5HDSA

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 3 ps structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
124
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
molecule tags Signaling protein
source organism Halorhodospira halophila
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
total genus 34
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hdsA00
2BASA 4PKYG 1UWPX 1BYWA 5G4ZA 2QKPA 4K08A 4WF0A 4LRXC 3P7NA 3ICYA 3LIBA 3B33A 4EEPA 2KX6A 4LRYC 1XJ2A 2I9VA 3BY8A 4I5SA 3UB9A 2INWA 2PR6A 1S4RA 3NJAA 3HJIA 4HHDA 2QWSA 4WL9A 4H6JB 5HWWA 5HZHA 4GS9B 1DP6A 1Y28A 5F68A 5TBMB 4BBUA 4I38A 2B02A 3MFXA 1DP8A 2ZOHA 3F1OA 2VEAA 4WLAA 2M1CA 5F6AA 5J4EA 1T1BA 2QJ7A 4MN5A 1N9NA 2CMNA 1OTDA 1VB6A 1TS6A 2QJ5A 2W27A 2V1BA 3CWFA 3EEHA 5HD5A 5HSQA 3LIFA 3LICA 5F5YA 4B9OA 4XT2A 4I3AA 4LLOB 4PKYA 2PR5A 1JNUA 5DKLA 2WKQA 2JN7A 2L4RA 3GDIA 2VV8A 3UMEA 2OOLA 1T18A 1OJGA 3F1OB 3F1PA 2ZBBA 2H28A 4R6LA 3UE6A 2WKRA 1S4SA 1ODVA 2Z6DA 3H82A 4HJ4A 4EQ1A 5HDCA 3H82B 1KOUA 3H9WA 5HD3A 3MQQA 4GW9A 3LI9A 2GJ3A 3A0RA 3LYXA 1OTEA 3VE3A 3MR0A 4JGPA 3BWLA 2D02A 1F9IA 3IS2B 3NOUC 4GCZA 4I3JA 1S67L 1EW0A 1TS0A 3UB6A 2W0NA 3EWKA 5AVFA 2OWHA 3D72A 4F3LB 2V1AA 1OT9A 3H7WB 4I39A 3F1NB 3UB7A 4GHIB 4WN5A 1GSVA 2J80A 4HJ3A 4E04A 2PYPA 3LUQA 5AVEA 1N9OA 2L1MA 3RTYA 4M4XA 4HQAA 4BBTA 4L9EA 1X0OA 4EESA 1T1CA 1DP9A 2P7JA 3LIAA 5HWVA 5KIZA 5G4YA 5J7EA 3MQOA 1OTAA 1OTBA 1OJ5A 2QHKA 5HDSA 4HOIA 4EERA 3E4PA 4HNBA 1P97A 3PYPA 4JGQA 3F1NA 5DKKA 1XJ6A 2V0UA 4KUOA 3SW1A 1XFNA 1LSXA 4R70A 5IS1A 4WUJA 1S1YA 3GECA 3NOTC 1V9ZA 4GS9A 1LSVA 2KDKA 4EXOA 3E4QA 3NOPC 3ULFA 2WKPA 1GSXA 4JGOA 4BBVA 1GSWA 2ZOIA 1DRMA 5TBMA 4NXFA 2K7SA 3KX0X 3FG8A 3E4OA 4KUKA 4HI4A 5J3WA 1TS8A 1XJ4A 3A0SA 1UWNX 1F98A 2JHEA 1P0ZA 1XFQA 3LI8A 3MXQA 1LT0A 4I3IA 5DJUA 1T19A 1N9LA 1UGUA 1NWZA 2V0WA 1G28A 2V9AA 2Z6CA 4HP4A 3VE4A 2PD8A 3FC7A 3UMDA 4NXGA 3IBRA 4RQ9A 3PHYA 4EW7A 2EA9A 3LIDA 2PYRA 4HH2A 4H6JA 5A8BA 3CLOA 3K3DA 2PHYA 4HP9A 4NXBA 5IU1A 1D7EA 1S1ZA 3IS2A 3MJQA 4L9GA 2YKHA 1OTIA 5HDDA 3F1PB 3RH8B 3LIEA 4KQDA 5HWTA 4L9FA 5F69A 3CAXA 2R78A 1OT6A 2PD7A 3HJKA 5DJTA 5EFWA 1WA9A 3ZQ5A 4XT2B 1MZUA 3C2WA 1LL8A 3G6OA 4LRZE 5I5LA 4R3AA 1T1AA 2VV6A 3OLOA 2L0WA 4NXEA 1XJ3A 2D01A 2PDRA 4R38A 2A24A 4HH3A 2YKFA 3T50A 3VOLA 2VV7A 4HIAA 4LPZA 4GHIA 4YWZA 4F3LA 3H7WA 4EETB 3C8CA 1D06A 4HJ6A 4EEUA 4DJ3A 4JGRA 3K3CA 4DJ2A 2OWJA 1TS7A 2VLGA 1LSWA 2HV1A 3NHQA 3A0VA 1S66L 4MN6A 2A24B 3BY9A 3UB8A 4HY8A 1V9YA
chains in the Genus database with same CATH superfamily
4ARZA 3MZDA 4IUKA 1Y4OA 5L09A 2DMWA 5FAOA 3I7JA 3P7NA 3DTKA 4KZ6A 1GCEA 5FI6A 4LV0A 3R4KA 2WK0A 3OCNA 1XP4A 3DTEA 2B02A 2ZOHA 1G5UA 4RA7A 1TS6A 1CI9A 2O9BA 3TJZC 4DXCA 1FQGA 2P9VB 2O9CA 3IWIA 3PBNA 3TRCA 4B93A 2EXAA 2WKQA 2ZMAA 3QNBA 4JXWA 1KOUA 4RVAA 4LGWA 2DCFA 2GX5A 2B5RA 1OTEA 4HEFA 3SH8A 3VSLA 1EW0A 4EU0A 3HLGA 1WE4A 3D3OA 4P87A 3BJNA 1MWUA 4EV4A 5KIZA 5J7EA 2Y8HA 3C38A 3LR4A 3VSKA 2Z2MB 4S2NA 3FPWA 2Y2PA 4MBFA 2ACGA 5FQ9A 3O87A 3SS4A 4EXOA 1ZHHB 4I3IA 2ZQDA 5L10A 4E3MA 1CJFA 5EVIA 4CPKA 5FDHA 3WRZA 3VE4A 3FC7A 4O0PA 2XR0A 2PAVP 4RX2A 5FATA 4ETXA 3F1PB 2HPBA 4EBLA 4L9FA 3CAXA 2WGWB 1PIOA 3C2WA 3DWZA 4D60A 1L2SA 1FIKA 4DE0A 1HVBA 4PMAA 5A93A 2BASA 2O9AA 2XH9A 1K0KA 3NY4A 2P74A 1L0DA 1SCWA 3UB5P 3RXXA 1DP6A 3FV7A 4BMWA 4GDBA 5GHYA 1P9RA 4EUZA 1E25A 2V1ZA 1JNUA 5DKLA 2X01A 1FCMA 2V20A 2WUQA 3MSHA 5HDCA 3E0YA 4GW9A 3S7OA 3GTCA 3A0RA 4OOMA 4WMCD 3LYXA 3RXWA 5KMWA 4IVKA 1DY6A 5KSCA 2OV5A 4JF5A 3H7WB 2J80A 4E3LA 1ESUA 4M4XA 5FQKA 3KYQA 4YFMA 1PZOA 5HWVA 2PU4A 4QWOA 4OQGA 1YLTA 3PYPA 3G30A 1XJ6A 2RCXA 3Q7VB 1W63M 1ES4A 1ERQA 4ZJ2A 4QJGA 1MBLA 5EM0A 3A0SA 4KQDA 5FI2A 3RJUA 1K57A 1XXMA 2V8FA 1D7EA 3IWQA 4Y7PA 2R78A 1OT6A 2E8JA 5CECA 2XQZA 3KSGA 4II7A 4R38A 2A24A 3KSFA 3HLDA 3T4OA 4KG5A 3Q82A 4HY8A 1WYCA 2I9VA 4LV1A 3VFHA 3NIAA 2WGWA 4Q0JA 2C5WB 3W2ZA 3EEHA 1K4EA 3HCYA 4GN2A 4XT2A 2PR5A 3BQ8A 4KZAA 1BLHA 2H28A 4GZBA 1XA7A 4A5RA 4GCZA 1YLWA 4CLCD 3HUMA 3CPTA 4MNRA 3OC2A 4WZ5A 3HBRA 3T4LA 3HLWA 4S2KA 4WM9A 5EOOA 4WUJA 4QY5A 4X1LA 2XROA 4QB8A 4NXFA 3QP1A 1JTDA 1TS8A 1P0ZA 1RCJA 2V0WA 4IJGA 4EW7A 5FAPA 4LV2A 3ZG5A 1L0FA 1WYBA 3K3DA 4CQHA 4IHQA 5HDDA 5IHVA 1NY0A 5AQAA 3OPRA 4AFIA 2W3GA 1MZUA 2A3UA 2L0WA 5TFQA 3BEBA 4O8GA 5TGFA 3JPUA 2JKTM 4BQMA 3QHYA 5CHUA 2HGVA 3HL9A 2OWJA 1LSWA 4GS9A 4WF0A 4JF6A 1IKGA 3VOZA 5FA7A 3N8RA 1IKIA 1L0GA 4Z1WA 4BBUA 3G34A 2Y2NA 4WLAA 3R7WA 3CPTB 2B95A 2CMNA 1KGGA 2W27A 3CWFA 4DE1A 3NBLA 5HPFA 3HUNA 2QYBA 3IBJA 5M19A 2VV8A 3GR2A 2ZBBA 4Y5FA 3NCKA 3UE6A 2FFFB 4MEZA 3UPOA 3CI6A 1NLZA 5A91A 5GHZA 1DJBA 4F3LB 1OT9A 4YINA 4GHIB 4JXVA 1EWZA 3VFFA 3CZDA 3SS5A 2P7JA 1KDSA 2VX8A 2QHKA 1OMEA 3UNWA 1P97A 2WGIA 3FWLA 1HLUP 3OBFA 1CI8A 2XGNA 3PR6A 2KDKA 2BTFP 4OLDA 5G18A 1GSWA 3P01A 5TBMA 2XSSA 3CITA 1F98A 4QHCA 2PT7A 1G28A 4XXRA 4N92A 5CTNA 3LIDA 1S1ZA 1OTIA 5GHXA 3DAVA 2MJ6A 2P08A 4FTXA 3RFBA 5DJTA 2M7UA 4XT2B 2I72A 2W1TA 2HF6A 3T50A 2XK1A 2ZC5B 1BLSA 2ZQAA 3Q7VA 1ZG6A 1K56A 3FKWA 1IELA 3GECA 3DW0A 1VQQA 4S2IA 4EBNA 