5HDSA

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 3 ps structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
molecule keywords Photoactive yellow protein
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hdsA00
4F3LB 4NXGA 4EETB 1S1YA 1NWZA 2PDRA 3LI9A 1T19A 3UE6A 3F1PA 3CAXA 1OJGA 1Y28A 2YKHA 4R3AA 2B02A 3HJIA 3LIBA 3UB9A 1V9ZA 3H82A 5J3WA 2PYRA 4PKYG 3CLOA 5F5YA 3A0VA 4BBTA 1WA9A 1P97A 2WKQA 1XJ4A 2D02A 3NJAA 3F1NA 3PHYA 3ZQ5A 1XJ3A 4HP9A 5A8BA 4EW7A 1OTIA 4WUJA 1F98A 1S4RA 2QJ5A 1OTDA 4JGQA 1S4SA 3ULFA 3UMDA 1OT6A 2W27A 1DP8A 3A0RA 3H7WA 4NXBA 1UGUA 3NOTC 4EQ1A 2QKPA 1T1AA 4EEPA 4MN6A 3C2WA 3LUQA 3RH8B 3LIEA 5HDSA 4LRYC 3SW1A 4XT2A 3LYXA 3UB8A 3NHQA 2EA9A 1MZUA 3OLOA 4JGOA 4GHIA 1T18A 3KX0X 2KDKA 1LSVA 4LRXC 1OT9A 3F1OA 3F1OB 4WN5A 1VB6A 3ICYA 2Z6DA 1OTEA 4HIAA 2VV7A 1OTBA 1TS8A 1G28A 1DP9A 4F3LA 4LRZE 2PD7A 4JGRA 1S1ZA 3A0SA 1P0ZA 2QHKA 4LLOB 4GW9A 3GDIA 4HJ6A 1F9IA 5J4EA 2Z6CA 2VV8A 3K3CA 3LIDA 4L9GA 1T1CA 4H6JA 1LSXA 4BBUA 3IS2B 5HSQA 4H6JB 1LL8A 1UWPX 1S67L 3LICA 4KUKA 2VV6A 4EERA 5I5LA 4HJ4A 5G4ZA 1TS7A 1D06A 3BWLA 1N9NA 3MFXA 1DP6A 3MR0A 1XFQA 1TS0A 4I5SA 5TBMB 4HH3A 5F68A 5HWWA 4GS9B 3VE3A 1UWNX 3LIAA 5IS1A 3MJQA 5F69A 5AVFA 2V1BA 3C8CA 2P7JA 2ZOHA 2PD8A 3LIFA 2QWSA 4R6LA 3H9WA 2QJ7A 1X0OA 4R38A 4WLAA 4R70A 2VEAA 2WKRA 3VOLA 3G6OA 4I39A 2D01A 4HJ3A 3IBRA 1LSWA 3VE4A 1BYWA 2M1CA 1GSVA 2K7SA 3MQQA 4PKYA 3D72A 5DKLA 5DJTA 5IU1A 3FG8A 4NXFA 2W0NA 4DJ3A 2V1AA 3GECA 3CWFA 1D7EA 2BASA 2JHEA 3MXQA 5G4YA 5AVEA 3LI8A 1OJ5A 5F6AA 1LT0A 3EEHA 1N9OA 5HD5A 2INWA 4HQAA 1KOUA 3E4PA 1GSXA 1EW0A 3BY9A 5DKKA 4B9OA 3E4OA 3K3DA 3UMEA 2OWHA 2A24B 2GJ3A 4HHDA 3E4QA 4YWZA 1N9LA 2CMNA 4WF0A 2PYPA 2L4RA 3UB6A 3F1PB 3IS2A 4L9FA 2KX6A 5DJUA 4KUOA 4HOIA 4HH2A 4EEUA 2JN7A 2YKFA 2L1MA 4HP4A 1DRMA 3H82B 4KQDA 4NXEA 3EWKA 5TBMA 1GSWA 4HY8A 2ZBBA 3NOUC 4E04A 4GS9A 5KIZA 3MQOA 1V9YA 3F1NB 3B33A 1ODVA 4MN5A 3HJKA 2I9VA 4LPZA 2V9AA 4I3JA 3FC7A 4WL9A 4K08A 1JNUA 4HI4A 4HNBA 3UB7A 2OWJA 5HZHA 3H7WB 1T1BA 4JGPA 2PR6A 2WKPA 4GCZA 4I38A 2V0UA 1S66L 3RTYA 4EESA 2VLGA 4M4XA 2ZOIA 3P7NA 4DJ2A 1XJ6A 5EFWA 3NOPC 4XT2B 1XFNA 2PR5A 5HDCA 2V0WA 2L0WA 1XJ2A 1TS6A 5HDDA 5HWVA 4GHIB 4EXOA 5J7EA 1OTAA 2PHYA 4I3AA 4RQ9A 4BBVA 2R78A 5HD3A 2H28A 3PYPA 4I3IA 5HWTA 2HV1A 2J80A 3BY8A 4L9EA 3T50A 2OOLA 2A24A
chains in the Genus database with same CATH superfamily
3LR5A 1ZC2A 2ZJ9A 4EETB 5M19A 1S1YA 2O9AA 2WK0A 2PDRA 3CI6A 4GD8A 2O9CA 1G68A 1XX2A 3KSIA 2P04A 4ARZA 1YAXA 4B4ZA 4FUWA 4IBXA 4R3AA 1NZOA 2GZAA 5L8MA 5KSHA 5EV0A 2M7VA 1V9ZA 3GSGA 5FDSA 3H82A 3WRZA 5FEFA 5L09A 5AQBA 5F5YA 5D3OA 2ZC3B 4GJ4A 4PPRA 2Y55A 4JBFA 3ZG8B 1TDGA 1OTIA 2HDSA 2XEPA 3A3EA 5A91A 1VEUB 4Y2FA 4N9LA 2XDMA 2HDUA 2W27A 1TD5A 3H7WA 1FR1A 1KGEA 1K0KA 3VP4A 1T1AA 3G4PA 3PBOA 5FI7A 3C2WA 2JKTI 3RH8B 4IEDA 2X71A 2Y2JA 3S7NA 1PW1A 4QWOA 3W4PA 3RXWA 4Z1WA 4XT2A 3LYXA 3OLOA 2ZC6B 3M6HA 2OSUA 4N9KA 3UDFA 3MFDA 1OT9A 3F1OA 4QY6A 2HF6A 3C5AA 1RGYA 1VB6A 3UDIA 2Y2MA 4P85A 2VGJA 1K4EA 4KG5A 4WYYA 5CHUA 2VV7A 5CX7A 1Q2PA 1O7EA 3D3OA 3UN7A 1K54A 5EM0A 4LRZE 4DDYA 2PD7A 2V2FF 4N1HA 3IF5A 1PRQA 4CPKA 2QHKA 1L3LA 3A3IA 4E3NA 2WGIA 5GLBA 1BLHA 2GX5A 5LBRA 2PU2A 4HJ6A 2Y4AA 3VOYA 2VV8A 4K0XA 3G31A 4FTXA 3K3CA 3LIDA 3BRMA 4IUKA 2QYBA 4L9GA 2H5SA 4H6JA 1LSXA 4BBUA 1BUEA 1W8YA 4OVDA 1IEMA 1H3QA 3L9KA 2WGVA 4N1XA 3LR3A 4GOGA 4KUKA 1H5XA 3FKVA 5G4ZA 3MFXA 1DP6A 1F2KA 1W63Q 5KMWA 2EX8A 1XFQA 1K57C 3RFBA 4X25A 5TBMB 1Z6FA 4HBTA 3UPNA 3VE3A 1UWNX 1Z09A 2JE5A 3LIAA 1FQGA 1BLCA 4GLQA 5DF8A 3ZNTA 1XPBA 3IWQA 5AVFA 1BTLA 1K6SA 2A3UA 3DTMA 1K6RA 5CEBA 4S2MA 1O07A 3UE0A 2HJEA 3NECA 4OPRA 3H9WA 1GA0A 3A3DA 4QD4A 4LCLA 1ZHHB 3O3VA 4WLAA 4R38A 2E8IA 2VEAA 3G6OA 2D01A 1NYYA 3IBRA 3VE4A 1EROA 3E98A 4Q0HA 1BYWA 3DTEA 4ZDXA 4D60A 4PKYA 4NK3A 3S4XA 3SH9A 3D72A 1L0EA 5DKLA 3W2ZA 3PR6A 4JF5A 4NXFA 4UA7A 4DJ3A 2W3EA 5M18A 2V1AA 3QP1A 3IH8A 3M2KA 2J3TC 1SKOA 4S2OA 4YINA 4KZBA 1OJ5A 3S7OA 1CJFA 4X68A 2C6WB 3E4PA 1BLSA 1RP5A 4QPRA 3WS2A 5DKKA 1ESUA 1JTDA 2VA0A 3UY6A 3UMEA 1HLUP 4OP5A 2Q9NA 1ZTUA 2UV0E 3ZG0A 1N9LA 4WEKA 4DDSA 3TW8A 5F82A 3IS2A 3D9YA 4E3OA 1DY6A 2I72A 5DJUA 4K91A 2Y2PA 2ZL1B 3UE1A 4B4XA 3HUMA 4R3BA 4EEUA 4MDZA 1PWGA 3IXHA 1L0FA 2J7VA 2FH5A 1DRMA 4PMAA 1BULA 1GSWA 1CEGA 4HY8A 4OQIA 3NOUC 3DBAA 4GS9A 3MQOA 3PBTA 2E8JA 3OCLA 3FPWA 3F1NB 1D1JA 5HPFA 1NJ4A 4LPZA 5FASA 3FC7A 4WL9A 1ESIA 4R1GA 3ITBA 3UB7A 1GA9A 1I2WA 1BZAA 4S2NA 1T1BA 4FCFA 2Y59A 3LCEA 3TRCA 2WKPA 3L7HA 3WS1A 2WKIA 1PFLA 3RTYA 4Z9QA 1NY0A 1A0KA 4II7A 4KZ9A 3PXPA 4DJ2A 5CECA 2EXBA 1XFNA 3OOVA 2V0WA 4S2PA 3ZFZA 2L0WA 3OPLA 3P09A 5HDDA 4GHIB 5J7EA 4NETA 1YKDA 2W3GA 4FOFA 4Q8IA 1TEMA 4E3IA 1YQSA 2HP9A 1SDNA 1JTGA 2XROA 2ZQ9A 4CLCD 4E3KA 2W1RA 4EUVA 2ZQCA 4X69A 4L9EA 4KQQA 1FR6A 4BD0A 4DXBA 2Z2LB 2A24A 5HAIA 4F3LB 2J8YA 1FIKA 2H0TA 1YM1A 3IWOA 5DTKA 1NWZA 1T19A 2DRWA 4PM8A 2K2NA 4JF4A 2HDQA 3F1PA 3CAXA 1G5UA 3G35A 3LO7A 2HP6A 3ISGA 3NI9A 5HFOA 4JPMA 2YKHA 3NY4A 4HEFA 3T1QB 2JC7A 2XF3A 1H8YA 3KYZA 3HJIA 1WE4A 1IYPA 3GMWA 