZOA 4IBRA 1XPBA 1IEMA 1L0DA 3IWQA 3A3FA 1K57C 3T4TA 4EEUA 4EERA 2QJ7A 3ZCZA 4OP5A 5FEGA 3QHYA 3WRZA 4JBFA 2P7JA 4LRZE 1LSVA 2XQZA 4PM6A 3NBLA 3NHQA 3BFFA 1A0KA 5EVIB 3V5MA 4P6ZS 1FCOA 4EUZA 3T4QA 4YFMA 2W3HA 3SW1A 1L0GA 1J9MA 1S4RA 5G4YA 4FTXA 2FFFB 2VZWA 2J3TC 3EGDC 1TVFA 1YLTA 2A24A 5HL6A 3T4OA 2XR0A 3BY9A 3I7JA 4JXSA 1EI5A 3BECA 3N7WA 4KZ6A 4JF6A 1H8MA 1AWIA 3VE4A 3UB5P 5FL3A 2O9CA 1U60A 3QNBA 1XJ2A 4R70A 1ONGA 5CHMA 1K25A 2WZZA 2QPNA 1PNEA 4BQMA 3RH8B 3R4KA 3BM6A 3DTIA 3GR2A 2GJ3A 3M2KA 1LSWA 4BBTA 1W8YA 5KMWA 5A92A 1KE0A 3NECA 1GHPA 2M1CA 3MKFA 2Y79A 4D60A 3T4SA 4RX3A 4E3MA 2ZMAA 4Y17A 1TS6A 1W5DA 2EX6A 1Z09A 2X71A 2L1MA 5CHJA 2ZQ9A 1W79A 2HDSA 4WELA 3PYPA 1OJ5A 1O7EA 4ZTKA 5DF7A 4FD8A 5TGFA 3LR3A 4GD8A 1YQSA 3Q7ZA 1L0FA 4QY6A 3WS2A 4R3JA 4L0LA 4IVKA 3T50A 1BSGA 5FQJA 4F94A 2EX8A 5A90A 1CQAA 2VGJA 3PTEA 1YSQA 4DRTA 3R7WB 4EU0A 3ULFA 4RQ9A 5TFQA 3A3JA 3OPRA 4O0PA 1OTBA 5FSRA 4HBUA 5EM1A 3W4OA 1L3LA 5FQQA 4DXBA 1OT6A 4LRXC 3VSLA 5DTKA 3EOIA 1H8YA 4K0WA 1ESUA 1N4OA 1YKDA 3P98A 1IYQA 3G34A 4XT2B 4II7A 2Y2MA 3HREA 4MCWA 2ZLYA 4U0TA 1DRMA 4E6WA 1EROA 2HJEA 1TDLA 3CAXA 4FSFA 3IH8A 1MWSA 1SHVA 1YLZA 3BQ8A 1TS0A 4Y13A 3LIDA 4JGOA 3ZGAB 4X69A 2WYXA 4HEFA 5CRFA 3E2KA 3C4OA 4JGQA 3BFDA 4ESPA 3SZTA 1RP5A 3T4JA 5KSCA 2DCFA 2PAVP 2Z2LB 5HDSA 3HJKA 4YOFA 2YKHA 3MF0A 4DE3A 4YWZA 5C5KA 5HARA 2EX9A 4EEPA 5EECA 3LR0A 3LIBA 5HL1A 4MMNA 1MKMA 4R3AA 5DVAA 2J9PA 2JC7A 4QU3A 2GDNA 4KZAA 4S2JA 3N6IA 3EQVA 3DW0A 5EVIA 4X1LA 3IF6C 1JTGA 2K31A 4EBPA 1RCJA 1LSXA 3G31A 1PWGA 3GSGA 1JVJA 1PW1A 1K0KA 1DJCA 3N8SA 3BW6A 1OTAA 3IT9A 4CPKA 1E25A 3MXRA 1N9LA 2INWA 2VGLS 5DFYA 4BL3A 1KVLA 2IWDA 4Q0IA 2OV5A 5J7EA 2I72A 3QP6A 4KG2A 1Q2PA 4E6XA 2A3UA 3D72A 4IEDA 1PRQA 3F1PB 3O5YA 5FQMA 2H0TA 1OMEA 4F3LB 4WF0A 4OPRA 2VKSA 2W1RA 3DTMA 3UPOA 4MLLA 4ZJ2A 3QP2A 1JWPA 3DBAA 4EETB 3KO6A 5IU1A 3FYZA 5EVLA 3C7VA 2GZAA 2B5RA 1GCEA 2VX8A 2V2FF 2W1TB 4EESA 3NDGA 4HIAA 3CPTA 5DTSA 4BBVA 4IVIA 3IF6A 2XD1A 2ZOHA 4R4SA 1IYOA 2VV7A 3VP3A 4ARZB 2P04A 5GLBA 5FAQA 1PFLA 5GLDA 5CTNA 4MN7A 3W8KA 3TG9A 2Y8HA 2XA7S 3WWXA 1Y54A 2P9VA 3IX4A 2W1TA 3UO9A 1OT9A 3U2AA 3OCNA 2WGWA 5HAQA 3OPHA 3LI8A 5J4EA 4Y15A 3MSHA 4R6LA 3DTKA 1NXYA 1GSWA 4WZ5A 3UNWA 3MBZA 2EFUA 1YM1A 4OOYA 4Q0HA 3JPUA 4QWOA 3VOYA 2J9OA 5FQIA 3Q82A 2DMWA 4LLOB 4C6YA 1Q2QA 1MPLA 3MQ0A 2E8JA 3ZHHA 1BLPA 2A2LA 4HESA 1FR1A 2PR6A 3B3XA 1ALQA 2LB9A 1SDEA 3N8RA 1QMFA 5CEDA 4GW9A 4GD6A 2QYBA 1XXMA 4ZDXA 1YLJA 1K6SA 3T4KA 2IWBA 3NI9A 3C8CA 1BT5A 4Y0TA 2M7UA 3ZG5A 4PM8A 5FQ9A 2KDKA 4PKYA 1G6AA 4NETA 1T1CA 1MY8A 5CX7A 3UE6A 3ZYTA 5HFOA 5GLCA 4CLCD 5FI6A 2HDRA 1KE3A 3KYZA 2O9AA 5HPIA 4GN2A 1W63Q 3LI9A 2JE5A 2JKTI 2P9VB 2WKIA 4S2KA 2HP9A 3HLCA 3BLMA 4LCLA 4LRYC 2XD5A 2D01A 2X02A 1I5QA 3HUNA 1NYMA 2QHKA 3QNCA 1L0EA 2Y2NA 5AQ9A 1HVBA 3IQAA 1N9BA 4FCFA 1NRFA 2P74A 1N9NA 3S7QA 5EFWA 4OQ0A 3F1OA 3T1QB 4R4RA 2A24B 4ZBEA 2DRWA 2OOLA 2WADA 4R0QA 1XJ3A 1UWNX 4EUVA 2QZ6A 1XA7A 1PI5A 4S2NA 5F6AA 2R78A 3S7PA 1LL8A 2H5SA 4QB8A 5HD5A 3UB9A 1GHIA 1VQQA 4Z1WA 2ZMVA 3IHAA 2Z6CA 3OC2A 3WS1A 2O9BA 3NULA 4RX2A 1CEFA 3IF6B 4UA7A 4EV4A 3LGOA 3IBRA 5CERA 1MWRA 3MJQA 1KDSA 3HJIA 1ES2A 1ACFA 4WEJA 2PBYA 1EW0A 4HNBA 3NCKA 1BZAA 3IX8A 2BG1A 1S1YA 3GRJA 4MBKA 4B4XA 3M6BA 4B88A 3FKWA 5IHVA 4LFUA 1TD5A 2XFTA 2WAFA 4XUZA 5TR7A 4KG6A 4O7DA 1G68A 3VP4A 2ZOIA 3LFVA 1FOFA 5EPHA 2L4RA 5G4ZA 1Y28A 4KUOA 4QJGA 3IXDA 2V8FA 2XA7M 1BLSA 3AGFA 2XSSA 4OQHA 3G35A 3ICYA 5G18A 3LR5A 5CGSA 3IBJA 3MKEA 5DFXA 2PU2A 4X25A 3G2ZA 1T18A 2XLNA 5FASA 4HHDA 1IKIA 3IF5A 1K57A 1UWPX 4CQHA 1V9YA 3CUEA 4OQGA 4Y0UA 3Q81A 2Y59A 5FI2A 4L9EA 1X0OA 5CECA 3PHYA 2LB5A 3ZFZA 1ES3A 1OTDA 1IELA 2PHYA 2ZL1B 1DY6A 2XDMA 3BFGA 2PBDP 1PZPA 1T1BA 2EX2A 3LIAA 3GMWA 4GKUA 1F9IA 4ZJ3A 2H0YA 1GA0A 4ME4A 3MS6A 2G2WA 1XKZA 4KZ9A 1BUEA 4GOGA 4Y2FA 3L9KA 1CF0A 3HLWA 5M18A 3CUEC 2OLVA 3K3DA 4WM9A 1HZOA 3T1XA 5FAOA 3HCYA 1KOUA 2KX6A 1XGJA 1XFNA 3CLOA 4FH4A 3TSGA 3P7NA 2HDUA 3PBNA 3Q07A 2MJ6A 3ZNTA 5AJGA 1OTEA 1CI8A 3RTYA 5AVFA 3E4QA 4DDYA 3CHWP 4I38A 2XROA 4S2IA 3B47A 3CMZA 3H7WB 3ZQ5A 4OVDA 3MMHA 4Y7PA 5I94A 2Q0OA 1FCMA 5F1FA 1LHYA 3VE3A 3LUQA 5CXWA 4QY5A 1LLBA 4BMWA 3VP2A 4PMAA 4CLCB 2EFXA 4HI4A 5DKLA 1XFQA 4EBLA 4OPYA 2XGNA 1YSPA 1OJGA 1M6KA 2IA2A 3AGEA 1F5MA 2GX5A 2WKQA 3NJAA 3TOIA 3EQUA 4BJPA 1XX2A 2OAP1 2UV0E 3A3EA 4R3BA 