4FCFA 4FSFA 2INWA 1G6OA 2Y91A 1S4RA 4Y0TA 3GRJA 2WAEA 3MFXA 1DP8A 3PXPA 2QJ7A 3C7VA 4KZ8A 5M18A 1XGIA 1YQSA 3JVUA 3LY4A 4KZ4A 5FEGA 4K0XA 4GLQA 4E3IA 2ZC7A 3IF5A 1NZUA 2DNSA 2Y2MA 4BD1A 3BFEA 3AGEA 2OWHA 4EUVA 4WN5A 1XX2A 4HJ3A 3BQAA 1T1CA 3DTMA 4MN7A 2VGKA 1M6KA 3AGFA 5IS1A 4DN0A 3T1XA 2Y4AA 4OPQA 1SDNA 2K7SA 3A3JA 1K4FA 3NC8A 4PPRA 4OH0A 4NEED 3IXGA 1UGUA 1NWZA 4MCWA 3IT9A 2Y2HA 2HDRA 4JLFA 2OAQ1 5A8BA 4ME4A 1ERMA 5GLDA 3RH8B 3HLBA 4DRTA 2Y2OA 2PD7A 3IH8A 3MFDA 1JWPA 4BL3A 1IYQA 1T1AA 3CUEC 3TE8A 1XJ3A 1NXYA 1MKIA 5E43A 1G68A 2PBDP 4NK3A 3NHQA 3OZHA 4WEJA 2ZM8A 1GA9A 3LY3A 1QMFA 3G4PA 3Q81A 3S7NA 2K2NA 3BLSA 1YSQA 1XJ2A 4Y13A 2PR6A 3WRTA 3N8SA 3HJIA 5DF8A 3CHWP 1H3QA 1PW8A 4I38A 4X69A 1XPBA 5CERA 5A90A 2M7VA 5F5YA 1ACFA 4KZ3A 5DFXA 5F82A 4ZDXA 1YLYA 3F1OB 3KSHA 5CEBA 4D2OA 3MR0A 1MWRA 3KYZA 4Q0HA 5HL1A 2JKRM 1S67L 1SZVA 4G3WA 1CK3A 4WMCA 3LUQA 3M6HA 1IYSA 3L7HA 3BFCA 5A92A 1LL5A 1CF0A 1OTAA 2JE5A 4OLGA 4ARZB 3OOVA 3AGDA 2Y79A 1KGFA 2EX8A 4G3VA 4OOYA 1K54A 2V0UA 3KO6A 2NUPC 2H0YA 4F94A 2FH5A 4UEYA 1DRMA 5CGXA 4PM9A 2B18A 2OLVA 3B47A 4N9KA 1SDEA 3L9KA 4ZJ1A 4HP4A 3V3SA 3E98A 3QP4A 1TDGA 4H6JA 4NXBA 3CMZA 3NDGA 2H10A 3WS0A 2W3DA 1NZOA 3MBZA 3OCLA 2OLUA 4IBXA 3LGOA 1VEUA 2UWXA 4S2LA 4OQHA 1W63Q 4PM8A 3WWXA 4R4SA 3ZG0A 3S22A 4KQRA 3TG9A 3CJMA 5HZHA 4GS9B 3HVFA 5F68A 2XDMA 4ZAMA 1N9NA 2Z2LB 5CGWA 3BYDA 4UQIM 5FQIA 2ZM2A 5FSRA 4NETA 4CLCB 3ZFZA 2R9WA 1OJGA 3IF6B 2Z6DA 3H82A 2GZAA 1GHPA 2HDUA 4LENA 3IX8A 2D02A 2Q9MA 5M1AA 3NECA 2K31A 1N9OA 3RTYA 4Q8IA 4L9EA 1YM1A 4UAAA 2Y59A 1Q2PA 3GV9A 3N8LA 3CUEA 3E4PA 4HOIA 4OVDA 4GKUA 2Q9NA 5DKKA 3S4XA 3C30A 2WKIA 2WYXA 4JF4A 3EGDC 3KX0X 3C4PA 3BFGA 3VP0A 3C7UA 5CRFA 5L8MA 1GHIA 5U47A 4ETZA 3IBRA 2XFSA 2YKHA 4X6TA 3VP2A 5JYPA 3HJKA 3ZQ5A 3G6OA 4GNUA 4O01A 4OQ0A 3IHBA 1PW1A 4LPZA 3K3CA 4JXSA 4JXGA 3VP1A 3BLMA 2JKTI 3D9YA 1MY8A 4MN6A 4OOLA 3UY6A 4HBUA 3O88A 5CXWA 3BFDA 1IYPA 1NYMA 4KZ7A 1KE4A 1BLPA 3UB9A 4I5SA 3TOIA 3O5YA 1W79A 5FDSA 3MKEA 1Y28A 2VEAA 4MN5A 2EWWA 1QMEA 4PHTA 2XD1A 3BFFA 5E2EA 1AWIA 2BG1A 3PAGA 2PRFA 4P0MA 3UMEA 2ZMVA 4M3KA 3LR3A 4XUZA 4IEDA 2GJ3A 3S1YA 1LLBA 1PYYA 2VGLM 3QP8A 2HDSA 4K0WA 1J3WA 4JGPA 3EWKA 2A49A 4LCLA 3UPNA 1JWZA 4GOGA 3FZCA 1XGJA 1ES5A 2L1MA 1SKOA 4KQQA 4JPMA 4FH4A 1ESIA 3MQOA 5HARA 2KOIA 2PU2A 3T4KA 4JGQA 1XA1A 4K91A 4ZRRA 3Q7ZA 4C3QA 4S2PA 3A3DA 4JGOA 3SZTA 2J9PA 5J3WA 3GVBA 1XFQA 2JHEA 1E3UA 3UE1A 2JKRI 3DBAA 3FYZA 4BJPA 3BW6A 3SH7A 2JKGA 4X56A 2WKHA 5EV0A 5I5LA 2FFYA 2VV6A 1K54C 5EVLA 4S2JA 1CQAA 4YWZA 5EUAA 1EROA 5F83A 3WS2A 4EEUA 1YPRA 1TS7A 4FH2A 1KVMA 2QPNA 1V9YA 1CEGA 4U3TA 2G7UA 2QKPA 2WGVA 2LB5A 3LIBA 3B33A 3N7WA 5AQBA 4S2NC 3NI9A 4DDSA 4WL9A 4UA7A 1M40A 4WZ4A 2G2WA 5HL6A 2AVXA 1IYOA 4UA6A 4B9OA 4I3AA 4MBHA 2BLSA 4C6YA 3IX4A 3S7QA 5EECA 1T18A 2ZD8A 1BUEA 4R6LA 5FQMA 4LV3A 5EE8A 3CG5A 3VE3A 1FCNA 5EOEA 3IWOA 3T4SA 1N4OA 2V1AA 4I39A 4DF6A 1CEFA 3EQUA 3T4QA 5GL9A 3UN7A 2XRNA 3V3RA 5FAQA 3IXHA 4WZ5C 4Q0IA 2ZL1B 1F2KA 1E3UD 3V39A 1S0WA 1LSXA 2RL3A 1S1YA 1LI9A 3ZYTA 3ULFA 5EVID 4CJNA 2ZOIA 5DFYA 1K55A 4FUWA 1YLZA 3LI8A 2Z6CA 3QP2A 3W4QA 2EA9A 3B42A 2W3HA 3MJQA 1H0MA 4L9GA 3UDIA 4DE2A 5HWTA 4B88A 4UA9A 2JCHA 1LL8A 3UO9A 4X55A 3OLOA 5LBRA 2VK3A 5HPIA 4HH3A 3VOLA 5D3OA 3C8CA 2ZLYA 4GDNA 1TVFA 1FR1A 3TSGA 3BY9A 4QD4A 4E3OA 4PKYG 1JTGA 3LR0A 4Y3IA 1HZOA 4NG2A 2GDNA 4LRXC 3DWKA 3PAEA 2PBYA 1ES3A 1NJ4A 5E2FA 5F6AA 3T1RA 4MDZA 5GLAA 5HSQA 1JWVA 3BECA 4PKYA 3ZG9B 2OSUA 3E2KA 5CTMA 2ZMFA 3VP3A 1ODVA 4HJ4A 4EQ1A 1RGZA 1NRJA 4OPRA 1F9IA 1W8YA 5KSHA 4GD8A 3MF0A 3MXSA 1X0OA 2O0YA 4WBGA 5HX9A 2XD5A 2CC1A 5HAIA 4PAUA 3F1NA 3SW1A 1YAXA 5EVEA 1DJCA 2EFUA 2FZ0A 2G2UA 2WKPA 3VOYA 5DJUA 1LT0A 1FSYA 5F1GA 2V9AA 4RYEA 2W3FA 3EOIA 3EGXC 4R23A 5IU1A 3LO7A 1S6RA 1H5XA 1STZA 4WYYA 1BZAA 3Q1FA 2Y55A 3BM6A 4EETB 5EFWA 5C5KA 4R3AA 4E6WA 1W5DA 1NLYA 2JBFA 2X71A 2Y2LA 4WEKA 4PM5A 4F3LA 2QMIA 1PFLA 3C5AA 1ZKJA 1FOFA 3UB8A 5G4ZA 1MWSA 4K08A 2IWDA 4PM7A 4LRYC 2XFTA 2ZC6B 4H6JB 2J8YA 3F1OA 3PBQA 2C6WB 1PWGA 2XEPA 3WS5A 3G2YA 3LIFA 4BLMA 1ES2A 2J3TD 3LR5A 5EM1A 3F1PA 2OAP1 2WKRA 4HBTA 4P85A 2VZWA 3LI9A 3QNCA 1W7FA 4IVIA 2E8IA 3IS2B 1E4DA 3D72A 3G35A 5J8XA 1U60A 3VMAA 3ISGA 3LIAA 3A3IA 3P98A 4LCMA 4KG6A 1VM1A 4JBFA 4O7DA 2R9XA 5FI7A 4OPYA 1PI5A 5HW3A 3NOTC 5CGSA 1H8YA 3JYIA 3Q07A 5AQ7A 3C4OA 3IXBA 4KUKA 1UWNX 4N1XA 1SHVA 1PWCA 2XA7S 1NRFA 2WADA 1YT4A 3MMHA 4ZBEA 4UQIS 3KSIA 5KZHA 4BD0A 1GHMA 2EFXA 5F69A 1I2SA 4E3JA 4X53A 2H0TA 1WA9A 2J3WA 4X25A 4EBPA 3ZDJA 2D01A 2PDRA 1ALQA 4G3KA 3T1QB 2O99A 4DJ2A 1MWTA 4YNRA 1O07A 4MBKA 3A0VA 2XLNA 4Y0OA 5EVIC 3GQZA 3VV4A 3ICYA 1KE0A 2HP6A 5EPHA 4DXBA 4FOFA 2W3EA 2ZQCA 3T1SA 4X1MA 3ITAA 1T1BA 3UE3A 4B4XA 4HESA 4P6BA 2OOLA 4R0QA 1PWDA 1VETB 3K2NA 3SS3A 2LB9A 4BL2A 3BWLA 3O3VA 1TS0A 3M2KA 3NDEA 2PYPA 4X68A 5AVEA 1K25A 5JYOA 4EESA 2W1TB 1MKMA 3KYEA 4LFUA 4EERA 3TW8A 1A0KA 3R7WB 4GD6A 5FQJA 3IQAA 1HD8A 4YOFA 1YLJA 4OKPA 3FG8A 3E4OA 3GMWA 1XJ4A 2EX6A 1BLCA 3V5MA 1N9LA 1FILA 3B3XA 5CEDA 1PNEA 3UMDA 4NXGA 3ZCZA 3WS4A 1IFQA 3UE0A 2ZJ9A 3PTEA 3T4JA 