5HDSA

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 3 ps structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hdsA00
3CWFA 2QJ5A 2L0WA 3F1NA 4GW9A 5DJTA 3IS2B 5F5YA 4I5SA 4RQ9A 4K08A 4JGOA 4JGPA 2ZOHA 2GJ3A 2Z6CA 3LI9A 2INWA 2BASA 3PHYA 5F69A 2WKRA 1GSXA 2A24B 1S4SA 1KOUA 4WUJA 4HQAA 3SW1A 1D7EA 1OTAA 3UMDA 4PKYG 4EESA 3A0VA 3H7WB 3UB9A 2PD8A 3NOTC 4JGRA 3E4PA 2H28A 4HIAA 2W0NA 2PR6A 4XT2B 5DKKA 2KX6A 4MN6A 2PDRA 3LIEA 4DJ2A 4EXOA 5HDSA 3BWLA 4I3JA 3UB7A 4DJ3A 3F1NB 3NJAA 1V9ZA 3E4QA 3FC7A 1TS0A 4NXEA 3VE4A 3ZQ5A 5J7EA 1WA9A 4HY8A 1V9YA 4WL9A 1G28A 1N9OA 4YWZA 2ZOIA 1TS6A 1EW0A 4HNBA 4LRZE 3EEHA 3VE3A 1LL8A 2HV1A 4WF0A 4I38A 1GSWA 2KDKA 2ZBBA 3BY8A 3F1OA 2V1BA 2D01A 4GCZA 1LSXA 4NXGA 3NOUC 5HWTA 4EEPA 4PKYA 2V9AA 4EETB 3RTYA 3H82A 1T1AA 3LYXA 2JHEA 5TBMA 3F1PA 2K7SA 4WLAA 2PD7A 5AVEA 5HD3A 5HDCA 4L9EA 4L9FA 1XFQA 1S1YA 3UB8A 5KIZA 4GS9A 3GDIA 3G6OA 1OJGA 1F9IA 3UE6A 2OOLA 1BYWA 4KUKA 3VOLA 3MR0A 2PYRA 3C8CA 5G4ZA 1XJ2A 2W27A 1OJ5A 3LIFA 3MFXA 1NWZA 5IU1A 4HJ3A 1N9NA 4LLOB 5HWVA 1Y28A 4HI4A 2L1MA 2V1AA 2JN7A 3F1OB 1P97A 5A8BA 5I5LA 1D06A 2QWSA 4I39A 2R78A 1XJ4A 2V0WA 3H82B 4LPZA 3LIBA 5G4YA 4LRYC 5TBMB 1LT0A 3F1PB 2B02A 1P0ZA 5F6AA 1T1BA 4F3LA 4I3AA 4BBVA 2Z6DA 4GHIA 5EFWA 5F68A 3HJKA 2D02A 4GS9B 1GSVA 1TS7A 4BBUA 1VB6A 4HJ6A 4B9OA 3GECA 4HJ4A 2YKHA 3KX0X 5IS1A 3D72A 5HZHA 1S67L 3LUQA 4JGQA 1T1CA 4EERA 3C2WA 3UMEA 5J4EA 5DJUA 1OTIA 3K3CA 4NXBA 1XFNA 2QKPA 4WN5A 2WKQA 5HWWA 3B33A 4R3AA 3LI8A 3HJIA 2YKFA 1T18A 3CAXA 1XJ6A 3BY9A 4HP4A 1OTEA 1OT9A 3FG8A 2VEAA 3MJQA 4F3LB 4EEUA 3A0RA 1F98A 4GHIB 3LIDA 2EA9A 1XJ3A 2V0UA 5DKLA 2VV6A 4E04A 3P7NA 4H6JB 2QHKA 2L4RA 4R70A 1MZUA 2WKPA 2PR5A 1S4RA 4L9GA 1N9LA 3CLOA 1DP9A 5J3WA 5HSQA 2CMNA 3LIAA 1DP8A 3NHQA 4HHDA 1T19A 3EWKA 1DRMA 3ULFA 3IS2A 1OTDA 1TS8A 4EW7A 1LSVA 1ODVA 4LRXC 4NXFA 3PYPA 1OT6A 4H6JA 1UWNX 1S66L 1LSWA 1UGUA 2VLGA 4KUOA 2A24A 2I9VA 1S1ZA 3IBRA 2M1CA 3ICYA 4BBTA 4HP9A 4M4XA 4I3IA 3MQQA 2QJ7A 3H9WA 2PHYA 3E4OA 3MXQA 3RH8B 3UB6A 2OWHA 2VV7A 2VV8A 1X0OA 3H7WA 4EQ1A 4HH2A 3K3DA 5HD5A 3A0SA 4HH3A 5HDDA 1DP6A 4XT2A 4MN5A 3LICA 3MQOA 1JNUA 4R38A 4KQDA 3NOPC 2PYPA 5AVFA 3OLOA 1OTBA 1UWPX 2OWJA 2J80A 2P7JA 4HOIA 4R6LA 3T50A
chains in the Genus database with same CATH superfamily