3P09A 1UGUA 4X53A 5GL9A 5HW3A 3ISGA 2X01A 2VA0A 3TE8A 3PBRA 3GQZA 2Y2PA 2BTFP 2H28A 2K2NA 2HPBA 1IKGA 2H10A 5U47A 3W2ZA 4OP8A 4X55A 1TF1A 1KDWA 3N4IA 2JKRM 4MN5A 1HTZA 4Y3IA 1PZOA 5KZHA 3E4OA 4WZ5C 1FCNA 5EUAA 4DF6A 2VGLM 3BFCA 4WEKA 3D4FA 3V50A 4UHUA 4C3QA 4Y5FA 4B4ZA 1LL5A 1DP8A 3LEZA 5IS1A 4JF4A 1T1AA 3NOTC 3DAVA 3C30A 2L0WA 1DP6A 4GHIB 3UDXA 3G32A 1CI9A 2V8CA 3U4LP 1K4EA 3T4LA 2J7VA 1LI9A 1K56D 3BLSA 4MBFA 3NIAA 2C6WB 2VJWA 4CLCE 3WS0A 2V20A 1N9OA 5MC7A 3CZDA 1ES5A 1P0ZA 3HLEA 2J80A 3FC7A 3Q7VB 2WKPA 2OLUA 5EM0A 3OCLA 1E3UD 4NXFA 2JKRI 2ZM2A 3K3CA 5FATA 5AQAA 3T12B 5IT5A 2Z2MB 5FI7A 4NK3A 4BBUA 1GA9A 3UN7A 1PI4A 4OH0A 5GHXA 2RCXA 2HP6A 3CG5A 2W27A 4LENA 1L2SA 4NXGA 4G3VA 3MQOA 2V0WA 4Q8IA 5E2FA 3VP0A 4GZBA 3SS5A 3AGDA 2B95A 3C38A 1K54A 5HPFA 4BLMA 1ODVA 2HZ5A 2GNXA 1SKFA 2Y2HA 1NY0A 2V9AA 4XXRA 5JYPA 1SCWA 4MEZA 4U0XA 3MZFA 1XJ6A 3UPPA 2ZBBA 1HLUP 4R23A 2B18A 4IUKA 3VV4A 4GLQA 4ZJ1A 4MNRA 4G3WA 2Y2LA 2JN7A 4PHTA 1C3BA 1VETA 1STZA 3IHBA 3JYIA 3V3RA 5KSHA 3FKVA 1NZUA 3B33A 3CJMA 5FA7A 3UDIA 1MXOA 4WN5A 2OWJA 3GVBA 1HD8A 2PD8A 4HQAA 1M40A 4WYYA 5AQBA 2ZC5B 4NXBA 2PU4A 2ZC6B 3UE3A 1P97A 2DNSA 4YNRA 1E4DA 3CI6A 3G30A 3WS5A 4ZRRA 5HWWA 2Q9NA 1EWZA 5L2FA 4BD0A 4G3KA 5HD3A 2PT7A 3ZG0A 3F1PA 4DN0A 2ZQDA 1K6RA 3FV7A 2VEAA 1S66L 2Y2QA 4FUWA 1XJ4A 2P08A 4GJ4A 2Q9MA 2B02A 5KIZA 2PYPA 4K91A 3EEHA 1T19A 3FWLA 3HUOA 3VSKA 3PAGA 3C5AA 4BD1A 1YT4A 4DJ3A 3OBFA 4KUKA 4JXWA 5L07A 3A0VA 2VLGA 2EXAA 2QMIA 5D3OA 2VGKA 4UA9A 1SDNA 4PM9A 3CPTB 4JGRA 4JKTA 3HLDA 2ZC7A 4HJ6A 1IFQA 1ZC2A 2QKPA 4OPQA 1ZTUA 2XF3A 3W4PA 1DP9A 5E2EA 2E8IA 2JCHA 1YLPA 3O3VA 1KVMA 3PXPA 4RYEA 1GSVA 1H5XA 3VP1A 3IXHA 4IBXA 4KZ5A 3BQAA 4UAAA 1ERQA 3OZHA 1FIKA 3O88A 4GDBA 3OPPA 1KGGA 3PBOA 2FH5A 2W3DA 4KZBA 4E3NA 2WK0A 2ZJ9A 3CITA 4HP4A 2V1AA 3MXSA 4N9LA 4DKIA 5F5YA 4R38A 2IWCA 4X1MA 3BY8A 4U3TA 4DXCA 2HDQA 1V9ZA 5J3WA 4RA7A 3OLOA 4KQOA 1KGFA 3A3IA 2HJ9C 3UPNA 3M2JA 5HAPA 2XRNA 4KZ4A 1O07A 4N9KA 2WKRA 5JYOA 4O8GA 1K56A 2OAQ1 5HDCA 3PBQA 5HWVA 1BTLA 1P9RA 5F68A 1YLWA 2CMNA 2ZC3B 4GCZA 4X56A 1ZG6A 1IOUA 3V3SA 4I3IA 1ONHA 2KLIA 5EE8A 3JVUA 2XK1A 3IS2B 4IUHA 4I3AA 1RGYA 2D02A 3WS4A 2Y55A 2ACGA 5FDHA 4PM7A 4PM5A 2O99A 5FEFA 2Z6DA 4KQQA 5J8XA 4D2OA 2EXBA 5CTMA 4MBHA 5GHZA 3EGXC 5F1GA 1GHMA 5E43A 5FQKA 1OPXA 2BLSA 2I9VA 5GHYA 4OLGA 2Y4AA 2J3TD 2WGVA 3G4PA 1VHMA 5LBRA 4ARZA 4M4XA 5EV0A 4O01A 1BYWA 2YKFA 3OPLA 1YMXA 4LPZA 1WYCA 4ETXA 5DJTA 1NYYA 4I39A 4MDZA 1S0WA 3RFBA 4UA6A 4EWFA 5EVIC
chains in the Genus database with same CATH topology
2H28A 1WA9A 5I5LA 2K2NA 4UEYA 5TBMA 3W2ZA 3CWFA 4WUJA 2ZOHA 1TF1A 2OWHA 2VV7A 4ARZB 2P04A 3EEAA 4FOFA 3P01A 2KOIA 4HOIA 5HDDA 4BWIA 4E04A 2JKRM 4MN5A 4Y3IA 4MN7A 2W3GA 3E4OA 3LIEA 4HY8A 4Q0JA 3V67A 4AFIA 2BASA 2Y8HA 2ZMFA 2XA7S 2VGLM 4WEKA 2W1TA 3KYQA 1OT9A 3U2AA 3OCNA 3FPVA 3LI8A 5J4EA 4R6LA 4Y5FA 4GS9A 4B9OA 1GSWA 3UB7A 1F98A 4EQ1A 3UMDA 1DP8A 3LIFA 2EA9A 5IS1A 4P6ZM 1T1AA 3KSGA 4Q0HA 3NOTC 1MC0A 2DMWA 3C30A 4LLOB 2L0WA 1DP6A 4GHIB 3B42A 3T4LA 3MQ0A 2PR5A 3G6OA 3F1NB 2A2LA 3TW8A 2PR6A 2VJWA 4CLCE 2LB9A 3BWLA 3MXQA 4DJ2A 1N9OA 2JHEA 4HH3A 5MC7A 4PAUA 1ZHHB 1LT0A 4GW9A 1P0ZA 2EWWA 5DKKA 5AVEA 1D7EA 2J80A 2QYBA 5DF9A 3FC7A 2V1BA 2NUTC 2WKPA 4DMZA 3T4KA 2JKTM 3C8CA 3MFXA 3OCLA 2QWSA 4EXOA 4NXFA 4UQIS 2M7UA 3EWKA 4GHIA 2JKRI 4CLCA 4WLAA 3K3CA 2KDKA 4PKYA 5IT5A 4OOLA 5DJUA 1T1CA 5CX7A 3UE6A 3ZYTA 4BBUA 3LICA 3T4TA 4CLCD 3LR4A 1TS7A 4EEUA 2FZ0A 2W27A 2QJ7A 3KYZA 4EERA 2O9AA 5HPIA 4NXGA 4G3VA 3S7NA 2P7JA 1W63Q 1LSVA 3LI9A 4LRZE 3MQOA 2V0WA 4HJ4A 3NHQA 2JKTI 4P6ZS 3C38A 5HPFA 4H6JA 1ODVA 3C2WA 4LRYC 1P9WA 2GNXA 2D01A 1GSXA 3T4QA 2V9AA 2W3HA 3PBTA 3SW1A 1XJ6A 1S4RA 4K08A 2ZBBA 2QHKA 2B18A 5G4YA 2VZWA 2J3TC 3EGDC 2A24A 1MZUA 4IUKA 3VV4A 4GLQA 4HP9A 2HF6A 5HL6A 3T4OA 4L9FA 3BY9A 1N9NA 3S7QA 5EFWA 4IJGA 4G3WA 3UB6A 3H9WA 3F1OA 2A24B 1H8MA 3F1NA 2JN7A 3VE4A 2OOLA 4PHTA 1XJ3A 1UWNX 5FL3A 1STZA 2O9CA 4EUVA 5KSHA 1XJ2A 5HSQA 2W0NA 4R70A 3B33A 3R7WA 5F6AA 2W3EA 3TRCA 2R78A 3S7PA 1LL8A 4HJ3A 4WN5A 5HD5A 2OWJA 3RH8B 3UB9A 3R4KA 2EWVA 4Z1WA 2PD8A 4HQAA 4QPRA 2GJ3A 3TJZC 2ZMVA 1LSWA 4BBTA 2Z6CA 3OC2A 2O9BA 4NXBA 2M1CA 2QJ5A 3UE3A 1P97A 2K7SA 4JGPA 4YNRA 2Y79A 3IBRA 3T4SA 3MJQA 3CI6A 1TS6A 2V0UA 3HJIA 3E4PA 4WEJA 1W63M 3KX0X 1EW0A 2L1MA 4HNBA 4ZRRA 5HWWA 4L9GA 1NWZA 4WELA 1S1YA 