4OP8A 4H8RA 3IHAA 1ZG4A 4U0TA 1K55C 1ONHA 4LRZE 4NXEA 2JKFA 1K56D 2YKFA 3O86A 1MC0A 3A3EA 1D06A 1K6SA 1BTLA 3LFVA 3G2ZA 1S66L 2Q0OA 2WAFA 3UDXA 1Y54A 2EX2A 4N9LA 2WZZA 3OPHA 4OP5A 2QWSA 1Z6FA 1PI4A 5TBMB 5FQQA 5I94A 5J4EA 2M1CA 1HTZA 2QJ5A 3MS6A 5DTKA 3IF6C 2JN7A 4L0LA 2IWCA 4QY6A 3W8KA 1S4SA 3QP5A 2HDQA 4I3JA 4WELA 5GLBA 2H5SA 3S7PA 3F1NB 3UB7A 4NKPA 4OONA 4U0XA 4RX3A 4E3NA 4KZ9A 1OTBA 1TD5A 1OJ5A 2HP5A 2A2LA 4S2OA 1D1JA 4R70A 1V9ZA 3P09A 3IF6A 5FEFA 1T19A 4EQIA 5HAPA 3PBSA 4BWIA 2VKSA 3WS1A 4RQ9A 3MZEA 4P6ZM 2PYRA 4HP9A 4KG2A 1FCOA 5TR7A 1RGYA 3LIEA 1TDLA 4KZBA 5GLCA 3T12B 4R3BA 4EWFA 1RP5A 3ZG7B 5CHMA 1YLPA 4E6XA 3PBRA 3LEQA 1PZPA 1VEUB 4E3KA 2HV1A 3HLEA 2XF3A 1F5MA 2ZL1A 4UHUA 4Y15A 1LI0A 1KVLA 3OPPA 2WZXA 5AQ9A 4EEPA 2KX6A 2DRWA 4KENB 1BULA 2VGLS 3A3FA 3UPPA 3QP6A 1J9MA 5L2FA 3HREA 3EQVA 5TJJA 2V1BA 1NYYA 5HD5A 4ID4A 3W4PA 5HAQA 3FPVA 1Z09A 3GDIA 2Y2QA 3EEAA 1N9BA 4XUXA 3D4FA 1ZTUA 1DJAA 3MKFA 1K38A 4IBRA 4R1GA 4QU3A 1TF1A 3V67A 5AVFA 1XKZA 4GJ4A 2J3TC 5DF7A 1IOUA 1KDWA 4HQAA 1DP9A 2JC7A 1I5QA 3M2JA 4MLLA 5HDSA 3UDFA 1YMXA 4HNBA 2WKEA 2EXBA 1BSGA 5DTSA 3SH9A 3PBTA 4S2MA 2X02A 1LSVA 3ZGAB 3NOPC 4CLCC 4MMNA 4BBVA 4ZJ3A 1FSWA 2HP9A 5IT5A 1OPXA 2VA0A 3ZNYA 4R3JA 1VHMA 4GB7A 3CLOA 2PHYA 2P04A 4N1HA 1AXBA 3NULA 2HJ9C 4PM6A 2Y2KA 1EI5A 2ZM0A 1TEMA 2VV7A 4HIAA 3H7WA 4DE3A 3G31A 1I2WA 3N6IA 1UWPX 1BYWA 2NUTC 3HLCA 1JVJA 3BY8A 1ZC2A 4ZTKA 1K57C 3N4IA 2V8CA 5HWWA 2GNXA 3V50A 5FASA 1SKOB 5DTTA 2Y2GA 1OTDA 4QPRA 2UV0E 1P9WA 3ZHHA 4LLOB 2L4RA 3PBOA 4DDYA 5L07A 4CLCE 5HD3A 3MQQA 3OPLA 2IA2A 5F1FA 3T4TA 1YMSA 4DMZA 4E04A 1GSVA 3U2AA 5FL3A 2VJWA 5CX7A 1IEMA 1L0EA 3IH9A 2IWBA 1GA0A 1KE3A 1L3LA 2Y2JA 4KUOA 3IX3A 4Y17A 4IUHA 2VGJA 1GSXA 2XA7M 5AJGA 4HI4A 2EX9A 5MC7A 1YSPA 2J7VA 3PHYA 4HH2A 3BRMA 4JKTA 1BT5A 3IS2A 2KLIA 4Y2FA 1MPLA 3W4OA 3ZG8B 4GHIA 1H8ZA 1K6RA 5DVAA 5CHJA 3MZFA 1PRQA 4HJ6A 3JVVA 3U4LP 1VETA 1W8QA 4Y0UA 3IXDA 3MQ0A 4OQIA 1O7EA 5EVIB 5HFOA 2ZQ7A 3NJAA 4HHDA 1H8MA 2QZ6A 1ONGA 5DF9A 1VB6A 3VP4A 1Q2QA 3HUOA 3LICA 2P9VA 1SKFA 1YKDA 3MXRA 2Y2IA 4CLCA 2ZQ9A 3DTIA 4P6ZS 3H82B 3H9WA 4KQOA 3G32A 2ZQ8A 3NOUC 3UB6A 3FKVA 2W0NA 1KGEA 4DKIA 5BOHA 3HLFA 4BBTA 3LEZA 5G4YA 3LCEA 4R4RA 4C75A 2EWVA 1XFNA 2V2FF 2HZ5A 3GSGA 2W1RA 3E4QA 3E2LA 4B4ZA 4KZ5A 2HJEA 1LHYA 3ITBA 1MXOA 4BENA 1LL9A 3MXQA 3SOIA 2PD8A 3ZVTA 4FD8A 3ZNTA 5E2GA 5K5BA 1C3BA 4ESPA 1FR6A 1G6AA 5E2HA 3ZVWA 4Z9QA 3M6BA 2ZC3B 4DJ3A 4JGRA 4OPZA 2VLGA 2ZC4B 2A24B 2J9OA
chains in the Genus database with same CATH topology
4ARZA 4IUKA 2DMWA 2G7UA 2QKPA 3P7NA 2LB5A 3LIBA 3B33A 4FSFA 2INWA 1G6OA 1S4RA 3R4KA 2QWSA 3OCNA 4WL9A 5TBMB 2B02A 3MFXA 1DP8A 2ZOHA 3PXPA 5J4EA 2M1CA 2QJ7A 5HL6A 1TS6A 2QJ5A 2O9BA 3TJZC 3TRCA 3PBNA 2O9CA 4B9OA 4I3AA 4B93A 2WKQA 2JN7A 4L0LA 3JVUA 3S7QA 1T18A 4GLQA 4R6LA 1S4SA 1KOUA 2GX5A 1OTEA 3VE3A 4I3JA 1EW0A 4WELA 3S7PA 4EU0A 2OWHA 3T4SA 2V1AA 4I39A 3F1NB 3UB7A 4WN5A 4EUVA 4HJ3A 3D3OA 3EQUA 3BQAA 4NKPA 3BJNA 3T4QA 1T1CA 4MN7A 2XRNA 5KIZA 5J7EA 2Y8HA 1OTBA 1TD5A 4Q0IA 1OJ5A 3C38A 2A2LA 3LR4A 3FPWA 1LSXA 4R70A 5IS1A 4DN0A 1S1YA 1V9ZA 4EXOA 3ZYTA 3ULFA 1ZHHB 2ZOIA 5DFYA 2K7SA 4I3IA 3LI8A 4NEED 1T19A 1UGUA 1NWZA 4MCWA 3PBSA 4BWIA 2VKSA 2Z6CA 3VE4A 3FC7A 4O0PA 4RQ9A 2EA9A 2OAQ1 4P6ZM 2PYRA 5A8BA 4HP9A 3B42A 4ME4A 2W3HA 3MJQA 4L9GA 4ETXA 3F1PB 3RH8B 3LIEA 5HWTA 4L9FA 3CAXA 2PD7A 3C2WA 1LL8A 1T1AA 3CUEC 3OLOA 5LBRA 3TE8A 1XJ3A 5HPIA 4HH3A 3VOLA 3C8CA 3PBRA 2HV1A 3NHQA 4WEJA 3BY9A 1F5MA 2BASA 2O9AA 3LR0A 4PKYG 4Y3IA 3S7NA 2K2NA 4LRXC 1YSQA 4EEPA 2KX6A 1XJ2A 2VGLS 2PR6A 3HJIA 1H3QA 1DP6A 4I38A 4BMWA 5F6AA 3EQVA 4MDZA 2V1BA 5HD5A 5TJJA 5HSQA 1P9RA 2M7VA 5F5YA 4PKYA 3FPVA 1JNUA 5DKLA 5DFXA 3GDIA 3F1OB 3EEAA 2ZMFA 1ODVA 1ZTUA 3KSHA 4HJ4A 4EQ1A 5HDCA 1NRJA 3E0YA 4GW9A 3S7OA 4OOMA 3A0RA 3LYXA 3MR0A 3KYZA 1F9IA 4Q0HA 5KSHA 2JKRM 1S67L 1TF1A 3V67A 5AVFA 4G3WA 3H7WB 4GJ4A 3MF0A 2J3TC 2J80A 1IOUA 3LUQA 4M4XA 3KYQA 4HQAA 1X0OA 2O0YA 1DP9A 5HWVA 1OTAA 4ARZB 5HDSA 3OOVA 4HNBA 2Y79A 3PYPA 4PAUA 3F1NA 4G3VA 1XJ6A 2V0UA 3KO6A 2NUPC 1YAXA 3SW1A 3PBTA 1W63M 2FZ0A 1LSVA 2FH5A 4UEYA 3NOPC 4CLCC 4MMNA 2WKPA 4BBVA 1DRMA 2B18A 3B47A 3A0SA 4KQDA 5IT5A 1OPXA 2VA0A 5DJUA 1LT0A 2V9AA 2W3FA 4HP4A 3EOIA 1VHMA 3EGXC 3E98A 4H6JA 3CLOA 2PHYA 2P04A 4NXBA 5IU1A 1D7EA 1STZA 2R78A 1OT6A 4EETB 5EFWA 5C5KA 4R3AA 2HJ9C 2W3DA 1NLYA 3KSGA 4II7A 4R38A 2A24A 3KSFA 2VV7A 4HIAA 4WEKA 4F3LA 3T4OA 3H7WA 3OCLA 3UB8A 4HY8A 1UWPX 1BYWA 5G4ZA 2NUTC 1W63Q 4K08A 4LRYC 3BY8A 2I9VA 4Q0JA 5HWWA 4H6JB 5HZHA 2GNXA 4GS9B 5F68A 3F1OA 3PBQA 1N9NA 1OTDA 4QPRA 3W2ZA 3EEHA 1P9WA 4UQIM 3LIFA 3HCYA 4XT2A 4LLOB 2PR5A 2J3TD 3BQ8A 4CLCB 2L4RA 3PBOA 3LR5A 1OJGA 3F1PA 2OAP1 2H28A 2WKRA 2Z6DA 3H82A 4CLCE 2GZAA 2VZWA 3MQQA 5HD3A 3LI9A 2IA2A 2D02A 3IS2B 4GCZA 3T4TA 3D72A 2K31A 4DMZA 4E04A 1GSVA 3U2AA 4CLCD 1N9OA 5FL3A 3RTYA 2VJWA 5CX7A 4L9EA 3LIAA 3OC2A 3T4LA 4HOIA 3CUEA 3E4PA 5DKKA 4KUOA 3C30A 4WUJA 3NOTC 4IUHA 2XROA 1GSXA 2XA7M 4NXFA 3EGDC 3KX0X 4KUKA 4HI4A 5AJGA 1TS8A 1UWNX 1P0ZA 5L8MA 2V0WA 4IJGA 5MC7A 2XA7S 4EW7A 1YSPA 