1YLJA 1CK3A 5HX9A 5GHZA 3C30A 4KQRA 5FSRA 4MCWA 5J3WA 4PKYG 3CLOA 1VQQA 3A0VA 2ZC4B 3E2KA 1P97A 1XP4A 3P98A 5EVID 2D02A 1PNEA 3ZQ5A 1XJ3A 4DE2A 3VP3A 2AVXA 2Y2NA 4Y0TA 4NEED 1F98A 3PBRA 3VP0A 3CZDA 3NCKA 4JGQA 3M6BA 3T4QA 1OT6A 1ES5A 1DP8A 1MKIA 2G2WA 4NXBA 2ZM2A 4X1MA 1UGUA 3KYQA 5E2GA 2QKPA 1MXOA 1VHMA 4LV0A 4B93A 3LIEA 4S2KA 5HDSA 1VETA 4QY5A 3SS4A 4DXCA 2Y2KA 3SW1A 3UB8A 3NHQA 2EA9A 5DF7A 2ZMVA 3FZCA 1MZUA 3IF6C 4JGOA 1XKZA 4MEZA 3IT9A 2KDKA 2O9BA 1JWVA 1J9MA 1GHMA 3UB5P 3ICYA 2Z6DA 4ZJ3A 4QHCA 1YMSA 4HIAA 2X02A 3JVUA 2J9PA 3QNCA 5GLDA 4WBGA 5F1GA 1OTBA 2V1ZA 1TS8A 1XXMA 3NIAA 1STZA 4Y0UA 2OAP1 3GQZA 5DTSA 2J3WA 4JXSA 1I2SA 3ZDJA 3P01A 2P74A 3KO6A 3C38A 4S2JA 1W79A 3GVBA 1P0ZA 1I5QA 4CJNA 1YMXA 3BFCA 1QMEA 5DFXA 5CGWA 4QJGA 1PI5A 4OQGA 4KZ7A 1ERMA 2W1TA 4Y17A 2XD5A 2IWBA 1LL8A 4C6YA 1UWPX 2DCFA 4EV4A 2JKFA 4WZ4A 4JXVA 3NDEA 1GHIA 4EERA 3G30A 4IUHA 5I5LA 3WWXA 1AXBA 5JYPA 3BWLA 4GB7A 3MR0A 3BW6A 1ALQA 4I5SA 4OPQA 3V3RA 3DW0A 1ACFA 3S1YA 3W8KA 4OH0A 2GNXA 1FOFA 4XUXA 3KYEA 4EU0A 4RA7A 2XGNA 3G32A 1FCOA 4U3TA 5GL9A 1ZG4A 4MMNA 4EBPA 1W5DA 1KDSA 3VP2A 2ZOHA 2QWSA 2HDRA 1FCMA 1K38A 4OPZA 3VFHA 4R70A 2WKRA 3VOLA 4WZ5C 4I39A 3JVVA 1AWIA 5GHYA 3QP6A 4R0QA 2V8FA 2EFUA 4BJPA 3T1XA 1KDWA 1BSGA 3R7WB 4EQIA 2K7SA 3U2AA 3MQQA 5GHXA 3LFVA 3UO9A 4OLDA 3FG8A 2XH9A 4CLCA 4ESPA 1LLBA 1LL9A 3LGOA 3W4QA 4E3LA 4DN0A 3OZHA 3GECA 3SZTA 3RXXA 3BLSA 1S6RA 1K55C 5A90A 2XFTA 3KSHA 3MXRA 4MLLA 3LI8A 5F6AA 4MBFA 3EEHA 1N9OA 4MNRA 5HD5A 2INWA 2XRNA 3PTEA 5TGFA 1H8MA 3LEQA 3WS4A 4OOLA 1PW8A 4B9OA 2J9OA 3MZEA 3HBRA 1XGIA 3E2LA 5FQKA 3E4QA 4WMCD 3PAGA 4YOFA 2CMNA 3NC8A 1K56D 4WF0A 1HTZA 2L4RA 1YLYA 4BQMA 2WAFA 1MKMA 2VZWA 3IX4A 2KX6A 1SZVA 4ARZB 5FI6A 2M7UA 4B88A 2ZQDA 3GTCA 4HH2A 2WKHA 1MWSA 5EVIA 3EGDC 2JN7A 2XLNA 4E6XA 3OBFA 1YLWA 3IXDA 4HP4A 3H82B 3V5MA 4KQDA 4HBUA 5EOOA 4XXRA 5KIZA 1ZG6A 2J3TD 3IXGA 1MWRA 4G3KA 1XA7A 3B33A 1L0GA 2ZC5B 4MBHA 4MN5A 3HJKA 3VMAA 4ME4A 2V9AA 2WGWB 4UEYA 1JNUA 4P6ZS 4BENA 3IHBA 1TVFA 3SH7A 1G6OA 5FEGA 2IWDA 5DTTA 5MC7A 1XGJA 4L0LA 2OWJA 4UA6A 3H7WB 3FV7A 3MBZA 4GCZA 3O5YA 1S66L 2DMWA 4R4SA 5F1FA 1NRJA 3P7NA 1JVJA 4Y15A 5EFWA 3NOPC 4XT2B 2PR5A 3MZDA 4UQIS 4OLGA 1TS6A 1BLPA 1YSPA 5HWVA 1NYMA 2ZC7A 4EXOA 4A5RA 4MBKA 1NXYA 5KZHA 1OTAA 2K31A 4S2IA 2XR0A 4UA9A 3MXSA 4RQ9A 4BBVA 5CRFA 2R78A 2H28A 3VSKA 1YLTA 5IT5A 1CF0A 1RCJA 4LFUA 3EGXC 1Y4OA 2WADA 3DWZA 5EVEA 4ZBEA 3T50A 2OOLA 5FA7A 3AGEA 1KE4A 3LY4A 4P6ZM 3T4TA 3ZG9B 3UE6A 4RVAA 3LR4A 2KLIA 1H8ZA 4DE3A 3IF6B 2B02A 3ZCZA 3LIBA 3PBNA 2O0YA 1KVMA 2Q0OA 1KGFA 3C4PA 2ZM8A 3N8SA 4DMZA 4QB8A 5FAQA 2PYRA 2FFYA 1P9WA 4BBTA 3UPOA 1WA9A 2WKQA 4UQIM 1XJ4A 1H0MA 1OPXA 2QZ6A 3PHYA 3NBLA 4Y3IA 5A8BA 4EW7A 2JKGA 4P87A 3PBQA 1YPRA 2EX9A 2HP5A 3W4OA 2O99A 3B42A 2ZQ8A 3ULFA 3UMDA 3V3SA 2ACGA 1ES2A 4Q0JA 5G18A 3CUEC 3HREA 2JKRM 3GR2A 3NOTC 2KOIA 4BL2A 1WYCA 3IX3A 5HARA 1NZUA 1IKGA 4EEPA 4MN6A 1IYSA 3BFEA 3DAVA 4KZ4A 3KSFA 4LRYC 3VSLA 3HUNA 4F94A 2W3DA 1J3WA 2R9XA 1CEFA 3C7VA 3UDXA 1T18A 4G3VA 3KX0X 1LSVA 4GZBA 5C5KA 1FCNA 2Y8HA 3DTIA 2W3FA 4KZ8A 3CPTA 2BG1A 1LI9A 3A3JA 5E2FA 3TOIA 5IHVA 5EVLA 4OP8A 1K57A 1FSWA 1YT4A 1OMEA 4X1LA 1YSQA 5FAOA 2B18A 3EOIA 3FKWA 1G28A 2RCXA 3TSGA 1DJAA 2QPNA 1SKOB 3ITAA 1LL5A 3I7JA 4YNRA 4FD8A 1BT5A 5CHMA 4S2LA 4JGRA 1S1ZA 1ERQA 5EM1A 4OOYA 4WMCA 3U4LP 2P9VB 3Q7ZA 2Y2GA 5L07A 3HLEA 3ZVWA 1K56A 2ZM0A 3R4KA 1LI0A 2LB5A 3GDIA 3Q7VB 3VP1A 4O7DA 2BTFP 3RJUA 5EECA 4WELA 2G2UA 2IA2A 1F9IA 5J4EA 3V50A 3O88A 2HPBA 4CLCE 3ZG7B 3O86A 1IELA 3IS2B 2BLSA 1S67L 2R9WA 3LICA 4DE0A 4U0TA 4JLFA 1TS7A 4DRTA 2Q9MA 3S7QA 1VEUA 3SOIA 3VFFA 2V8CA 5J8XA 1HD8A 1TS0A 4XUZA 1KE0A 4LGWA 5F68A 5HWWA 4GS9B 3ZVTA 4O01A 2G7UA 2VK3A 1K54C 1N4OA 4HESA 3MJQA 3HLGA 5F69A 2V1BA 4R3JA 4K0WA 5E43A 2ZD8A 3LIFA 5DFYA 4R6LA 5CGXA 2QJ7A 3IQAA 5CHJA 1X0OA 4BWIA 2XQZA 3PBSA 1M6KA 2EWVA 3S22A 2NUTC 4KG6A 2EFXA 3ZYTA 2FZ0A 1W63M 3Q82A 4KQOA 4RX3A 1K4FA 2M1CA 1GSVA 3IH9A 4IJGA 4M3KA 1XA1A 2A49A 3E0YA 4R4RA 1IYQA 2JCHA 3GRJA 3BECA 3CWFA 1D7EA 3MKFA 2BASA 5AQ9A 4LV3A 4EWFA 3EQUA 4FH4A 4UAAA 5DVAA 3OC2A 4KZ3A 2H0YA 5AQAA 3BY9A 1SDEA 1PZOA 2OWHA 4NKPA 5EE8A 1NLZA 2A24B 2JKTM 1MBLA 4HHDA 3BQAA 4X6TA 5FDHA 1M40A 4YWZA 1YLZA 3M2JA 3UB6A 1IYOA 3F1PB 1QMFA 4LV1A 4P6BA 4HOIA 4BD1A 5CTNA 3C7UA 4X53A 4BLMA 3N8RA 3UPPA 1KGGA 1FILA 3CMZA 5BOHA 1G6AA 4ID4A 4OPYA 4NXEA 2XFSA 5TBMA 2ZBBA 3ZNYA 1CQAA 5U47A 3MZFA 3FWLA 5A93A 1E3UD 3MS6A 3G2YA 1ODVA 3DTKA 2WGWA 2OLVA 2DNSA 3SH8A 4I3JA 3K2NA 2XD1A 2FFFB 3TG9A 4KG2A 4HNBA 3ZG5A 4NG2A 2CC1A 3UNWA 3O87A 3T1SA 2PRFA 2OV5A 4KZ5A 3NDGA 3QP2A 4I38A 3PAEA 2Y2IA 2V0UA 2PBDP 3WRTA 1LHYA 2B95A 2Y91A 1MPLA 3DWKA 1VETB 4EBLA 1XJ6A 3SS3A 1Y54A 2V20A 4UHUA 2ZQAA 4PM9A 5DF9A 1K25A 3CG5A 4ZJ2A 2H10A 3BJNA 2PHYA 3LR0A 2Y2OA 4FSFA 4OONA 1JWZA 3OCNA 2XK1A 3LY3A 3PYPA 5HWTA 2HV1A 2J80A 2X01A 1PWCA 5JYOA 1SCWA 3BY8A 4GD6A 1VM1A 5HW3A 4NXGA 1PI4A 4KZAA 5E2EA 5HAQA 4GKUA 2Y2LA 3MMHA 3QNBA 4OQ0A 3LI9A 3V67A 2P08A 2WAEA 3T1RA 1DJBA 4S2NC 1OJGA 2W3HA 4OKPA 3BYDA 4GN2A 