3CWFA 3IS2B 1ZHHB 4I5SA 5FAPA 5DF8A 2HDUA 3MBZA 3FYZA 1S6RA 4ZJ2A 2Y79A 4PPRA 1E3UA 1OMEA 2BASA 3UY6A 2LB9A 3VP4A 2WK0A 1N9BA 1S4SA 1FQGA 1SHVA 1D7EA 1L0EA 1TVFA 1VEUA 3BEBA 4PKYG 2P9VB 4EESA 3HLBA 1W63Q 5CGWA 2JC7A 2P74A 5DFXA 3UDIA 4JBFA 3E4PA 2H28A 4KZ3A 4HIAA 1L3LA 2PR6A 1QMEA 3DTIA 3IXBA 3ZNYA 2PRFA 2NUTC 3IXDA 5DKKA 5M18A 3NC8A 2VGLM 2XD1A 4JXSA 4N92A 1JWVA 3IX4A 5AJGA 2V2FF 5F1FA 5HDSA 4I3JA 4DJ3A 3FV7A 1H8ZA 3N8RA 1TS0A 4NXEA 2HF6A 2WGWA 5J7EA 2H10A 2ZC5B 1V9YA 4YWZA 4K0XA 1Y54A 2JBFA 4JXVA 1A0KA 1G6OA 1TS6A 4GDBA 4IVIA 4WELA 1ES4A 3OCNA 3QP1A 1K4FA 2G7UA 3MKFA 2HV1A 1LI9A 1K54C 1BZAA 2ZBBA 2EFXA 1BLPA 5EM1A 5KSCA 3PR6A 3G32A 3WS5A 4Y7PA 3GV9A 5EECA 1Q2PA 4LV0A 1LSXA 3BQ8A 3NOUC 4GN2A 4EEPA 3EOIA 4E3IA 1G6AA 1T1AA 3LYXA 5TGFA 5CEBA 3BYDA 4WLAA 3WRTA 4PM9A 5E2FA 1S1YA 1OJGA 4KUKA 1C3BA 4KG5A 1KDWA 3MR0A 2PYRA 3PBRA 3GSGA 1XX2A 2Y4AA 1OJ5A 3Q7VA 1JWPA 3KYQA 2Y2LA 1NWZA 3WRZA 1NXYA 5CHJA 3DAVA 1N9NA 3HLWA 5HWVA 2HDQA 2J3WA 4GJ4A 4BL3A 3N8LA 3QP6A 2OAQ1 2JN7A 4P6ZS 4CLCA 3PAGA 5M19A 1P97A 2PBYA 5L10A 3S7QA 2Z2LB 2DMWA 4X1LA 2ZM2A 3VOZA 1P0ZA 1PFLA 1TDGA 3UNWA 1HVBA 4DE2A 5EFWA 3LR0A 3NULA 4GS9B 3SS3A 2HDRA 4B9OA 1RGYA 4X69A 4C6YA 2YKHA 5IS1A 4XXRA 1NYMA 1XGIA 1I5QA 4EV4A 3PBQA 2A3UA 4II7A 4P0MA 4QY5A 1XFNA 1LL5A 3VSLA 2RCXA 3QP8A 3C7VA 3T1XA 4D60A 3PBNA 5F82A 3UDFA 4UQIM 1Z6FA 2HP9A 3LI8A 5AQ9A 3EQUA 2YKFA 2ZQ9A 2B95A 3CAXA 2WGIA 2GX5A 3TG9A 5JYPA 2Q9NA 3M6HA 4HP4A 2GNXA 3VFFA 1F5MA 4JF4A 2VEAA 1EROA 4F3LB 5FA7A 3LIDA 4ARZB 2J9PA 5KMWA 1ESUA 3OC2A 1MKMA 3CHWP 4E04A 4PMAA 1PWGA 5A91A 1QMFA 3U4LP 3VOYA 2HZ5A 4H6JB 1KE3A 2GDNA 4MBHA 4EBNA 4FCFA 2EX8A 2UWXA 3Q1FA 4OQGA 5CHMA 5FQIA 5FEFA 1Z09A 2JKTM 4RA7A 2WKPA 2Y2PA 2J7VA 2LB5A 2JKTI 1PNEA 4S2JA 1N9LA 1LI0A 5CGXA 1K54A 1DP9A 1MBLA 5FAQA 3JYIA 2VK3A 3NECA 1IOUA 1YLPA 4X56A 2XROA 1K4EA 3P09A 2Q0OA 1T19A 3EWKA 1FIKA 2R9XA 1DRMA 5CEDA 5DTKA 3RXXA 1D1JA 3UB5P 1VETA 3BFEA 1OTDA 5E2HA 1N4OA 1LSVA 1NYYA 4MDZA 4E3LA 2W3HA 2AVXA 3HLFA 5JYOA 3C4OA 1Y4OA 2Y2MA 4KUOA 5FAOA 2I9VA 3NBLA 4S2NC 1H3QA 2ZJ9A 4IUHA 5CGSA 4HP9A 3H9WA 3IWOA 3MXQA 4Q0JA 3TRCA 4LFUA 4KQOA 2VV8A 1X0OA 3H7WA 4R3BA 3WS0A 3L7HA 2E8IA 5HD5A 5AQBA 2BTFP 3IQAA 4HH3A 1BSGA 1ZKJA 4MN5A 3O5YA 1MWSA 1JNUA 4G3KA 3IF5A 4UHUA 2K2NA 2PYPA 5AVFA 4Y2FA 1YPRA 4PM6A 4KG2A 2OWJA 4Q0HA 1K57C 3E0YA 4HOIA 3VP0A 3T50A 1PWDA 5DJTA 1MPLA 4DDYA 3OPLA 3CUEC 1BULA 3IH8A 3NDGA 4M3KA 5EPHA 3LGOA 2Z6CA 3LI9A 5DVAA 2Y55A 1JTDA 4CJNA 1IFQA 5EVIB 1W8QA 2WKRA 2WGVA 1K56A 3IX3A 1KOUA 