5HDSA

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 3 ps structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hdsA00
4EW7A 1LSXA 2OWHA 3F1OB 1NWZA 2INWA 4GHIA 3B33A 4R6LA 2K7SA 5HDDA 3UMEA 3UE6A 1V9YA 3T50A 1DP8A 3HJIA 3CWFA 2KX6A 5G4YA 2OOLA 4JGOA 4L9FA 4JGQA 4HH2A 5F68A 2VEAA 4L9GA 1F98A 4EESA 3F1PB 2PYPA 5HDSA 2BASA 1XFQA 3LYXA 1XFNA 4MN6A 1Y28A 2V0WA 2P7JA 2V0UA 2B02A 3NOTC 2V9AA 4XT2B 5F69A 4B9OA 2PD8A 2Z6DA 1XJ6A 3CAXA 3F1NB 2CMNA 3VE3A 5HWWA 4F3LA 4EQ1A 3PHYA 1OTBA 1JNUA 4I38A 2QHKA 1LT0A 1S1ZA 5DJTA 4HY8A 4R70A 4E04A 4LLOB 1X0OA 4HP9A 2EA9A 4LRYC 3C8CA 3EWKA 3LI9A 3A0VA 3H82A 3SW1A 2VLGA 3FC7A 4DJ3A 4NXEA 4KUOA 2PR5A 1S66L 1V9ZA 3IS2B 5TBMB 1P0ZA 1OTDA 4WF0A 1OJGA 3LI8A 1P97A 1N9NA 4WN5A 5AVEA 4R3AA 3LIFA 2PR6A 3NHQA 2KDKA 3E4OA 4HIAA 2V1AA 3LIBA 4EEUA 4HI4A 4GCZA 1ODVA 4M4XA 3LICA 3BY8A 1T19A 2YKHA 2I9VA 1EW0A 5IS1A 1OTIA 3PYPA 4NXGA 5A8BA 4WLAA 1GSWA 4I5SA 4EETB 4MN5A 3UB9A 4JGRA 1MZUA 1UGUA 3A0RA 4F3LB 1KOUA 4HNBA 1S4SA 1XJ2A 4LPZA 3MXQA 5DJUA 2J80A 5HWTA 2QJ7A 3UB6A 2A24A 1GSVA 5I5LA 1S1YA 4PKYA 1DP6A 1OTAA 4EXOA 3MQQA 1BYWA 4HH3A 1TS0A 2JN7A 1UWPX 1T18A 5DKKA 4GW9A 4BBUA 1N9OA 1OT6A 1T1CA 4BBVA 2YKFA 2QKPA 3VOLA 4H6JB 1S4RA 1D7EA 4GS9A 2W27A 3LUQA 4GHIB 4XT2A 3MJQA 2GJ3A 3H7WA 5EFWA 2L4RA 1LSVA 2OWJA 2VV7A 5HDCA 1OT9A 3P7NA 4HJ3A 3NJAA 1OTEA 1G28A 2PD7A 3LIEA 1TS8A 3NOPC 4HOIA 2VV8A 2L1MA 1LSWA 5J4EA 2Z6CA 4KUKA 2WKRA 2ZOHA 5HD5A 2W0NA 3BWLA 3GECA 4K08A 3UB8A 5J7EA 4YWZA 2VV6A 1N9LA 4EEPA 5F6AA 5F5YA 3IS2A 5TBMA 4KQDA 2L0WA 2D02A 2QWSA 2A24B 4NXFA 2H28A 1VB6A 4LRZE 4I39A 1S67L 2QJ5A 2R78A 1OJ5A 1T1BA 2PDRA 4HP4A 1DRMA 3MFXA 4R38A 3LIAA 4L9EA 4PKYG 4HHDA 2PHYA 3K3CA 4DJ2A 4I3IA 3EEHA 3FG8A 3H82B 3F1OA 1LL8A 1DP9A 4GS9B 4WL9A 2V1BA 5G4ZA 1UWNX 5J3WA 2PYRA 1XJ4A 3OLOA 3E4PA 3H7WB 5HSQA 4WUJA 3MR0A 3HJKA 4HJ6A 3ICYA 5IU1A 3RH8B 3F1PA 4BBTA 4RQ9A 3MQOA 4HQAA 2WKQA 5AVFA 1D06A 5KIZA 4I3AA 4LRXC 4NXBA 1F9IA 3C2WA 3E4QA 3ZQ5A 3A0SA 3F1NA 3NOUC 3GDIA 4HJ4A 3K3DA 3D72A 5HZHA 2ZOIA 3UB7A 1TS7A 3RTYA 3LIDA 3G6OA 3IBRA 4I3JA 1WA9A 2ZBBA 1XJ3A 3BY9A 3UMDA 4EERA 5HWVA 2M1CA 2WKPA 3H9WA 3VE4A 4H6JA 4JGPA 1T1AA 3KX0X 2HV1A 2D01A 5HD3A 1GSXA 3ULFA 5DKLA 2JHEA 1TS6A 3CLOA
chains in the Genus database with same CATH superfamily
1XKZA 3F1OB 2INWA 3GV9A 5DFYA 4ARZB 3OPHA 3B42A 4X6TA 3S7NA 5I94A 5FEGA 4IVIA 3UE6A 2FFYA 2WZXA 2CC1A 4K0WA 1GA0A 3CWFA 3PR6A 5AQ9A 1YLJA 3HLFA 5EOEA 4L9FA 2G2UA 4Y0UA 5F68A 3ZG8B 3OPPA 5A90A 5FDSA 3BFCA 4EESA 2JKTM 3F1PB 1TDGA 2V20A 2PU2A 1Z6FA 1XFNA 3NOTC 4B93A 3TRCA 3IXDA 4CLCB 2Y59A 4GZBA 5E2HA 2PD8A 1AXBA 2Z6DA 2X71A 3JVVA 1XJ6A 4IJGA 2CMNA 3GR2A 2Y2JA 1ONGA 5EVIA 4D2OA 2KLIA 1OMEA 4EQ1A 3PHYA 2VGLS 3SS5A 3P01A 3P98A 3G2YA 4Y5FA 4LLOB 5GLCA 5GLAA 1X0OA 2O0YA 4LRYC 3MZEA 2W3FA 3MZFA 3EWKA 2WGIA 3SW1A 2VLGA 2Y2OA 1N9BA 4Y7PA 4N9LA 1L0EA 2PR5A 4CQHA 1BUEA 4KZ5A 2O9CA 1YSQA 4IEDA 2XR0A 1OTDA 2AVXA 2ZC5B 4WF0A 2VJWA 5FQQA 5EE8A 3LI8A 5TJJA 2UV0E 3N8RA 4BLMA 3DAVA 3LIFA 1ERQA 1MXOA 2PR6A 5JYOA 2ZQCA 3E4OA 4HIAA 3MFDA 3V3RA 2OLUA 4MCWA 4N9KA 1GCEA 1EWZA 1K54A 2XD1A 2Y4AA 5M1AA 1FR1A 2K31A 1RGZA 5HFOA 1MBLA 5FDHA 4NKPA 4ZAMA 2YKHA 4NK3A 3UDIA 4R0QA 1PNEA 5IS1A 3DTIA 2OAP1 1PI5A 3PYPA 4NXGA 5TGFA 3A3EA 3GVBA 1E4DA 1PW8A 5BOHA 2VA0A 4WLAA 5CEDA 5FQJA 3T4QA 4S2NA 4WEKA 1CJFA 1KGGA 4EWFA 3MKEA 2HDSA 2HDQA 3OC2A 4LPZA 5A92A 1H8YA 2Y2QA 3Q07A 3MKFA 3A3DA 4C6YA 2PBYA 5HWTA 4KZBA 3DTKA 4RYEA 2QJ7A 3PXPA 1GA9A 3BM6A 2RL3A 3S22A 1TVFA 3G2ZA 3D4FA 3RFBA 4BD0A 3KYZA 4PKYA 3QNCA 2H0YA 4EXOA 5L2FA 2Y2KA 3T12B 3IWQA 1NZUA 3CPTB 3TE8A 4JLFA 1VETB 3QNBA 1O07A 5FL3A 3UE3A 4O8GA 1KDSA 4LFUA 1C3BA 4JXGA 5EUAA 3QHYA 5DKKA 3B3XA 2JBFA 1OT6A 1T1CA 2ZJ9A 3PBTA 4GB7A 2YKFA 5E2EA 4CLCE 2QKPA 2EWVA 1MKMA 1S4RA 3ZGAB 1D7EA 3R4KA 3PBOA 4QU3A 2XDMA 2JKGA 4IUHA 2WUQA 1W79A 4GLQA 3PAEA 5E43A 5DTSA 4QB8A 5HPIA 1ZC2A 4KQQA 3PBQA 3WRZA 3MJQA 4R4RA 4JF4A 1PIOA 2W1TA 2XA7S 1BSGA 3FZCA 1PZOA 1RGYA 2PBDP 2WYXA 2PD7A 1JWPA 3LIEA 2L1MA 1L2SA 4KUKA 4PM8A 4E6XA 4HEFA 2ZC6B 3FYZA 4JBFA 1WYBA 1YLWA 5FQMA 3L9KA 2IWDA 2DCFA 5J7EA 3M2KA 3NCKA 2GZAA 4EEPA 1GHIA 1YSPA 3IH8A 4Q0JA 4P87A 1JTDA 2L0WA 3CG5A 2D02A 1DJBA 2W3DA 4G3VA 2V1ZA 4E6WA 2VK3A 1K38A 2GX5A 1VHMA 1JVJA 1E3UA 2C6WB 4HP4A 1DRMA 3VOZA 3GMWA 1LI9A 3A3IA 4DJ2A 1VEUB 4DDYA 3H82B 3S1YA 3Q82A 1H8MA 5EVLA 2ZM8A 1K55A 4GS9B 1H0MA 1PWDA 3GSGA 5EVID 4OP8A 3LR5A 4LV3A 3L7HA 1U60A 3A3JA 1VQQA 5EM0A 2WGWB 2Y8HA 1ESUA 1IYSA 1LL5A 4WUJA 4S2NC 4GJ4A 1K25A 4YFMA 2ZMVA 4X53A 1MPLA 3ISGA 1Z09A 4E3IA 2ZM0A 3MQOA 3MSHA 4Y0OA 1XXMA 2LB5A 1BLSA 4OVDA 3FPVA 4EBLA 2HZ5A 4GOGA 3EQUA 1F9IA 3C2WA 4IHQA 4MN7A 2ZL1A 3K3DA 1KVMA 3T4JA 3D72A 1GHPA 2P08A 3WWXA 3RTYA 3OBFA 5CECA 5CHMA 1WA9A 3T1QB 3ZYTA 1IFQA 2XK1A 3UMDA 1W63M 1HD8A 3CZDA 1P9WA 5HWVA 3VE4A 4FTXA 1K0KA 2XGNA 2D01A 2WK0A 2ZD8A 1Q2PA 2OWHA 3T1SA 4R6LA 1YPRA 2J3TC 1SKOA 2H10A 1SCWA 2H5SA 2R9XA 4A5RA 3SS4A 1FR6A 4N1HA 1XGIA 2OOLA 3CHWP 2ZLYA 3BEBA 3MZDA 4P0MA 4MBFA 1TEMA 5K5BA 1F98A 2Y2NA 3CMZA 3NDEA 