3PYPA 4G3KA 1OJ5A 5HD3A 2PT7A 3F1PA 3KSIA 4DN0A 1D06A 1TD5A 2VEAA 1S66L 3LR3A 1XJ4A 3A0RA 2P08A 4GJ4A 4H6JB 5L8MA 2B02A 5A8BA 5KIZA 4L0LA 2PYPA 3T50A 3EEHA 1T19A 2ZOIA 3LFVA 3NOPC 2L4RA 4DJ3A 5G4ZA 1Y28A 4KUOA 3OBFA 4KUKA 3K2NA 2XA7M 3IS2A 1YSQA 3A0VA 3R7WB 4EU0A 2XSSA 2VLGA 3ULFA 4RQ9A 3ICYA 3LR5A 2VV8A 3IBJA 4O0PA 5DFXA 4JGRA 1OTBA 3JVVA 1T18A 1IFQA 4HJ6A 2QKPA 4HHDA 1ZTUA 4WL9A 1TS8A 1OT6A 1UWPX 4CQHA 1DP9A 4LRXC 1NRJA 1V9YA 3EOIA 3PBSA 1NLZA 3CUEA 3PXPA 2W3FA 1GSVA 3E98A 1YKDA 3KSFA 1X0OA 4L9EA 3PHYA 2LB5A 4I3JA 3H82B 1OTDA 2PHYA 4XT2B 2VV6A 3BQAA 4PKYG 3KSHA 2HV1A 4II7A 3PBOA 1T1BA 3LIAA 4MCWA 4EW7A 3PR6A 2FH5A 2W3DA 1DRMA 3UB8A 1F9IA 2HJEA 5TBMB 3CAXA 4FSFA 1JNUA 1S4SA 3CITA 3BQ8A 4ME4A 3VOLA 1TS0A 4HP4A 1VB6A 2V1AA 3LIDA 4JGOA 2NUPC 5F5YA 4ETZA 4Y2FA 4R38A 3BY8A 4JGQA 1G28A 3MQQA 3CUEC 3K3DA 1V9ZA 5J3WA 3T4JA 3OLOA 3E0YA 5HDSA 3HJKA 4YOFA 2YKHA 3OOVA 3MF0A 4KQOA 2HJ9C 4YWZA 3HCYA 5C5KA 1KOUA 2KX6A 2XRNA 3LYXA 4EEPA 2WKRA 1XFNA 3CLOA 3LR0A 3LIBA 3F1OB 4O8GA 4MMNA 3P7NA 1MKMA 2OAQ1 5TJJA 3PBNA 4R3AA 5HDCA 3PBQA 2MJ6A 5HWVA 1P9RA 4NEED 5AJGA 5F68A 2CMNA 1OTEA 4OOMA 3RTYA 4GCZA 5AVFA 3E4QA 2PD7A 3EQVA 4I38A 2XROA 1IOUA 4I3IA 3B47A 3H7WB 4IHQA 3ZQ5A 1G6OA 2KLIA 3MMHA 2K31A 3JVUA 2J3WA 3IS2B 1LSXA 4IUHA 4I3AA 3UMEA 3VE3A 3LUQA 2D02A 3A0SA 4CLCC 4HH2A 3S7OA 4BMWA 3H82A 2PDRA 3BW6A 1OTAA 2O99A 1N9LA 4I5SA 4CLCB 2HGVA 2INWA 2VGLS 5DFYA 4HI4A 4Q0IA 5J7EA 2Z6DA 5DKLA 1XFQA 1YSPA 5F69A 4F3LA 3D72A 1S67L 3EGXC 3H7WA 1OJGA 3F1PB 4UQIM 2PYRA 3O5YA 5K5BA 2O0YA 1OPXA 4GS9B 4F3LB 2IA2A 2I9VA 1F5MA 2GX5A 4MN6A 4KQDA 2WKQA 3NJAA 4WF0A 3FG8A 2J3TD 2VKSA 3EQUA 2W1RA 1VHMA 1YAXA 5LBRA 4ARZA 4BJPA 4NKPA 5HZHA 2OAP1 4NXEA 2G7UA 3DBAA 3GDIA 4EETB 4M4XA 3D3OA 3KO6A 3NOUC 5IU1A 4B93A 1UGUA 4O01A 1BYWA 2YKFA 2M7VA 1OTIA 2GZAA 2VX8A 4LPZA 2W1TB 4XT2A 4ETXA 5DJTA 1NLYA 5HWTA 2VA0A 3TE8A 3BJNA 4EESA 1H3QA 3GECA 4I39A 3MR0A 4HIAA 3PBRA 4BBVA 4MDZA 3RFBA 3FPWA 1S1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H28 A;  1WA9 A;  2QJ7 A;  2W27 A;  4EER A;  2VEA A;  1S66 L;  3LYX A;  5I5L A;  4EEP A;  1XJ4 A;  5TBM B;  2WKR A;  5TBM A;  3A0R A;  1XFN A;  3CLO A;  3CWF A;  3LIB A;  3F1O B;  4H6J B;  2ZOH A;  4NXG A;  2OWH A;  4WUJ A;  2B02 A;  3P7N A;  2P7J A;  5A8B A;  5KIZ A;  2VV7 A;  1LSV A;  3LI9 A;  4LRZ E;  2PYP A;  2V0W A;  3MQO A;  4R3A A;  4HJ4 A;  3T50 A;  5HDC A;  3NHQ A;  3EEH A;  1T19 A;  2ZOI A;  5HWV A;  4HOI A;  5HDD A;  4E04 A;  5F68 A;  4MN5 A;  3NOP C;  2L4R A;  4DJ3 A;  5G4Z A;  2CMN A;  1Y28 A;  1OTE A;  3E4O A;  1ODV A;  3LIE A;  4H6J A;  4HY8 A;  4KUK A;  3C2W A;  3RTY A;  4LRY C;  2BAS A;  3IS2 A;  4GCZ A;  5AVF A;  3A0V A;  3E4Q A;  2D01 A;  2PD7 A;  4I38 A;  1GSX A;  2V9A A;  2VLG A;  3ULF A;  4RQ9 A;  3ICY A;  3SW1 A;  4I3I A;  1XJ6 A;  3H7W B;  3ZQ5 A;  1S4R A;  1OT9 A;  2VV8 A;  4K08 A;  2ZBB A;  2QHK A;  5G4Y A;  2A24 A;  4JGR A;  1MZU A;  3LI8 A;  1OTB A;  3IS2 B;  1LSX A;  5J4E A;  4WLA A;  4HP9 A;  1T18 A;  4GS9 A;  4HJ6 A;  2QKP A;  4I3A A;  4R6L A;  4B9O A;  4L9F A;  1GSW A;  4HHD A;  3UME A;  3BY9 A;  4WL9 A;  1N9N A;  1F98 A;  3UB7 A;  3LUQ A;  2D02 A;  5EFW A;  3VE3 A;  4EQ1 A;  3A0S A;  1TS8 A;  3UMD A;  3UB6 A;  3H9W A;  1DP8 A;  1OT6 A;  4HH2 A;  3F1O A;  1UWP X;  3LIF A;  2EA9 A;  1DP9 A;  4LRX C;  5IS1 A;  2A24 B;  3F1N A;  1T1A A;  1V9Y A;  3H82 A;  2PDR A;  3NOT C;  2JN7 A;  3VE4 A;  2OOL A;  1OTA A;  4LLO B;  1XJ3 A;  2L0W A;  1DP6 A;  4GHI B;  1UWN X;  1N9L A;  4I5S A;  2INW A;  4HI4 A;  1GSV A;  2PR5 A;  4L9E A;  1X0O A;  2Z6D A;  1XJ2 A;  5J7E A;  3PHY A;  3G6O A;  5HSQ A;  5DKL A;  1XFQ A;  2W0N A;  3F1N B;  4I3J A;  4R70 A;  3H82 B;  1OTD A;  3B33 A;  5F6A A;  2PR6 A;  2PHY A;  5F69 A;  2R78 A;  4XT2 B;  4F3L A;  1LL8 A;  2VV6 A;  4HJ3 A;  4WN5 A;  3D72 A;  1S67 L;  4PKY G;  5HD5 A;  2OWJ A;  3RH8 B;  3UB9 A;  2HV1 A;  3H7W A;  1OJG A;  3F1P B;  2PYR A;  2PD8 A;  4HQA A;  2GJ3 A;  1T1B A;  3BWL A;  3LIA A;  3MXQ A;  1N9O A;  1LSW A;  2JHE A;  4HH3 A;  2Z6C A;  4BBT A;  4DJ2 A;  4EW7 A;  4KUO A;  1LT0 A;  4GS9 B;  4GW9 A;  1DRM A;  3UB8 A;  1P0Z A;  4F3L B;  1F9I A;  5AVE A;  3CAX A;  4NXB A;  5DKK A;  1D7E A;  2J80 A;  1JNU A;  2I9V A;  2M1C A;  2QJ5 A;  3FC7 A;  4MN6 A;  4KQD A;  2WKQ A;  1P97 A;  1S4S A;  2K7S