1L2SA 3BFDA 3MSHA 3C4OA 3Q81A 1Y28A 3NULA 3IF6A 2ZL1A 1W8QA 2Z2MB 3Q07A 5L2FA 4CQHA 3UB9A 2W1TB 1MY8A 2OLUA 3IBJA 3BLMA 4PM7A 4PM5A 4ZAMA 3EQVA 5CXWA 4G3WA 3ZGAB 1ES4A 3NJAA 3F1NA 3N6IA 1W7FA 4X55A 1E4DA 4D2OA 2WZZA 4KENB 3SS5A 4HP9A 3IHAA 4LCMA 4WUJA 4E6WA 2ZQ7A 1S4RA 2QJ5A 3IXBA 1OTDA 4Y0OA 3ZHHA 1PYYA 1S4SA 4C3QA 2ZMFA 1IOUA 1MWUA 5FQJA 3A0RA 4AFIA 1ONHA 4EQ1A 5EOEA 3LUQA 5A92A 1GHPA 4MN7A 1EI5A 5FQ9A 1HVBA 3JYIA 3VOZA 3EEAA 4DKIA 1ONGA 2UWXA 3A3FA 2PT7A 3HLBA 3V39A 4Y5FA 5TFQA 4GHIA 3N8LA 4O0PA 1PWDA 3LEZA 4LRXC 4ZTKA 3T12B 3F1OB 4WN5A 1HZOA 4JXGA 2OAQ1 2Y2HA 3HL9A 3HLWA 2NUPC 4KZ6A 1Q2QA 1OTEA 4CLCB 5FATA 4LENA 5AJGA 4RYEA 1DP9A 1L0DA 5AQ7A 4F3LA 2WKEA 4PM6A 5CEDA 1TDLA 3AGFA 1NLYA 4RX2A 2VKSA 1ES3A 3A0SA 3CHWP 2P9VA 3HLFA 4LLOB 4GW9A 5L10A 3Q7VA 4JXWA 1U60A 4O8GA 5I94A 3OPPA 4WEJA 3OPRA 4WZ5A 2RL3A 2Z6CA 1YLPA 5HPIA 1T1CA 2Y79A 3GV9A 3T4KA 5HSQA 4H6JB 4E3MA 2A2LA 1PZPA 5HL1A 4YFMA 3OPHA 3B3XA 4N92A 3BM6A 2VGKA 3IWIA 1NRFA 3B47A 3FPVA 4IBRA 2VV6A 4HJ4A 2PU4A 5EVIB 1E3UA 1D06A 2ZMAA 1N9NA 4Y7PA 1K55A 4Y13A 5F83A 4HH3A 2HJ9C 5FL3A 3MF0A 3IX8A 4PHTA 4PAUA 3HLCA 1CI9A 3TE8A 5IS1A 4GDBA 5GLAA 3C8CA 1FSYA 2P7JA 2PD8A 3N4IA 2EX2A 1E25A 3HLDA 2B5RA 3QP8A 1P9RA 4BL3A 5CTMA 1S0WA 3UE3A 4OOMA 4HJ3A 2WUQA 2PBYA 4H8RA 1LSWA 5FAPA 1KE3A 3Q1FA 2WYXA 3AGDA 2IWCA 1IKIA 3T4SA 4E3JA 4DF6A 2PAVP 4IVKA 2JBFA 5DJTA 5IU1A 4Q0IA 4LV2A 2XA7S 2W0NA 3HVFA 5TJJA 2GDNA 1SKFA 3FYZA 3HCYA 2JHEA 5TR7A 5M1AA 3MXQA 5G4YA 5AVEA 3MKEA 1LT0A 3TJZC 4ZRRA 3D4FA 4ZJ1A 3CITA 3T4LA 4HQAA 1KOUA 1EWZA 1GSXA 3MQ0A 1EW0A 3QHYA 4GDNA 2JKRI 4U0XA 1RGZA 3E4OA 3K3DA 5FQMA 2VGLS 2GJ3A 5GLCA 1JWPA 4IVIA 5HL6A 4ETXA 4X56A 2PYPA 3HUOA 4FH2A 4JKTA 2XSSA 4L9FA 5HAPA 3BQ8A 4KUOA 2HGVA 4P0MA 1F5MA 3CJMA 3G34A 2YKFA 4ETZA 2MJ6A 2L1MA 3WS5A 3EWKA 1ZKJA 4CLCC 3KSGA 5KSCA 4E04A 1V9YA 3S7PA 2XA7M 1GCEA 1KVLA 1MC0A 4BMWA 2Y2QA 4WM9A 4QU3A 1IFQA 3JPUA 2I9VA 5CGSA 1DJCA 1SHVA 5EPHA 4K08A 3BFGA 2EXAA 4HI4A 2C5WB 1WYBA 4EUZA 5HZHA 4JGPA 2PR6A 1CI8A 2LB9A 3T4OA 3WS0A 1MWTA 5CERA 5K5BA 1PIOA 3VV4A 4EESA 2QMIA 2VLGA 4DE1A 2VGLM 4M4XA 3R7WA 5FI2A 4JF6A 2ZOIA 2VJWA 4IHQA 3QP5A 1C3BA 3T4JA 3BFFA 5HDCA 2VX8A 2WZXA 1XJ2A 4EBNA 2HZ5A 1TF1A 4R23A 3BEBA 5EUAA 3N7WA 5EVIC 2EX6A 4I3AA 3QP4A 4GNUA 3CPTB 5FQIA 5HD3A 4I3IA 4OQHA 5FQQA 3G2ZA 4C75A 5E2HA 2ZLYA 1N9BA 2EWWA 3CUEA
chains in the Genus database with same CATH topology
3LR5A 4F3LB 4NXGA 4EETB 1S1YA 2O9AA 1NWZA 3MMHA 2PDRA 3CI6A 3LI9A 4P6ZM 1T19A 2K2NA 2O9CA 3T4TA 2P08A 3V67A 3UE6A 3F1PA 3CAXA 1OJGA 2W3HA 3KSIA 3LR4A 2KLIA 2P04A 4ARZA 1YAXA 1Y28A 2YKHA 4R3AA 2B02A 3KYZA 2GZAA 3HJIA 5L8MA 5KSHA 3LIBA 3PBNA 2O0YA 2M7VA 4CQHA 3UB9A 1V9ZA 2W1TB 4DMZA 3C30A 3IBJA 3H82A 5J3WA 2PYRA 4MCWA 4PKYG 3CLOA 5F5YA 3EQVA 3A0VA 1P9WA 4BBTA 4GJ4A 1WA9A 4G3WA 1P97A 2WKQA 4UQIM 1XJ4A 2D02A 3NJAA 3F1NA 1OPXA 3PHYA 3ZQ5A 4Y3IA 1XJ3A 4HP9A 5A8BA 4EW7A 1OTIA 4NEED 4WUJA 1F98A 1S4RA 2QJ5A 3PBRA 3PBQA 1OTDA 4JGQA 2O99A 3B42A 1S4SA 4Y2FA 3T4QA 3ULFA 1IOUA 2ZMFA 3UMDA 1OT6A 2W27A 1DP8A 1TD5A 4Q0JA 3A0RA 3CUEC 3H7WA 4NXBA 2JKRM 4AFIA 1UGUA 3KYQA 3NOTC 4EQ1A 2KOIA 2QKPA 1T1AA 3PBOA 4EEPA 4MN6A 1VHMA 3C2WA 2JKTI 3LUQA 3RH8B 4B93A 3LIEA 4MN7A 5HDSA 4LRYC 3KSFA 3S7NA 3EEAA 4Z1WA 3SW1A 4XT2A 2W3DA 3LYXA 3UB8A 3NHQA 2EA9A 2ZMVA 2PT7A 1MZUA 3OLOA 4Y5FA 4JGOA 4GHIA 1T18A 4G3VA 3KX0X 2KDKA 1LSVA 4O0PA 2O9BA 5C5KA 4LRXC 1OT9A 3F1OA 2Y8HA 2W3FA 3F1OB 4WN5A 2HF6A 2OAQ1 1VB6A 2NUPC 3ICYA 2Z6DA 1OTEA 4HIAA 1YSQA 3JVUA 4CLCB 2B18A 2VV7A 5CX7A 1OTBA 3EOIA 5AJGA 1TS8A 1G28A 1STZA 3D3OA 1DP9A 2OAP1 2J3WA 4F3LA 4LRZE 2PD7A 3P01A 4YNRA 1NLYA 2VKSA 3C38A 3KO6A 4JGRA 1S1ZA 3A0SA 1P0ZA 2QHKA 4LLOB 4GW9A 3R4KA 2LB5A 3GDIA 4O8GA 5DFXA 2GX5A 4WEJA 5LBRA 4WELA 4HJ6A 2IA2A 1F9IA 5J4EA 2Z6CA 2VV8A 2W1TA 4CLCE 3K3CA 3LIDA 4IUKA 5HPIA 2QYBA 4L9GA 1T1CA 2Y79A 4H6JA 1LSXA 3T4KA 3IS2B 4BBUA 5HSQA 4H6JB 2A2LA 1LL8A 1UWPX 1H3QA 1S67L 3LICA 3LR3A 4KUKA 3B47A 3FPVA 2VV6A 4EERA 4IUHA 5I5LA 4HJ4A 5G4ZA 1TS7A 1D06A 3BWLA 1N9NA 3MFXA 1DP6A 3MR0A 3BW6A 1W63Q 3S7QA 1XFQA 3RFBA 1TS0A 4I5SA 5TBMB 4HH3A 5F68A 2HJ9C 5HWWA 5FL3A 4GS9B 3VE3A 1UWNX 4O01A 2GNXA 2G7UA 3MF0A 3LIAA 4PHTA 4PAUA 4EU0A 4GLQA 3TE8A 5IS1A 3MJQA 4MMNA 5F69A 5AVFA 2V1BA 3C8CA 2P7JA 2ZOHA 2PD8A 3LIFA 5DFYA 2HJEA 2QWSA 4R6LA 3H9WA 2QJ7A 1ZHHB 1X0OA 4R38A 4WLAA 4BWIA 1P9RA 3PBSA 4R70A 2EWVA 2VEAA 2WKRA 3VOLA 3G6OA 3UE3A 2NUTC 4I39A 4OOMA 2D01A 4HJ3A 3ZYTA 3JVVA 2FZ0A 1W63M 3IBRA 1LSWA 3VE4A 3E98A 4Q0HA 4KQOA 4BJPA 1BYWA 2M1CA 3R7WB 1GSVA 2K7SA 3U2AA 4IJGA 3MQQA 4PKYA 3T4SA 3LFVA 3D72A 5DKLA 3E0YA 5DJTA 5IU1A 3W2ZA 3PR6A 4Q0IA 2XA7S 3FG8A 4NXFA 2W0NA 4CLCA 4DJ3A 2W3EA 5TJJA 2V1AA 4DN0A 2J3TC 3GECA 3CWFA 1D7EA 3HCYA 2BASA 2JHEA 3MXQA 5G4YA 5AVEA 3KSHA 3LI8A 1OJ5A 5F6AA 1LT0A 3EQUA 3S7OA 3TJZC 4ZRRA 3EEHA 1N9OA 3CITA 5HD5A 2INWA 2XRNA 3T4LA 4HQAA 1KOUA 3OC2A 3E4PA 1GSXA 1H8MA 3MQ0A 1EW0A 4QPRA 4OOLA 3BY9A 5DKKA 4B9OA 2JKRI 2VA0A 3E4OA 3K3DA 3UMEA 2OWHA 4NKPA 1NLZA 2A24B 2JKTM 2VGLS 2GJ3A 4HHDA 1ZTUA 3BQAA 3E4QA 5HL6A 