1I2WA 4QD4A 4QY5A 3ZG9B 4DE0A 1XFQA 1Y28A 4WM9A 3FWLA 2V0UA 3HLDA 2B95A 4S2OA 2Y2MA 3OPRA 3UB5P 4ME4A 2HP6A 3KO6A 1W8YA 3CAXA 3C4PA 3F1NB 4OP5A 4BQMA 2QZ6A 5GHYA 5HWWA 2M7VA 1PYYA 1FSWA 3G31A 3CI6A 1OTBA 1JNUA 4I38A 4O01A 2QHKA 5GLDA 2QYBA 2Y2LA 5DJTA 4HY8A 4R70A 4E04A 3UDFA 2J9OA 4Z9QA 1VEUA 4LCMA 3A0VA 2EX2A 3H82A 3VSKA 3FC7A 3VP3A 3GRJA 4NXEA 1S66L 1V9ZA 5TBMB 4H8RA 3LO7A 3GQZA 3ZG5A 1K56A 1MWUA 4Q0IA 1QMEA 1FOFA 1PWGA 1P97A 4WN5A 3DTEA 3UY6A 1NLZA 4GDNA 3NHQA 2KDKA 3D9YA 1W63Q 1NRFA 2Q9NA 3T1XA 5EPHA 3AGEA 4CJNA 2EX8A 2K2NA 3IF6C 3O5YA 1IYOA 3FKVA 3LICA 5DF9A 1T19A 1CQAA 4GN2A 4OPZA 4EU0A 3IXBA 5CX7A 2HF6A 1OTIA 2WKHA 1E3UD 5A8BA 1CEGA 4KZ4A 4EETB 4JGRA 1MZUA 4Y17A 4JKTA 5HPFA 1I2SA 3LEZA 3SH7A 4F3LB 3NECA 4GD8A 4ZRRA 3OCNA 3SH9A 1LL9A 1NYYA 1STZA 4OQHA 4DE1A 3DBAA 2OLVA 3G35A 1RCJA 5F83A 5FAOA 1FCOA 2ZC4B 1S1YA 4WEJA 3U2AA 1DP6A 3KSHA 4X68A 1YT4A 5F1FA 4LGWA 4C75A 3ZCZA 4E3JA 4HH3A 5CRFA 2J9PA 1CI9A 1G68A 3TW8A 1W7FA 3IWIA 1A0KA 1ONHA 5GHZA 4BBUA 3CUEA 3AGDA 3DTMA 3BFFA 1N9OA 4BBVA 5HL1A 5HAIA 1EROA 1ZHHB 1IYQA 3VOLA 3VOYA 1NJ4A 3ITBA 3IHAA 1CI8A 5EV0A 1PZPA 3IX3A 3IXHA 4M3KA 4PMAA 2XF3A 3W4OA 3H7WA 5EFWA 2L4RA 2M7UA 5F82A 2VV7A 1OT9A 1XGJA 3PTEA 1H5XA 4MLLA 3AGFA 1NRJA 4X56A 1G28A 1TS8A 3BYDA 2VV8A 3KSFA 1BZAA 4KENB 5HD5A 3IHBA 4R3JA 4EUZA 5EVEA 3IWOA 3JYIA 3UB8A 3QP6A 2VGJA 5FQ9A 1K57A 3RJUA 1YKDA 5F5YA 4MDZA 5TBMA 3Q81A 3BFGA 2A24B 4PHTA 1QMFA 4MBKA 4F94A 2H28A 2V8CA 4LRZE 5HAPA 1WYCA 2QJ5A 2R78A 3C4OA 3MFXA 4HESA 3UE0A 5G18A 4HHDA 2Y91A 1CF0A 3K3CA 2VGKA 4I3IA 1TD5A 3IX8A 1KDWA 4OPQA 2EXAA 3F1OA 3NDGA 5J8XA 4WL9A 2V1BA 4ARZA 2WZZA 3EGDC 3IF6B 5L10A 1YLZA 4JXWA 1S6RA 1M40A 1TF1A 3EQVA 3HVFA 3HL9A 1F2KA 3HJKA 1RP5A 3LEQA 4EUVA 3IQAA 3VSLA 4ETZA 5MC7A 3F1PA 4EV4A 3N6IA 5L8MA 3LCEA 1G5UA 2Y2GA 4IUKA 4OQIA 5AVFA 5DF8A 3LY3A 4CLCA 1K56D 3TG9A 4E3NA 1KE0A 3NOUC 4KZ9A 4XXRA 3MQ0A 1P9RA 5FI2A 3BFDA 4OQGA 3LR3A 1DJAA 5EVIC 2XFTA 4KZ3A 4UEYA 1ESIA 2JE5A 1TS7A 4XUZA 3DWKA 3G6OA 3WS0A 4MEZA 1E25A 1XJ3A 3Q7VB 3PAGA 3WS5A 3G34A 3V50A 4UQIS 4OPRA 3V5MA 5FQKA 2VX8A 3ZG0A 4Q8IA 2ACGA 1BT5A 2IWCA 3QP1A 1K6RA 3A3FA 3C5AA 3ZG7B 5HL6A 3R7WB 3I7JA 3UPOA 5IHVA 1GSXA 3ULFA 3CLOA 4QPRA 5D3OA 4UAAA 2FFFB 1NLYA 1LHYA 4WZ5A 1XPBA 5U47A 5HDDA 3UMEA 2EX6A 4KZ7A 2VZWA 3E0YA 1Y4OA 3T50A 4UQIM 5M19A 4R1GA 4UA7A 3VP0A 4BENA 5AJGA 3VP4A 4JGOA 2P9VB 4DE3A 3IX4A 1K54C 2B18A 4NETA 3T4OA 1FILA 2DRWA 5A91A 1YM1A 3V67A 3S7OA 3LYXA 4MN6A 2V0WA 3SOIA 2P7JA 2DMWA 3U4LP 2B02A 4XT2B 1BLHA 1PFLA 2XQZA 1MWTA 2HPBA 5FSRA 2Q0OA 2HGVA 5KZHA 2JKFA 1PI4A 1TDLA 2EWWA 4KG2A 4DE2A 5KSHA 4FH4A 1YLYA 4X55A 1LT0A 1S1ZA 3UPNA 1G6AA 3MMHA 3BW6A 4JF5A 4QY6A 3TSGA 2JKRI 2Y79A 3T4SA 1FCMA 3IXGA 5A93A 4KZAA 4Y2FA 3UO9A 4GDBA 3TOIA 4KUOA 3KYQA 3IS2B 1P0ZA 4XUXA 3W4PA 4MBHA 3CPTA 1OJGA 1VETA 2PT7A 3MXRA 2XSSA 1N9NA 2J8YA 5AVEA 4R3AA 3M2JA 4X25A 1FCNA 2V1AA 3C30A 2ZQDA 3LIBA 4EEUA 4HI4A 3W8KA 4E3MA 3FV7A 3JPUA 4GCZA 4U0XA 4O7DA 3O88A 5EM1A 2XLNA 2EFXA 3BECA 2HP5A 5HW3A 3BY8A 3M6BA 4CLCC 4OLGA 3IBJA 4S2MA 3OZHA 1D1JA 2E8IA 2J3WA 3JVUA 4G3KA 4X1LA 5DTTA 2E8JA 2EFUA 3UB9A 2X02A 4B88A 4S2IA 1UGUA 3DWZA 2B5RA 3Q7VA 5EVIB 1XX2A 3FPWA 1KOUA 1XJ2A 2JKTI 4DN0A 4Y3IA 4DRTA 4RVAA 1SHVA 1GHMA 4BD1A 2OAQ1 5GL9A 3NI9A 2O99A 3UB6A 1L0GA 1GSVA 1OTAA 4YINA 4DDSA 4BMWA 4L0LA 3MQQA 4KQOA 2Y2IA 1TS0A 2Y2HA 2JN7A 1UWPX 3OCLA 4E3OA 4PM5A 1BTLA 2ZMFA 2KOIA 2NUPC 1T18A 2H0TA 5CGSA 3T4KA 4CLCD 2WKEA 4KZ6A 1HTZA 1NXYA 4GW9A 4ZBEA 1IYPA 2OSUA 4H6JB 5LBRA 5TR7A 4GS9A 4B4XA 1K55C 4OH0A 4LCLA 4JF6A 2W27A 4R23A 4OPYA 1SKFA 4EQIA 3VP1A 4GHIB 4XT2A 2W3HA 2WGWA 2XD5A 1LSVA 2OWJA 3SH8A 4OONA 3P7NA 4ZJ1A 3KSIA 1OPXA 4HJ3A 3NJAA 2BLSA 1ES2A 1OTEA 2J7VA 4AFIA 4QWOA 4DXBA 2ZQ7A 5J4EA 1MY8A 4EBNA 2IWBA 3IT9A 2WKRA 1IKGA 3WS2A 2W0NA 3BWLA 2Z2MB 3GECA 2LB9A 1XP4A 4IBRA 4Y13A 2C5WB 1ZG6A 1KVLA 2O9AA 3NBLA 1N9LA 4E3KA 1W8QA 1J9MA 1ERMA 4QHCA 4QJGA 3IS2A 2A49A 4OOYA 3V3SA 2QPNA 4ZJ3A 5L09A 1HLUP 4G3WA 1YLPA 1VB6A 4N92A 1AWIA 4LV2A 4S2LA 1K6SA 4I39A 2G2WA 3MS6A 2WKIA 4PM6A 1OJ5A 2PDRA 3BQAA 4P85A 3WRTA 4WMCA 1IKIA 3LIAA 3OPLA 3PBRA 4UA9A 3G4PA 3SS3A 4Y15A 3EEHA 3NC8A 4GD6A 1DP9A 2HDRA 1KGEA 4PPRA 5G4ZA 3PBNA 3C38A 2PYRA 3LY4A 5KSCA 1XJ4A 2Q9MA 5AQ7A 5CGWA 2V8FA 3V39A 5HSQA 3BLSA 5KMWA 2W1TB 1LI0A 1HVBA 5DFXA 4HJ6A 5IU1A 3M6HA 4PM7A 3KYEA 5CTNA 3EGXC 4BBTA 1FIKA 4HQAA 3LFVA 4CPKA 4DKIA 1D06A 1F5MA 1G6OA 2BTFP 4KQRA 5KIZA 3QP2A 4LRXC 3C7UA 3E4QA 3ZQ5A 2HP9A 4X69A 3F1NA 5FQIA 3GDIA 1FQGA 4HJ4A 3P09A 2JC7A 4RA7A 2FZ0A 1HZOA 3IBRA 4C3QA 4I3JA 3N7WA 4JPMA 2ZBBA 1PRQA 2VGLM 3LGOA 1KE3A 4BWIA 3VFHA 1J3WA 3BJNA 4P6BA 3H9WA 3BRMA 4H6JA 4RX3A 1CK3A 3KSGA 4WELA 3KX0X 3S7PA 3WS4A 5IT5A 4OOMA 1O7EA 4EW7A 1LSXA 3LR0A 1NWZA 4GHIA 3B33A 2K7SA 3ZDJA 1CEFA 2OV5A 3GTCA 3HBRA 1V9YA 4YOFA 1L3LA 3CJMA 2FH5A 1DP8A 3HJIA 5FEFA 2KX6A 5G4YA 4ID4A 4K91A 4JGQA 2Z2LB 4HH2A 4R3BA 1MKIA 2VEAA 4L9GA 3MXSA 2PYPA 5HDSA 3G30A 2GNXA 2BASA 1K4FA 1W5DA 2W3EA 3TJZC 4GKUA 1BLPA 5HARA 4LV0A 4IBXA 2V9AA 2ZQAA 5F69A 4B9OA 