A;  3FG8 A;  2V1B A;  3NJA A;  2WKP A;  4JGP A;  4WF0 A;  3VOL A;  1TS0 A;  4HP4 A;  1VB6 A;  3IBR A;  2V1A A;  3C8C A;  3LID A;  3MFX A;  3MJQ A;  4JGO A;  4NXE A;  5HZH A;  2QWS A;  4EXO A;  1TS6 A;  2V0U A;  3GDI A;  3HJI A;  4NXF A;  1KOU A;  3E4P A;  5F5Y A;  4M4X A;  5IU1 A;  4EET B;  3EWK A;  3NOU C;  4GHI A;  4R38 A;  3BY8 A;  1UGU A;  1EW0 A;  1G28 A;  3K3C A;  3KX0 X;  2L1M A;  4HNB A;  4JGQ A;  2KDK A;  4PKY A;  1BYW A;  5HWW A;  2YKF A;  3MQQ A;  4L9G A;  1NWZ A;  5DJU A;  1OTI A;  3K3D A;  1T1C A;  1V9Z A;  4LPZ A;  5J3W A;  4XT2 A;  3OLO A;  1S1Y A;  3PYP A;  3UE6 A;  1OJ5 A;  5DJT A;  5HWT A;  4BBU A;  5HD3 A;  3LIC A;  5HDS A;  4EES A;  3GEC A;  3HJK A;  4I39 A;  3MR0 A;  3F1P A;  1TS7 A;  4HIA A;  2YKH A;  4BBV A;  4EEU A;  4YWZ A;  1D06 A;  1S1Z A;  2KX6 A; 
#chains in the Genus database with same CATH topology
 1WA9 A;  1KGE A;  5A91 A;  5I5L A;  3PAE A;  4LV2 A;  5TBM A;  4WUJ A;  2OWH A;  3BRM A;  3O87 A;  4KZ8 A;  1Z6F A;  2WUQ A;  5DF8 A;  1ES4 A;  3EEA A;  4FOF A;  4A5R A;  3P01 A;  2KOI A;  3GTC A;  4HOI A;  4BWI A;  1ESI A;  5E2H A;  2W3G A;  1BUL A;  3MFD A;  3LIE A;  4WBG A;  4Q0J A;  3V67 A;  4AFI A;  2BAS A;  2ZMF A;  4FH2 A;  1Y4O A;  2WGI A;  4LV3 A;  4M3K A;  1YPR A;  1CEG A;  4JPM A;  3FPV A;  5GLA A;  3SOI A;  5FDS A;  4GS9 A;  3VFH A;  4ID4 A;  1NJ4 A;  1VET B;  3UB7 A;  4EQ1 A;  3IWI A;  4DE2 A;  1PYY A;  3LIF A;  2EA9 A;  4P6Z M;  1WE4 A;  3KSG A;  1MC0 A;  3G6O A;  3F1N B;  3GV9 A;  2PRF A;  4Z9Q A;  3ZVW A;  1VEU B;  2ZM0 A;  5AQ7 A;  3BWL A;  3RXX A;  4P6B A;  4HH3 A;  4PAU A;  3IX3 A;  1LT0 A;  4S2M A;  2EWW A;  5DKK A;  4Y0O A;  2V1B A;  2NUT C;  3UY6 A;  1JTD A;  4EXO A;  3NDE A;  4UQI S;  2Y2G A;  3EWK A;  1SKO B;  4CLC A;  1BLC A;  3IXG A;  4OOL A;  5DJU A;  1S6R A;  4GB7 A;  4K0X A;  3LIC A;  1K55 A;  3LR4 A;  1TS7 A;  3ZVT A;  3MZD A;  4LCM A;  2ZQ8 A;  2FZ0 A;  4NG2 A;  5CGX A;  3RJU A;  3S22 A;  1JWZ A;  4S2L A;  5HAI A;  3T1R A;  4EBN A;  3S7N A;  2R9X A;  4N1X A;  2R9W A;  4HJ4 A;  3O86 A;  2Y2I A;  5EOE A;  1H0M A;  3LY3 A;  4R1G A;  4H6J A;  3SH8 A;  3C2W A;  1P9W A;  1W8Q A;  4E3L A;  3BFE A;  1GSX A;  3D9Y A;  3PBT A;  1TDG A;  4K08 A;  1W7F A;  4P85 A;  3HLG A;  1MZU A;  3RXW A;  1K54 C;  1LI0 A;  4HP9 A;  2HF6 A;  3BYD A;  4L9F A;  4IJG A;  3Q7V A;  3UB6 A;  3H9W A;  3HL9 A;  3F1N A;  2JBF A;  4OQI A;  1KE4 A;  2RL3 A;  3SS4 A;  1ZG4 A;  3QP4 A;  5HSQ A;  2W0N A;  1RGZ A;  3R7W A;  2W3E A;  3TRC A;  4HJ3 A;  3L7H A;  3ZG8 B;  2EWV A;  4QPR A;  3TJZ C;  2C5W B;  2ZM8 A;  4X6T A;  5M19 A;  3BEB A;  4H8R A;  2QJ5 A;  3VMA A;  3ITB A;  2K7S A;  4JGP A;  2WZX A;  3S1Y A;  1IYS A;  3HLB A;  2V0U A;  4ZAM A;  3E4P A;  1YLY A;  1W63 M;  3KX0 X;  2G2U A;  4E3O A;  4OLD A;  1MBL A;  2J8Y A;  4L9G A;  1NWZ A;  3M6H A;  3HUM A;  3FZC A;  1JWV A;  3KSI A;  3ZG9 B;  1D06 A;  3ZG7 B;  1VM1 A;  4E3K A;  5EOO A;  2V1Z A;  3A0R A;  3W4Q A;  1MWT A;  4H6J B;  5L8M A;  3NY4 A;  5A8B A;  1G5U A;  3HLF A;  3HVF A;  4JLF A;  3ZDJ A;  2JKF A;  3NOP C;  2XFS A;  2WAE A;  3DWZ A;  2XEP A;  3K2N A;  3IS2 A;  1QME A;  1BLH A;  2VK3 A;  2VV8 A;  1K38 A;  4KZ7 A;  5F82 A;  3JVV A;  4PPR A;  2FFY A;  4WL9 A;  4LV1 A;  1TS8 A;  3KYE A;  1K4F A;  4EQI A;  1NRJ A;  3PBS A;  1FSW A;  1NLZ A;  1FSY A;  1J3W A;  1PWC A;  4DE1 A;  3LO7 A;  2W3F A;  3E98 A;  3KSF A;  2ZQ7 A;  2Y2J A;  4CJN A;  4WZ4 A;  1ZKJ A;  4I3J A;  3H82 B;  2VV6 A;  2ZC4 B;  4PKY G;  3KSH A;  2HV1 A;  3E2L A;  4EW7 A;  3QP5 A;  3PR6 A;  4YIN A;  3QP1 A;  4E3J A;  3A3D A;  3UB8 A;  1PIO A;  2HP5 A;  1CJF A;  3IXB A;  5TBM B;  1YMS A;  1JNU A;  4OPZ A;  4XUX A;  4BL2 A;  5L09 A;  1S4S A;  4LV0 A;  5L10 A;  4C75 A;  3VOL A;  1VB6 A;  4HBT A;  2NUP C;  4ETZ A;  1G28 A;  1LL9 A;  1XGI A;  3MQQ A;  1H8Z A;  1I2S A;  3E0Y A;  3VFF A;  2OSU A;  3OOV A;  3SS3 A;  3LYX A;  4DE0 A;  3F1O B;  4JF5 A;  3IWO A;  4P0M A;  2WKE A;  5TJJ A;  3DWK A;  1FR6 A;  1TEM A;  4QHC A;  4KG5 A;  1FQG A;  5EVE A;  4GNU A;  4NEE D;  5M1A A;  5BOH A;  2WGW B;  4OOM A;  4LGW A;  1F2K A;  2PD7 A;  1MWU A;  4IHQ A;  3Q1F A;  1G6O A;  1VEU A;  2JKG A;  2J3W A;  4JXG A;  3NC8 A;  3UME A;  1MKI A;  3UDF A;  3A0S A;  4CLC C;  4HH2 A;  3S7O A;  5DTT A;  2CC1 A;  3SH7 A;  3H82 A;  