4YWZA 4YOFA 1N9LA 2CMNA 4WEKA 4ETXA 4WF0A 2PYPA 3TW8A 2L4RA 3UB6A 3F1PB 3IS2A 2XSSA 1MKMA 4L9FA 2VZWA 2KX6A 4ARZB 5DJUA 3BQ8A 2M7UA 4KUOA 4HOIA 2HGVA 1F5MA 4HH2A 4EEUA 4MDZA 3EGDC 2JN7A 3OBFA 2YKFA 4ETZA 2MJ6A 2FH5A 2L1MA 4HP4A 1DRMA 3H82B 4KQDA 4NXEA 3EWKA 5TBMA 1GSWA 4HY8A 2ZBBA 4CLCC 3KSGA 3NOUC 4E04A 3DBAA 4GS9A 3MQOA 5KIZA 1V9YA 3PBTA 2J3TD 3S7PA 2XA7M 3OCLA 1MC0A 3FPWA 4G3KA 4BMWA 3F1NB 3B33A 1ODVA 1IFQA 4MN5A 3HJKA 5HPFA 2I9VA 4LPZA 4ME4A 2V9AA 4I3JA 3K2NA 3FC7A 4UEYA 4K08A 4WL9A 1JNUA 4P6ZS 4HI4A 1G6OA 4HNBA 3UB7A 5MC7A 4L0LA 2OWJA 5HZHA 3H7WB 1T1BA 4JGPA 2PR6A 2LB9A 3TRCA 2WKPA 4GCZA 4I38A 3T4OA 3O5YA 2V0UA 5K5BA 1S66L 3RTYA 3VV4A 4EESA 2DMWA 2VLGA 2VGLM 4M4XA 3R7WA 2ZOIA 2VJWA 1NRJA 3P7NA 4IHQA 4II7A 4DJ2A 3PXPA 1XJ6A 3T4JA 5EFWA 3NOPC 4XT2B 1XFNA 2PR5A 4UQIS 3OOVA 5HDCA 2V0WA 2VX8A 2L0WA 1XJ2A 5DF9A 1TF1A 1TS6A 5HDDA 1YSPA 5HWVA 4GHIB 4EXOA 5J7EA 1YKDA 2W3GA 4FOFA 3BJNA 1OTAA 2K31A 2PHYA 3LR0A 4FSFA 4I3AA 4RQ9A 3OCNA 4BBVA 2R78A 4CLCD 2XROA 5HD3A 2H28A 2W1RA 3PYPA 4I3IA 4EUVA 5IT5A 5HWTA 2HV1A 2J80A 3BY8A 4L9EA 3EGXC 3CUEA 2EWWA 3T50A 2OOLA 2A24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3L B;  4NXG A;  4EET B;  1S1Y A;  1NWZ A;  2PDR A;  3LI9 A;  1T19 A;  3UE6 A;  3F1P A;  3CAX A;  1OJG A;  1Y28 A;  2YKH A;  4R3A A;  2B02 A;  3HJI A;  3LIB A;  3UB9 A;  1V9Z A;  3H82 A;  5J3W A;  2PYR A;  4PKY G;  3CLO A;  5F5Y A;  3A0V A;  4BBT A;  1WA9 A;  1P97 A;  2WKQ A;  1XJ4 A;  2D02 A;  3NJA A;  3F1N A;  3PHY A;  3ZQ5 A;  1XJ3 A;  4HP9 A;  5A8B A;  4EW7 A;  1OTI A;  4WUJ A;  1F98 A;  1S4R A;  2QJ5 A;  1OTD A;  4JGQ A;  1S4S A;  3ULF A;  3UMD A;  1OT6 A;  2W27 A;  1DP8 A;  3A0R A;  3H7W A;  4NXB A;  1UGU A;  3NOT C;  4EQ1 A;  2QKP A;  1T1A A;  4EEP A;  4MN6 A;  3C2W A;  3LUQ A;  3RH8 B;  3LIE A;  5HDS A;  4LRY C;  3SW1 A;  4XT2 A;  3LYX A;  3UB8 A;  3NHQ A;  2EA9 A;  1MZU A;  3OLO A;  4JGO A;  4GHI A;  1T18 A;  3KX0 X;  2KDK A;  1LSV A;  4LRX C;  1OT9 A;  3F1O A;  3F1O B;  4WN5 A;  1VB6 A;  3ICY A;  2Z6D A;  1OTE A;  4HIA A;  2VV7 A;  1OTB A;  1TS8 A;  1G28 A;  1DP9 A;  4F3L A;  4LRZ E;  2PD7 A;  4JGR A;  1S1Z A;  3A0S A;  1P0Z A;  2QHK A;  4LLO B;  4GW9 A;  3GDI A;  4HJ6 A;  1F9I A;  5J4E A;  2Z6C A;  2VV8 A;  3K3C A;  3LID A;  4L9G A;  1T1C A;  4H6J A;  1LSX A;  4BBU A;  3IS2 B;  5HSQ A;  4H6J B;  1LL8 A;  1UWP X;  1S67 L;  3LIC A;  4KUK A;  2VV6 A;  4EER A;  5I5L A;  4HJ4 A;  5G4Z A;  1TS7 A;  1D06 A;  3BWL A;  1N9N A;  3MFX A;  1DP6 A;  3MR0 A;  1XFQ A;  1TS0 A;  4I5S A;  5TBM B;  4HH3 A;  5F68 A;  5HWW A;  4GS9 B;  3VE3 A;  1UWN X;  3LIA A;  5IS1 A;  3MJQ A;  5F69 A;  5AVF A;  2V1B A;  3C8C A;  2P7J A;  2ZOH A;  2PD8 A;  3LIF A;  2QWS A;  4R6L A;  3H9W A;  2QJ7 A;  1X0O A;  4R38 A;  4WLA A;  4R70 A;  2VEA A;  2WKR A;  3VOL A;  3G6O A;  4I39 A;  2D01 A;  4HJ3 A;  3IBR A;  1LSW A;  3VE4 A;  1BYW A;  2M1C A;  1GSV A;  2K7S A;  3MQQ A;  4PKY A;  3D72 A;  5DKL A;  5DJT A;  5IU1 A;  3FG8 A;  4NXF A;  2W0N A;  4DJ3 A;  2V1A A;  3GEC A;  3CWF A;  1D7E A;  2BAS A;  2JHE A;  3MXQ A;  5G4Y A;  5AVE A;  3LI8 A;  1OJ5 A;  5F6A A;  1LT0 A;  3EEH A;  1N9O A;  5HD5 A;  2INW A;  4HQA A;  1KOU A;  3E4P A;  1GSX A;  1EW0 A;  3BY9 A;  5DKK A;  4B9O A;  3E4O A;  3K3D A;  3UME A;  2OWH A;  2A24 B;  2GJ3 A;  4HHD A;  3E4Q A;  4YWZ A;  1N9L A;  2CMN A;  4WF0 A;  2PYP A;  2L4R A;  3UB6 A;  3F1P B;  3IS2 A;  4L9F A;  2KX6 A;  5DJU A;  4KUO A;  4HOI A;  4HH2 A;  4EEU A;  2JN7 A;  2YKF A;  2L1M A;  4HP4 A;  1DRM A;  3H82 B;  4KQD A;  4NXE A;  3EWK A;  5TBM A;  1GSW A;  4HY8 A;  2ZBB A;  3NOU C;  4E04 A;  4GS9 A;  5KIZ A;  3MQO A;  1V9Y A;  3F1N B;  3B33 A;  1ODV A;  4MN5 A;  3HJK A;  2I9V A;  4LPZ A;  2V9A A;  4I3J A;  3FC7 A;  4WL9 A;  4K08 A;  1JNU A;  4HI4 A;  4HNB A;  3UB7 A;  2OWJ A;  5HZH A;  3H7W B;  1T1B A;  4JGP A;  2PR6 A;  2WKP A;  4GCZ A;  4I38 A;  2V0U A;  1S66 L;  3RTY A;  4EES A;  2VLG A;  4M4X A;  2ZOI A;  3P7N A;  4DJ2 A;  1XJ6 A;  5EFW A;  3NOP C;  4XT2 B;  1XFN A;  2PR5 A;  5HDC A;  2V0W A;  2L0W A;  1XJ2 A;  1TS6 A;  5HDD A;  5HWV A;  4GHI B;  4EXO A;  5J7E A;  1OTA A;  2PHY A;  4I3A A;  4RQ9 A;  4BBV A;  2R78 A;  5HD3 A;  2H28 A;  3PYP A;  4I3I A;  5HWT A;  2HV1 A;  2J80 A;  3BY8 A;  4L9E A;  3T50 A;  2OOL A;  2A24 A; 
#chains in the Genus database with same CATH topology