4K0XA 4Q0HA 4Z1WA 1Y54A 3OOVA 2HDUA 2XH9A 3Q1FA 1L0FA 1IOUA 3K2NA 2ZMAA 3NULA 4GNUA 3UDXA 3CITA 3VE3A 2ZL1B 5CGXA 3DW0A 1KGFA 4F3LA 3UE1A 2RCXA 4DXCA 3E2KA 2ZM2A 3HUMA 5GHXA 3HUOA 5CTMA 4FSFA 1MWRA 4HP9A 2EA9A 1ZTUA 3C8CA 3WS1A 3PBSA 3LI9A 3VP2A 4HBTA 1ALQA 4DJ3A 1ES4A 3EOIA 4R4SA 2ZQ9A 2HJEA 1YMXA 4JXVA 1SKOB 2EXBA 5FAPA 1NZOA 1PW1A 4OQ0A 5FASA 4FOFA 2P04A 4KG5A 3CUEC 1ES5A 1H3QA 3HLGA 1EI5A 4S2KA 4ESPA 1MC0A 4NG2A 1YQSA 1LLBA 5CHJA 1ODVA 3QP8A 3D3OA 4M4XA 4OLDA 2EX9A 2ZC3B 2BG1A 1M6KA 3ZNYA 2I9VA 1EW0A 1YAXA 5L07A 4LV1A 4JXSA 4E3LA 3C7VA 4WBGA 1BULA 1DJCA 1N4OA 1MWSA 2XA7M 5GLBA 4FUWA 1WE4A 4WMCD 1GSWA 2A2LA 3HUNA 4I5SA 5TFQA 4OKPA 2DNSA 4MN5A 4LENA 3A0RA 1Q2QA 2P74A 5CXWA 3O86A 3ZNTA 3ZFZA 4UHUA 2WAEA 4B4ZA 4HNBA 2NUTC 3VMAA 4ETXA 1S4SA 3MXQA 5DJUA 4RX2A 5FAQA 2G7UA 1YLTA 2W1RA 1K57C 4PAUA 2GDNA 3N4IA 4BL2A 2J80A 3E2LA 5EECA 3T4LA 2O9BA 3LR4A 2XRNA 2QMIA 3Q7ZA 2A24A 3HLCA 5I5LA 3RXXA 3O3VA 2PRFA 1NY0A 3BLMA 1BYWA 1DY6A 4O0PA 4N1XA 3MBZA 5FI6A 5DF7A 5FATA 3HCYA 3B47A 3S7QA 3RXWA 5EOOA 5AQAA 5F1GA 2V2FF 1SDNA 1K4EA 3IF6A 2WADA 1ZKJA 3FKWA 5HAQA 3LUQA 2PU4A 2GJ3A 3UN7A 1VM1A 1XA1A 3UNWA 3S4XA 5HDCA 4DMZA 2PAVP 4WZ4A 3SZTA 4KG6A 4BL3A 3NOPC 4HOIA 1LSWA 2XFSA 2MJ6A 2Z6CA 4D60A 2R9WA 2ZOHA 1IEMA 2HJ9C 3NY4A 1IELA 1JWZA 4K08A 1FSYA 4OOLA 2Y55A 4YWZA 5JYPA 2VV6A 3VFFA 5M18A 3HLBA 1JTGA 3E98A 5F6AA 2I72A 1SZVA 5CERA 1PWCA 4PM9A 4KQDA 2IA2A 4P6ZS 2QWSA 3NIAA 5DTKA 5C5KA 4NXFA 2WGVA 3BFEA 4UA6A 2Y2PA 4X1MA 1S67L 1T1BA 4YNRA 1L0DA 4R38A 3N8LA 1ES3A 4FCFA 4MNRA 3T1RA 3R7WA 4L9EA 3ZVWA 4PKYG 2ZC7A 2PHYA 1H8ZA 3QP5A 4Y0TA 3FG8A 1LL8A 2XROA 4FD8A 4P6ZM 4WZ5C 2UWXA 3ZVTA 5DVAA 3IH9A 5CHUA 1UWNX 5J3WA 4MMNA 4S2JA 3ZHHA 3HLWA 3OLOA 4FH2A 3E4PA 4KZ8A 3H7WB 3W2ZA 4BJPA 1BLCA 2P9VA 2X01A 3MR0A 3ICYA 3QP4A 3N8SA 3W4QA 1ZG4A 4WYYA 2A3UA 3RH8B 3BQ8A 4DF6A 5AQBA 4RQ9A 3IF5A 4IVKA 2WAFA 1I5QA 2WKQA 1YMSA 2ZQ8A 1XA7A 2VKSA 4ZTKA 2JKRM 5E2FA 3EEAA 3MF0A 1SDEA 3O87A 2J3TD 4I3AA 4NXBA 5FA7A 3A0SA 3VV4A 5CEBA 1ACFA 4U0TA 5HZHA 2ZOIA 3UB7A 4S2PA 2W3GA 3LIDA 4ZJ2A 1JWVA 1NYMA 3T4TA 3HREA 3BY9A 1S0WA 4ZDXA 5E2GA 4EBPA 4EERA 4II7A 3UPPA 5FI7A 2M1CA 2XEPA 2WKPA 3ITAA 1KE4A 4U3TA 2JCHA 4JGPA 1T1AA 4NEED 2HV1A 5HD3A 3HLEA 5DKLA 2JHEA 1TS6A 5HX9A 4HBUA 3G32A
chains in the Genus database with same CATH topology
4OOMA 4EW7A 1LSXA 3LR0A 2OWHA 1NLYA 1NWZA 2INWA 3F1OB 4GHIA 3B33A 4R6LA 5DFYA 2K7SA 4ARZB 2J3TC 3B42A 3S7NA 5HDDA 3UMEA 3UE6A 2VZWA 3E0YA 1V9YA 3T50A 4YOFA 4UQIM 2FH5A 1DP8A 3HJIA 3CWFA 3PR6A 2KX6A 5G4YA 5AJGA 2OOLA 4JGOA 4L9FA 4JGQA 4HH2A 5F68A 2B18A 5K5BA 3T4OA 2VEAA 4L9GA 1F98A 4EESA 2JKTM 3F1PB 2PYPA 5HDSA 2GNXA 2BASA 3V67A 1XFQA 3S7OA 3LYXA 1XFNA 2W3EA 1Y28A 4MN6A 2V0WA 2P7JA 2DMWA 2V0UA 3TJZC 2B02A 3NOTC 4B93A 3TRCA 4CLCB 2V9AA 4XT2B 5F69A 4B9OA 4ME4A 4Q0HA 2PD8A 2Z6DA 4Z1WA 3OOVA 3JVVA 1XJ6A 3KO6A 1IOUA 3CAXA 3K2NA 3F1NB 4IJGA 3CITA 2CMNA 3VE3A 5HWWA 2HGVA 2M7VA 4F3LA 2KLIA 2EWWA 4EQ1A 3PHYA 2VGLS 3CI6A 1OTBA 5KSHA 1JNUA 3P01A 4I38A 4O01A 2QHKA 1LT0A 1S1ZA 4Y5FA 2QYBA 5DJTA 4HY8A 4R70A 4E04A 4LLOB 4FSFA 3MMHA 3BW6A 1X0OA 2O0YA 4HP9A 2EA9A 1ZTUA 4LRYC 3C8CA 2JKRI 2Y79A 2W3FA 3PBSA 3EWKA 3LI9A 3A0VA 3T4SA 3H82A 3SW1A 4Y2FA 2VLGA 3FC7A 4DJ3A 4NXEA 4KUOA 3KYQA 2PR5A 3EOIA 1S66L 1V9ZA 3IS2B 5TBMB 4CQHA 1P0ZA 2O9CA 1YSQA 2HJEA 1OTDA 4WF0A 2VJWA 4Q0IA 1OJGA 3LI8A 5TJJA 2PT7A 1P97A 1N9NA 2XSSA 4WN5A 5AVEA 4FOFA 4R3AA 1NLZA 3LIFA 2PR6A 2P04A 3NHQA 3CUEC 2KDKA 1H3QA 3E4OA 4HIAA 1W63Q 2V1AA 4MCWA 3C30A 3LIBA 4EEUA 4HI4A 1MC0A 2K2NA 3O5YA 4GCZA 1ODVA 3D3OA 2K31A 4M4XA 3LICA 5DF9A 3BY8A 4CLCC 1T19A 4NKPA 2YKHA 3IBJA 4EU0A 2I9VA 1EW0A 1YAXA 5CX7A 2HF6A 5IS1A 1OTIA 2OAP1 3PYPA 4NXGA 2J3WA 3JVUA 2XA7M 4G3KA 5A8BA 2VA0A 4WLAA 1GSWA 2A2LA 4I5SA 4EETB 4MN5A 3UB9A 4JGRA 1MZUA 3T4QA 1UGUA 5HPFA 4WEKA 3A0RA 3FPWA 4F3LB 1KOUA 4HNBA 3OC2A 2NUTC 4ETXA 1S4SA 1XJ2A 4LPZA 4ZRRA 3MXQA 2JKTI 3OCNA 5DJUA 2G7UA 4DN0A 2W1RA 4Y3IA 4PAUA 1STZA 2J80A 5HWTA 3T4LA 2O9BA 3LR4A 2XRNA 3DBAA 2OAQ1 2QJ7A 3PXPA 2O99A 3UB6A 2A24A 3RFBA 1GSVA 5I5LA 3KYZA 1S1YA 4WEJA 4PKYA 3U2AA 1DP6A 1OTAA 3KSHA 4BMWA 4EXOA 4L0LA 3MQQA 4KQOA 1BYWA 4HH3A 4O0PA 1TS0A 2JN7A 1UWPX 3OCLA 3TE8A 3TW8A 2ZMFA 2KOIA 5FL3A 2NUPC 1T18A 4O8GA 3UE3A 3HCYA 5DKKA 3T4KA 3B47A 4CLCD 3S7QA 4GW9A 4BBUA 3CUEA 1N9OA 1OT6A 1T1CA 4BBVA 3PBTA 2YKFA 4CLCE 2QKPA 3VOLA 1ZHHB 2EWVA 1MKMA 4H6JB 5LBRA 1S4RA 1D7EA 3R4KA 4GS9A 3PBOA 4IUHA 2W27A 4GLQA 5HPIA 3LUQA 3PBQA 4GHIB 4XT2A 3MJQA 2GJ3A 2W3HA 3H7WA 5EFWA 2L4RA 2M7UA 1LSVA 2OWJA 2VV7A 5HDCA 1OT9A 2W1TA 3P7NA 2XA7S 3KSIA 1OPXA 4DMZA 4HJ3A 3NJAA 1NRJA 1OTEA 1G28A 2PD7A 3LIEA 1TS8A 3NOPC 4HOIA 3KSFA 2L1MA 2VV8A 4AFIA 1LSWA 5J4EA 2MJ6A 2Z6CA 4KUKA 2WKRA 2ZOHA 5HD5A 2HJ9C 2W0NA 3BWLA 3GECA 2LB9A 4K08A 3UB8A 5J7EA 4OOLA 4YWZA 2O9AA 2VV6A 1N9LA 2GZAA 4EEPA 3E98A 1YKDA 1YSPA 5F6AA 5F5YA 4MDZA 4Q0JA 3IS2A 5TBMA 4KQDA 2IA2A 2L0WA 2D02A 2W3DA 4G3VA 4P6ZS 2QWSA 5C5KA 2A24B 4PHTA 4NXFA 4G3WA 2H28A 1VB6A 2GX5A 4LRZE 1VHMA 4I39A 1S67L 2QJ5A 2R78A 