2PDR A;  2Y2K A;  1DJB A;  4GDN A;  4I5S A;  2HGV A;  2Y2O A;  4OON A;  1PW8 A;  5F69 A;  4F3L A;  1AXB A;  2Y91 A;  3C4P A;  1S67 L;  3H7W A;  3LY4 A;  4UQI M;  2PYR A;  3UE1 A;  5CEB A;  1IYP A;  5K5B A;  4N1H A;  2O0Y A;  4GS9 B;  1DJA A;  3LCE A;  4MN6 A;  4KQD A;  3FG8 A;  3V39 A;  1YAX A;  4NKP A;  5HZH A;  4NXE A;  2G7U A;  3GDI A;  4KEN B;  3N8L A;  3D3O A;  3ZNY A;  3NOU C;  4B93 A;  4RVA A;  2M7V A;  1CK3 A;  1OTI A;  1D1J A;  1FIL A;  5CHU A;  4QD4 A;  4XT2 A;  1NLY A;  5HWT A;  3BJN A;  1H3Q A;  3GEC A;  3MR0 A;  5FAP A;  3FPW A;  2UWX A;  1SZV A;  1PWD A;  2ZQC A;  3QP8 A;  1S1Z A;  3S4X A;  4S2O A;  3DTE A;  3ITA A;  4UEY A;  5EVI D;  3CWF A;  2AVX A;  5HDD A;  4E04 A;  2WKH A;  1XA1 A;  4S2P A;  1ERM A;  1SKO A;  4HY8 A;  1WYB A;  3HBR A;  4S2N C;  4KQR A;  2ZL1 A;  3C7U A;  3KYQ A;  2A49 A;  4DDS A;  3SH9 A;  2ZQA A;  4B9O A;  2ZD8 A;  3WRT A;  1F98 A;  1I2W A;  3IH9 A;  3UMD A;  3G2Y A;  4OKP A;  5A93 A;  4JXV A;  4BEN A;  3VOZ A;  3MZE A;  4E3I A;  3B42 A;  2PR5 A;  3TW8 A;  5HX9 A;  3MXQ A;  4DJ2 A;  2JHE A;  4WMC A;  5F83 A;  3LEQ A;  1E3U A;  1ZHH B;  4X68 A;  5AVE A;  1D7E A;  1XP4 A;  5DF9 A;  5E2G A;  3UE0 A;  4DMZ A;  4N92 A;  2JKT M;  3MFX A;  4P87 A;  4WMC D;  3T1S A;  1K55 C;  2QWS A;  4GHI A;  2XH9 A;  4WLA A;  5CGW A;  4KZ3 A;  1NZO A;  4IBR A;  1XPB A;  1IEM A;  1L0D A;  3IWQ A;  3A3F A;  1K57 C;  3T4T A;  4EEU A;  4EER A;  2QJ7 A;  3ZCZ A;  4OP5 A;  5FEG A;  3QHY A;  3WRZ A;  4JBF A;  2P7J A;  4LRZ E;  1LSV A;  2XQZ A;  4PM6 A;  3NBL A;  3NHQ A;  3BFF A;  1A0K A;  5EVI B;  3V5M A;  4P6Z S;  1FCO A;  4EUZ A;  3T4Q A;  4YFM A;  2W3H A;  3SW1 A;  1L0G A;  1J9M A;  1S4R A;  5G4Y A;  4FTX A;  2FFF B;  2VZW A;  2J3T C;  3EGD C;  1TVF A;  1YLT A;  2A24 A;  5HL6 A;  3T4O A;  2XR0 A;  3BY9 A;  3I7J A;  4JXS A;  1EI5 A;  3BEC A;  3N7W A;  4KZ6 A;  4JF6 A;  1H8M A;  1AWI A;  3VE4 A;  3UB5 P;  5FL3 A;  2O9C A;  1U60 A;  3QNB A;  1XJ2 A;  4R70 A;  1ONG A;  5CHM A;  1K25 A;  2WZZ A;  2QPN A;  1PNE A;  4BQM A;  3RH8 B;  3R4K A;  3BM6 A;  3DTI A;  3GR2 A;  2GJ3 A;  3M2K A;  1LSW A;  4BBT A;  1W8Y A;  5KMW A;  5A92 A;  1KE0 A;  3NEC A;  1GHP A;  2M1C A;  3MKF A;  2Y79 A;  4D60 A;  3T4S A;  4RX3 A;  4E3M A;  2ZMA A;  4Y17 A;  1TS6 A;  1W5D A;  2EX6 A;  1Z09 A;  2X71 A;  2L1M A;  5CHJ A;  2ZQ9 A;  1W79 A;  2HDS A;  4WEL A;  3PYP A;  1OJ5 A;  1O7E A;  4ZTK A;  5DF7 A;  4FD8 A;  5TGF A;  3LR3 A;  4GD8 A;  1YQS A;  3Q7Z A;  1L0F A;  4QY6 A;  3WS2 A;  4R3J A;  4L0L A;  4IVK A;  3T50 A;  1BSG A;  5FQJ A;  4F94 A;  2EX8 A;  5A90 A;  1CQA A;  2VGJ A;  3PTE A;  1YSQ A;  4DRT A;  3R7W B;  4EU0 A;  3ULF A;  4RQ9 A;  5TFQ A;  3A3J A;  3OPR A;  4O0P A;  1OTB A;  5FSR A;  4HBU A;  5EM1 A;  3W4O A;  1L3L A;  5FQQ A;  4DXB A;  1OT6 A;  4LRX C;  3VSL A;  5DTK A;  3EOI A;  1H8Y A;  4K0W A;  1ESU A;  1N4O A;  1YKD A;  3P98 A;  1IYQ A;  3G34 A;  4XT2 B;  4II7 A;  2Y2M A;  3HRE A;  4MCW A;  2ZLY A;  4U0T A;  1DRM A;  4E6W A;  1ERO A;  2HJE A;  1TDL A;  3CAX A;  4FSF A;  3IH8 A;  1MWS A;  1SHV A;  1YLZ A;  3BQ8 A;  1TS0 A;  4Y13 A;  3LID A;  4JGO A;  3ZGA B;  4X69 A;  2WYX A;  4HEF A;  5CRF A;  3E2K A;  3C4O A;  4JGQ A;  3BFD A;  4ESP A;  3SZT A;  1RP5 A;  3T4J A;  5KSC A;  2DCF A;  2PAV P;  2Z2L B;  5HDS A;  3HJK A;  4YOF A;  2YKH A;  3MF0 A;  4DE3 A;  4YWZ A;  5C5K A;  5HAR A;  2EX9 A;  4EEP A;  5EEC A;  3LR0 A;  3LIB A;  5HL1 A;  4MMN A;  1MKM A;  4R3A A;  5DVA A;  2J9P A;  2JC7 A;  4QU3 A;  2GDN A;  4KZA A;  4S2J A;  3N6I A;  3EQV A;  3DW0 A;  5EVI A;  4X1L A;  3IF6 C;  1JTG A;  2K31 A;  4EBP A;  1RCJ A;  1LSX A;  3G31 A;  1PWG A;  3GSG A;  1JVJ A;  1PW1 A;  1K0K A;  1DJC A;  3N8S A;  3BW6 A;  1OTA A;  3IT9 A;  4CPK A;  1E25 A;  3MXR A;  1N9L A;  2INW A;  2VGL S;  5DFY A;  4BL3 A;  1KVL A;  2IWD A;  4Q0I A;  2OV5 A;  5J7E A;  2I72 A;  3QP6 A;  4KG2 A;  1Q2P A;  4E6X A;  2A3U A;  3D72 A;  4IED A;  1PRQ A;  3F1P B;  3O5Y A;  5FQM A;  2H0T A;  1OME A;  4F3L B;  4WF0 A;  4OPR A;  2VKS A;  2W1R A;  3DTM A;  3UPO A;  4MLL A;  4ZJ2 A;  3QP2 A;  1JWP A;  3DBA A;  4EET B;  3KO6 A;  5IU1 A;  3FYZ A;  5EVL A;  3C7V A;  2GZA A;  2B5R A;  1GCE A;  2VX8 A;  2V2F F;  2W1T B;  4EES A;  3NDG A;  4HIA A;  3CPT A;  5DTS A;  4BBV A;  4IVI A;  3IF6 A;  2XD1 