4ETZA 3IBRA 3PHYA 3MMHA 4HH2A 3K3DA 4CQHA 4UQIS 3KSIA 3IS2A 2YKHA 2KLIA 4IHQA 5HDDA 5F69A 4AFIA 2W3GA 3HJKA 1WA9A 2J3WA 3ZQ5A 1MZUA 3G6OA 4Y2FA 4O01A 2L0WA 2D01A 4O8GA 2PDRA 4LPZA 4GHIA 2JKTM 4G3KA 4HJ6A 3K3CA 2HGVA 2O99A 3JVVA 4DJ2A 2OWJA 2JKTI 4YNRA 1LSWA 3A0VA 4MN6A 4OOLA 4GS9A 3MQ0A 4WF0A 3VV4A 3ICYA 3UB9A 4I5SA 4FOFA 3O5YA 3NJAA 2W3EA 4HHDA 1H8MA 4Z1WA 1Y28A 4BBUA 4WLAA 2VEAA 3R7WA 1T1BA 4MN5A 3UE3A 2CMNA 5DF9A 1VB6A 2W27A 3CWFA 2EWWA 4PHTA 3LICA 5HPFA 1YKDA 2QYBA 3IBJA 4CLCA 2VV8A 3UMEA 2OOLA 2ZBBA 4Y5FA 3UE6A 2ZMVA 3LR3A 4P6ZS 3H82B 3H9WA 4KQOA 2GJ3A 3CI6A 3K2NA 2VGLM 2LB9A 4JGPA 1NLZA 3BWLA 3NOUC 3UB6A 1TS0A 2W0NA 3EWKA 4F3LB 1OT9A 4GHIB 2PYPA 5AVEA 2L1MA 4BBTA 4EESA 2P7JA 2W1TB 5G4YA 2VX8A 3MQOA 2KOIA 1MKMA 2QHKA 3T4KA 4EERA 3TW8A 1P97A 2EWVA 4JGQA 3R7WB 4ZRRA 1XFNA 3OBFA 2W1RA 3PR6A 2KDKA 4YOFA 3E4QA 4JGOA 1GSWA 3P01A 5TBMA 2HJEA 3FG8A 2XSSA 3E4OA 5J3WA 3CITA 1XJ4A 1F98A 1XFQA 2JHEA 2PT7A 3MXQA 1N9LA 1G28A 2PD8A 3UMDA 4NXGA 2JKRI 3LIDA 3DBAA 5K5BA 4BJPA 3BW6A 1IFQA 1S1ZA 1OTIA 3T4JA 2MJ6A 2P08A 5DJTA 3RFBA 2M7UA 4XT2B 5I5LA 2W1TA 4LRZE 2VV6A 4NXEA 2HF6A 2YKFA 3T50A 1MC0A 4YWZA 1D06A 4EEUA 4DJ3A 4JGRA 3LFVA 1TS7A 2VLGA 1S66L 2A24B 3GECA 1V9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAS A;  4PKY G;  1UWP X;  1BYW A;  5G4Z A;  2QKP A;  4K08 A;  4WF0 A;  4LRX C;  3P7N A;  3ICY A;  3LIB A;  3B33 A;  4EEP A;  2KX6 A;  4LRY C;  1XJ2 A;  2I9V A;  3BY8 A;  4I5S A;  3UB9 A;  2INW A;  2PR6 A;  1S4R A;  3NJA A;  3HJI A;  4HHD A;  2QWS A;  4WL9 A;  4H6J B;  5HWW A;  5HZH A;  4GS9 B;  1DP6 A;  1Y28 A;  5F68 A;  5TBM B;  4BBU A;  4I38 A;  2B02 A;  3MFX A;  1DP8 A;  2ZOH A;  3F1O A;  2VEA A;  4WLA A;  2M1C A;  5F6A A;  5J4E A;  1T1B A;  2QJ7 A;  4MN5 A;  1N9N A;  2CMN A;  1OTD A;  1VB6 A;  1TS6 A;  2QJ5 A;  2W27 A;  2V1B A;  3CWF A;  3EEH A;  5HD5 A;  5HSQ A;  3LIF A;  3LIC A;  5F5Y A;  4B9O A;  4XT2 A;  4I3A A;  4LLO B;  4PKY A;  2PR5 A;  1JNU A;  5DKL A;  2WKQ A;  2JN7 A;  2L4R A;  3GDI A;  2VV8 A;  3UME A;  2OOL A;  1T18 A;  1OJG A;  3F1O B;  3F1P A;  2ZBB A;  2H28 A;  4R6L A;  3UE6 A;  2WKR A;  1S4S A;  1ODV A;  2Z6D A;  3H82 A;  4HJ4 A;  4EQ1 A;  5HDC A;  3H82 B;  1KOU A;  3H9W A;  5HD3 A;  3MQQ A;  4GW9 A;  3LI9 A;  2GJ3 A;  3A0R A;  3LYX A;  1OTE A;  3VE3 A;  3MR0 A;  4JGP A;  3BWL A;  2D02 A;  1F9I A;  3IS2 B;  3NOU C;  4GCZ A;  4I3J A;  1S67 L;  1EW0 A;  1TS0 A;  3UB6 A;  2W0N A;  3EWK A;  5AVF A;  2OWH A;  3D72 A;  4F3L B;  2V1A A;  1OT9 A;  3H7W B;  4I39 A;  3F1N B;  3UB7 A;  4GHI B;  4WN5 A;  1GSV A;  2J80 A;  4HJ3 A;  4E04 A;  2PYP A;  3LUQ A;  5AVE A;  1N9O A;  2L1M A;  3RTY A;  4M4X A;  4HQA A;  4BBT A;  4L9E A;  1X0O A;  4EES A;  1T1C A;  1DP9 A;  2P7J A;  3LIA A;  5HWV A;  5KIZ A;  5G4Y A;  5J7E A;  3MQO A;  1OTA A;  1OTB A;  1OJ5 A;  2QHK A;  5HDS A;  4HOI A;  4EER A;  3E4P A;  4HNB A;  1P97 A;  3PYP A;  4JGQ A;  3F1N A;  5DKK A;  1XJ6 A;  2V0U A;  4KUO A;  3SW1 A;  1XFN A;  1LSX A;  4R70 A;  5IS1 A;  4WUJ A;  1S1Y A;  3GEC A;  3NOT C;  1V9Z A;  4GS9 A;  1LSV A;  2KDK A;  4EXO A;  3E4Q A;  3NOP C;  3ULF A;  2WKP A;  1GSX A;  4JGO A;  4BBV A;  1GSW A;  2ZOI A;  1DRM A;  5TBM A;  4NXF A;  2K7S A;  3KX0 X;  3FG8 A;  3E4O A;  4KUK A;  4HI4 A;  5J3W A;  1TS8 A;  1XJ4 A;  3A0S A;  1UWN X;  1F98 A;  2JHE A;  1P0Z A;  1XFQ A;  3LI8 A;  3MXQ A;  1LT0 A;  4I3I A;  5DJU A;  1T19 A;  1N9L A;  1UGU A;  1NWZ A;  2V0W A;  1G28 A;  2V9A A;  2Z6C A;  4HP4 A;  3VE4 A;  2PD8 A;  3FC7 A;  3UMD A;  4NXG A;  3IBR A;  4RQ9 A;  3PHY A;  4EW7 A;  2EA9 A;  3LID A;  2PYR A;  4HH2 A;  4H6J A;  5A8B A;  3CLO A;  3K3D A;  2PHY A;  4HP9 A;  4NXB A;  5IU1 A;  1D7E A;  1S1Z A;  3IS2 A;  3MJQ A;  4L9G A;  2YKH A;  1OTI A;  5HDD A;  3F1P B;  3RH8 B;  3LIE A;  4KQD A;  5HWT A;  4L9F A;  5F69 A;  3CAX A;  2R78 A;  1OT6 A;  2PD7 A;  3HJK A;  5DJT A;  5EFW A;  1WA9 A;  3ZQ5 A;  4XT2 B;  1MZU A;  3C2W A;  1LL8 A;  3G6O A;  4LRZ E;  5I5L A;  4R3A A;  1T1A A;  2VV6 A;  3OLO A;  2L0W A;  4NXE A;  1XJ3 A;  2D01 A;  2PDR A;  4R38 A;  2A24 A;  4HH3 A;  2YKF A;  3T50 A;  3VOL A;  2VV7 A;  4HIA A;  4LPZ A;  4GHI A;  4YWZ A;  4F3L A;  3H7W A;  4EET B;  3C8C A;  1D06 A;  4HJ6 A;  4EEU A;  4DJ3 A;  4JGR A;  3K3C A;  4DJ2 A;  2OWJ A;  1TS7 A;  2VLG A;  1LSW A;  2HV1 A;  3NHQ A;  3A0V A;  1S66 L;  4MN6 A;  2A24 B;  3BY9 A;  3UB8 A;  4HY8 A;  1V9Y A; 
#chains in the Genus database with same CATH topology