 3LR5 A;  1ZC2 A;  2ZJ9 A;  4EET B;  5M19 A;  1S1Y A;  2O9A A;  2WK0 A;  2PDR A;  3CI6 A;  4GD8 A;  2O9C A;  1G68 A;  1XX2 A;  3KSI A;  2P04 A;  4ARZ A;  1YAX A;  4B4Z A;  4FUW A;  4IBX A;  4R3A A;  1NZO A;  2GZA A;  5L8M A;  5KSH A;  5EV0 A;  2M7V A;  1V9Z A;  3GSG A;  5FDS A;  3H82 A;  3WRZ A;  5FEF A;  5L09 A;  5AQB A;  5F5Y A;  5D3O A;  2ZC3 B;  4GJ4 A;  4PPR A;  2Y55 A;  4JBF A;  3ZG8 B;  1TDG A;  1OTI A;  2HDS A;  2XEP A;  3A3E A;  5A91 A;  1VEU B;  4Y2F A;  4N9L A;  2XDM A;  2HDU A;  2W27 A;  1TD5 A;  3H7W A;  1FR1 A;  1KGE A;  1K0K A;  3VP4 A;  1T1A A;  3G4P A;  3PBO A;  5FI7 A;  3C2W A;  2JKT I;  3RH8 B;  4IED A;  2X71 A;  2Y2J A;  3S7N A;  1PW1 A;  4QWO A;  3W4P A;  3RXW A;  4Z1W A;  4XT2 A;  3LYX A;  3OLO A;  2ZC6 B;  3M6H A;  2OSU A;  4N9K A;  3UDF A;  3MFD A;  1OT9 A;  3F1O A;  4QY6 A;  2HF6 A;  3C5A A;  1RGY A;  1VB6 A;  3UDI A;  2Y2M A;  4P85 A;  2VGJ A;  1K4E A;  4KG5 A;  4WYY A;  5CHU A;  2VV7 A;  5CX7 A;  1Q2P A;  1O7E A;  3D3O A;  3UN7 A;  1K54 A;  5EM0 A;  4LRZ E;  4DDY A;  2PD7 A;  2V2F F;  4N1H A;  3IF5 A;  1PRQ A;  4CPK A;  2QHK A;  1L3L A;  3A3I A;  4E3N A;  2WGI A;  5GLB A;  1BLH A;  2GX5 A;  5LBR A;  2PU2 A;  4HJ6 A;  2Y4A A;  3VOY A;  2VV8 A;  4K0X A;  3G31 A;  4FTX A;  3K3C A;  3LID A;  3BRM A;  4IUK A;  2QYB A;  4L9G A;  2H5S A;  4H6J A;  1LSX A;  4BBU A;  1BUE A;  1W8Y A;  4OVD A;  1IEM A;  1H3Q A;  3L9K A;  2WGV A;  4N1X A;  3LR3 A;  4GOG A;  4KUK A;  1H5X A;  3FKV A;  5G4Z A;  3MFX A;  1DP6 A;  1F2K A;  1W63 Q;  5KMW A;  2EX8 A;  1XFQ A;  1K57 C;  3RFB A;  4X25 A;  5TBM B;  1Z6F A;  4HBT A;  3UPN A;  3VE3 A;  1UWN X;  1Z09 A;  2JE5 A;  3LIA A;  1FQG A;  1BLC A;  4GLQ A;  5DF8 A;  3ZNT A;  1XPB A;  3IWQ A;  5AVF A;  1BTL A;  1K6S A;  2A3U A;  3DTM A;  1K6R A;  5CEB A;  4S2M A;  1O07 A;  3UE0 A;  2HJE A;  3NEC A;  4OPR A;  3H9W A;  1GA0 A;  3A3D A;  4QD4 A;  4LCL A;  1ZHH B;  3O3V A;  4WLA A;  4R38 A;  2E8I A;  2VEA A;  3G6O A;  2D01 A;  1NYY A;  3IBR A;  3VE4 A;  1ERO A;  3E98 A;  4Q0H A;  1BYW A;  3DTE A;  4ZDX A;  4D60 A;  4PKY A;  4NK3 A;  3S4X A;  3SH9 A;  3D72 A;  1L0E A;  5DKL A;  3W2Z A;  3PR6 A;  4JF5 A;  4NXF A;  4UA7 A;  4DJ3 A;  2W3E A;  5M18 A;  2V1A A;  3QP1 A;  3IH8 A;  3M2K A;  2J3T C;  1SKO A;  4S2O A;  4YIN A;  4KZB A;  1OJ5 A;  3S7O A;  1CJF A;  4X68 A;  2C6W B;  3E4P A;  1BLS A;  1RP5 A;  4QPR A;  3WS2 A;  5DKK A;  1ESU A;  1JTD A;  2VA0 A;  3UY6 A;  3UME A;  1HLU P;  4OP5 A;  2Q9N A;  1ZTU A;  2UV0 E;  3ZG0 A;  1N9L A;  4WEK A;  4DDS A;  3TW8 A;  5F82 A;  3IS2 A;  3D9Y A;  4E3O A;  1DY6 A;  2I72 A;  5DJU A;  4K91 A;  2Y2P A;  2ZL1 B;  3UE1 A;  4B4X A;  3HUM A;  4R3B A;  4EEU A;  4MDZ A;  1PWG A;  3IXH A;  1L0F A;  2J7V A;  2FH5 A;  1DRM A;  4PMA A;  1BUL A;  1GSW A;  1CEG A;  4HY8 A;  4OQI A;  3NOU C;  3DBA A;  4GS9 A;  3MQO A;  3PBT A;  2E8J A;  3OCL A;  3FPW A;  3F1N B;  1D1J A;  5HPF A;  1NJ4 A;  4LPZ A;  5FAS A;  3FC7 A;  4WL9 A;  1ESI A;  4R1G A;  3ITB A;  3UB7 A;  1GA9 A;  1I2W A;  1BZA A;  4S2N A;  1T1B A;  4FCF A;  2Y59 A;  3LCE A;  3TRC A;  2WKP A;  3L7H A;  3WS1 A;  2WKI A;  1PFL A;  3RTY A;  4Z9Q A;  1NY0 A;  1A0K A;  4II7 A;  4KZ9 A;  3PXP A;  4DJ2 A;  5CEC A;  2EXB A;  1XFN A;  3OOV A;  2V0W A;  4S2P A;  3ZFZ A;  2L0W A;  3OPL A;  3P09 A;  5HDD A;  4GHI B;  5J7E A;  4NET A;  1YKD A;  2W3G A;  4FOF A;  4Q8I A;  1TEM A;  4E3I A;  1YQS A;  2HP9 A;  1SDN A;  1JTG A;  2XRO A;  2ZQ9 A;  4CLC D;  4E3K A;  2W1R A;  4EUV A;  2ZQC A;  4X69 A;  4L9E A;  4KQQ A;  1FR6 A;  4BD0 A;  4DXB A;  2Z2L B;  2A24 A;  5HAI A;  4F3L B;  2J8Y A;  1FIK A;  2H0T A;  1YM1 A;  3IWO A;  5DTK A;  1NWZ A;  1T19 A;  2DRW A;  4PM8 A;  2K2N A;  4JF4 A;  2HDQ A;  3F1P A;  3CAX A;  1G5U A;  3G35 A;  3LO7 A;  2HP6 A;  3ISG A;  3NI9 A;  5HFO A;  4JPM A;  2YKH A;  3NY4 A;  4HEF A;  3T1Q B;  2JC7 A;  2XF3 A;  1H8Y A;  3KYZ A;  3HJI A;  1WE4 A;  1IYP A;  3GMW A;  1YLJ A;  1CK3 A;  5HX9 A;  5GHZ A;  3C30 A;  4KQR A;  5FSR A;  4MCW A;  5J3W A;  4PKY G;  3CLO A;  1VQQ A;  3A0V A;  2ZC4 B;  3E2K A;  1P97 A;  1XP4 A;  3P98 A;  5EVI D;  2D02 A;  1PNE A;  3ZQ5 A;  1XJ3 A;  4DE2 A;  3VP3 A;  2AVX A;  2Y2N A;  4Y0T A;  4NEE D;  1F98 A;  3PBR A;  3VP0 A;  3CZD A;  3NCK A;  4JGQ A;  3M6B A;  3T4Q A;  1OT6 A;  1ES5 A;  1DP8 A;  1MKI A;  2G2W A;  4NXB A;  2ZM2 A;  4X1M A;  1UGU A;  3KYQ A;  5E2G A;  2QKP A;  1MXO A;  1VHM A;  4LV0 A;  4B93 A;  3LIE A;  4S2K A;  5HDS A;  1VET A;  4QY5 A;  3SS4 A;  4DXC A;  2Y2K A;  3SW1 A;  3UB8 A;  3NHQ A;  2EA9 A;  5DF7 A;  2ZMV A;  3FZC A;  1MZU A;  3IF6 C;  4JGO A;  1XKZ A;  4MEZ A;  3IT9 A;  2KDK A;  2O9B A;  1JWV A;  1J9M A;  1GHM A;  3UB5 P;  3ICY A;  2Z6D A;  4ZJ3 A;  4QHC A;  1YMS A;  4HIA A;  2X02 A;  3JVU A;  2J9P A;  3QNC A;  5GLD A;  4WBG A;  5F1G A;  1OTB A;  2V1Z A;  1TS8 A;  1XXM A;  3NIA A;  1STZ A;  4Y0U A;  2OAP 1;  3GQZ A;  5DTS A;  2J3W A;  4JXS A;  1I2S A;  3ZDJ A;  3P01 A;  2P74 A;  3KO6 A;  3C38 A;  4S2J A;  1W79 A;  3GVB A;  1P0Z A;  1I5Q A;  4CJN A;  1YMX A;  3BFC A;  1QME A;  5DFX A;  5CGW A;  4QJG A;  1PI5 A;  4OQG A;  4KZ7 A;  1ERM A;  2W1T A;  4Y17 A;  2XD5 A;  2IWB A;  1LL8 A;  4C6Y A;  1UWP X;  2DCF A;  4EV4 A;  2JKF A;  4WZ4 A;  4JXV A;  3NDE A;  1GHI A;  4EER A;  3G30 A;  4IUH A;  5I5L A;  3WWX A;  1AXB A;  5JYP A;  3BWL A;  4GB7 A;  3MR0 A;  3BW6 A;  1ALQ A;  4I5S A;  4OPQ A;  3V3R A;  3DW0 A;  1ACF A;  3S1Y A;  3W8K A;  4OH0 A;  2GNX A;  1FOF A;  4XUX A;  3KYE A;  4EU0 A;  4RA7 A;  2XGN A;  3G32 A;  1FCO A;  4U3T A;  5GL9 A;  1ZG4 A;  4MMN A;  4EBP A;  1W5D A;  1KDS A;  3VP2 A;  2ZOH A;  2QWS A;  2HDR A;  1FCM