A;  2ZOH A;  4R4S A;  1IYO A;  2VV7 A;  3VP3 A;  4ARZ B;  2P04 A;  5GLB A;  5FAQ A;  1PFL A;  5GLD A;  5CTN A;  4MN7 A;  3W8K A;  3TG9 A;  2Y8H A;  2XA7 S;  3WWX A;  1Y54 A;  2P9V A;  3IX4 A;  2W1T A;  3UO9 A;  1OT9 A;  3U2A A;  3OCN A;  2WGW A;  5HAQ A;  3OPH A;  3LI8 A;  5J4E A;  4Y15 A;  3MSH A;  4R6L A;  3DTK A;  1NXY A;  1GSW A;  4WZ5 A;  3UNW A;  3MBZ A;  2EFU A;  1YM1 A;  4OOY A;  4Q0H A;  3JPU A;  4QWO A;  3VOY A;  2J9O A;  5FQI A;  3Q82 A;  2DMW A;  4LLO B;  4C6Y A;  1Q2Q A;  1MPL A;  3MQ0 A;  2E8J A;  3ZHH A;  1BLP A;  2A2L A;  4HES A;  1FR1 A;  2PR6 A;  3B3X A;  1ALQ A;  2LB9 A;  1SDE A;  3N8R A;  1QMF A;  5CED A;  4GW9 A;  4GD6 A;  2QYB A;  1XXM A;  4ZDX A;  1YLJ A;  1K6S A;  3T4K A;  2IWB A;  3NI9 A;  3C8C A;  1BT5 A;  4Y0T A;  2M7U A;  3ZG5 A;  4PM8 A;  5FQ9 A;  2KDK A;  4PKY A;  1G6A A;  4NET A;  1T1C A;  1MY8 A;  5CX7 A;  3UE6 A;  3ZYT A;  5HFO A;  5GLC A;  4CLC D;  5FI6 A;  2HDR A;  1KE3 A;  3KYZ A;  2O9A A;  5HPI A;  4GN2 A;  1W63 Q;  3LI9 A;  2JE5 A;  2JKT I;  2P9V B;  2WKI A;  4S2K A;  2HP9 A;  3HLC A;  3BLM A;  4LCL A;  4LRY C;  2XD5 A;  2D01 A;  2X02 A;  1I5Q A;  3HUN A;  1NYM A;  2QHK A;  3QNC A;  1L0E A;  2Y2N A;  5AQ9 A;  1HVB A;  3IQA A;  1N9B A;  4FCF A;  1NRF A;  2P74 A;  1N9N A;  3S7Q A;  5EFW A;  4OQ0 A;  3F1O A;  3T1Q B;  4R4R A;  2A24 B;  4ZBE A;  2DRW A;  2OOL A;  2WAD A;  4R0Q A;  1XJ3 A;  1UWN X;  4EUV A;  2QZ6 A;  1XA7 A;  1PI5 A;  4S2N A;  5F6A A;  2R78 A;  3S7P A;  1LL8 A;  2H5S A;  4QB8 A;  5HD5 A;  3UB9 A;  1GHI A;  1VQQ A;  4Z1W A;  2ZMV A;  3IHA A;  2Z6C A;  3OC2 A;  3WS1 A;  2O9B A;  3NUL A;  4RX2 A;  1CEF A;  3IF6 B;  4UA7 A;  4EV4 A;  3LGO A;  3IBR A;  5CER A;  1MWR A;  3MJQ A;  1KDS A;  3HJI A;  1ES2 A;  1ACF A;  4WEJ A;  2PBY A;  1EW0 A;  4HNB A;  3NCK A;  1BZA A;  3IX8 A;  2BG1 A;  1S1Y A;  3GRJ A;  4MBK A;  4B4X A;  3M6B A;  4B88 A;  3FKW A;  5IHV A;  4LFU A;  1TD5 A;  2XFT A;  2WAF A;  4XUZ A;  5TR7 A;  4KG6 A;  4O7D A;  1G68 A;  3VP4 A;  2ZOI A;  3LFV A;  1FOF A;  5EPH A;  2L4R A;  5G4Z A;  1Y28 A;  4KUO A;  4QJG A;  3IXD A;  2V8F A;  2XA7 M;  1BLS A;  3AGF A;  2XSS A;  4OQH A;  3G35 A;  3ICY A;  5G18 A;  3LR5 A;  5CGS A;  3IBJ A;  3MKE A;  5DFX A;  2PU2 A;  4X25 A;  3G2Z A;  1T18 A;  2XLN A;  5FAS A;  4HHD A;  1IKI A;  3IF5 A;  1K57 A;  1UWP X;  4CQH A;  1V9Y A;  3CUE A;  4OQG A;  4Y0U A;  3Q81 A;  2Y59 A;  5FI2 A;  4L9E A;  1X0O A;  5CEC A;  3PHY A;  2LB5 A;  3ZFZ A;  1ES3 A;  1OTD A;  1IEL A;  2PHY A;  2ZL1 B;  1DY6 A;  2XDM A;  3BFG A;  2PBD P;  1PZP A;  1T1B A;  2EX2 A;  3LIA A;  3GMW A;  4GKU A;  1F9I A;  4ZJ3 A;  2H0Y A;  1GA0 A;  4ME4 A;  3MS6 A;  2G2W A;  1XKZ A;  4KZ9 A;  1BUE A;  4GOG A;  4Y2F A;  3L9K A;  1CF0 A;  3HLW A;  5M18 A;  3CUE C;  2OLV A;  3K3D A;  4WM9 A;  1HZO A;  3T1X A;  5FAO A;  3HCY A;  1KOU A;  2KX6 A;  1XGJ A;  1XFN A;  3CLO A;  4FH4 A;  3TSG A;  3P7N A;  2HDU A;  3PBN A;  3Q07 A;  2MJ6 A;  3ZNT A;  5AJG A;  1OTE A;  1CI8 A;  3RTY A;  5AVF A;  3E4Q A;  4DDY A;  3CHW P;  4I38 A;  2XRO A;  4S2I A;  3B47 A;  3CMZ A;  3H7W B;  3ZQ5 A;  4OVD A;  3MMH A;  4Y7P A;  5I94 A;  2Q0O A;  1FCM A;  5F1F A;  1LHY A;  3VE3 A;  3LUQ A;  5CXW A;  4QY5 A;  1LLB A;  4BMW A;  3VP2 A;  4PMA A;  4CLC B;  2EFX A;  4HI4 A;  5DKL A;  1XFQ A;  4EBL A;  4OPY A;  2XGN A;  1YSP A;  1OJG A;  1M6K A;  2IA2 A;  3AGE A;  1F5M A;  2GX5 A;  2WKQ A;  3NJA A;  3TOI A;  3EQU A;  4BJP A;  1XX2 A;  2OAP 1;  2UV0 E;  3A3E A;  4R3B A;  3P09 A;  1UGU A;  4X53 A;  5GL9 A;  5HW3 A;  3ISG A;  2X01 A;  2VA0 A;  3TE8 A;  3PBR A;  3GQZ A;  2Y2P A;  2BTF P;  2H28 A;  2K2N A;  2HPB A;  1IKG A;  2H10 A;  5U47 A;  3W2Z A;  4OP8 A;  4X55 A;  1TF1 A;  1KDW A;  3N4I A;  2JKR M;  4MN5 A;  1HTZ A;  4Y3I A;  1PZO A;  5KZH A;  3E4O A;  4WZ5 C;  1FCN A;  5EUA A;  4DF6 A;  2VGL M;  3BFC A;  4WEK A;  3D4F A;  3V50 A;  4UHU A;  4C3Q A;  4Y5F A;  4B4Z A;  1LL5 A;  1DP8 A;  3LEZ A;  5IS1 A;  4JF4 A;  1T1A A;  3NOT C;  3DAV A;  3C30 A;  2L0W A;  1DP6 A;  4GHI B;  3UDX A;  3G32 A;  1CI9 A;  2V8C A;  3U4L P;  1K4E A;  3T4L A;  2J7V A;  1LI9 A;  1K56 D;  3BLS A;  4MBF A;  3NIA A;  2C6W B;  2VJW A;  4CLC E;  3WS0 A;  2V20 A;  1N9O A;  5MC7 A;  3CZD A;  1ES5 A;  1P0Z A;  3HLE A;  2J80 A;  3FC7 A;  3Q7V B;  2WKP A;  2OLU A;  5EM0 