 4ARZ A;  3MZD A;  4IUK A;  1Y4O A;  5L09 A;  2DMW A;  5FAO A;  3I7J A;  3P7N A;  3DTK A;  4KZ6 A;  1GCE A;  5FI6 A;  4LV0 A;  3R4K A;  2WK0 A;  3OCN A;  1XP4 A;  3DTE A;  2B02 A;  2ZOH A;  1G5U A;  4RA7 A;  1TS6 A;  1CI9 A;  2O9B A;  3TJZ C;  4DXC A;  1FQG A;  2P9V B;  2O9C A;  3IWI A;  3PBN A;  3TRC A;  4B93 A;  2EXA A;  2WKQ A;  2ZMA A;  3QNB A;  4JXW A;  1KOU A;  4RVA A;  4LGW A;  2DCF A;  2GX5 A;  2B5R A;  1OTE A;  4HEF A;  3SH8 A;  3VSL A;  1EW0 A;  4EU0 A;  3HLG A;  1WE4 A;  3D3O A;  4P87 A;  3BJN A;  1MWU A;  4EV4 A;  5KIZ A;  5J7E A;  2Y8H A;  3C38 A;  3LR4 A;  3VSK A;  2Z2M B;  4S2N A;  3FPW A;  2Y2P A;  4MBF A;  2ACG A;  5FQ9 A;  3O87 A;  3SS4 A;  4EXO A;  1ZHH B;  4I3I A;  2ZQD A;  5L10 A;  4E3M A;  1CJF A;  5EVI A;  4CPK A;  5FDH A;  3WRZ A;  3VE4 A;  3FC7 A;  4O0P A;  2XR0 A;  2PAV P;  4RX2 A;  5FAT A;  4ETX A;  3F1P B;  2HPB A;  4EBL A;  4L9F A;  3CAX A;  2WGW B;  1PIO A;  3C2W A;  3DWZ A;  4D60 A;  1L2S A;  1FIK A;  4DE0 A;  1HVB A;  4PMA A;  5A93 A;  2BAS A;  2O9A A;  2XH9 A;  1K0K A;  3NY4 A;  2P74 A;  1L0D A;  1SCW A;  3UB5 P;  3RXX A;  1DP6 A;  3FV7 A;  4BMW A;  4GDB A;  5GHY A;  1P9R A;  4EUZ A;  1E25 A;  2V1Z A;  1JNU A;  5DKL A;  2X01 A;  1FCM A;  2V20 A;  2WUQ A;  3MSH A;  5HDC A;  3E0Y A;  4GW9 A;  3S7O A;  3GTC A;  3A0R A;  4OOM A;  4WMC D;  3LYX A;  3RXW A;  5KMW A;  4IVK A;  1DY6 A;  5KSC A;  2OV5 A;  4JF5 A;  3H7W B;  2J80 A;  4E3L A;  1ESU A;  4M4X A;  5FQK A;  3KYQ A;  4YFM A;  1PZO A;  5HWV A;  2PU4 A;  4QWO A;  4OQG A;  1YLT A;  3PYP A;  3G30 A;  1XJ6 A;  2RCX A;  3Q7V B;  1W63 M;  1ES4 A;  1ERQ A;  4ZJ2 A;  4QJG A;  1MBL A;  5EM0 A;  3A0S A;  4KQD A;  5FI2 A;  3RJU A;  1K57 A;  1XXM A;  2V8F A;  1D7E A;  3IWQ A;  4Y7P A;  2R78 A;  1OT6 A;  2E8J A;  5CEC A;  2XQZ A;  3KSG A;  4II7 A;  4R38 A;  2A24 A;  3KSF A;  3HLD A;  3T4O A;  4KG5 A;  3Q82 A;  4HY8 A;  1WYC A;  2I9V A;  4LV1 A;  3VFH A;  3NIA A;  2WGW A;  4Q0J A;  2C5W B;  3W2Z A;  3EEH A;  1K4E A;  3HCY A;  4GN2 A;  4XT2 A;  2PR5 A;  3BQ8 A;  4KZA A;  1BLH A;  2H28 A;  4GZB A;  1XA7 A;  4A5R A;  4GCZ A;  1YLW A;  4CLC D;  3HUM A;  3CPT A;  4MNR A;  3OC2 A;  4WZ5 A;  3HBR A;  3T4L A;  3HLW A;  4S2K A;  4WM9 A;  5EOO A;  4WUJ A;  4QY5 A;  4X1L A;  2XRO A;  4QB8 A;  4NXF A;  3QP1 A;  1JTD A;  1TS8 A;  1P0Z A;  1RCJ A;  2V0W A;  4IJG A;  4EW7 A;  5FAP A;  4LV2 A;  3ZG5 A;  1L0F A;  1WYB A;  3K3D A;  4CQH A;  4IHQ A;  5HDD A;  5IHV A;  1NY0 A;  5AQA A;  3OPR A;  4AFI A;  2W3G A;  1MZU A;  2A3U A;  2L0W A;  5TFQ A;  3BEB A;  4O8G A;  5TGF A;  3JPU A;  2JKT M;  4BQM A;  3QHY A;  5CHU A;  2HGV A;  3HL9 A;  2OWJ A;  1LSW A;  4GS9 A;  4WF0 A;  4JF6 A;  1IKG A;  3VOZ A;  5FA7 A;  3N8R A;  1IKI A;  1L0G A;  4Z1W A;  4BBU A;  3G34 A;  2Y2N A;  4WLA A;  3R7W A;  3CPT B;  2B95 A;  2CMN A;  1KGG A;  2W27 A;  3CWF A;  4DE1 A;  3NBL A;  5HPF A;  3HUN A;  2QYB A;  3IBJ A;  5M19 A;  2VV8 A;  3GR2 A;  2ZBB A;  4Y5F A;  3NCK A;  3UE6 A;  2FFF B;  4MEZ A;  3UPO A;  3CI6 A;  1NLZ A;  5A91 A;  5GHZ A;  1DJB A;  4F3L B;  1OT9 A;  4YIN A;  4GHI B;  4JXV A;  1EWZ A;  3VFF A;  3CZD A;  3SS5 A;  2P7J A;  1KDS A;  2VX8 A;  2QHK A;  1OME A;  3UNW A;  1P97 A;  2WGI A;  3FWL A;  1HLU P;  3OBF A;  1CI8 A;  2XGN A;  3PR6 A;  2KDK A;  2BTF P;  4OLD A;  5G18 A;  1GSW A;  3P01 A;  5TBM A;  2XSS A;  3CIT A;  1F98 A;  4QHC A;  2PT7 A;  1G28 A;  4XXR A;  4N92 A;  5CTN A;  3LID A;  1S1Z A;  1OTI A;  5GHX A;  3DAV A;  2MJ6 A;  2P08 A;  4FTX A;  3RFB A;  5DJT A;  2M7U A;  4XT2 B;  2I72 A;  2W1T A;  2HF6 A;  3T50 A;  2XK1 A;  2ZC5 B;  1BLS A;  2ZQA A;  3Q7V A;  1ZG6 A;  1K56 A;  3FKW A;  1IEL A;  3GEC A;  3DW0 A;  1VQQ A;  4S2I A;  4EBN A;  4FCF A;  4FSF A;  2INW A;  1G6O A;  2Y91 A;  1S4R A;  4Y0T A;  3GRJ A;  2WAE A;  3MFX A;  1DP8 A;  3PXP A;  2QJ7 A;  3C7V A;  4KZ8 A;  5M18 A;  1XGI A;  1YQS A;  3JVU A;  3LY4 A;  4KZ4 A;  5FEG A;  4K0X A;  4GLQ A;  4E3I A;  2ZC7 A;  3IF5 A;  1NZU A;  2DNS A;  2Y2M A;  4BD1 A;  3BFE A;  3AGE A;  2OWH A;  4EUV A;  4WN5 A;  1XX2 A;  4HJ3 A;  3BQA A;  1T1C A;  3DTM A;  4MN7 A;  2VGK A;  1M6K A;  3AGF A;  5IS1 A;  4DN0 A;  3T1X A;  2Y4A A;  4OPQ A;  1SDN A;  2K7S A;  3A3J A;  1K4F A;  3NC8 A;  4PPR A;  4OH0 A;  4NEE D;  3IXG A;  1UGU A;  1NWZ A;  4MCW A;  3IT9 A;  2Y2H A;  2HDR A;  4JLF A;  2OAQ 1;  5A8B A;  4ME4 A;  1ERM A;  5GLD A;  3RH8 B;  3HLB A;  4DRT A;  2Y2O A;  2PD7 A;  3IH8 A;  3MFD A;  1JWP A;  4BL3 A;  1IYQ A;  1T1A A;  3CUE C;  3TE8 A;  1XJ3 A;  1NXY A;  1MKI A;  5E43 A;  1G68 A;  2PBD P;  4NK3 A;  3NHQ A;  3OZH A;  4WEJ A;  2ZM8 A;  1GA9 A;  3LY3 A;  1QMF A;  3G4P A;  3Q81 A;  3S7N A;  2K2N A;  3BLS A;  1YSQ A;  1XJ2 A;  4Y13 A;  2PR6 A;  3WRT A;  3N8S A;  3HJI A;  5DF8 A;  3CHW P;  1H3Q A;  1PW8 A;  4I38 A;  4X69 A;  1XPB A;  5CER A;  5A90 A;  2M7V A;  5F5Y A;  1ACF A;  4KZ3 A;  5DFX A;  5F82 A;  4ZDX A;  1YLY A;  3F1O B;  3KSH A;  5CEB A;  4D2O A;  3MR0 A;  1MWR A;  3KYZ A;  4Q0H A;  5HL1 A;  2JKR M;  1S67 L;  1SZV A;  4G3W A;  1CK3 A;  4WMC A;  3LUQ A;  3M6H A;  1IYS A;  3L7H A;  3BFC A;  5A92 A;  1LL5 A;  1CF0 A;  1OTA A;  2JE5 A;  4OLG A;  4ARZ B;  3OOV A;  3AGD A;  2Y79 A;  1KGF A;  2EX8 A;  4G3V A;  4OOY A;  1K54 A;  2V0U A;  3KO6 A;  2NUP C;  2H0Y A;  4F94 A;  2FH5 A;  4UEY A;  1DRM A;  5CGX A;  4PM9 A;  2B18 A;  2OLV A;  3B47 A;  4N9K A;  1SDE A;  3L9K A;  4ZJ1 A;  4HP4 A;  3V3S A;  3E98 A;  3QP4 A;  1TDG A;  4H6J A;  4NXB A;  3CMZ A;  3NDG A;  2H10 A;  3WS0 A;  2W3D A;  1NZO A;  3MBZ A;  3OCL A;  2OLU A;  4IBX A;  3LGO A;  1VEU A;  