A;  1K38 A;  4OPZ A;  3VFH A;  4R70 A;  2WKR A;  3VOL A;  4WZ5 C;  4I39 A;  3JVV A;  1AWI A;  5GHY A;  3QP6 A;  4R0Q A;  2V8F A;  2EFU A;  4BJP A;  3T1X A;  1KDW A;  1BSG A;  3R7W B;  4EQI A;  2K7S A;  3U2A A;  3MQQ A;  5GHX A;  3LFV A;  3UO9 A;  4OLD A;  3FG8 A;  2XH9 A;  4CLC A;  4ESP A;  1LLB A;  1LL9 A;  3LGO A;  3W4Q A;  4E3L A;  4DN0 A;  3OZH A;  3GEC A;  3SZT A;  3RXX A;  3BLS A;  1S6R A;  1K55 C;  5A90 A;  2XFT A;  3KSH A;  3MXR A;  4MLL A;  3LI8 A;  5F6A A;  4MBF A;  3EEH A;  1N9O A;  4MNR A;  5HD5 A;  2INW A;  2XRN A;  3PTE A;  5TGF A;  1H8M A;  3LEQ A;  3WS4 A;  4OOL A;  1PW8 A;  4B9O A;  2J9O A;  3MZE A;  3HBR A;  1XGI A;  3E2L A;  5FQK A;  3E4Q A;  4WMC D;  3PAG A;  4YOF A;  2CMN A;  3NC8 A;  1K56 D;  4WF0 A;  1HTZ A;  2L4R A;  1YLY A;  4BQM A;  2WAF A;  1MKM A;  2VZW A;  3IX4 A;  2KX6 A;  1SZV A;  4ARZ B;  5FI6 A;  2M7U A;  4B88 A;  2ZQD A;  3GTC A;  4HH2 A;  2WKH A;  1MWS A;  5EVI A;  3EGD C;  2JN7 A;  2XLN A;  4E6X A;  3OBF A;  1YLW A;  3IXD A;  4HP4 A;  3H82 B;  3V5M A;  4KQD A;  4HBU A;  5EOO A;  4XXR A;  5KIZ A;  1ZG6 A;  2J3T D;  3IXG A;  1MWR A;  4G3K A;  1XA7 A;  3B33 A;  1L0G A;  2ZC5 B;  4MBH A;  4MN5 A;  3HJK A;  3VMA A;  4ME4 A;  2V9A A;  2WGW B;  4UEY A;  1JNU A;  4P6Z S;  4BEN A;  3IHB A;  1TVF A;  3SH7 A;  1G6O A;  5FEG A;  2IWD A;  5DTT A;  5MC7 A;  1XGJ A;  4L0L A;  2OWJ A;  4UA6 A;  3H7W B;  3FV7 A;  3MBZ A;  4GCZ A;  3O5Y A;  1S66 L;  2DMW A;  4R4S A;  5F1F A;  1NRJ A;  3P7N A;  1JVJ A;  4Y15 A;  5EFW A;  3NOP C;  4XT2 B;  2PR5 A;  3MZD A;  4UQI S;  4OLG A;  1TS6 A;  1BLP A;  1YSP A;  5HWV A;  1NYM A;  2ZC7 A;  4EXO A;  4A5R A;  4MBK A;  1NXY A;  5KZH A;  1OTA A;  2K31 A;  4S2I A;  2XR0 A;  4UA9 A;  3MXS A;  4RQ9 A;  4BBV A;  5CRF A;  2R78 A;  2H28 A;  3VSK A;  1YLT A;  5IT5 A;  1CF0 A;  1RCJ A;  4LFU A;  3EGX C;  1Y4O A;  2WAD A;  3DWZ A;  5EVE A;  4ZBE A;  3T50 A;  2OOL A;  5FA7 A;  3AGE A;  1KE4 A;  3LY4 A;  4P6Z M;  3T4T A;  3ZG9 B;  3UE6 A;  4RVA A;  3LR4 A;  2KLI A;  1H8Z A;  4DE3 A;  3IF6 B;  2B02 A;  3ZCZ A;  3LIB A;  3PBN A;  2O0Y A;  1KVM A;  2Q0O A;  1KGF A;  3C4P A;  2ZM8 A;  3N8S A;  4DMZ A;  4QB8 A;  5FAQ A;  2PYR A;  2FFY A;  1P9W A;  4BBT A;  3UPO A;  1WA9 A;  2WKQ A;  4UQI M;  1XJ4 A;  1H0M A;  1OPX A;  2QZ6 A;  3PHY A;  3NBL A;  4Y3I A;  5A8B A;  4EW7 A;  2JKG A;  4P87 A;  3PBQ A;  1YPR A;  2EX9 A;  2HP5 A;  3W4O A;  2O99 A;  3B42 A;  2ZQ8 A;  3ULF A;  3UMD A;  3V3S A;  2ACG A;  1ES2 A;  4Q0J A;  5G18 A;  3CUE C;  3HRE A;  2JKR M;  3GR2 A;  3NOT C;  2KOI A;  4BL2 A;  1WYC A;  3IX3 A;  5HAR A;  1NZU A;  1IKG A;  4EEP A;  4MN6 A;  1IYS A;  3BFE A;  3DAV A;  4KZ4 A;  3KSF A;  4LRY C;  3VSL A;  3HUN A;  4F94 A;  2W3D A;  1J3W A;  2R9X A;  1CEF A;  3C7V A;  3UDX A;  1T18 A;  4G3V A;  3KX0 X;  1LSV A;  4GZB A;  5C5K A;  1FCN A;  2Y8H A;  3DTI A;  2W3F A;  4KZ8 A;  3CPT A;  2BG1 A;  1LI9 A;  3A3J A;  5E2F A;  3TOI A;  5IHV A;  5EVL A;  4OP8 A;  1K57 A;  1FSW A;  1YT4 A;  1OME A;  4X1L A;  1YSQ A;  5FAO A;  2B18 A;  3EOI A;  3FKW A;  1G28 A;  2RCX A;  3TSG A;  1DJA A;  2QPN A;  1SKO B;  3ITA A;  1LL5 A;  3I7J A;  4YNR A;  4FD8 A;  1BT5 A;  5CHM A;  4S2L A;  4JGR A;  1S1Z A;  1ERQ A;  5EM1 A;  4OOY A;  4WMC A;  3U4L P;  2P9V B;  3Q7Z A;  2Y2G A;  5L07 A;  3HLE A;  3ZVW A;  1K56 A;  2ZM0 A;  3R4K A;  1LI0 A;  2LB5 A;  3GDI A;  3Q7V B;  3VP1 A;  4O7D A;  2BTF P;  3RJU A;  5EEC A;  4WEL A;  2G2U A;  2IA2 A;  1F9I A;  5J4E A;  3V50 A;  3O88 A;  2HPB A;  4CLC E;  3ZG7 B;  3O86 A;  1IEL A;  3IS2 B;  2BLS A;  1S67 L;  2R9W A;  3LIC A;  4DE0 A;  4U0T A;  4JLF A;  1TS7 A;  4DRT A;  2Q9M A;  3S7Q A;  1VEU A;  3SOI A;  3VFF A;  2V8C A;  5J8X A;  1HD8 A;  1TS0 A;  4XUZ A;  1KE0 A;  4LGW A;  5F68 A;  5HWW A;  4GS9 B;  3ZVT A;  4O01 A;  2G7U A;  2VK3 A;  1K54 C;  1N4O A;  4HES A;  3MJQ A;  3HLG A;  5F69 A;  2V1B A;  4R3J A;  4K0W A;  5E43 A;  2ZD8 A;  3LIF A;  5DFY A;  4R6L A;  5CGX A;  2QJ7 A;  3IQA A;  5CHJ A;  1X0O A;  4BWI A;  2XQZ A;  3PBS A;  1M6K A;  2EWV A;  3S22 A;  2NUT C;  4KG6 A;  2EFX A;  3ZYT A;  2FZ0 A;  1W63 M;  3Q82 A;  4KQO A;  4RX3 A;  1K4F A;  2M1C A;  1GSV A;  3IH9 A;  4IJG A;  4M3K A;  1XA1 A;  2A49 A;  3E0Y A;  4R4R A;  1IYQ A;  2JCH A;  3GRJ A;  3BEC A;  3CWF A;  1D7E A;  3MKF A;  2BAS A;  5AQ9 A;  4LV3 A;  4EWF A;  3EQU A;  4FH4 A;  4UAA A;  5DVA A;  3OC2 A;  4KZ3 A;  2H0Y A;  5AQA A;  3BY9 A;  1SDE A;  1PZO A;  2OWH A;  4NKP A;  5EE8 A;  1NLZ A;  2A24 B;  2JKT M;  1MBL A;  4HHD A;  3BQA A;  4X6T A;  5FDH A;  1M40 A;  4YWZ A;  1YLZ A;  3M2J A;  3UB6 A;  1IYO A;  3F1P B;  1QMF A;  4LV1 A;  4P6B A;  4HOI A;  4BD1 A;  5CTN A;  3C7U A;  4X53 A;  4BLM A;  3N8R A;  3UPP A;  1KGG A;  1FIL A;  3CMZ A;  5BOH A;  1G6A A;  4ID4 A;  4OPY A;  4NXE A;  2XFS A;  5TBM A;  2ZBB A;  3ZNY A;  1CQA A;  5U47 A;  3MZF A;  3FWL A;  5A93 A;  1E3U D;  3MS6 A;  3G2Y A;  1ODV A;  3DTK A;  2WGW A;  2OLV A;  2DNS A;  3SH8 A;  4I3J A;  3K2N A;  2XD1 A;  2FFF B;  