3IF6A 4RX3A 1YLWA 1OTAA 3UMDA 5HPFA 3E2KA 3D9YA 2R9WA 2VGKA 2WAEA 3A0VA 3OBFA 1CI8A 1TD5A 3LEQA 4B4XA 3ZFZA 3CG5A 3NOTC 4IVKA 5IHVA 5FEGA 4R4SA 2ZQCA 1L2SA 1RCJA 3IXGA 1W63M 2IWBA 2Y2OA 2WKHA 1MXOA 3SOIA 1P9WA 4NEED 4KZ5A 3IWIA 2XA7S 3KSFA 3OZHA 4GDNA 3T1QB 4MNRA 4Z1WA 3BWLA 1S0WA 4HESA 4Q8IA 5CRFA 3F1NB 4OPZA 3FC7A 2Z2MB 2ZC6B 4FUWA 4Y15A 3C30A 3ZQ5A 2XFTA 1WA9A 3WS2A 1SDEA 2FFFB 1GHMA 2OAP1 5GLAA 4WYYA 1IELA 1N9OA 1PI4A 2EX9A 4BD1A 4OKPA 4LRZE 3HLEA 4P6BA 4KZ8A 1KVMA 5EUAA 4ZAMA 3HUOA 1LL8A 5FQJA 4O0PA 4WF0A 2JCHA 3HUMA 4RVAA 2ZQAA 2BLSA 2KDKA 3LO7A 4ZRRA 4DKIA 1JVJA 3TSGA 1E4DA 4GCZA 3ZHHA 3GR2A 4S2KA 3NIAA 4PKYA 2WUQA 3H82A 2P08A 2ZD8A 4NK3A 1YSPA 3B47A 3BECA 4YFMA 2Y2NA 3F1PA 4YINA 1YMXA 2PD7A 1YSQA 3GMWA 5HDCA 3QNBA 4KENB 4L9EA 3VSKA 3LR4A 2VZWA 1P9RA 3UB8A 1KGFA 3P98A 2ZQ8A 3ZNTA 2OOLA 1MWRA 3KYZA 2EX6A 4E3JA 2Y8HA 3C8CA 4F94A 2W1TB 5F83A 2W1RA 5LBRA 4WBGA 1IYPA 5IU1A 4E6WA 2HP5A 5A90A 3G31A 2PBDP 1Y28A 1O07A 4HI4A 4CLCE 3QP4A 2HP6A 3NI9A 5HAIA 3F1OB 1ZG4A 1XA1A 4E6XA 2ZM0A 5A8BA 4ME4A 5I5LA 4Y17A 1YLJA 2QWSA 3T4OA 2R78A 4KZAA 4LENA 4WMCD 4LPZA 4QD4A 1YAXA 3IBJA 2XEPA 5CXWA 2Y2QA 5M1AA 5TBMB 5HL6A 4ETXA 1LT0A 3DWKA 2OLVA 4I3AA 4IHQA 3MKEA 5CERA 3W4OA 3EGXC 4EUVA 3RFBA 3AGDA 5DF9A 3CPTA 4DF6A 1GSVA 3HVFA 3GRJA 1CJFA 1JWZA 4HJ4A 2HGVA 3D72A 5HZHA 4UAAA 3K2NA 3WS4A 1GA0A 2M7UA 5C5KA 3W4QA 3C2WA 3UMEA 4NXBA 5GLCA 3UPNA 5EV0A 2QKPA 4WN5A 2WKQA 4LV2A 1XP4A 3B33A 2X02A 3G4PA 4S2MA 1NZOA 5F1GA 3T4TA 5TJJA 4N1XA 4JLFA 5KZHA 2W3FA 4QU3A 3MS6A 5J8XA 4GB7A 1OTEA 3FWLA 4C3QA 3FG8A 2QPNA 4EEUA 4IBXA 3W4PA 4X55A 4GHIB 2XQZA 3LR3A 1FOFA 1HTZA 1GHIA 2VV6A 5FI6A 3N8SA 5FI7A 1VHMA 3V3SA 4MN7A 4XUXA 5TR7A 2J9OA 2WADA 3ZGAB 2QHKA 4MBFA 5AQAA 5EVID 4YNRA 3ZG7B 4DN0A 2ZMAA 4Y0TA 4R0QA 4R70A 3UPOA 3JVVA 4FTXA 4Y0UA 5DFYA 1FR6A 1ONGA 1S4RA 3ZG0A 3C7UA 4OONA 1ERQA 2HDSA 4PM8A 4BD0A 4EU0A 3HLGA 2C5WB 1ES5A 3Q07A 2QMIA 4OOMA 1PIOA 3NHQA 4JXGA 2EWVA 3ZDJA 3CI6A 4P6ZM 2WZXA 1H8YA 1GCEA 3OPPA 3Q7ZA 1SZVA 5A93A 3IS2A 2W3DA 3AGEA 1L0FA 3UO9A 1TS8A 2G2UA 2Q9MA 3KSGA 4EW7A 1ODVA 4Q0IA 4LRXC 4FH2A 4NXFA 3PYPA 4E3MA 1OT6A 1WYCA 1S66L 1LSWA 1UGUA 1LL9A 4KQQA 4WZ5C 1CQAA 3ICYA 3T4LA 1FSWA 4LV3A 3T1RA 2ZMVA 1SKOB 2QJ7A 4I3IA 4X68A 5FASA 3MZDA 2PHYA 4S2OA 5KSHA 2UV0E 3FKWA 2C6WB 4IBRA 4LGWA 1YQSA 4EQ1A 4FD8A 4KG6A 3K3DA 2NUPC 3BQAA 2EXAA 4CPKA 1LLBA 3AGFA 4MBKA 5HDDA 1DP6A 3VP1A 4Y3IA 