2UWX A;  4S2L A;  4OQH A;  1W63 Q;  4PM8 A;  3WWX A;  4R4S A;  3ZG0 A;  3S22 A;  4KQR A;  3TG9 A;  3CJM A;  5HZH A;  4GS9 B;  3HVF A;  5F68 A;  2XDM A;  4ZAM A;  1N9N A;  2Z2L B;  5CGW A;  3BYD A;  4UQI M;  5FQI A;  2ZM2 A;  5FSR A;  4NET A;  4CLC B;  3ZFZ A;  2R9W A;  1OJG A;  3IF6 B;  2Z6D A;  3H82 A;  2GZA A;  1GHP A;  2HDU A;  4LEN A;  3IX8 A;  2D02 A;  2Q9M A;  5M1A A;  3NEC A;  2K31 A;  1N9O A;  3RTY A;  4Q8I A;  4L9E A;  1YM1 A;  4UAA A;  2Y59 A;  1Q2P A;  3GV9 A;  3N8L A;  3CUE A;  3E4P A;  4HOI A;  4OVD A;  4GKU A;  2Q9N A;  5DKK A;  3S4X A;  3C30 A;  2WKI A;  2WYX A;  4JF4 A;  3EGD C;  3KX0 X;  3C4P A;  3BFG A;  3VP0 A;  3C7U A;  5CRF A;  5L8M A;  1GHI A;  5U47 A;  4ETZ A;  3IBR A;  2XFS A;  2YKH A;  4X6T A;  3VP2 A;  5JYP A;  3HJK A;  3ZQ5 A;  3G6O A;  4GNU A;  4O01 A;  4OQ0 A;  3IHB A;  1PW1 A;  4LPZ A;  3K3C A;  4JXS A;  4JXG A;  3VP1 A;  3BLM A;  2JKT I;  3D9Y A;  1MY8 A;  4MN6 A;  4OOL A;  3UY6 A;  4HBU A;  3O88 A;  5CXW A;  3BFD A;  1IYP A;  1NYM A;  4KZ7 A;  1KE4 A;  1BLP A;  3UB9 A;  4I5S A;  3TOI A;  3O5Y A;  1W79 A;  5FDS A;  3MKE A;  1Y28 A;  2VEA A;  4MN5 A;  2EWW A;  1QME A;  4PHT A;  2XD1 A;  3BFF A;  5E2E A;  1AWI A;  2BG1 A;  3PAG A;  2PRF A;  4P0M A;  3UME A;  2ZMV A;  4M3K A;  3LR3 A;  4XUZ A;  4IED A;  2GJ3 A;  3S1Y A;  1LLB A;  1PYY A;  2VGL M;  3QP8 A;  2HDS A;  4K0W A;  1J3W A;  4JGP A;  3EWK A;  2A49 A;  4LCL A;  3UPN A;  1JWZ A;  4GOG A;  3FZC A;  1XGJ A;  1ES5 A;  2L1M A;  1SKO A;  4KQQ A;  4JPM A;  4FH4 A;  1ESI A;  3MQO A;  5HAR A;  2KOI A;  2PU2 A;  3T4K A;  4JGQ A;  1XA1 A;  4K91 A;  4ZRR A;  3Q7Z A;  4C3Q A;  4S2P A;  3A3D A;  4JGO A;  3SZT A;  2J9P A;  5J3W A;  3GVB A;  1XFQ A;  2JHE A;  1E3U A;  3UE1 A;  2JKR I;  3DBA A;  3FYZ A;  4BJP A;  3BW6 A;  3SH7 A;  2JKG A;  4X56 A;  2WKH A;  5EV0 A;  5I5L A;  2FFY A;  2VV6 A;  1K54 C;  5EVL A;  4S2J A;  1CQA A;  4YWZ A;  5EUA A;  1ERO A;  5F83 A;  3WS2 A;  4EEU A;  1YPR A;  1TS7 A;  4FH2 A;  1KVM A;  2QPN A;  1V9Y A;  1CEG A;  4U3T A;  2G7U A;  2QKP A;  2WGV A;  2LB5 A;  3LIB A;  3B33 A;  3N7W A;  5AQB A;  4S2N C;  3NI9 A;  4DDS A;  4WL9 A;  4UA7 A;  1M40 A;  4WZ4 A;  2G2W A;  5HL6 A;  2AVX A;  1IYO A;  4UA6 A;  4B9O A;  4I3A A;  4MBH A;  2BLS A;  4C6Y A;  3IX4 A;  3S7Q A;  5EEC A;  1T18 A;  2ZD8 A;  1BUE A;  4R6L A;  5FQM A;  4LV3 A;  5EE8 A;  3CG5 A;  3VE3 A;  1FCN A;  5EOE A;  3IWO A;  3T4S A;  1N4O A;  2V1A A;  4I39 A;  4DF6 A;  1CEF A;  3EQU A;  3T4Q A;  5GL9 A;  3UN7 A;  2XRN A;  3V3R A;  5FAQ A;  3IXH A;  4WZ5 C;  4Q0I A;  2ZL1 B;  1F2K A;  1E3U D;  3V39 A;  1S0W A;  1LSX A;  2RL3 A;  1S1Y A;  1LI9 A;  3ZYT A;  3ULF A;  5EVI D;  4CJN A;  2ZOI A;  5DFY A;  1K55 A;  4FUW A;  1YLZ A;  3LI8 A;  2Z6C A;  3QP2 A;  3W4Q A;  2EA9 A;  3B42 A;  2W3H A;  3MJQ A;  1H0M A;  4L9G A;  3UDI A;  4DE2 A;  5HWT A;  4B88 A;  4UA9 A;  2JCH A;  1LL8 A;  3UO9 A;  4X55 A;  3OLO A;  5LBR A;  2VK3 A;  5HPI A;  4HH3 A;  3VOL A;  5D3O A;  3C8C A;  2ZLY A;  4GDN A;  1TVF A;  1FR1 A;  3TSG A;  3BY9 A;  4QD4 A;  4E3O A;  4PKY G;  1JTG A;  3LR0 A;  4Y3I A;  1HZO A;  4NG2 A;  2GDN A;  4LRX C;  3DWK A;  3PAE A;  2PBY A;  1ES3 A;  1NJ4 A;  5E2F A;  5F6A A;  3T1R A;  4MDZ A;  5GLA A;  5HSQ A;  1JWV A;  3BEC A;  4PKY A;  3ZG9 B;  2OSU A;  3E2K A;  5CTM A;  2ZMF A;  3VP3 A;  1ODV A;  4HJ4 A;  4EQ1 A;  1RGZ A;  1NRJ A;  4OPR A;  1F9I A;  1W8Y A;  5KSH A;  4GD8 A;  3MF0 A;  3MXS A;  1X0O A;  2O0Y A;  4WBG A;  5HX9 A;  2XD5 A;  2CC1 A;  5HAI A;  4PAU A;  3F1N A;  3SW1 A;  1YAX A;  5EVE A;  1DJC A;  2EFU A;  2FZ0 A;  2G2U A;  2WKP A;  3VOY A;  5DJU A;  1LT0 A;  1FSY A;  5F1G A;  2V9A A;  4RYE A;  2W3F A;  3EOI A;  3EGX C;  4R23 A;  5IU1 A;  3LO7 A;  1S6R A;  1H5X A;  1STZ A;  4WYY A;  1BZA A;  3Q1F A;  2Y55 A;  3BM6 A;  4EET B;  5EFW A;  5C5K A;  4R3A A;  4E6W A;  1W5D A;  1NLY A;  2JBF A;  2X71 A;  2Y2L A;  4WEK A;  4PM5 A;  4F3L A;  2QMI A;  1PFL A;  3C5A A;  1ZKJ A;  1FOF A;  3UB8 A;  5G4Z A;  1MWS A;  4K08 A;  2IWD A;  4PM7 A;  4LRY C;  2XFT A;  2ZC6 B;  4H6J B;  2J8Y A;  3F1O A;  3PBQ A;  2C6W B;  1PWG A;  2XEP A;  3WS5 A;  3G2Y A;  3LIF A;  4BLM A;  1ES2 A;  2J3T D;  3LR5 A;  5EM1 A;  3F1P A;  2OAP 1;  2WKR A;  4HBT A;  4P85 A;  2VZW A;  3LI9 A;  3QNC A;  1W7F A;  4IVI A;  2E8I A;  3IS2 B;  1E4D A;  3D72 A;  3G35 A;  5J8X A;  1U60 A;  3VMA A;  3ISG A;  3LIA A;  3A3I A;  3P98 A;  4LCM A;  4KG6 A;  1VM1 A;  4JBF A;  4O7D A;  2R9X A;  5FI7 A;  4OPY A;  1PI5 A;  5HW3 A;  3NOT C;  5CGS A;  1H8Y A;  3JYI A;  3Q07 A;  5AQ7 A;  3C4O A;  3IXB A;  4KUK A;  1UWN X;  4N1X A;  1SHV A;  1PWC A;  2XA7 S;  1NRF A;  2WAD A;  1YT4 A;  3MMH A;  4ZBE A;  4UQI S;  3KSI A;  5KZH A;  4BD0 A;  1GHM A;  2EFX A;  5F69 A;  1I2S A;  4E3J A;  4X53 A;  2H0T A;  1WA9 A;  2J3W A;  4X25 A;  4EBP A;  3ZDJ A;  2D01 A;  2PDR A;  1ALQ A;  4G3K A;  3T1Q B;  2O99 A;  4DJ2 A;  1MWT A;  4YNR A;  1O07 A;  4MBK A;  3A0V A;  2XLN A;  4Y0O A;  5EVI C;  3GQZ A;  3VV4 A;  3ICY A;  1KE0 A;  2HP6 