A;  3OCL A;  1E3U D;  4NXF A;  2JKR I;  2ZM2 A;  3K3C A;  5FAT A;  5AQA A;  3T12 B;  5IT5 A;  2Z2M B;  5FI7 A;  4NK3 A;  4BBU A;  1GA9 A;  3UN7 A;  1PI4 A;  4OH0 A;  5GHX A;  2RCX A;  2HP6 A;  3CG5 A;  2W27 A;  4LEN A;  1L2S A;  4NXG A;  4G3V A;  3MQO A;  2V0W A;  4Q8I A;  5E2F A;  3VP0 A;  4GZB A;  3SS5 A;  3AGD A;  2B95 A;  3C38 A;  1K54 A;  5HPF A;  4BLM A;  1ODV A;  2HZ5 A;  2GNX A;  1SKF A;  2Y2H A;  1NY0 A;  2V9A A;  4XXR A;  5JYP A;  1SCW A;  4MEZ A;  4U0X A;  3MZF A;  1XJ6 A;  3UPP A;  2ZBB A;  1HLU P;  4R23 A;  2B18 A;  4IUK A;  3VV4 A;  4GLQ A;  4ZJ1 A;  4MNR A;  4G3W A;  2Y2L A;  2JN7 A;  4PHT A;  1C3B A;  1VET A;  1STZ A;  3IHB A;  3JYI A;  3V3R A;  5KSH A;  3FKV A;  1NZU A;  3B33 A;  3CJM A;  5FA7 A;  3UDI A;  1MXO A;  4WN5 A;  2OWJ A;  3GVB A;  1HD8 A;  2PD8 A;  4HQA A;  1M40 A;  4WYY A;  5AQB A;  2ZC5 B;  4NXB A;  2PU4 A;  2ZC6 B;  3UE3 A;  1P97 A;  2DNS A;  4YNR A;  1E4D A;  3CI6 A;  3G30 A;  3WS5 A;  4ZRR A;  5HWW A;  2Q9N A;  1EWZ A;  5L2F A;  4BD0 A;  4G3K A;  5HD3 A;  2PT7 A;  3ZG0 A;  3F1P A;  4DN0 A;  2ZQD A;  1K6R A;  3FV7 A;  2VEA A;  1S66 L;  2Y2Q A;  4FUW A;  1XJ4 A;  2P08 A;  4GJ4 A;  2Q9M A;  2B02 A;  5KIZ A;  2PYP A;  4K91 A;  3EEH A;  1T19 A;  3FWL A;  3HUO A;  3VSK A;  3PAG A;  3C5A A;  4BD1 A;  1YT4 A;  4DJ3 A;  3OBF A;  4KUK A;  4JXW A;  5L07 A;  3A0V A;  2VLG A;  2EXA A;  2QMI A;  5D3O A;  2VGK A;  4UA9 A;  1SDN A;  4PM9 A;  3CPT B;  4JGR A;  4JKT A;  3HLD A;  2ZC7 A;  4HJ6 A;  1IFQ A;  1ZC2 A;  2QKP A;  4OPQ A;  1ZTU A;  2XF3 A;  3W4P A;  1DP9 A;  5E2E A;  2E8I A;  2JCH A;  1YLP A;  3O3V A;  1KVM A;  3PXP A;  4RYE A;  1GSV A;  1H5X A;  3VP1 A;  3IXH A;  4IBX A;  4KZ5 A;  3BQA A;  4UAA A;  1ERQ A;  3OZH A;  1FIK A;  3O88 A;  4GDB A;  3OPP A;  1KGG A;  3PBO A;  2FH5 A;  2W3D A;  4KZB A;  4E3N A;  2WK0 A;  2ZJ9 A;  3CIT A;  4HP4 A;  2V1A A;  3MXS A;  4N9L A;  4DKI A;  5F5Y A;  4R38 A;  2IWC A;  4X1M A;  3BY8 A;  4U3T A;  4DXC A;  2HDQ A;  1V9Z A;  5J3W A;  4RA7 A;  3OLO A;  4KQO A;  1KGF A;  3A3I A;  2HJ9 C;  3UPN A;  3M2J A;  5HAP A;  2XRN A;  4KZ4 A;  1O07 A;  4N9K A;  2WKR A;  5JYO A;  4O8G A;  1K56 A;  2OAQ 1;  5HDC A;  3PBQ A;  5HWV A;  1BTL A;  1P9R A;  5F68 A;  1YLW A;  2CMN A;  2ZC3 B;  4GCZ A;  4X56 A;  1ZG6 A;  1IOU A;  3V3S A;  4I3I A;  1ONH A;  2KLI A;  5EE8 A;  3JVU A;  2XK1 A;  3IS2 B;  4IUH A;  4I3A A;  1RGY A;  2D02 A;  3WS4 A;  2Y55 A;  2ACG A;  5FDH A;  4PM7 A;  4PM5 A;  2O99 A;  5FEF A;  2Z6D A;  4KQQ A;  5J8X A;  4D2O A;  2EXB A;  5CTM A;  4MBH A;  5GHZ A;  3EGX C;  5F1G A;  1GHM A;  5E43 A;  5FQK A;  1OPX A;  2BLS A;  2I9V A;  5GHY A;  4OLG A;  2Y4A A;  2J3T D;  2WGV A;  3G4P A;  1VHM A;  5LBR A;  4ARZ A;  4M4X A;  5EV0 A;  4O01 A;  1BYW A;  2YKF A;  3OPL A;  1YMX A;  4LPZ A;  1WYC A;  4ETX A;  5DJT A;  1NYY A;  4I39 A;  4MDZ A;  1S0W A;  3RFB A;  4UA6 A;  4EWF A;  5EVI C; 
#chains in the Genus database with same CATH homology
 2H28 A;  1WA9 A;  5I5L A;  2K2N A;  4UEY A;  5TBM A;  3W2Z A;  3CWF A;  4WUJ A;  2ZOH A;  1TF1 A;  2OWH A;  2VV7 A;  4ARZ B;  2P04 A;  3EEA A;  4FOF A;  3P01 A;  2KOI A;  4HOI A;  5HDD A;  4BWI A;  4E04 A;  2JKR M;  4MN5 A;  4Y3I A;  4MN7 A;  2W3G A;  3E4O A;  3LIE A;  4HY8 A;  4Q0J A;  3V67 A;  4AFI A;  2BAS A;  2Y8H A;  2ZMF A;  2XA7 S;  2VGL M;  4WEK A;  2W1T A;  3KYQ A;  1OT9 A;  3U2A A;  3OCN A;  3FPV A;  3LI8 A;  5J4E A;  4R6L A;  4Y5F A;  4GS9 A;  4B9O A;  1GSW A;  3UB7 A;  1F98 A;  4EQ1 A;  3UMD A;  1DP8 A;  3LIF A;  2EA9 A;  5IS1 A;  4P6Z M;  1T1A A;  3KSG A;  4Q0H A;  3NOT C;  1MC0 A;  2DMW A;  3C30 A;  4LLO B;  2L0W A;  1DP6 A;  4GHI B;  3B42 A;  3T4L A;  3MQ0 A;  2PR5 A;  3G6O A;  3F1N B;  2A2L A;  3TW8 A;  2PR6 A;  2VJW A;  4CLC E;  2LB9 A;  3BWL A;  3MXQ A;  4DJ2 A;  1N9O A;  2JHE A;  4HH3 A;  5MC7 A;  4PAU A;  1ZHH B;  1LT0 A;  4GW9 A;  1P0Z A;  2EWW A;  5DKK A;  5AVE A;  1D7E A;  2J80 A;  2QYB A;  5DF9 A;  3FC7 A;  2V1B A;  2NUT C;  2WKP A;  4DMZ A;  3T4K A;  2JKT M;  3C8C A;  3MFX A;  3OCL A;  2QWS A;  4EXO A;  4NXF A;  4UQI S;  2M7U A;  3EWK A;  4GHI A;  2JKR I;  4CLC A;  4WLA A;  3K3C A;  2KDK A;  4PKY A;  5IT5 A;  4OOL A;  5DJU A;  1T1C A;  5CX7 A;  3UE6 A;  3ZYT A;  4BBU A;  3LIC A;  3T4T A;  4CLC D;  3LR4 A;  1TS7 A;  4EEU A;  2FZ0 A;  