5FQKA 4O7DA 5EM0A 1HLUP 5FDSA 1YMSA 1YLZA 3VP3A 2P7JA 2V1ZA 5E2EA 2QJ5A 3S7OA 3R7WB 3HREA 5F5YA 4BENA 2OLUA 3PXPA 3BLMA 1G68A 2B5RA 4K08A 4JGOA 4JGPA 2XLNA 2DNSA 2X01A 2VKSA 3PHYA 4WEKA 2A24B 4QJGA 4WUJA 3LY4A 3PAEA 4HQAA 3M2JA 4EQIA 4U3TA 3SW1A 1Q2QA 4CQHA 1ACFA 4ZBEA 2PU2A 2PD8A 3GQZA 1BUEA 1SKFA 4GLQA 3EGDC 3RJUA 3O87A 4BQMA 4XT2B 5GL9A 3CITA 3T12B 5TFQA 4OOYA 1FR1A 2KX6A 2ZL1B 1PZOA 3ZG8B 2KOIA 3IXHA 2PDRA 4MN6A 4O8GA 1GHPA 2BG1A 3BFDA 4DJ2A 1STZA 3UE1A 1YLYA 3UB7A 5U47A 2WKEA 3NJAA 2P04A 3NY4A 1V9ZA 2QZ6A 5GHZA 3UE3A 4KZ6A 2WAFA 3T4KA 1G28A 3KSIA 1PI5A 4WM9A 1NJ4A 2ZLYA 4PAUA 2XDMA 1ALQA 2FZ0A 4EUZA 1ZG6A 4DXBA 1EW0A 4HNBA 3BRMA 2I72A 3VE3A 4IEDA 2JKFA 1XKZA 3LCEA 4OQHA 2EX2A 2WYXA 1VEUB 4OOLA 3N4IA 3BY8A 4GD8A 4ZJ3A 4K91A 2V1BA 2D01A 2Y2KA 5G18A 4NXGA 5HW3A 4BL2A 5HWTA 2O0YA 5FQMA 4OP5A 2EFUA 4E3OA 4EETB 3RTYA 4QWOA 2X71A 1YLTA 3T1SA 1PW8A 5I94A 2JHEA 2PT7A 1AWIA 3FZCA 2K7SA 3MXSA 2OSUA 5AVEA 5HD3A 5EVIC 2IWCA 2WGWB 3LFVA 3T4QA 5L2FA 2VA0A 1DJAA 5A92A 4GS9A 3HUNA 5KIZA 3GDIA 1F9IA 2ZM8A 3UE6A 1BYWA 3G2ZA 5G4ZA 4ZTKA 4ESPA 4GOGA 3EQVA 4JPMA 3LIFA 3D3OA 3MFDA 2KLIA 3M2KA 3MF0A 1TF1A 2Y2IA 4KZBA 5IT5A 2L1MA 2V1AA 2FFYA 4P87A 2B18A 3QHYA 4WZ5A 3WS1A 3ZVTA 5CTNA 3VFHA 1D06A 1KGGA 3W8KA 4ZDXA 3DWZA 4I39A 3Q81A 2K31A 3IX8A 3TW8A 3LIBA 4LRYC 4Z9QA 4LCLA 4JXWA 3ZG5A 2B02A 5E2GA 1PRQA 1T1BA 4F3LA 4BBVA 2JKRM 5F68A 2Y2GA 3HJKA 1W7FA 2D02A 4S2LA 1TS7A 3DW0A 1VB6A 2JKRI 4HJ6A 3GECA 3S7PA 3V39A 2XA7M 3KX0X 4AFIA 4BMWA 5MC7A 1M40A 3LUQA 3NCKA 4DE0A 2Y59A 3Q7VB 4JGQA 4MEZA 3OPHA 1T1CA 3A3IA 4JKTA 4CLCC 1KDSA 3TJZC 3K3CA 3G35A 5DTTA 4DXCA 4ETZA 1CF0A 3V3RA 4CLCB 3BM6A 2MJ6A 5HWWA 4WZ4A 2JKGA 5D3OA 4JF5A 4DRTA 3MXRA 4BLMA 4OH0A 4WMCA 3A3DA 2OV5A 3BFGA 3A3FA 1NRJA 4G3VA 1XJ6A 2ZC4B 1ZC2A 2G2WA 2DCFA 1OT9A 2ACGA 5HL1A 3S1YA 3ZG9B 1RP5A 4MCWA 3MJQA 4N1HA 5E43A 1IKIA 3A0RA 1MY8A 2EA9A 3S7NA 1VQQA 1W79A 2XD5A 4XUZA 3CMZA 3UPPA 2WKIA 2W3EA 3P7NA 3D4FA 1K55C 3TE8A 3C4PA 3SZTA 2VGLS 3KSHA 4QHCA 3S4XA 1H5XA 5GHXA 4S2NA 3V50A 3Q82A 3DBAA 1BLCA 2V8FA 1KGEA 2XF3A 3V67A 2WZZA 3P01A 4H8RA 2PR5A 5FQ9A 1J3WA 4U0TA 4UEYA 4L0LA 1WYBA 4KZ4A 5EOEA 3C38A 5J3WA 5HSQA 1FCOA 4B93A 5HAQA 4FH4A 4DMZA 2E8JA 3BFFA 3V5MA 2IA2A 3EEAA 1K57A 4MLLA 4BJPA 3HL9A 3W2ZA 4OQ0A 1RGZA 2XH9A 1LHYA 1K38A 1UWNX 3CUEA 5EVIA 4QB8A 5L09A 2J3TC 1E3UD 2H5SA 3CJMA 4GD6A 4BBTA 3G34A 3E98A 3MQQA 4OVDA 3RH8B 