A;  5EPH A;  4DXB A;  4FOF A;  2W3E A;  2ZQC A;  3T1S A;  4X1M A;  3ITA A;  1T1B A;  3UE3 A;  4B4X A;  4HES A;  4P6B A;  2OOL A;  4R0Q A;  1PWD A;  1VET B;  3K2N A;  3SS3 A;  2LB9 A;  4BL2 A;  3BWL A;  3O3V A;  1TS0 A;  3M2K A;  3NDE A;  2PYP A;  4X68 A;  5AVE A;  1K25 A;  5JYO A;  4EES A;  2W1T B;  1MKM A;  3KYE A;  4LFU A;  4EER A;  3TW8 A;  1A0K A;  3R7W B;  4GD6 A;  5FQJ A;  3IQA A;  1HD8 A;  4YOF A;  1YLJ A;  4OKP A;  3FG8 A;  3E4O A;  3GMW A;  1XJ4 A;  2EX6 A;  1BLC A;  3V5M A;  1N9L A;  1FIL A;  3B3X A;  5CED A;  1PNE A;  3UMD A;  4NXG A;  3ZCZ A;  3WS4 A;  1IFQ A;  3UE0 A;  2ZJ9 A;  3PTE A;  3T4J A;  4OP8 A;  4H8R A;  3IHA A;  1ZG4 A;  4U0T A;  1K55 C;  1ONH A;  4LRZ E;  4NXE A;  2JKF A;  1K56 D;  2YKF A;  3O86 A;  1MC0 A;  3A3E A;  1D06 A;  1K6S A;  1BTL A;  3LFV A;  3G2Z A;  1S66 L;  2Q0O A;  2WAF A;  3UDX A;  1Y54 A;  2EX2 A;  4N9L A;  2WZZ A;  3OPH A;  4OP5 A;  2QWS A;  1Z6F A;  1PI4 A;  5TBM B;  5FQQ A;  5I94 A;  5J4E A;  2M1C A;  1HTZ A;  2QJ5 A;  3MS6 A;  5DTK A;  3IF6 C;  2JN7 A;  4L0L A;  2IWC A;  4QY6 A;  3W8K A;  1S4S A;  3QP5 A;  2HDQ A;  4I3J A;  4WEL A;  5GLB A;  2H5S A;  3S7P A;  3F1N B;  3UB7 A;  4NKP A;  4OON A;  4U0X A;  4RX3 A;  4E3N A;  4KZ9 A;  1OTB A;  1TD5 A;  1OJ5 A;  2HP5 A;  2A2L A;  4S2O A;  1D1J A;  4R70 A;  1V9Z A;  3P09 A;  3IF6 A;  5FEF A;  1T19 A;  4EQI A;  5HAP A;  3PBS A;  4BWI A;  2VKS A;  3WS1 A;  4RQ9 A;  3MZE A;  4P6Z M;  2PYR A;  4HP9 A;  4KG2 A;  1FCO A;  5TR7 A;  1RGY A;  3LIE A;  1TDL A;  4KZB A;  5GLC A;  3T12 B;  4R3B A;  4EWF A;  1RP5 A;  3ZG7 B;  5CHM A;  1YLP A;  4E6X A;  3PBR A;  3LEQ A;  1PZP A;  1VEU B;  4E3K A;  2HV1 A;  3HLE A;  2XF3 A;  1F5M A;  2ZL1 A;  4UHU A;  4Y15 A;  1LI0 A;  1KVL A;  3OPP A;  2WZX A;  5AQ9 A;  4EEP A;  2KX6 A;  2DRW A;  4KEN B;  1BUL A;  2VGL S;  3A3F A;  3UPP A;  3QP6 A;  1J9M A;  5L2F A;  3HRE A;  3EQV A;  5TJJ A;  2V1B A;  1NYY A;  5HD5 A;  4ID4 A;  3W4P A;  5HAQ A;  3FPV A;  1Z09 A;  3GDI A;  2Y2Q A;  3EEA A;  1N9B A;  4XUX A;  3D4F A;  1ZTU A;  1DJA A;  3MKF A;  1K38 A;  4IBR A;  4R1G A;  4QU3 A;  1TF1 A;  3V67 A;  5AVF A;  1XKZ A;  4GJ4 A;  2J3T C;  5DF7 A;  1IOU A;  1KDW A;  4HQA A;  1DP9 A;  2JC7 A;  1I5Q A;  3M2J A;  4MLL A;  5HDS A;  3UDF A;  1YMX A;  4HNB A;  2WKE A;  2EXB A;  1BSG A;  5DTS A;  3SH9 A;  3PBT A;  4S2M A;  2X02 A;  1LSV A;  3ZGA B;  3NOP C;  4CLC C;  4MMN A;  4BBV A;  4ZJ3 A;  1FSW A;  2HP9 A;  5IT5 A;  1OPX A;  2VA0 A;  3ZNY A;  4R3J A;  1VHM A;  4GB7 A;  3CLO A;  2PHY A;  2P04 A;  4N1H A;  1AXB A;  3NUL A;  2HJ9 C;  4PM6 A;  2Y2K A;  1EI5 A;  2ZM0 A;  1TEM A;  2VV7 A;  4HIA A;  3H7W A;  4DE3 A;  3G31 A;  1I2W A;  3N6I A;  1UWP X;  1BYW A;  2NUT C;  3HLC A;  1JVJ A;  3BY8 A;  1ZC2 A;  4ZTK A;  1K57 C;  3N4I A;  2V8C A;  5HWW A;  2GNX A;  3V50 A;  5FAS A;  1SKO B;  5DTT A;  2Y2G A;  1OTD A;  4QPR A;  2UV0 E;  1P9W A;  3ZHH A;  4LLO B;  2L4R A;  3PBO A;  4DDY A;  5L07 A;  4CLC E;  5HD3 A;  3MQQ A;  3OPL A;  2IA2 A;  5F1F A;  3T4T A;  1YMS A;  4DMZ A;  4E04 A;  1GSV A;  3U2A A;  5FL3 A;  2VJW A;  5CX7 A;  1IEM A;  1L0E A;  3IH9 A;  2IWB A;  1GA0 A;  1KE3 A;  1L3L A;  2Y2J A;  4KUO A;  3IX3 A;  4Y17 A;  4IUH A;  2VGJ A;  1GSX A;  2XA7 M;  5AJG A;  4HI4 A;  2EX9 A;  5MC7 A;  1YSP A;  2J7V A;  3PHY A;  4HH2 A;  3BRM A;  4JKT A;  1BT5 A;  3IS2 A;  2KLI A;  4Y2F A;  1MPL A;  3W4O A;  3ZG8 B;  4GHI A;  1H8Z A;  1K6R A;  5DVA A;  5CHJ A;  3MZF A;  1PRQ A;  4HJ6 A;  3JVV A;  3U4L P;  1VET A;  1W8Q A;  4Y0U A;  3IXD A;  3MQ0 A;  4OQI A;  1O7E A;  5EVI B;  5HFO A;  2ZQ7 A;  3NJA A;  4HHD A;  1H8M A;  2QZ6 A;  1ONG A;  5DF9 A;  1VB6 A;  3VP4 A;  1Q2Q A;  3HUO A;  3LIC A;  2P9V A;  1SKF A;  1YKD A;  3MXR A;  2Y2I A;  4CLC A;  2ZQ9 A;  3DTI A;  4P6Z S;  3H82 B;  3H9W A;  4KQO A;  3G32 A;  2ZQ8 A;  3NOU C;  3UB6 A;  3FKV A;  2W0N A;  1KGE A;  4DKI A;  5BOH A;  3HLF A;  4BBT A;  3LEZ A;  5G4Y A;  3LCE A;  4R4R A;  4C75 A;  2EWV A;  1XFN A;  2V2F F;  2HZ5 A;  3GSG A;  2W1R A;  3E4Q A;  3E2L A;  4B4Z A;  4KZ5 A;  2HJE A;  1LHY A;  3ITB A;  1MXO A;  4BEN A;  1LL9 A;  3MXQ A;  3SOI A;  2PD8 A;  3ZVT A;  4FD8 A;  3ZNT A;  5E2G A;  5K5B A;  1C3B A;  4ESP A;  1FR6 A;  1G6A A;  5E2H A;  3ZVW A;  4Z9Q A;  3M6B A;  2ZC3 B;  4DJ3 A;  4JGR A;  4OPZ A;  2VLG A;  2ZC4 B;  2A24 B;  2J9O A; 
#chains in the Genus database with same CATH homology