1OJ5A 1T1BA 4YNRA 2PDRA 3BQAA 4HP4A 1DRMA 3MFXA 4R38A 3LIAA 3R7WA 4L9EA 4PKYG 4HHDA 2PHYA 3PBRA 3K3CA 4DJ2A 4I3IA 3EEHA 1TD5A 3FG8A 3H82B 1H8MA 3F1OA 1LL8A 1DP9A 4GS9B 4WL9A 2XROA 2V1BA 4P6ZM 4ARZA 3EGDC 3LR5A 5G4ZA 1UWNX 5J3WA 3PBNA 4MMNA 3C38A 2PYRA 1XJ4A 3OLOA 1TF1A 3E4PA 3H7WB 3EQVA 2Y8HA 5HSQA 3W2ZA 4BJPA 2W1TB 4WUJA 5DFXA 3MR0A 3HJKA 4HJ6A 4GJ4A 3ICYA 5IU1A 4EUVA 2ZMVA 3RH8B 3BQ8A 4ETZA 5MC7A 3EGXC 3F1PA 4BBTA 4RQ9A 3MQOA 5L8MA 4HQAA 3LFVA 4IUKA 2WKQA 5AVFA 1D06A 2VKSA 1F5MA 1G6OA 2LB5A 2JKRM 4CLCA 3FPVA 3EEAA 3MF0A 5KIZA 2J3TD 4I3AA 4LRXC 3EQUA 4NXBA 1F9IA 3C2WA 3E4QA 3ZQ5A 3A0SA 3VV4A 3F1NA 3NOUC 4IHQA 3GDIA 3MQ0A 4HJ4A 4MN7A 1P9RA 3K3DA 3LR3A 3T4JA 4UEYA 3D72A 5HZHA 2FZ0A 2ZOIA 2P08A 1TS7A 3UB7A 3RTYA 2W3GA 3LIDA 3G6OA 3IBRA 3OBFA 4I3JA 1WA9A 2ZBBA 3T4TA 1XJ3A 3ZYTA 2VGLM 1IFQA 3BY9A 3UMDA 1W63M 4UQIS 4EERA 4BWIA 4II7A 1P9WA 2VX8A 3BJNA 5HWVA 2M1CA 2WKPA 3H9WA 3VE4A 4H6JA 4JGPA 3KSGA 5HL6A 1T1AA 3R7WB 4WELA 4NEED 3KX0X 3S7PA 2HV1A 2D01A 5HD3A 1GSXA 3ULFA 5IT5A 5DKLA 2JHEA 1TS6A 3CLOA 4QPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EW7 A;  1LSX A;  2OWH A;  3F1O B;  1NWZ A;  2INW A;  4GHI A;  3B33 A;  4R6L A;  2K7S A;  5HDD A;  3UME A;  3UE6 A;  1V9Y A;  3T50 A;  1DP8 A;  3HJI A;  3CWF A;  2KX6 A;  5G4Y A;  2OOL A;  4JGO A;  4L9F A;  4JGQ A;  4HH2 A;  5F68 A;  2VEA A;  4L9G A;  1F98 A;  4EES A;  3F1P B;  2PYP A;  5HDS A;  2BAS A;  1XFQ A;  3LYX A;  1XFN A;  4MN6 A;  1Y28 A;  2V0W A;  2P7J A;  2V0U A;  2B02 A;  3NOT C;  2V9A A;  4XT2 B;  5F69 A;  4B9O A;  2PD8 A;  2Z6D A;  1XJ6 A;  3CAX A;  3F1N B;  2CMN A;  3VE3 A;  5HWW A;  4F3L A;  4EQ1 A;  3PHY A;  1OTB A;  1JNU A;  4I38 A;  2QHK A;  1LT0 A;  1S1Z A;  5DJT A;  4HY8 A;  4R70 A;  4E04 A;  4LLO B;  1X0O A;  4HP9 A;  2EA9 A;  4LRY C;  3C8C A;  3EWK A;  3LI9 A;  3A0V A;  3H82 A;  3SW1 A;  2VLG A;  3FC7 A;  4DJ3 A;  4NXE A;  4KUO A;  2PR5 A;  1S66 L;  1V9Z A;  3IS2 B;  5TBM B;  1P0Z A;  1OTD A;  4WF0 A;  1OJG A;  3LI8 A;  1P97 A;  1N9N A;  4WN5 A;  5AVE A;  4R3A A;  3LIF A;  2PR6 A;  3NHQ A;  2KDK A;  3E4O A;  4HIA A;  2V1A A;  3LIB A;  4EEU A;  4HI4 A;  4GCZ A;  1ODV A;  4M4X A;  3LIC A;  3BY8 A;  1T19 A;  2YKH A;  2I9V A;  1EW0 A;  5IS1 A;  1OTI A;  3PYP A;  4NXG A;  5A8B A;  4WLA A;  1GSW A;  4I5S A;  4EET B;  4MN5 A;  3UB9 A;  4JGR A;  1MZU A;  1UGU A;  3A0R A;  4F3L B;  1KOU A;  4HNB A;  1S4S A;  1XJ2 A;  4LPZ A;  3MXQ A;  5DJU A;  2J80 A;  5HWT A;  2QJ7 A;  3UB6 A;  2A24 A;  1GSV A;  5I5L A;  1S1Y A;  4PKY A;  1DP6 A;  1OTA A;  4EXO A;  3MQQ A;  1BYW A;  4HH3 A;  1TS0 A;  2JN7 A;  1UWP X;  1T18 A;  5DKK A;  4GW9 A;  4BBU A;  1N9O A;  1OT6 A;  1T1C A;  4BBV A;  2YKF A;  2QKP A;  3VOL A;  4H6J B;  1S4R A;  1D7E A;  4GS9 A;  2W27 A;  3LUQ A;  4GHI B;  4XT2 A;  3MJQ A;  2GJ3 A;  3H7W A;  5EFW A;  2L4R A;  1LSV A;  2OWJ A;  2VV7 A;  5HDC A;  1OT9 A;  3P7N A;  4HJ3 A;  3NJA A;  1OTE A;  1G28 A;  2PD7 A;  3LIE A;  1TS8 A;  3NOP C;  4HOI A;  2VV8 A;  2L1M A;  1LSW A;  5J4E A;  2Z6C A;  4KUK A;  2WKR A;  2ZOH A;  5HD5 A;  2W0N A;  3BWL A;  3GEC A;  4K08 A;  3UB8 A;  5J7E A;  4YWZ A;  2VV6 A;  1N9L A;  4EEP A;  5F6A A;  5F5Y A;  3IS2 A;  5TBM A;  4KQD A;  2L0W A;  2D02 A;  2QWS A;  2A24 B;  4NXF A;  2H28 A;  1VB6 A;  4LRZ E;  4I39 A;  1S67 L;  2QJ5 A;  2R78 A;  1OJ5 A;  1T1B A;  2PDR A;  4HP4 A;  1DRM A;  3MFX A;  4R38 A;  3LIA A;  4L9E A;  4PKY G;  4HHD A;  2PHY A;  3K3C A;  4DJ2 A;  4I3I A;  3EEH A;  3FG8 A;  3H82 B;  3F1O A;  1LL8 A;  1DP9 A;  4GS9 B;  4WL9 A;  2V1B A;  5G4Z A;  1UWN X;  5J3W A;  2PYR A;  1XJ4 A;  3OLO A;  3E4P A;  3H7W B;  5HSQ A;  4WUJ A;  3MR0 A;  3HJK A;  4HJ6 A;  3ICY A;  5IU1 A;  3RH8 B;  3F1P A;  4BBT A;  4RQ9 A;  3MQO A;  4HQA A;  2WKQ A;  5AVF A;  1D06 A;  5KIZ A;  4I3A A;  4LRX C;  4NXB A;  1F9I A;  3C2W A;  3E4Q A;  3ZQ5 A;  3A0S A;  3F1N A;  3NOU C;  3GDI A;  4HJ4 A;  3K3D A;  3D72 A;  5HZH A;  2ZOI A;  3UB7 A;  1TS7 A;  3RTY A;  3LID A;  3G6O A;  3IBR A;  4I3J A;  1WA9 A;  2ZBB A;  1XJ3 A;  3BY9 A;  3UMD A;  4EER A;  5HWV A;  2M1C A;  2WKP A;  3H9W A;  3VE4 A;  4H6J A;  4JGP A;  1T1A A;  3KX0 X;  2HV1 A;  2D01 A;  5HD3 A;  1GSX A;  3ULF A;  5DKL A;  2JHE A;  1TS6 A;  3CLO A; 
#chains in the Genus database with same CATH topology