1OPXA 2XR0A 1NLYA 4X53A 2XK1A 2OWHA 3NDEA 1K25A 4HH2A 3VP2A 1MWUA 2O9BA 5FL3A 4PM7A 3A0SA 4FSFA 1NRFA 1FCNA 3SH7A 3LICA 3T4JA 3MQOA 4R38A 4KQDA 3NOPC 3LR5A 2ZQ7A 2XRNA 3ZYTA 1OTBA 4HBUA 3UN7A 2J80A 1XXMA 4R1GA 4YOFA 4Y13A 3FKVA 4U0XA 3F1NA 2L0WA 4NKPA 4GW9A 4KQRA 4S2PA 1MC0A 3OCLA 4R23A 1O7EA 1ES3A 1VETB 1MWTA 2HJ9C 3RXWA 5EOOA 3JVUA 4RQ9A 3GTCA 2ZOHA 2GJ3A 2INWA 5FDHA 2A2LA 2W3GA 5F69A 5HARA 2DRWA 1GSXA 2V8CA 3G2YA 4PHTA 5BOHA 3B3XA 4NG2A 2HPBA 2IWDA 1DJBA 4Y5FA 3PBSA 1BLHA 3TOIA 3ZVWA 3H7WB 4DE3A 4OPQA 1E25A 1L0DA 4KZ9A 3UB9A 2H0TA 4JGRA 4FOFA 1XA7A 2W0NA 1I2SA 4EBLA 5EVLA 2M7VA 3LIEA 5K5BA 4EXOA 1M6KA 1VM1A 3JPUA 4OLGA 2XFSA 2Y2JA 3L9KA 2ZQDA 2XSSA 3E4QA 4IJGA 3O3VA 4ID4A 3HLCA 4R4RA 3VE4A 1HD8A 5HAPA 4HY8A 3OPRA 4C75A 2V20A 3IF6C 4WL9A 1SCWA 2O9AA 3PBTA 5HX9A 2ZOIA 4UQIS 4QY6A 2JE5A 2W1TA 3ITBA 2EWWA 3IF6B 4JF6A 3EEHA 3DTKA 2ZMFA 2P9VA 1TDLA 4I38A 1WE4A 1GSWA 1ERMA 3BLSA 4OP8A 5GHYA 3M6BA 4NETA 3FPWA 2QYBA 1K55A 2VX8A 3F1OA 4Y0OA 2Y91A 3ITAA 1BTLA 4E3NA 4CLCD 2H0YA 1NLZA 1K6RA 3VMAA 2V9AA 3N7WA 4MMNA 4OQIA 5DTSA 3BFCA 5CHUA 2FH5A 4IUKA 1PW1A 5TBMA 1CK3A 3FPVA 2PU4A 3MMHA 4L9FA 1XFQA 4E3KA 3IT9A 3O86A 4N9LA 1SDNA 3G6OA 2J8YA 5CECA 4OPRA 2A49A 4B88A 3U2AA 1G5UA 4P85A 3VOLA 3OOVA 4RX2A 1FILA 1XJ2A 3LY3A 1DJCA 2W27A 3PBOA 3MFXA 3DTMA 4HJ3A 1IEMA 5L07A 4LLOB 2CC1A 2XGNA 3E2LA 5FATA 1IYSA 3BJNA 3O88A 1KE0A 3PTEA 1ONHA 1BLSA 4QPRA 1XJ4A 2V0WA 1YM1A 3QNCA 3IHBA 3H82B 3MQ0A 5G4YA 5FQQA 1ZTUA 3F1PB 5F6AA 3WWXA 1U60A 4N9KA 4S2IA 5DF7A 3HLDA 2Z6DA 4GHIA 4BWIA 3HCYA 4WEJA 5CX7A 4PM5A 5FSRA 4G3WA 4DE1A 3KO6A 4BBUA 4D2OA 1ES2A 1S67L 4UA6A 4X1MA 4EERA 5J4EA 5DJUA 1OTIA 1FSYA 5EE8A 1CI9A 1EWZA 1IKGA 2J3TD 2O9CA 1PYYA 3A3JA 4R3AA 3GVBA 3HJIA 1YKDA 5AQ7A 4ZJ1A 3SS5A 2VGJA 3N6IA 1T18A 2O99A 2RL3A 3BY9A 3A3EA 3QP2A 4DDSA 5HFOA 1CEGA 5EVEA 1JTGA 4K0WA 3LEZA 3IHAA 2EXBA 1J9MA 1MKIA 2VJWA 3ZCZA 1F98A 2ZC3B 1F2KA 1IYQA 3CPTB 1XJ3A 2V0UA 5DKLA 2GZAA 3B42A 4O01A 1H8MA 3BW6A 4LV1A 1ESIA 4HBTA 3KYEA 1XGJA 4GZBA 5L8MA 2PAVP 1SKOA 4GNUA 1NY0A 4EWFA 2HJEA 4EBPA 2L4RA 3SH9A 4LCMA 3MZEA 1MZUA 5FI2A 3VV4A 1FCMA 1W8YA 4UA9A 4L9GA 4X25A 3T4SA 3C5AA 1XPBA 3CLOA 1PWCA 4R3JA 3IWQA 3MSHA 2CMNA 4HEFA 1KVLA 3LIAA 1TEMA 1I2WA 2ZC7A 1DP8A 4HHDA 3SS4A 4A5RA 4ARZA 1W5DA 3ULFA 1NZUA 3R7WA 2Y2HA 5GLBA 4B4ZA 1H0MA 1GA9A 5HPIA 3QP5A 1HZOA 4H6JA 3DTEA 2VLGA 1CEFA 2A24A 1S1ZA 1K6SA 3IBRA 2M1CA 4M4XA 4X6TA 1K56D 1EI5A 1L0GA 3E4OA 3HBRA 5GLDA 3UB6A 2VV7A 1BT5A 1K0KA 1AXBA 1KE4A 1YT4A 5CTMA 4UA7A 3CZDA 3R4KA 4KZ7A 4OPYA 3UDXA 3G30A 4OLDA 4XT2A 3ISGA 2ZL1A 3S22A 3OLOA 1PZPA 3I7JA 1UWPX 3SH8A 1DY6A 3UE0A 1IYOA 4GKUA 3IH9A 3MZFA 4R6LA 4RYEA