 4ARZ A;  4IUK A;  2DMW A;  2G7U A;  2QKP A;  3P7N A;  2LB5 A;  3LIB A;  3B33 A;  4FSF A;  2INW A;  1G6O A;  1S4R A;  3R4K A;  2QWS A;  3OCN A;  4WL9 A;  5TBM B;  2B02 A;  3MFX A;  1DP8 A;  2ZOH A;  3PXP A;  5J4E A;  2M1C A;  2QJ7 A;  5HL6 A;  1TS6 A;  2QJ5 A;  2O9B A;  3TJZ C;  3TRC A;  3PBN A;  2O9C A;  4B9O A;  4I3A A;  4B93 A;  2WKQ A;  2JN7 A;  4L0L A;  3JVU A;  3S7Q A;  1T18 A;  4GLQ A;  4R6L A;  1S4S A;  1KOU A;  2GX5 A;  1OTE A;  3VE3 A;  4I3J A;  1EW0 A;  4WEL A;  3S7P A;  4EU0 A;  2OWH A;  3T4S A;  2V1A A;  4I39 A;  3F1N B;  3UB7 A;  4WN5 A;  4EUV A;  4HJ3 A;  3D3O A;  3EQU A;  3BQA A;  4NKP A;  3BJN A;  3T4Q A;  1T1C A;  4MN7 A;  2XRN A;  5KIZ A;  5J7E A;  2Y8H A;  1OTB A;  1TD5 A;  4Q0I A;  1OJ5 A;  3C38 A;  2A2L A;  3LR4 A;  3FPW A;  1LSX A;  4R70 A;  5IS1 A;  4DN0 A;  1S1Y A;  1V9Z A;  4EXO A;  3ZYT A;  3ULF A;  1ZHH B;  2ZOI A;  5DFY A;  2K7S A;  4I3I A;  3LI8 A;  4NEE D;  1T19 A;  1UGU A;  1NWZ A;  4MCW A;  3PBS A;  4BWI A;  2VKS A;  2Z6C A;  3VE4 A;  3FC7 A;  4O0P A;  4RQ9 A;  2EA9 A;  2OAQ 1;  4P6Z M;  2PYR A;  5A8B A;  4HP9 A;  3B42 A;  4ME4 A;  2W3H A;  3MJQ A;  4L9G A;  4ETX A;  3F1P B;  3RH8 B;  3LIE A;  5HWT A;  4L9F A;  3CAX A;  2PD7 A;  3C2W A;  1LL8 A;  1T1A A;  3CUE C;  3OLO A;  5LBR A;  3TE8 A;  1XJ3 A;  5HPI A;  4HH3 A;  3VOL A;  3C8C A;  3PBR A;  2HV1 A;  3NHQ A;  4WEJ A;  3BY9 A;  1F5M A;  2BAS A;  2O9A A;  3LR0 A;  4PKY G;  4Y3I A;  3S7N A;  2K2N A;  4LRX C;  1YSQ A;  4EEP A;  2KX6 A;  1XJ2 A;  2VGL S;  2PR6 A;  3HJI A;  1H3Q A;  1DP6 A;  4I38 A;  4BMW A;  5F6A A;  3EQV A;  4MDZ A;  2V1B A;  5HD5 A;  5TJJ A;  5HSQ A;  1P9R A;  2M7V A;  5F5Y A;  4PKY A;  3FPV A;  1JNU A;  5DKL A;  5DFX A;  3GDI A;  3F1O B;  3EEA A;  2ZMF A;  1ODV A;  1ZTU A;  3KSH A;  4HJ4 A;  4EQ1 A;  5HDC A;  1NRJ A;  3E0Y A;  4GW9 A;  3S7O A;  4OOM A;  3A0R A;  3LYX A;  3MR0 A;  3KYZ A;  1F9I A;  4Q0H A;  5KSH A;  2JKR M;  1S67 L;  1TF1 A;  3V67 A;  5AVF A;  4G3W A;  3H7W B;  4GJ4 A;  3MF0 A;  2J3T C;  2J80 A;  1IOU A;  3LUQ A;  4M4X A;  3KYQ A;  4HQA A;  1X0O A;  2O0Y A;  1DP9 A;  5HWV A;  1OTA A;  4ARZ B;  5HDS A;  3OOV A;  4HNB A;  2Y79 A;  3PYP A;  4PAU A;  3F1N A;  4G3V A;  1XJ6 A;  2V0U A;  3KO6 A;  2NUP C;  1YAX A;  3SW1 A;  3PBT A;  1W63 M;  2FZ0 A;  1LSV A;  2FH5 A;  4UEY A;  3NOP C;  4CLC C;  4MMN A;  2WKP A;  4BBV A;  1DRM A;  2B18 A;  3B47 A;  3A0S A;  4KQD A;  5IT5 A;  1OPX A;  2VA0 A;  5DJU A;  1LT0 A;  2V9A A;  2W3F A;  4HP4 A;  3EOI A;  1VHM A;  3EGX C;  3E98 A;  4H6J A;  3CLO A;  2PHY A;  2P04 A;  4NXB A;  5IU1 A;  1D7E A;  1STZ A;  2R78 A;  1OT6 A;  4EET B;  5EFW A;  5C5K A;  4R3A A;  2HJ9 C;  2W3D A;  1NLY A;  3KSG A;  4II7 A;  4R38 A;  2A24 A;  3KSF A;  2VV7 A;  4HIA A;  4WEK A;  4F3L A;  3T4O A;  3H7W A;  3OCL A;  3UB8 A;  4HY8 A;  1UWP X;  1BYW A;  5G4Z A;  2NUT C;  1W63 Q;  4K08 A;  4LRY C;  3BY8 A;  2I9V A;  4Q0J A;  5HWW A;  4H6J B;  5HZH A;  2GNX A;  4GS9 B;  5F68 A;  3F1O A;  3PBQ A;  1N9N A;  1OTD A;  4QPR A;  3W2Z A;  3EEH A;  1P9W A;  4UQI M;  3LIF A;  3HCY A;  4XT2 A;  4LLO B;  2PR5 A;  2J3T D;  3BQ8 A;  4CLC B;  2L4R A;  3PBO A;  3LR5 A;  1OJG A;  3F1P A;  2OAP 1;  2H28 A;  2WKR A;  2Z6D A;  3H82 A;  4CLC E;  2GZA A;  2VZW A;  3MQQ A;  5HD3 A;  3LI9 A;  2IA2 A;  2D02 A;  3IS2 B;  4GCZ A;  3T4T A;  3D72 A;  2K31 A;  4DMZ A;  4E04 A;  1GSV A;  3U2A A;  4CLC D;  1N9O A;  5FL3 A;  3RTY A;  2VJW A;  5CX7 A;  4L9E A;  3LIA A;  3OC2 A;  3T4L A;  4HOI A;  3CUE A;  3E4P A;  5DKK A;  4KUO A;  3C30 A;  4WUJ A;  3NOT C;  4IUH A;  2XRO A;  1GSX A;  2XA7 M;  4NXF A;  3EGD C;  3KX0 X;  4KUK A;  4HI4 A;  5AJG A;  1TS8 A;  1UWN X;  1P0Z A;  5L8M A;  2V0W A;  4IJG A;  5MC7 A;  2XA7 S;  4EW7 A;  1YSP A;  4ETZ A;  3IBR A;  3PHY A;  3MMH A;  4HH2 A;  3K3D A;  4CQH A;  4UQI S;  3KSI A;  3IS2 A;  2YKH A;  2KLI A;  4IHQ A;  5HDD A;  5F69 A;  4AFI A;  2W3G A;  3HJK A;  1WA9 A;  2J3W A;  3ZQ5 A;  1MZU A;  3G6O A;  4Y2F A;  4O01 A;  2L0W A;  2D01 A;  4O8G A;  2PDR A;  4LPZ A;  4GHI A;  2JKT M;  4G3K A;  4HJ6 A;  3K3C A;  2HGV A;  2O99 A;  3JVV A;  4DJ2 A;  2OWJ A;  2JKT I;  4YNR A;  1LSW A;  3A0V A;  4MN6 A;  4OOL A;  4GS9 A;  3MQ0 A;  4WF0 A;  3VV4 A;  3ICY A;  3UB9 A;  4I5S A;  4FOF A;  3O5Y A;  3NJA A;  2W3E A;  4HHD A;  1H8M A;  4Z1W A;  1Y28 A;  4BBU A;  4WLA A;  2VEA A;  3R7W A;  1T1B A;  4MN5 A;  3UE3 A;  2CMN A;  5DF9 A;  1VB6 A;  2W27 A;  3CWF A;  2EWW A;  4PHT A;  3LIC A;  5HPF A;  1YKD A;  2QYB A;  3IBJ A;  4CLC A;  2VV8 A;  3UME A;  2OOL A;  2ZBB A;  4Y5F A;  3UE6 A;  2ZMV A;  3LR3 A;  4P6Z S;  3H82 B;  3H9W A;  4KQO A;  2GJ3 A;  3CI6 A;  3K2N A;  2VGL M;  2LB9 A;  4JGP A;  1NLZ A;  3BWL A;  3NOU C;  3UB6 A;  1TS0 A;  2W0N A;  3EWK A;  4F3L B;  1OT9 A;  4GHI B;  2PYP A;  5AVE A;  2L1M A;  4BBT A;  4EES A;  2P7J A;  2W1T B;  5G4Y A;  2VX8 A;  3MQO A;  2KOI A;  1MKM A;  2QHK A;  3T4K A;  4EER A;  3TW8 A;  1P97 A;  2EWV A;  4JGQ A;  3R7W B;  4ZRR A;  1XFN A;  3OBF A;  2W1R A;  3PR6 A;  2KDK A;  4YOF A;  3E4Q A;  4JGO A;  1GSW A;  3P01 A;  5TBM A;  2HJE A;  3FG8 A;  2XSS A;  3E4O A;  5J3W A;  3CIT A;  1XJ4 A;  1F98 A;  1XFQ A;  2JHE A;  2PT7 A;  3MXQ A;  1N9L A;  1G28 A;  2PD8 A;  3UMD A;  4NXG A;  2JKR I;  3LID A;  3DBA A;  5K5B A;  4BJP A;  3BW6 A;  1IFQ A;  1S1Z A;  1OTI A;  3T4J A;  2MJ6 A;  2P08 A;  5DJT A;  3RFB A;  2M7U A;  4XT2 B;  5I5L A;  2W1T A;  4LRZ E;  2VV6 A;  4NXE A;  2HF6 A;  2YKF A;  3T50 A;  1MC0 A;  4YWZ A;  1D06 A;  4EEU A;  4DJ3 A;  4JGR A;  3LFV A;  1TS7 A;  2VLG A;  1S66 L;  2A24 B;  3GEC A;  1V9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...