 1XKZ A;  3F1O B;  2INW A;  3GV9 A;  5DFY A;  4ARZ B;  3OPH A;  3B42 A;  4X6T A;  3S7N A;  5I94 A;  5FEG A;  4IVI A;  3UE6 A;  2FFY A;  2WZX A;  2CC1 A;  4K0W A;  1GA0 A;  3CWF A;  3PR6 A;  5AQ9 A;  1YLJ A;  3HLF A;  5EOE A;  4L9F A;  2G2U A;  4Y0U A;  5F68 A;  3ZG8 B;  3OPP A;  5A90 A;  5FDS A;  3BFC A;  4EES A;  2JKT M;  3F1P B;  1TDG A;  2V20 A;  2PU2 A;  1Z6F A;  1XFN A;  3NOT C;  4B93 A;  3TRC A;  3IXD A;  4CLC B;  2Y59 A;  4GZB A;  5E2H A;  2PD8 A;  1AXB A;  2Z6D A;  2X71 A;  3JVV A;  1XJ6 A;  4IJG A;  2CMN A;  3GR2 A;  2Y2J A;  1ONG A;  5EVI A;  4D2O A;  2KLI A;  1OME A;  4EQ1 A;  3PHY A;  2VGL S;  3SS5 A;  3P01 A;  3P98 A;  3G2Y A;  4Y5F A;  4LLO B;  5GLC A;  5GLA A;  1X0O A;  2O0Y A;  4LRY C;  3MZE A;  2W3F A;  3MZF A;  3EWK A;  2WGI A;  3SW1 A;  2VLG A;  2Y2O A;  1N9B A;  4Y7P A;  4N9L A;  1L0E A;  2PR5 A;  4CQH A;  1BUE A;  4KZ5 A;  2O9C A;  1YSQ A;  4IED A;  2XR0 A;  1OTD A;  2AVX A;  2ZC5 B;  4WF0 A;  2VJW A;  5FQQ A;  5EE8 A;  3LI8 A;  5TJJ A;  2UV0 E;  3N8R A;  4BLM A;  3DAV A;  3LIF A;  1ERQ A;  1MXO A;  2PR6 A;  5JYO A;  2ZQC A;  3E4O A;  4HIA A;  3MFD A;  3V3R A;  2OLU A;  4MCW A;  4N9K A;  1GCE A;  1EWZ A;  1K54 A;  2XD1 A;  2Y4A A;  5M1A A;  1FR1 A;  2K31 A;  1RGZ A;  5HFO A;  1MBL A;  5FDH A;  4NKP A;  4ZAM A;  2YKH A;  4NK3 A;  3UDI A;  4R0Q A;  1PNE A;  5IS1 A;  3DTI A;  2OAP 1;  1PI5 A;  3PYP A;  4NXG A;  5TGF A;  3A3E A;  3GVB A;  1E4D A;  1PW8 A;  5BOH A;  2VA0 A;  4WLA A;  5CED A;  5FQJ A;  3T4Q A;  4S2N A;  4WEK A;  1CJF A;  1KGG A;  4EWF A;  3MKE A;  2HDS A;  2HDQ A;  3OC2 A;  4LPZ A;  5A92 A;  1H8Y A;  2Y2Q A;  3Q07 A;  3MKF A;  3A3D A;  4C6Y A;  2PBY A;  5HWT A;  4KZB A;  3DTK A;  4RYE A;  2QJ7 A;  3PXP A;  1GA9 A;  3BM6 A;  2RL3 A;  3S22 A;  1TVF A;  3G2Z A;  3D4F A;  3RFB A;  4BD0 A;  3KYZ A;  4PKY A;  3QNC A;  2H0Y A;  4EXO A;  5L2F A;  2Y2K A;  3T12 B;  3IWQ A;  1NZU A;  3CPT B;  3TE8 A;  4JLF A;  1VET B;  3QNB A;  1O07 A;  5FL3 A;  3UE3 A;  4O8G A;  1KDS A;  4LFU A;  1C3B A;  4JXG A;  5EUA A;  3QHY A;  5DKK A;  3B3X A;  2JBF A;  1OT6 A;  1T1C A;  2ZJ9 A;  3PBT A;  4GB7 A;  2YKF A;  5E2E A;  4CLC E;  2QKP A;  2EWV A;  1MKM A;  1S4R A;  3ZGA B;  1D7E A;  3R4K A;  3PBO A;  4QU3 A;  2XDM A;  2JKG A;  4IUH A;  2WUQ A;  1W79 A;  4GLQ A;  3PAE A;  5E43 A;  5DTS A;  4QB8 A;  5HPI A;  1ZC2 A;  4KQQ A;  3PBQ A;  3WRZ A;  3MJQ A;  4R4R A;  4JF4 A;  1PIO A;  2W1T A;  2XA7 S;  1BSG A;  3FZC A;  1PZO A;  1RGY A;  2PBD P;  2WYX A;  2PD7 A;  1JWP A;  3LIE A;  2L1M A;  1L2S A;  4KUK A;  4PM8 A;  4E6X A;  4HEF A;  2ZC6 B;  3FYZ A;  4JBF A;  1WYB A;  1YLW A;  5FQM A;  3L9K A;  2IWD A;  2DCF A;  5J7E A;  3M2K A;  3NCK A;  2GZA A;  4EEP A;  1GHI A;  1YSP A;  3IH8 A;  4Q0J A;  4P87 A;  1JTD A;  2L0W A;  3CG5 A;  2D02 A;  1DJB A;  2W3D A;  4G3V A;  2V1Z A;  4E6W A;  2VK3 A;  1K38 A;  2GX5 A;  1VHM A;  1JVJ A;  1E3U A;  2C6W B;  4HP4 A;  1DRM A;  3VOZ A;  3GMW A;  1LI9 A;  3A3I A;  4DJ2 A;  1VEU B;  4DDY A;  3H82 B;  3S1Y A;  3Q82 A;  1H8M A;  5EVL A;  2ZM8 A;  1K55 A;  4GS9 B;  1H0M A;  1PWD A;  3GSG A;  5EVI D;  4OP8 A;  3LR5 A;  4LV3 A;  3L7H A;  1U60 A;  3A3J A;  1VQQ A;  5EM0 A;  2WGW B;  2Y8H A;  1ESU A;  1IYS A;  1LL5 A;  4WUJ A;  4S2N C;  4GJ4 A;  1K25 A;  4YFM A;  2ZMV A;  4X53 A;  1MPL A;  3ISG A;  1Z09 A;  4E3I A;  2ZM0 A;  3MQO A;  3MSH A;  4Y0O A;  1XXM A;  2LB5 A;  1BLS A;  4OVD A;  3FPV A;  4EBL A;  2HZ5 A;  4GOG A;  3EQU A;  1F9I A;  3C2W A;  4IHQ A;  4MN7 A;  2ZL1 A;  3K3D A;  1KVM A;  3T4J A;  3D72 A;  1GHP A;  2P08 A;  3WWX A;  3RTY A;  3OBF A;  5CEC A;  5CHM A;  1WA9 A;  3T1Q B;  3ZYT A;  1IFQ A;  2XK1 A;  3UMD A;  1W63 M;  1HD8 A;  3CZD A;  1P9W A;  5HWV A;  3VE4 A;  4FTX A;  1K0K A;  2XGN A;  2D01 A;  2WK0 A;  2ZD8 A;  1Q2P A;  2OWH A;  3T1S A;  4R6L A;  1YPR A;  2J3T C;  1SKO A;  2H10 A;  1SCW A;  2H5S A;  2R9X A;  4A5R A;  3SS4 A;  1FR6 A;  4N1H A;  1XGI A;  2OOL A;  3CHW P;  2ZLY A;  3BEB A;  3MZD A;  4P0M A;  4MBF A;  1TEM A;  5K5B A;  1F98 A;  2Y2N A;  3CMZ A;  3NDE A;  1I2W A;  4QD4 A;  4QY5 A;  3ZG9 B;  4DE0 A;  1XFQ A;  1Y28 A;  4WM9 A;  3FWL A;  2V0U A;  3HLD A;  2B95 A;  4S2O A;  2Y2M A;  3OPR A;  3UB5 P;  4ME4 A;  2HP6 A;  3KO6 A;  1W8Y A;  3CAX A;  3C4P A;  3F1N B;  4OP5 A;  4BQM A;  2QZ6 A;  5GHY A;  5HWW A;  2M7V A;  1PYY A;  1FSW A;  3G31 A;  3CI6 A;  1OTB A;  1JNU A;  4I38 A;  4O01 A;  2QHK A;  5GLD A;  2QYB A;  2Y2L A;  5DJT A;  4HY8 A;  4R70 A;  4E04 A;  3UDF A;  2J9O A;  4Z9Q A;  1VEU A;  4LCM A;  3A0V A;  2EX2 A;  3H82 A;  3VSK A;  3FC7 A;  3VP3 A;  3GRJ A;  4NXE A;  1S66 L;  1V9Z A;  5TBM B;  4H8R A;  3LO7 A;  3GQZ A;  3ZG5 A;  1K56 A;  1MWU A;  4Q0I A;  1QME A;  1FOF A;  1PWG A;  1P97 A;  4WN5 A;  3DTE A;  3UY6 A;  1NLZ A;  4GDN A;  3NHQ A;  2KDK A;  3D9Y A;  1W63 Q;  1NRF A;  2Q9N A;  3T1X A;  5EPH A;  3AGE A;  4CJN A;  2EX8 A;  2K2N A;  3IF6 C;  3O5Y A;  1IYO A;  3FKV A;  3LIC A;  5DF9 A;  1T19 A;  1CQA A;  4GN2 A;  4OPZ A;  4EU0 A;  3IXB A;  5CX7 A;  2HF6 A;  1OTI A;  2WKH A;  1E3U D;  5A8B A;  1CEG A;  4KZ4 A;  4EET B;  4JGR A;  1MZU A;  4Y17 A;  4JKT A;  5HPF A;  1I2S A;  3LEZ A;  3SH7 A;  4F3L B;  3NEC A;  4GD8 A;  4ZRR A;  3OCN A;  3SH9 A;  1LL9 A;  1NYY A;  1STZ A;  4OQH A;  4DE1 A;  3DBA A;  2OLV A;  3G35 A;  1RCJ A;  5F83 A;  5FAO A;  1FCO A;  2ZC4 B;  1S1Y A;  4WEJ A;  3U2A A;  1DP6 A;  3KSH A;  4X68 A;  1YT4 A;  5F1F A;  4LGW A;  4C75 A;  3ZCZ A;  4E3J A;  4HH3 A;  5CRF A;  2J9P A;  1CI9 A;  1G68 A;  3TW8 A;  1W7F A;  3IWI A;  1A0K A;  1ONH A;  5GHZ A;  4BBU A;  3CUE A;  3AGD A;  3DTM A;  3BFF A;  1N9O A;  4BBV A;  5HL1 A;  5HAI A;  1ERO A;  1ZHH B;  1IYQ A;  