3TG9 A;  4KG2 A;  4HNB A;  3ZG5 A;  4NG2 A;  2CC1 A;  3UNW A;  3O87 A;  3T1S A;  2PRF A;  2OV5 A;  4KZ5 A;  3NDG A;  3QP2 A;  4I38 A;  3PAE A;  2Y2I A;  2V0U A;  2PBD P;  3WRT A;  1LHY A;  2B95 A;  2Y91 A;  1MPL A;  3DWK A;  1VET B;  4EBL A;  1XJ6 A;  3SS3 A;  1Y54 A;  2V20 A;  4UHU A;  2ZQA A;  4PM9 A;  5DF9 A;  1K25 A;  3CG5 A;  4ZJ2 A;  2H10 A;  3BJN A;  2PHY A;  3LR0 A;  2Y2O A;  4FSF A;  4OON A;  1JWZ A;  3OCN A;  2XK1 A;  3LY3 A;  3PYP A;  5HWT A;  2HV1 A;  2J80 A;  2X01 A;  1PWC A;  5JYO A;  1SCW A;  3BY8 A;  4GD6 A;  1VM1 A;  5HW3 A;  4NXG A;  1PI4 A;  4KZA A;  5E2E A;  5HAQ A;  4GKU A;  2Y2L A;  3MMH A;  3QNB A;  4OQ0 A;  3LI9 A;  3V67 A;  2P08 A;  2WAE A;  3T1R A;  1DJB A;  4S2N C;  1OJG A;  2W3H A;  4OKP A;  3BYD A;  4GN2 A;  1L2S A;  3BFD A;  3MSH A;  3C4O A;  3Q81 A;  1Y28 A;  3NUL A;  3IF6 A;  2ZL1 A;  1W8Q A;  2Z2M B;  3Q07 A;  5L2F A;  4CQH A;  3UB9 A;  2W1T B;  1MY8 A;  2OLU A;  3IBJ A;  3BLM A;  4PM7 A;  4PM5 A;  4ZAM A;  3EQV A;  5CXW A;  4G3W A;  3ZGA B;  1ES4 A;  3NJA A;  3F1N A;  3N6I A;  1W7F A;  4X55 A;  1E4D A;  4D2O A;  2WZZ A;  4KEN B;  3SS5 A;  4HP9 A;  3IHA A;  4LCM A;  4WUJ A;  4E6W A;  2ZQ7 A;  1S4R A;  2QJ5 A;  3IXB A;  1OTD A;  4Y0O A;  3ZHH A;  1PYY A;  1S4S A;  4C3Q A;  2ZMF A;  1IOU A;  1MWU A;  5FQJ A;  3A0R A;  4AFI A;  1ONH A;  4EQ1 A;  5EOE A;  3LUQ A;  5A92 A;  1GHP A;  4MN7 A;  1EI5 A;  5FQ9 A;  1HVB A;  3JYI A;  3VOZ A;  3EEA A;  4DKI A;  1ONG A;  2UWX A;  3A3F A;  2PT7 A;  3HLB A;  3V39 A;  4Y5F A;  5TFQ A;  4GHI A;  3N8L A;  4O0P A;  1PWD A;  3LEZ A;  4LRX C;  4ZTK A;  3T12 B;  3F1O B;  4WN5 A;  1HZO A;  4JXG A;  2OAQ 1;  2Y2H A;  3HL9 A;  3HLW A;  2NUP C;  4KZ6 A;  1Q2Q A;  1OTE A;  4CLC B;  5FAT A;  4LEN A;  5AJG A;  4RYE A;  1DP9 A;  1L0D A;  5AQ7 A;  4F3L A;  2WKE A;  4PM6 A;  5CED A;  1TDL A;  3AGF A;  1NLY A;  4RX2 A;  2VKS A;  1ES3 A;  3A0S A;  3CHW P;  2P9V A;  3HLF A;  4LLO B;  4GW9 A;  5L10 A;  3Q7V A;  4JXW A;  1U60 A;  4O8G A;  5I94 A;  3OPP A;  4WEJ A;  3OPR A;  4WZ5 A;  2RL3 A;  2Z6C A;  1YLP A;  5HPI A;  1T1C A;  2Y79 A;  3GV9 A;  3T4K A;  5HSQ A;  4H6J B;  4E3M A;  2A2L A;  1PZP A;  5HL1 A;  4YFM A;  3OPH A;  3B3X A;  4N92 A;  3BM6 A;  2VGK A;  3IWI A;  1NRF A;  3B47 A;  3FPV A;  4IBR A;  2VV6 A;  4HJ4 A;  2PU4 A;  5EVI B;  1E3U A;  1D06 A;  2ZMA A;  1N9N A;  4Y7P A;  1K55 A;  4Y13 A;  5F83 A;  4HH3 A;  2HJ9 C;  5FL3 A;  3MF0 A;  3IX8 A;  4PHT A;  4PAU A;  3HLC A;  1CI9 A;  3TE8 A;  5IS1 A;  4GDB A;  5GLA A;  3C8C A;  1FSY A;  2P7J A;  2PD8 A;  3N4I A;  2EX2 A;  1E25 A;  3HLD A;  2B5R A;  3QP8 A;  1P9R A;  4BL3 A;  5CTM A;  1S0W A;  3UE3 A;  4OOM A;  4HJ3 A;  2WUQ A;  2PBY A;  4H8R A;  1LSW A;  5FAP A;  1KE3 A;  3Q1F A;  2WYX A;  3AGD A;  2IWC A;  1IKI A;  3T4S A;  4E3J A;  4DF6 A;  2PAV P;  4IVK A;  2JBF A;  5DJT A;  5IU1 A;  4Q0I A;  4LV2 A;  2XA7 S;  2W0N A;  3HVF A;  5TJJ A;  2GDN A;  1SKF A;  3FYZ A;  3HCY A;  2JHE A;  5TR7 A;  5M1A A;  3MXQ A;  5G4Y A;  5AVE A;  3MKE A;  1LT0 A;  3TJZ C;  4ZRR A;  3D4F A;  4ZJ1 A;  3CIT A;  3T4L A;  4HQA A;  1KOU A;  1EWZ A;  1GSX A;  3MQ0 A;  1EW0 A;  3QHY A;  4GDN A;  2JKR I;  4U0X A;  1RGZ A;  3E4O A;  3K3D A;  5FQM A;  2VGL S;  2GJ3 A;  5GLC A;  1JWP A;  4IVI A;  5HL6 A;  4ETX A;  4X56 A;  2PYP A;  3HUO A;  4FH2 A;  4JKT A;  2XSS A;  4L9F A;  5HAP A;  3BQ8 A;  4KUO A;  2HGV A;  4P0M A;  1F5M A;  3CJM A;  3G34 A;  2YKF A;  4ETZ A;  2MJ6 A;  2L1M A;  3WS5 A;  3EWK A;  1ZKJ A;  4CLC C;  3KSG A;  5KSC A;  4E04 A;  1V9Y A;  3S7P A;  2XA7 M;  1GCE A;  1KVL A;  1MC0 A;  4BMW A;  2Y2Q A;  4WM9 A;  4QU3 A;  1IFQ A;  3JPU A;  2I9V A;  5CGS A;  1DJC A;  1SHV A;  5EPH A;  4K08 A;  3BFG A;  2EXA A;  4HI4 A;  2C5W B;  1WYB A;  4EUZ A;  5HZH A;  4JGP A;  2PR6 A;  1CI8 A;  2LB9 A;  3T4O A;  3WS0 A;  1MWT A;  5CER A;  5K5B A;  1PIO A;  3VV4 A;  4EES A;  2QMI A;  2VLG A;  4DE1 A;  2VGL M;  4M4X A;  3R7W A;  5FI2 A;  4JF6 A;  2ZOI A;  2VJW A;  4IHQ A;  3QP5 A;  1C3B A;  3T4J A;  3BFF A;  5HDC A;  2VX8 A;  2WZX A;  1XJ2 A;  4EBN A;  2HZ5 A;  1TF1 A;  4R23 A;  3BEB A;  5EUA A;  3N7W A;  5EVI C;  2EX6 A;  4I3A A;  3QP4 A;  4GNU A;  3CPT B;  5FQI A;  5HD3 A;  4I3I A;  4OQH A;  5FQQ A;  3G2Z A;  4C75 A;  5E2H A;  2ZLY A;  1N9B A;  2EWW A;  3CUE A; 
#chains in the Genus database with same CATH homology