chains in the Genus database with same CATH topology
3CWFA 2QJ5A 2L0WA 3F1NA 4GW9A 4NKPA 5DJTA 3S7OA 1MC0A 3OCLA 3IS2B 3R7WB 1ZHHB 5F5YA 4I5SA 3CUEC 2HJ9C 3PXPA 3JVUA 4RQ9A 4K08A 4JGOA 4JGPA 2ZOHA 2GJ3A 2Z6CA 3LI9A 2Y79A 2INWA 2VKSA 2BASA 1IFQA 2A2LA 2W3GA 3PHYA 5F69A 2LB9A 4WEKA 2WKRA 1GSXA 2A24B 1S4SA 4PHTA 1KOUA 4WUJA 4HQAA 3SW1A 1D7EA 1OTAA 3UMDA 4Y5FA 5HPFA 4PKYG 3PBSA 4CQHA 4EESA 3A0VA 3OBFA 1W63Q 1TD5A 3H7WB 3UB9A 2PD8A 5DFXA 3NOTC 4FOFA 4JGRA 3E4PA 2H28A 4GLQA 3EGDC 4HIAA 2W0NA 2PR6A 4XT2B 1W63M 3CITA 1P9WA 2NUTC 5DKKA 2KX6A 2VGLM 2M7VA 2KOIA 4MN6A 2PDRA 4O8GA 4NEED 3LIEA 5K5BA 4DJ2A 4EXOA 2XA7S 3KSFA 1STZA 5AJGA 4Z1WA 5HDSA 3BWLA 4I3JA 3UB7A 4DJ3A 3F1NB 3NJAA 2P04A 1V9ZA 2XSSA 3E4QA 3FC7A 4IJGA 3UE3A 1TS0A 4NXEA 3VE4A 3C30A 2HF6A 3ZQ5A 5J7EA 1WA9A 4HY8A 1V9YA 2OAP1 4WL9A 3T4KA 1G28A 1N9OA 3KSIA 2O9AA 4YWZA 3PBTA 4PAUA 2ZOIA 4UQIS 2FZ0A 1G6OA 1EW0A 1TS6A 2W1TA 4HNBA 4LRZE 4WELA 2EWWA 3OCNA 3EEHA 3VE3A 2ZMFA 2G7UA 1LL8A 2HV1A 4O0PA 4WF0A 4I38A 1GSWA 4OOLA 2KDKA 2ZBBA 3FPWA 3BY8A 4ZRRA 3PR6A 2QYBA 2VX8A 3F1OA 2V1BA 2D01A 4GCZA 1LSXA 4NXGA 3BQ8A 4CLCD 3NOUC 5HWTA 4EEPA 1NLZA 2O0YA 4PKYA 3EOIA 2V9AA 4EETB 3RTYA 4MMNA 3H82A 1T1AA 2P08A 1YSPA 3B47A 3LYXA 2JHEA 2FH5A 2PT7A 4IUKA 5TBMA 3F1PA 2K7SA 4WLAA 2PD7A 1YSQA 5AVEA 3FPVA 5HD3A 5HDCA 4L9EA 3MMHA 4L9FA 3LR4A 1XFQA 3LFVA 2VZWA 1S1YA 3T4QA 1P9RA 2VA0A 3UB8A 5KIZA 4GS9A 3GDIA 3G6OA 1OJGA 1F9IA 3UE6A 2OOLA 1BYWA 3U2AA 3KYZA 4KUKA 3VOLA 3MR0A 3OOVA 2Y8HA 2PYRA 3PBRA 3C8CA 5G4ZA 1XJ2A 2W1TB 3EQVA 2W1RA 2W27A 1OJ5A 5LBRA 3LIFA 3PBOA 3D3OA 3KYQA 3MFXA 1NWZA 5IU1A 2KLIA 4HJ3A 3MF0A 1N9NA 4LLOB 1TF1A 5HWVA 2J3WA 4GJ4A 1Y28A 4HI4A 4CLCE 5IT5A 3BJNA 2L1MA 2V1AA 2OAQ1 2JN7A 3F1OB 4P6ZS 4CLCA 2B18A 1P97A 5A8BA 4ME4A 5I5LA 1D06A 3S7QA 2QWSA 3T4OA 4I39A 2R78A 4QPRA 1XJ4A 2V0WA 2K31A 3H82B 4LPZA 2DMWA 3TW8A 3LIBA 1YAXA 3MQ0A 5G4YA 4LRYC 3IBJA 5TBMB 5HL6A 1ZTUA 1LT0A 4ETXA 3F1PB 2B02A 1P0ZA 5F6AA 1T1BA 4F3LA 4I3AA 4IHQA 4BBVA 2Z6DA 4GHIA 5EFWA 4BWIA 3EGXC 3HCYA 2JKRM 3LR0A 4WEJA 5CX7A 4EUVA 3RFBA 5F68A 5DF9A 3HJKA 4G3WA 2D02A 3KO6A 4GS9B 1GSVA 1TS7A 4BBUA 1VB6A 2JKRI 4HJ6A 