3VOL A;  3VOY A;  1NJ4 A;  3ITB A;  3IHA A;  1CI8 A;  5EV0 A;  1PZP A;  3IX3 A;  3IXH A;  4M3K A;  4PMA A;  2XF3 A;  3W4O A;  3H7W A;  5EFW A;  2L4R A;  2M7U A;  5F82 A;  2VV7 A;  1OT9 A;  1XGJ A;  3PTE A;  1H5X A;  4MLL A;  3AGF A;  1NRJ A;  4X56 A;  1G28 A;  1TS8 A;  3BYD A;  2VV8 A;  3KSF A;  1BZA A;  4KEN B;  5HD5 A;  3IHB A;  4R3J A;  4EUZ A;  5EVE A;  3IWO A;  3JYI A;  3UB8 A;  3QP6 A;  2VGJ A;  5FQ9 A;  1K57 A;  3RJU A;  1YKD A;  5F5Y A;  4MDZ A;  5TBM A;  3Q81 A;  3BFG A;  2A24 B;  4PHT A;  1QMF A;  4MBK A;  4F94 A;  2H28 A;  2V8C A;  4LRZ E;  5HAP A;  1WYC A;  2QJ5 A;  2R78 A;  3C4O A;  3MFX A;  4HES A;  3UE0 A;  5G18 A;  4HHD A;  2Y91 A;  1CF0 A;  3K3C A;  2VGK A;  4I3I A;  1TD5 A;  3IX8 A;  1KDW A;  4OPQ A;  2EXA A;  3F1O A;  3NDG A;  5J8X A;  4WL9 A;  2V1B A;  4ARZ A;  2WZZ A;  3EGD C;  3IF6 B;  5L10 A;  1YLZ A;  4JXW A;  1S6R A;  1M40 A;  1TF1 A;  3EQV A;  3HVF A;  3HL9 A;  1F2K A;  3HJK A;  1RP5 A;  3LEQ A;  4EUV A;  3IQA A;  3VSL A;  4ETZ A;  5MC7 A;  3F1P A;  4EV4 A;  3N6I A;  5L8M A;  3LCE A;  1G5U A;  2Y2G A;  4IUK A;  4OQI A;  5AVF A;  5DF8 A;  3LY3 A;  4CLC A;  1K56 D;  3TG9 A;  4E3N A;  1KE0 A;  3NOU C;  4KZ9 A;  4XXR A;  3MQ0 A;  1P9R A;  5FI2 A;  3BFD A;  4OQG A;  3LR3 A;  1DJA A;  5EVI C;  2XFT A;  4KZ3 A;  4UEY A;  1ESI A;  2JE5 A;  1TS7 A;  4XUZ A;  3DWK A;  3G6O A;  3WS0 A;  4MEZ A;  1E25 A;  1XJ3 A;  3Q7V B;  3PAG A;  3WS5 A;  3G34 A;  3V50 A;  4UQI S;  4OPR A;  3V5M A;  5FQK A;  2VX8 A;  3ZG0 A;  4Q8I A;  2ACG A;  1BT5 A;  2IWC A;  3QP1 A;  1K6R A;  3A3F A;  3C5A A;  3ZG7 B;  5HL6 A;  3R7W B;  3I7J A;  3UPO A;  5IHV A;  1GSX A;  3ULF A;  3CLO A;  4QPR A;  5D3O A;  4UAA A;  2FFF B;  1NLY A;  1LHY A;  4WZ5 A;  1XPB A;  5U47 A;  5HDD A;  3UME A;  2EX6 A;  4KZ7 A;  2VZW A;  3E0Y A;  1Y4O A;  3T50 A;  4UQI M;  5M19 A;  4R1G A;  4UA7 A;  3VP0 A;  4BEN A;  5AJG A;  3VP4 A;  4JGO A;  2P9V B;  4DE3 A;  3IX4 A;  1K54 C;  2B18 A;  4NET A;  3T4O A;  1FIL A;  2DRW A;  5A91 A;  1YM1 A;  3V67 A;  3S7O A;  3LYX A;  4MN6 A;  2V0W A;  3SOI A;  2P7J A;  2DMW A;  3U4L P;  2B02 A;  4XT2 B;  1BLH A;  1PFL A;  2XQZ A;  1MWT A;  2HPB A;  5FSR A;  2Q0O A;  2HGV A;  5KZH A;  2JKF A;  1PI4 A;  1TDL A;  2EWW A;  4KG2 A;  4DE2 A;  5KSH A;  4FH4 A;  1YLY A;  4X55 A;  1LT0 A;  1S1Z A;  3UPN A;  1G6A A;  3MMH A;  3BW6 A;  4JF5 A;  4QY6 A;  3TSG A;  2JKR I;  2Y79 A;  3T4S A;  1FCM A;  3IXG A;  5A93 A;  4KZA A;  4Y2F A;  3UO9 A;  4GDB A;  3TOI A;  4KUO A;  3KYQ A;  3IS2 B;  1P0Z A;  4XUX A;  3W4P A;  4MBH A;  3CPT A;  1OJG A;  1VET A;  2PT7 A;  3MXR A;  2XSS A;  1N9N A;  2J8Y A;  5AVE A;  4R3A A;  3M2J A;  4X25 A;  1FCN A;  2V1A A;  3C30 A;  2ZQD A;  3LIB A;  4EEU A;  4HI4 A;  3W8K A;  4E3M A;  3FV7 A;  3JPU A;  4GCZ A;  4U0X A;  4O7D A;  3O88 A;  5EM1 A;  2XLN A;  2EFX A;  3BEC A;  2HP5 A;  5HW3 A;  3BY8 A;  3M6B A;  4CLC C;  4OLG A;  3IBJ A;  4S2M A;  3OZH A;  1D1J A;  2E8I A;  2J3W A;  3JVU A;  4G3K A;  4X1L A;  5DTT A;  2E8J A;  2EFU A;  3UB9 A;  2X02 A;  4B88 A;  4S2I A;  1UGU A;  3DWZ A;  2B5R A;  3Q7V A;  5EVI B;  1XX2 A;  3FPW A;  1KOU A;  1XJ2 A;  2JKT I;  4DN0 A;  4Y3I A;  4DRT A;  4RVA A;  1SHV A;  1GHM A;  4BD1 A;  2OAQ 1;  5GL9 A;  3NI9 A;  2O99 A;  3UB6 A;  1L0G A;  1GSV A;  1OTA A;  4YIN A;  4DDS A;  4BMW A;  4L0L A;  3MQQ A;  4KQO A;  2Y2I A;  1TS0 A;  2Y2H A;  2JN7 A;  1UWP X;  3OCL A;  4E3O A;  4PM5 A;  1BTL A;  2ZMF A;  2KOI A;  2NUP C;  1T18 A;  2H0T A;  5CGS A;  3T4K A;  4CLC D;  2WKE A;  4KZ6 A;  1HTZ A;  1NXY A;  4GW9 A;  4ZBE A;  1IYP A;  2OSU A;  4H6J B;  5LBR A;  5TR7 A;  4GS9 A;  4B4X A;  1K55 C;  4OH0 A;  4LCL A;  4JF6 A;  2W27 A;  4R23 A;  4OPY A;  1SKF A;  4EQI A;  3VP1 A;  4GHI B;  4XT2 A;  2W3H A;  2WGW A;  2XD5 A;  1LSV A;  2OWJ A;  3SH8 A;  4OON A;  3P7N A;  4ZJ1 A;  3KSI A;  1OPX A;  4HJ3 A;  3NJA A;  2BLS A;  1ES2 A;  1OTE A;  2J7V A;  4AFI A;  4QWO A;  4DXB A;  2ZQ7 A;  5J4E A;  1MY8 A;  4EBN A;  2IWB A;  3IT9 A;  2WKR A;  1IKG A;  3WS2 A;  2W0N A;  3BWL A;  2Z2M B;  3GEC A;  2LB9 A;  1XP4 A;  4IBR A;  4Y13 A;  2C5W B;  1ZG6 A;  1KVL A;  2O9A A;  3NBL A;  1N9L A;  4E3K A;  1W8Q A;  1J9M A;  1ERM A;  4QHC A;  4QJG A;  3IS2 A;  2A49 A;  4OOY A;  3V3S A;  2QPN A;  4ZJ3 A;  5L09 A;  1HLU P;  4G3W A;  1YLP A;  1VB6 A;  4N92 A;  1AWI A;  4LV2 A;  4S2L A;  1K6S A;  4I39 A;  2G2W A;  3MS6 A;  2WKI A;  4PM6 A;  1OJ5 A;  2PDR A;  3BQA A;  4P85 A;  3WRT A;  4WMC A;  1IKI A;  3LIA A;  3OPL A;  3PBR A;  4UA9 A;  3G4P A;  3SS3 A;  4Y15 A;  3EEH A;  3NC8 A;  4GD6 A;  1DP9 A;  2HDR A;  1KGE A;  4PPR A;  5G4Z A;  3PBN A;  3C38 A;  2PYR A;  3LY4 A;  5KSC A;  1XJ4 A;  2Q9M A;  5AQ7 A;  5CGW A;  2V8F A;  3V39 A;  5HSQ A;  3BLS A;  5KMW A;  2W1T B;  1LI0 A;  1HVB A;  5DFX A;  4HJ6 A;  5IU1 A;  3M6H A;  4PM7 A;  3KYE A;  5CTN A;  3EGX C;  4BBT A;  1FIK A;  4HQA A;  3LFV A;  4CPK A;  4DKI A;  1D06 A;  1F5M A;  1G6O A;  2BTF P;  4KQR A;  5KIZ A;  3QP2 A;  4LRX