 3LR5 A;  4F3L B;  4NXG A;  4EET B;  1S1Y A;  2O9A A;  1NWZ A;  3MMH A;  2PDR A;  3CI6 A;  3LI9 A;  4P6Z M;  1T19 A;  2K2N A;  2O9C A;  3T4T A;  2P08 A;  3V67 A;  3UE6 A;  3F1P A;  3CAX A;  1OJG A;  2W3H A;  3KSI A;  3LR4 A;  2KLI A;  2P04 A;  4ARZ A;  1YAX A;  1Y28 A;  2YKH A;  4R3A A;  2B02 A;  3KYZ A;  2GZA A;  3HJI A;  5L8M A;  5KSH A;  3LIB A;  3PBN A;  2O0Y A;  2M7V A;  4CQH A;  3UB9 A;  1V9Z A;  2W1T B;  4DMZ A;  3C30 A;  3IBJ A;  3H82 A;  5J3W A;  2PYR A;  4MCW A;  4PKY G;  3CLO A;  5F5Y A;  3EQV A;  3A0V A;  1P9W A;  4BBT A;  4GJ4 A;  1WA9 A;  4G3W A;  1P97 A;  2WKQ A;  4UQI M;  1XJ4 A;  2D02 A;  3NJA A;  3F1N A;  1OPX A;  3PHY A;  3ZQ5 A;  4Y3I A;  1XJ3 A;  4HP9 A;  5A8B A;  4EW7 A;  1OTI A;  4NEE D;  4WUJ A;  1F98 A;  1S4R A;  2QJ5 A;  3PBR A;  3PBQ A;  1OTD A;  4JGQ A;  2O99 A;  3B42 A;  1S4S A;  4Y2F A;  3T4Q A;  3ULF A;  1IOU A;  2ZMF A;  3UMD A;  1OT6 A;  2W27 A;  1DP8 A;  1TD5 A;  4Q0J A;  3A0R A;  3CUE C;  3H7W A;  4NXB A;  2JKR M;  4AFI A;  1UGU A;  3KYQ A;  3NOT C;  4EQ1 A;  2KOI A;  2QKP A;  1T1A A;  3PBO A;  4EEP A;  4MN6 A;  1VHM A;  3C2W A;  2JKT I;  3LUQ A;  3RH8 B;  4B93 A;  3LIE A;  4MN7 A;  5HDS A;  4LRY C;  3KSF A;  3S7N A;  3EEA A;  4Z1W A;  3SW1 A;  4XT2 A;  2W3D A;  3LYX A;  3UB8 A;  3NHQ A;  2EA9 A;  2ZMV A;  2PT7 A;  1MZU A;  3OLO A;  4Y5F A;  4JGO A;  4GHI A;  1T18 A;  4G3V A;  3KX0 X;  2KDK A;  1LSV A;  4O0P A;  2O9B A;  5C5K A;  4LRX C;  1OT9 A;  3F1O A;  2Y8H A;  2W3F A;  3F1O B;  4WN5 A;  2HF6 A;  2OAQ 1;  1VB6 A;  2NUP C;  3ICY A;  2Z6D A;  1OTE A;  4HIA A;  1YSQ A;  3JVU A;  4CLC B;  2B18 A;  2VV7 A;  5CX7 A;  1OTB A;  3EOI A;  5AJG A;  1TS8 A;  1G28 A;  1STZ A;  3D3O A;  1DP9 A;  2OAP 1;  2J3W A;  4F3L A;  4LRZ E;  2PD7 A;  3P01 A;  4YNR A;  1NLY A;  2VKS A;  3C38 A;  3KO6 A;  4JGR A;  1S1Z A;  3A0S A;  1P0Z A;  2QHK A;  4LLO B;  4GW9 A;  3R4K A;  2LB5 A;  3GDI A;  4O8G A;  5DFX A;  2GX5 A;  4WEJ A;  5LBR A;  4WEL A;  4HJ6 A;  2IA2 A;  1F9I A;  5J4E A;  2Z6C A;  2VV8 A;  2W1T A;  4CLC E;  3K3C A;  3LID A;  4IUK A;  5HPI A;  2QYB A;  4L9G A;  1T1C A;  2Y79 A;  4H6J A;  1LSX A;  3T4K A;  3IS2 B;  4BBU A;  5HSQ A;  4H6J B;  2A2L A;  1LL8 A;  1UWP X;  1H3Q A;  1S67 L;  3LIC A;  3LR3 A;  4KUK A;  3B47 A;  3FPV A;  2VV6 A;  4EER A;  4IUH A;  5I5L A;  4HJ4 A;  5G4Z A;  1TS7 A;  1D06 A;  3BWL A;  1N9N A;  3MFX A;  1DP6 A;  3MR0 A;  3BW6 A;  1W63 Q;  3S7Q A;  1XFQ A;  3RFB A;  1TS0 A;  4I5S A;  5TBM B;  4HH3 A;  5F68 A;  2HJ9 C;  5HWW A;  5FL3 A;  4GS9 B;  3VE3 A;  1UWN X;  4O01 A;  2GNX A;  2G7U A;  3MF0 A;  3LIA A;  4PHT A;  4PAU A;  4EU0 A;  4GLQ A;  3TE8 A;  5IS1 A;  3MJQ A;  4MMN A;  5F69 A;  5AVF A;  2V1B A;  3C8C A;  2P7J A;  2ZOH A;  2PD8 A;  3LIF A;  5DFY A;  2HJE A;  2QWS A;  4R6L A;  3H9W A;  2QJ7 A;  1ZHH B;  1X0O A;  4R38 A;  4WLA A;  4BWI A;  1P9R A;  3PBS A;  4R70 A;  2EWV A;  2VEA A;  2WKR A;  3VOL A;  3G6O A;  3UE3 A;  2NUT C;  4I39 A;  4OOM A;  2D01 A;  4HJ3 A;  3ZYT A;  3JVV A;  2FZ0 A;  1W63 M;  3IBR A;  1LSW A;  3VE4 A;  3E98 A;  4Q0H A;  4KQO A;  4BJP A;  1BYW A;  2M1C A;  3R7W B;  1GSV A;  2K7S A;  3U2A A;  4IJG A;  3MQQ A;  4PKY A;  3T4S A;  3LFV A;  3D72 A;  5DKL A;  3E0Y A;  5DJT A;  5IU1 A;  3W2Z A;  3PR6 A;  4Q0I A;  2XA7 S;  3FG8 A;  4NXF A;  2W0N A;  4CLC A;  4DJ3 A;  2W3E A;  5TJJ A;  2V1A A;  4DN0 A;  2J3T C;  3GEC A;  3CWF A;  1D7E A;  3HCY A;  2BAS A;  2JHE A;  3MXQ A;  5G4Y A;  5AVE A;  3KSH A;  3LI8 A;  1OJ5 A;  5F6A A;  1LT0 A;  3EQU A;  3S7O A;  3TJZ C;  4ZRR A;  3EEH A;  1N9O A;  3CIT A;  5HD5 A;  2INW A;  2XRN A;  3T4L A;  4HQA A;  1KOU A;  3OC2 A;  3E4P A;  1GSX A;  1H8M A;  3MQ0 A;  1EW0 A;  4QPR A;  4OOL A;  3BY9 A;  5DKK A;  4B9O A;  2JKR I;  2VA0 A;  3E4O A;  3K3D A;  3UME A;  2OWH A;  4NKP A;  1NLZ A;  2A24 B;  2JKT M;  2VGL S;  2GJ3 A;  4HHD A;  1ZTU A;  3BQA A;  3E4Q A;  5HL6 A;  4YWZ A;  4YOF A;  1N9L A;  2CMN A;  4WEK A;  4ETX A;  4WF0 A;  2PYP A;  3TW8 A;  2L4R A;  3UB6 A;  3F1P B;  3IS2 A;  2XSS A;  1MKM A;  4L9F A;  2VZW A;  2KX6 A;  4ARZ B;  5DJU A;  3BQ8 A;  2M7U A;  4KUO A;  4HOI A;  2HGV A;  1F5M A;  4HH2 A;  4EEU A;  4MDZ A;  3EGD C;  2JN7 A;  3OBF A;  2YKF A;  4ETZ A;  2MJ6 A;  2FH5 A;  2L1M A;  4HP4 A;  1DRM A;  3H82 B;  4KQD A;  4NXE A;  3EWK A;  5TBM A;  1GSW A;  4HY8 A;  2ZBB A;  4CLC C;  3KSG A;  3NOU C;  4E04 A;  3DBA A;  4GS9 A;  3MQO A;  5KIZ A;  1V9Y A;  3PBT A;  2J3T D;  3S7P A;  2XA7 M;  3OCL A;  1MC0 A;  3FPW A;  4G3K A;  4BMW A;  3F1N B;  3B33 A;  1ODV A;  1IFQ A;  4MN5 A;  3HJK A;  5HPF A;  2I9V A;  4LPZ A;  4ME4 A;  2V9A A;  4I3J A;  3K2N A;  3FC7 A;  4UEY A;  4K08 A;  4WL9 A;  1JNU A;  4P6Z S;  4HI4 A;  1G6O A;  4HNB A;  3UB7 A;  5MC7 A;  4L0L A;  2OWJ A;  5HZH A;  3H7W B;  1T1B A;  4JGP A;  2PR6 A;  2LB9 A;  3TRC A;  2WKP A;  4GCZ A;  4I38 A;  3T4O A;  3O5Y A;  2V0U A;  5K5B A;  1S66 L;  3RTY A;  3VV4 A;  4EES A;  2DMW A;  2VLG A;  2VGL M;  4M4X A;  3R7W A;  2ZOI A;  2VJW A;  1NRJ A;  3P7N A;  4IHQ A;  4II7 A;  4DJ2 A;  3PXP A;  1XJ6 A;  3T4J A;  5EFW A;  3NOP C;  4XT2 B;  1XFN A;  2PR5 A;  4UQI S;  3OOV A;  5HDC A;  2V0W A;  2VX8 A;  2L0W A;  1XJ2 A;  5DF9 A;  1TF1 A;  1TS6 A;  5HDD A;  1YSP A;  5HWV A;  4GHI B;  4EXO A;  5J7E A;  1YKD A;  2W3G A;  4FOF A;  3BJN A;  1OTA A;  2K31 A;  2PHY A;  3LR0 A;  4FSF A;  4I3A A;  4RQ9 A;  3OCN A;  4BBV A;  2R78 A;  4CLC D;  2XRO A;  5HD3 A;  2H28 A;  2W1R A;  3PYP A;  4I3I A;  4EUV A;  5IT5 A;  5HWT A;  2HV1 A;  2J80 A;  3BY8 A;  4L9E A;  3EGX C;  3CUE A;  2EWW A;  3T50 A;  2OOL A;  2A24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...