4B9OA 3GECA 3S7PA 4HJ4A 2YKHA 2HGVA 2XA7M 3KX0X 4AFIA 4BMWA 5MC7A 5IS1A 3D72A 5HZHA 1S67L 3LUQA 3K2NA 4JGQA 2M7UA 1T1CA 5C5KA 4EERA 3C2WA 3PBQA 3UMEA 4CLCC 5J4EA 3TJZC 4II7A 5DJUA 1OTIA 3K3CA 4NXBA 4ETZA 1XFNA 2QKPA 3PBNA 4WN5A 4CLCB 2WKQA 2J3TD 4UQIM 2O9CA 2MJ6A 5HWWA 3B33A 4R3AA 3LI8A 3HJIA 1YKDA 3EQUA 3T4TA 2YKFA 1NRJA 4G3VA 5TJJA 1T18A 3CAXA 1XJ6A 2W3FA 2GX5A 2O99A 3BY9A 4HP4A 2GNXA 1OTEA 1OT9A 3FG8A 1F5MA 2VEAA 4MCWA 3MJQA 4F3LB 4EEUA 2VJWA 3A0RA 1F98A 4GHIB 3LIDA 4ARZB 2EA9A 3LR3A 3S7NA 1XJ3A 2V0UA 3OC2A 1MKMA 5DKLA 2VV6A 4E04A 2GZAA 3B42A 1VHMA 4O01A 4MN7A 1H8MA 2W3EA 3BW6A 3P7NA 4H6JB 2QHKA 3TE8A 4YNRA 5L8MA 4DN0A 2VGLS 3KSHA 2HJEA 2L4RA 4R70A 2JKTM 1MZUA 3JVVA 2WKPA 3DBAA 3VV4A 5DFYA 3V67A 3P01A 2LB5A 2JKTI 2PR5A 1S4RA 4L9GA 1N9LA 4UEYA 4L0LA 3T4SA 3C38A 3CLOA 1DP9A 5J3WA 4EU0A 5HSQA 4B93A 2CMNA 3LIAA 1IOUA 4DMZA 4OOMA 1DP8A 2XROA 3NHQA 2EWVA 1T19A 4HHDA 2IA2A 3EEAA 3CI6A 3EWKA 4P6ZM 4ARZA 1DRMA 3ULFA 3IS2A 3R7WA 4BJPA 2W3DA 1OTDA 1TS8A 3KSGA 3W2ZA 4EW7A 1LSVA 1ODVA 4MDZA 4Q0IA 4LRXC 5HPIA 4NXFA 3PYPA 2W3HA 1OT6A 4H6JA 1UWNX 3CUEA 1S66L 1LSWA 1UGUA 2VLGA 4KUOA 2A24A 2I9VA 2J3TC 1S1ZA 3IBRA 2M1CA 1H3QA 4IUHA 3ICYA 3T4LA 4BBTA 4HP9A 3E98A 4M4XA 2ZMVA 3MQQA 2QJ7A 4I3IA 3H9WA 2PHYA 3E4OA 3MXQA 3RH8B 1OPXA 5KSHA 3UB6A 4Q0JA 1NLYA 3TRCA 2OWHA 2VV7A 2VV8A 1X0OA 4KQOA 3H7WA 4EQ1A 4HH2A 3K3DA 5HD5A 3BQAA 2O9BA 3R4KA 2NUPC 5FL3A 3A0SA 4HH3A 4FSFA 5HDDA 1DP6A 4XT2A 4MN5A 3LICA 3O5YA 4Y3IA 3T4JA 3MQOA 1JNUA 4R38A 4G3KA 3NOPC 4KQDA 3LR5A 2K2NA 2PYPA 5AVFA 2XRNA 4Y2FA 3ZYTA 3OLOA 1UWPX 1OTBA 2OWJA 4Q0HA 2J80A 2P7JA 3E0YA 4HOIA 4YOFA 4R6LA 3T50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWF A;  2QJ5 A;  2L0W A;  3F1N A;  4GW9 A;  5DJT A;  3IS2 B;  5F5Y A;  4I5S A;  4RQ9 A;  4K08 A;  4JGO A;  4JGP A;  2ZOH A;  2GJ3 A;  2Z6C A;  3LI9 A;  2INW A;  2BAS A;  3PHY A;  5F69 A;  2WKR A;  1GSX A;  2A24 B;  1S4S A;  1KOU A;  4WUJ A;  4HQA A;  3SW1 A;  1D7E A;  1OTA A;  3UMD A;  4PKY G;  4EES A;  3A0V A;  3H7W B;  3UB9 A;  2PD8 A;  3NOT C;  4JGR A;  3E4P A;  2H28 A;  4HIA A;  2W0N A;  2PR6 A;  4XT2 B;  5DKK A;  2KX6 A;  4MN6 A;  2PDR A;  3LIE A;  4DJ2 A;  4EXO A;  5HDS A;  3BWL A;  4I3J A;  3UB7 A;  4DJ3 A;  3F1N B;  3NJA A;  1V9Z A;  3E4Q A;  3FC7 A;  1TS0 A;  4NXE A;  3VE4 A;  3ZQ5 A;  5J7E A;  1WA9 A;  4HY8 A;  1V9Y A;  4WL9 A;  1G28 A;  1N9O A;  4YWZ A;  