2W27 A;  2QJ7 A;  3KYZ A;  4EER A;  2O9A A;  5HPI A;  4NXG A;  4G3V A;  3S7N A;  2P7J A;  1W63 Q;  1LSV A;  3LI9 A;  4LRZ E;  3MQO A;  2V0W A;  4HJ4 A;  3NHQ A;  2JKT I;  4P6Z S;  3C38 A;  5HPF A;  4H6J A;  1ODV A;  3C2W A;  4LRY C;  1P9W A;  2GNX A;  2D01 A;  1GSX A;  3T4Q A;  2V9A A;  2W3H A;  3PBT A;  3SW1 A;  1XJ6 A;  1S4R A;  4K08 A;  2ZBB A;  2QHK A;  2B18 A;  5G4Y A;  2VZW A;  2J3T C;  3EGD C;  2A24 A;  1MZU A;  4IUK A;  3VV4 A;  4GLQ A;  4HP9 A;  2HF6 A;  5HL6 A;  3T4O A;  4L9F A;  3BY9 A;  1N9N A;  3S7Q A;  5EFW A;  4IJG A;  4G3W A;  3UB6 A;  3H9W A;  3F1O A;  2A24 B;  1H8M A;  3F1N A;  2JN7 A;  3VE4 A;  2OOL A;  4PHT A;  1XJ3 A;  1UWN X;  5FL3 A;  1STZ A;  2O9C A;  4EUV A;  5KSH A;  1XJ2 A;  5HSQ A;  2W0N A;  4R70 A;  3B33 A;  3R7W A;  5F6A A;  2W3E A;  3TRC A;  2R78 A;  3S7P A;  1LL8 A;  4HJ3 A;  4WN5 A;  5HD5 A;  2OWJ A;  3RH8 B;  3UB9 A;  3R4K A;  2EWV A;  4Z1W A;  2PD8 A;  4HQA A;  4QPR A;  2GJ3 A;  3TJZ C;  2ZMV A;  1LSW A;  4BBT A;  2Z6C A;  3OC2 A;  2O9B A;  4NXB A;  2M1C A;  2QJ5 A;  3UE3 A;  1P97 A;  2K7S A;  4JGP A;  4YNR A;  2Y79 A;  3IBR A;  3T4S A;  3MJQ A;  3CI6 A;  1TS6 A;  2V0U A;  3HJI A;  3E4P A;  4WEJ A;  1W63 M;  3KX0 X;  1EW0 A;  2L1M A;  4HNB A;  4ZRR A;  5HWW A;  4L9G A;  1NWZ A;  4WEL A;  1S1Y A;  3PYP A;  4G3K A;  1OJ5 A;  5HD3 A;  2PT7 A;  3F1P A;  3KSI A;  4DN0 A;  1D06 A;  1TD5 A;  2VEA A;  1S66 L;  3LR3 A;  1XJ4 A;  3A0R A;  2P08 A;  4GJ4 A;  4H6J B;  5L8M A;  2B02 A;  5A8B A;  5KIZ A;  4L0L A;  2PYP A;  3T50 A;  3EEH A;  1T19 A;  2ZOI A;  3LFV A;  3NOP C;  2L4R A;  4DJ3 A;  5G4Z A;  1Y28 A;  4KUO A;  3OBF A;  4KUK A;  3K2N A;  2XA7 M;  3IS2 A;  1YSQ A;  3A0V A;  3R7W B;  4EU0 A;  2XSS A;  2VLG A;  3ULF A;  4RQ9 A;  3ICY A;  3LR5 A;  2VV8 A;  3IBJ A;  4O0P A;  5DFX A;  4JGR A;  1OTB A;  3JVV A;  1T18 A;  1IFQ A;  4HJ6 A;  2QKP A;  4HHD A;  1ZTU A;  4WL9 A;  1TS8 A;  1OT6 A;  1UWP X;  4CQH A;  1DP9 A;  4LRX C;  1NRJ A;  1V9Y A;  3EOI A;  3PBS A;  1NLZ A;  3CUE A;  3PXP A;  2W3F A;  1GSV A;  3E98 A;  1YKD A;  3KSF A;  1X0O A;  4L9E A;  3PHY A;  2LB5 A;  4I3J A;  3H82 B;  1OTD A;  2PHY A;  4XT2 B;  2VV6 A;  3BQA A;  4PKY G;  3KSH A;  2HV1 A;  4II7 A;  3PBO A;  1T1B A;  3LIA A;  4MCW A;  4EW7 A;  3PR6 A;  2FH5 A;  2W3D A;  1DRM A;  3UB8 A;  1F9I A;  2HJE A;  5TBM B;  3CAX A;  4FSF A;  1JNU A;  1S4S A;  3CIT A;  3BQ8 A;  4ME4 A;  3VOL A;  1TS0 A;  4HP4 A;  1VB6 A;  2V1A A;  3LID A;  4JGO A;  2NUP C;  5F5Y A;  4ETZ A;  4Y2F A;  4R38 A;  3BY8 A;  4JGQ A;  1G28 A;  3MQQ A;  3CUE C;  3K3D A;  1V9Z A;  5J3W A;  3T4J A;  3OLO A;  3E0Y A;  5HDS A;  3HJK A;  4YOF A;  2YKH A;  3OOV A;  3MF0 A;  4KQO A;  2HJ9 C;  4YWZ A;  3HCY A;  5C5K A;  1KOU A;  2KX6 A;  2XRN A;  3LYX A;  4EEP A;  2WKR A;  1XFN A;  3CLO A;  3LR0 A;  3LIB A;  3F1O B;  4O8G A;  4MMN A;  3P7N A;  1MKM A;  2OAQ 1;  5TJJ A;  3PBN A;  4R3A A;  5HDC A;  3PBQ A;  2MJ6 A;  5HWV A;  1P9R A;  4NEE D;  5AJG A;  5F68 A;  2CMN A;  1OTE A;  4OOM A;  3RTY A;  4GCZ A;  5AVF A;  3E4Q A;  2PD7 A;  3EQV A;  4I38 A;  2XRO A;  1IOU A;  4I3I A;  3B47 A;  3H7W B;  4IHQ A;  3ZQ5 A;  1G6O A;  2KLI A;  3MMH A;  2K31 A;  3JVU A;  2J3W A;  3IS2 B;  1LSX A;  4IUH A;  4I3A A;  3UME A;  3VE3 A;  3LUQ A;  2D02 A;  3A0S A;  4CLC C;  4HH2 A;  3S7O A;  4BMW A;  3H82 A;  2PDR A;  3BW6 A;  1OTA A;  2O99 A;  1N9L A;  4I5S A;  4CLC B;  2HGV A;  2INW A;  2VGL S;  5DFY A;  4HI4 A;  4Q0I A;  5J7E A;  2Z6D A;  5DKL A;  1XFQ A;  1YSP A;  5F69 A;  4F3L A;  3D72 A;  1S67 L;  3EGX C;  3H7W A;  1OJG A;  3F1P B;  4UQI M;  2PYR A;  3O5Y A;  5K5B A;  2O0Y A;  1OPX A;  4GS9 B;  4F3L B;  2IA2 A;  2I9V A;  1F5M A;  2GX5 A;  4MN6 A;  4KQD A;  2WKQ A;  3NJA A;  4WF0 A;  3FG8 A;  2J3T D;  2VKS A;  3EQU A;  2W1R A;  1VHM A;  1YAX A;  5LBR A;  4ARZ A;  4BJP A;  4NKP A;  5HZH A;  2OAP 1;  4NXE A;  2G7U A;  3DBA A;  3GDI A;  4EET B;  4M4X A;  3D3O A;  3KO6 A;  3NOU C;  5IU1 A;  4B93 A;  1UGU A;  4O01 A;  1BYW A;  2YKF A;  2M7V A;  1OTI A;  2GZA A;  2VX8 A;  4LPZ A;  2W1T B;  4XT2 A;  4ETX A;  5DJT A;  1NLY A;  5HWT A;  2VA0 A;  3TE8 A;  3BJN A;  4EES A;  1H3Q A;  3GEC A;  4I39 A;  3MR0 A;  4HIA A;  3PBR A;  4BBV A;  4MDZ A;  3RFB A;  3FPW A;  1S1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...