C;  3C7U A;  3E4Q A;  3ZQ5 A;  2HP9 A;  4X69 A;  3F1N A;  5FQI A;  3GDI A;  1FQG A;  4HJ4 A;  3P09 A;  2JC7 A;  4RA7 A;  2FZ0 A;  1HZO A;  3IBR A;  4C3Q A;  4I3J A;  3N7W A;  4JPM A;  2ZBB A;  1PRQ A;  2VGL M;  3LGO A;  1KE3 A;  4BWI A;  3VFH A;  1J3W A;  3BJN A;  4P6B A;  3H9W A;  3BRM A;  4H6J A;  4RX3 A;  1CK3 A;  3KSG A;  4WEL A;  3KX0 X;  3S7P A;  3WS4 A;  5IT5 A;  4OOM A;  1O7E A;  4EW7 A;  1LSX A;  3LR0 A;  1NWZ A;  4GHI A;  3B33 A;  2K7S A;  3ZDJ A;  1CEF A;  2OV5 A;  3GTC A;  3HBR A;  1V9Y A;  4YOF A;  1L3L A;  3CJM A;  2FH5 A;  1DP8 A;  3HJI A;  5FEF A;  2KX6 A;  5G4Y A;  4ID4 A;  4K91 A;  4JGQ A;  2Z2L B;  4HH2 A;  4R3B A;  1MKI A;  2VEA A;  4L9G A;  3MXS A;  2PYP A;  5HDS A;  3G30 A;  2GNX A;  2BAS A;  1K4F A;  1W5D A;  2W3E A;  3TJZ C;  4GKU A;  1BLP A;  5HAR A;  4LV0 A;  4IBX A;  2V9A A;  2ZQA A;  5F69 A;  4B9O A;  4K0X A;  4Q0H A;  4Z1W A;  1Y54 A;  3OOV A;  2HDU A;  2XH9 A;  3Q1F A;  1L0F A;  1IOU A;  3K2N A;  2ZMA A;  3NUL A;  4GNU A;  3UDX A;  3CIT A;  3VE3 A;  2ZL1 B;  5CGX A;  3DW0 A;  1KGF A;  4F3L A;  3UE1 A;  2RCX A;  4DXC A;  3E2K A;  2ZM2 A;  3HUM A;  5GHX A;  3HUO A;  5CTM A;  4FSF A;  1MWR A;  4HP9 A;  2EA9 A;  1ZTU A;  3C8C A;  3WS1 A;  3PBS A;  3LI9 A;  3VP2 A;  4HBT A;  1ALQ A;  4DJ3 A;  1ES4 A;  3EOI A;  4R4S A;  2ZQ9 A;  2HJE A;  1YMX A;  4JXV A;  1SKO B;  2EXB A;  5FAP A;  1NZO A;  1PW1 A;  4OQ0 A;  5FAS A;  4FOF A;  2P04 A;  4KG5 A;  3CUE C;  1ES5 A;  1H3Q A;  3HLG A;  1EI5 A;  4S2K A;  4ESP A;  1MC0 A;  4NG2 A;  1YQS A;  1LLB A;  5CHJ A;  1ODV A;  3QP8 A;  3D3O A;  4M4X A;  4OLD A;  2EX9 A;  2ZC3 B;  2BG1 A;  1M6K A;  3ZNY A;  2I9V A;  1EW0 A;  1YAX A;  5L07 A;  4LV1 A;  4JXS A;  4E3L A;  3C7V A;  4WBG A;  1BUL A;  1DJC A;  1N4O A;  1MWS A;  2XA7 M;  5GLB A;  4FUW A;  1WE4 A;  4WMC D;  1GSW A;  2A2L A;  3HUN A;  4I5S A;  5TFQ A;  4OKP A;  2DNS A;  4MN5 A;  4LEN A;  3A0R A;  1Q2Q A;  2P74 A;  5CXW A;  3O86 A;  3ZNT A;  3ZFZ A;  4UHU A;  2WAE A;  4B4Z A;  4HNB A;  2NUT C;  3VMA A;  4ETX A;  1S4S A;  3MXQ A;  5DJU A;  4RX2 A;  5FAQ A;  2G7U A;  1YLT A;  2W1R A;  1K57 C;  4PAU A;  2GDN A;  3N4I A;  4BL2 A;  2J80 A;  3E2L A;  5EEC A;  3T4L A;  2O9B A;  3LR4 A;  2XRN A;  2QMI A;  3Q7Z A;  2A24 A;  3HLC A;  5I5L A;  3RXX A;  3O3V A;  2PRF A;  1NY0 A;  3BLM A;  1BYW A;  1DY6 A;  4O0P A;  4N1X A;  3MBZ A;  5FI6 A;  5DF7 A;  5FAT A;  3HCY A;  3B47 A;  3S7Q A;  3RXW A;  5EOO A;  5AQA A;  5F1G A;  2V2F F;  1SDN A;  1K4E A;  3IF6 A;  2WAD A;  1ZKJ A;  3FKW A;  5HAQ A;  3LUQ A;  2PU4 A;  2GJ3 A;  3UN7 A;  1VM1 A;  1XA1 A;  3UNW A;  3S4X A;  5HDC A;  4DMZ A;  2PAV P;  4WZ4 A;  3SZT A;  4KG6 A;  4BL3 A;  3NOP C;  4HOI A;  1LSW A;  2XFS A;  2MJ6 A;  2Z6C A;  4D60 A;  2R9W A;  2ZOH A;  1IEM A;  2HJ9 C;  3NY4 A;  1IEL A;  1JWZ A;  4K08 A;  1FSY A;  4OOL A;  2Y55 A;  4YWZ A;  5JYP A;  2VV6 A;  3VFF A;  5M18 A;  3HLB A;  1JTG A;  3E98 A;  5F6A A;  2I72 A;  1SZV A;  5CER A;  1PWC A;  4PM9 A;  4KQD A;  2IA2 A;  4P6Z S;  2QWS A;  3NIA A;  5DTK A;  5C5K A;  4NXF A;  2WGV A;  3BFE A;  4UA6 A;  2Y2P A;  4X1M A;  1S67 L;  1T1B A;  4YNR A;  1L0D A;  4R38 A;  3N8L A;  1ES3 A;  4FCF A;  4MNR A;  3T1R A;  3R7W A;  4L9E A;  3ZVW A;  4PKY G;  2ZC7 A;  2PHY A;  1H8Z A;  3QP5 A;  4Y0T A;  3FG8 A;  1LL8 A;  2XRO A;  4FD8 A;  4P6Z M;  4WZ5 C;  2UWX A;  3ZVT A;  5DVA A;  3IH9 A;  5CHU A;  1UWN X;  5J3W A;  4MMN A;  4S2J A;  3ZHH A;  3HLW A;  3OLO A;  4FH2 A;  3E4P A;  4KZ8 A;  3H7W B;  3W2Z A;  4BJP A;  1BLC A;  2P9V A;  2X01 A;  3MR0 A;  3ICY A;  3QP4 A;  3N8S A;  3W4Q A;  1ZG4 A;  4WYY A;  2A3U A;  3RH8 B;  3BQ8 A;  4DF6 A;  5AQB A;  4RQ9 A;  3IF5 A;  4IVK A;  2WAF A;  1I5Q A;  2WKQ A;  1YMS A;  2ZQ8 A;  1XA7 A;  2VKS A;  4ZTK A;  2JKR M;  5E2F A;  3EEA A;  3MF0 A;  1SDE A;  3O87 A;  2J3T D;  4I3A A;  4NXB A;  5FA7 A;  3A0S A;  3VV4 A;  5CEB A;  1ACF A;  4U0T A;  5HZH A;  2ZOI A;  3UB7 A;  4S2P A;  2W3G A;  3LID A;  4ZJ2 A;  1JWV A;  1NYM A;  3T4T A;  3HRE A;  3BY9 A;  1S0W A;  4ZDX A;  5E2G A;  4EBP A;  4EER A;  4II7 A;  3UPP A;  5FI7 A;  2M1C A;  2XEP A;  2WKP A;  3ITA A;  1KE4 A;  4U3T A;  2JCH A;  4JGP A;  1T1A A;  4NEE D;  2HV1 A;  5HD3 A;  3HLE A;  5DKL A;  2JHE A;  1TS6 A;  5HX9 A;  4HBU A;  3G32 A; 
#chains in the Genus database with same CATH homology
 4OOM A;  4EW7 A;  1LSX A;  3LR0 A;  2OWH A;  1NLY A;  1NWZ A;  2INW A;  3F1O B;  4GHI A;  3B33 A;  4R6L A;  5DFY A;  2K7S A;  4ARZ B;  2J3T C;  3B42 A;  3S7N A;  5HDD A;  3UME A;  3UE6 A;  2VZW A;  3E0Y A;  1V9Y A;  3T50 A;  4YOF A;  4UQI M;  2FH5 A;  1DP8 A;  3HJI A;  3CWF A;  3PR6 A;  2KX6 A;  5G4Y A;  5AJG A;  2OOL A;  4JGO A;  4L9F A;  4JGQ A;  4HH2 A;  5F68 A;  2B18 A;  5K5B A;  3T4O A;  2VEA A;  4L9G A;  1F98 A;  4EES A;  2JKT M;  3F1P B;  2PYP A;  5HDS A;  2GNX A;  2BAS A;  3V67 A;  1XFQ A;  3S7O A;  3LYX A;  1XFN A;  2W3E A;  1Y28 A;  4MN6 A;  2V0W A;  2P7J A;  2DMW A;  2V0U A;  3TJZ C;  2B02 A;  3NOT C;  4B93 A;  3TRC A;  4CLC B;  2V9A A;  4XT2 B;  5F69 A;  4B9O A;  4ME4 A;  4Q0H A;  2PD8 A;  2Z6D A;  4Z1W A;  3OOV A;  3JVV A;  1XJ6 A;  3KO6 A;  1IOU A;  3CAX A;  3K2N A;  3F1N B;  4IJG A;  3CIT A;  2CMN A;  3VE3 A;  5HWW A;  2HGV A;  2M7V A;  4F3L A;  2KLI A;  2EWW A;  4EQ1 A;  3PHY A;  2VGL S;  3CI6 A;  1OTB A;  5KSH A;  1JNU A;  3P01 A;  4I38 A;  4O01 A;  2QHK A;  1LT0 A;  1S1Z A;  4Y5F A;  2QYB A;  5DJT A;  4HY8 A;  4R70 A;  4E04 A;  4LLO B;  4FSF A;  3MMH A;  3BW6 A;  1X0O A;  2O0Y A;  4HP9 A;  2EA9 A;  1ZTU A;  4LRY C;  3C8C A;  2JKR I;  2Y79 A;  2W3F A;  3PBS A;  3EWK A;  3LI9 A;  3A0V A;  3T4S A;  3H82 A;  3SW1 A;  4Y2F A;  2VLG A;  3FC7 A;  4DJ3 A;  4NXE A;  4KUO A;  3KYQ A;  2PR5 A;  3EOI A;  1S66 L;  1V9Z A;  3IS2 B;  5TBM B;  4CQH A;  1P0Z A;  2O9C A;  1YSQ A;  2HJE A;  1OTD A;  4WF0 A;  2VJW A;  4Q0I A;  1OJG A;  3LI8 A;  5TJJ A;  2PT7 A;  1P97 A;  1N9N A;  2XSS A;  4WN5 A;  5AVE A;  4FOF A;  4R3A A;  1NLZ A;  3LIF A;  2PR6 A;  2P04 A;  3NHQ A;  3CUE C;  2KDK A;  1H3Q A;  3E4O A;  4HIA A;  1W63 Q;  2V1A A;  4MCW A;  3C30 A;  3LIB A;  4EEU A;  4HI4 A;  1MC0 A;  2K2N A;  3O5Y A;  4GCZ A;  1ODV A;  3D3O A;  2K31 A;  4M4X A;  3LIC A;  5DF9 A;  3BY8 A;  4CLC C;  1T19 A;  4NKP A;  2YKH A;  3IBJ A;  4EU0 A;  2I9V A;  1EW0 A;  1YAX A;  5CX7 A;  2HF6 A;  5IS1 A;  1OTI A;  2OAP 1;  3PYP A;  4NXG A;  2J3W A;  3JVU A;  2XA7 M;  4G3K A;  5A8B A;  2VA0 A;  4WLA A;  1GSW A;  2A2L A;  4I5S A;  4EET B;  4MN5 A;  3UB9 A;  4JGR A;  1MZU A;  3T4Q A;  1UGU A;  5HPF A;  4WEK A;  3A0R A;  3FPW A;  4F3L B;  1KOU A;  4HNB A;  3OC2 A;  2NUT C;  4ETX A;  1S4S A;  1XJ2 A;  4LPZ A;  4ZRR A;  3MXQ A;  2JKT I;  3OCN A;  5DJU A;  2G7U A;  4DN0 A;  2W1R A;  4Y3I A;  4PAU A;  1STZ A;  2J80 A;  5HWT A;  3T4L A;  2O9B A;  3LR4 A;  2XRN A;  3DBA A;  2OAQ 1;  2QJ7 A;  3PXP A;  2O99 A;  3UB6 A;  2A24 A;  3RFB A;  1GSV A;  5I5L A;  3KYZ A;  1S1Y A;  4WEJ A;  4PKY A;  3U2A A;  1DP6 A;  1OTA A;  3KSH A;  4BMW A;  4EXO A;  4L0L A;  3MQQ A;  4KQO A;  1BYW A;  4HH3 A;  4O0P A;  1TS0 A;  2JN7 A;  1UWP X;  3OCL A;  3TE8 A;  3TW8 A;  2ZMF A;  2KOI A;  5FL3 A;  2NUP C;  1T18 A;  4O8G A;  3UE3 A;  3HCY A;  5DKK A;  3T4K A;  3B47 A;  4CLC D;  3S7Q A;  4GW9 A;  4BBU A;  3CUE A;  1N9O A;  1OT6 A;  1T1C A;  4BBV A;  3PBT A;  2YKF A;  4CLC E;  2QKP A;  3VOL A;  1ZHH B;  2EWV A;  1MKM A;  4H6J B;  5LBR A;  1S4R A;  1D7E A;  3R4K A;  4GS9 A;  3PBO A;  4IUH A;  2W27 A;  4GLQ A;  5HPI A;  3LUQ A;  3PBQ A;  4GHI B;  4XT2 A;  3MJQ A;  2GJ3 A;  2W3H A;  3H7W A;  5EFW A;  2L4R A;  2M7U A;  1LSV A;  2OWJ A;  2VV7 A;  5HDC A;  1OT9 A;  2W1T A;  3P7N A;  2XA7 S;  3KSI A;  1OPX A;  4DMZ A;  4HJ3 A;  3NJA A;  1NRJ A;  1OTE A;  1G28 A;  2PD7 A;  3LIE A;  1TS8 A;  3NOP C;  4HOI A;  3KSF A;  2L1M A;  2VV8 A;  4AFI A;  1LSW A;  5J4E A;  2MJ6 A;  2Z6C A;  4KUK A;  2WKR A;  2ZOH A;  5HD5 A;  2HJ9 C;  2W0N A;  3BWL A;  3GEC A;  2LB9 A;  4K08 A;  3UB8 A;  5J7E A;  4OOL A;  4YWZ A;  2O9A A;  2VV6 A;  1N9L A;  2GZA A;  4EEP A;  3E98 A;  1YKD A;  1YSP A;  5F6A A;  5F5Y A;  4MDZ A;  4Q0J A;  3IS2 A;  5TBM A;  4KQD A;  2IA2 A;  2L0W A;  2D02 A;  2W3D A;  4G3V A;  4P6Z S;  2QWS A;  5C5K A;  2A24 B;  4PHT A;  4NXF A;  4G3W A;  2H28 A;  1VB6 A;  2GX5 A;  4LRZ E;  1VHM A;  4I39 A;  1S67 L;  2QJ5 A;  2R78 A;  1OJ5 A;  1T1B A;  4YNR A;  2PDR A;  3BQA A;  4HP4 A;  1DRM A;  3MFX A;  4R38 A;  3LIA A;  3R7W A;  4L9E A;  4PKY G;  4HHD A;  2PHY A;  3PBR A;  3K3C A;  4DJ2 A;  4I3I A;  3EEH A;  1TD5 A;  3FG8 A;  3H82 B;  1H8M A;  3F1O A;  1LL8 A;  1DP9 A;  4GS9 B;  4WL9 A;  2XRO A;  2V1B A;  4P6Z M;  4ARZ A;  3EGD C;  3LR5 A;  5G4Z A;  1UWN X;  5J3W A;  3PBN A;  4MMN A;  3C38 A;  2PYR A;  1XJ4 A;  3OLO A;  1TF1 A;  3E4P A;  3H7W B;  3EQV A;  2Y8H A;  5HSQ A;  3W2Z A;  4BJP A;  2W1T B;  4WUJ A;  5DFX A;  3MR0 A;  3HJK A;  4HJ6 A;  4GJ4 A;  3ICY A;  5IU1 A;  4EUV A;  2ZMV A;  3RH8 B;  3BQ8 A;  4ETZ A;  5MC7 A;  3EGX C;  3F1P A;  4BBT A;  4RQ9 A;  3MQO A;  5L8M A;  4HQA A;  3LFV A;  4IUK A;  2WKQ A;  5AVF A;  1D06 A;  2VKS A;  1F5M A;  1G6O A;  2LB5 A;  2JKR M;  4CLC A;  3FPV A;  3EEA A;  3MF0 A;  5KIZ A;  2J3T D;  4I3A A;  4LRX C;  3EQU A;  4NXB A;  1F9I A;  3C2W A;  3E4Q A;  3ZQ5 A;  3A0S A;  3VV4 A;  3F1N A;  3NOU C;  4IHQ A;  3GDI A;  3MQ0 A;  4HJ4 A;  4MN7 A;  1P9R A;  3K3D A;  3LR3 A;  3T4J A;  4UEY A;  3D72 A;  5HZH A;  2FZ0 A;  2ZOI A;  2P08 A;  1TS7 A;  3UB7 A;  3RTY A;  2W3G A;  3LID A;  3G6O A;  3IBR A;  3OBF A;  4I3J A;  1WA9 A;  2ZBB A;  3T4T A;  1XJ3 A;  3ZYT A;  2VGL M;  1IFQ A;  3BY9 A;  3UMD A;  1W63 M;  4UQI S;  4EER A;  4BWI A;  4II7 A;  1P9W A;  2VX8 A;  3BJN A;  5HWV A;  2M1C A;  2WKP A;  3H9W A;  3VE4 A;  4H6J A;  4JGP A;  3KSG A;  5HL6 A;  1T1A A;  3R7W B;  4WEL A;  4NEE D;  3KX0 X;  3S7P A;  2HV1 A;  2D01 A;  5HD3 A;  1GSX A;  3ULF A;  5IT5 A;  5DKL A;  2JHE A;  1TS6 A;  3CLO A;  4QPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...