2ZOI A;  1TS6 A;  1EW0 A;  4HNB A;  4LRZ E;  3EEH A;  3VE3 A;  1LL8 A;  2HV1 A;  4WF0 A;  4I38 A;  1GSW A;  2KDK A;  2ZBB A;  3BY8 A;  3F1O A;  2V1B A;  2D01 A;  4GCZ A;  1LSX A;  4NXG A;  3NOU C;  5HWT A;  4EEP A;  4PKY A;  2V9A A;  4EET B;  3RTY A;  3H82 A;  1T1A A;  3LYX A;  2JHE A;  5TBM A;  3F1P A;  2K7S A;  4WLA A;  2PD7 A;  5AVE A;  5HD3 A;  5HDC A;  4L9E A;  4L9F A;  1XFQ A;  1S1Y A;  3UB8 A;  5KIZ A;  4GS9 A;  3GDI A;  3G6O A;  1OJG A;  1F9I A;  3UE6 A;  2OOL A;  1BYW A;  4KUK A;  3VOL A;  3MR0 A;  2PYR A;  3C8C A;  5G4Z A;  1XJ2 A;  2W27 A;  1OJ5 A;  3LIF A;  3MFX A;  1NWZ A;  5IU1 A;  4HJ3 A;  1N9N A;  4LLO B;  5HWV A;  1Y28 A;  4HI4 A;  2L1M A;  2V1A A;  2JN7 A;  3F1O B;  1P97 A;  5A8B A;  5I5L A;  1D06 A;  2QWS A;  4I39 A;  2R78 A;  1XJ4 A;  2V0W A;  3H82 B;  4LPZ A;  3LIB A;  5G4Y A;  4LRY C;  5TBM B;  1LT0 A;  3F1P B;  2B02 A;  1P0Z A;  5F6A A;  1T1B A;  4F3L A;  4I3A A;  4BBV A;  2Z6D A;  4GHI A;  5EFW A;  5F68 A;  3HJK A;  2D02 A;  4GS9 B;  1GSV A;  1TS7 A;  4BBU A;  1VB6 A;  4HJ6 A;  4B9O A;  3GEC A;  4HJ4 A;  2YKH A;  3KX0 X;  5IS1 A;  3D72 A;  5HZH A;  1S67 L;  3LUQ A;  4JGQ A;  1T1C A;  4EER A;  3C2W A;  3UME A;  5J4E A;  5DJU A;  1OTI A;  3K3C A;  4NXB A;  1XFN A;  2QKP A;  4WN5 A;  2WKQ A;  5HWW A;  3B33 A;  4R3A A;  3LI8 A;  3HJI A;  2YKF A;  1T18 A;  3CAX A;  1XJ6 A;  3BY9 A;  4HP4 A;  1OTE A;  1OT9 A;  3FG8 A;  2VEA A;  3MJQ A;  4F3L B;  4EEU A;  3A0R A;  1F98 A;  4GHI B;  3LID A;  2EA9 A;  1XJ3 A;  2V0U A;  5DKL A;  2VV6 A;  4E04 A;  3P7N A;  4H6J B;  2QHK A;  2L4R A;  4R70 A;  1MZU A;  2WKP A;  2PR5 A;  1S4R A;  4L9G A;  1N9L A;  3CLO A;  1DP9 A;  5J3W A;  5HSQ A;  2CMN A;  3LIA A;  1DP8 A;  3NHQ A;  4HHD A;  1T19 A;  3EWK A;  1DRM A;  3ULF A;  3IS2 A;  1OTD A;  1TS8 A;  4EW7 A;  1LSV A;  1ODV A;  4LRX C;  4NXF A;  3PYP A;  1OT6 A;  4H6J A;  1UWN X;  1S66 L;  1LSW A;  1UGU A;  2VLG A;  4KUO A;  2A24 A;  2I9V A;  1S1Z A;  3IBR A;  2M1C A;  3ICY A;  4BBT A;  4HP9 A;  4M4X A;  4I3I A;  3MQQ A;  2QJ7 A;  3H9W A;  2PHY A;  3E4O A;  3MXQ A;  3RH8 B;  3UB6 A;  2OWH A;  2VV7 A;  2VV8 A;  1X0O A;  3H7W A;  4EQ1 A;  4HH2 A;  3K3D A;  5HD5 A;  3A0S A;  4HH3 A;  5HDD A;  1DP6 A;  4XT2 A;  4MN5 A;  3LIC A;  3MQO A;  1JNU A;  4R38 A;  4KQD A;  3NOP C;  2PYP A;  5AVF A;  3OLO A;  1OTB A;  1UWP X;  2OWJ A;  2J80 A;  2P7J A;  4HOI A;  4R6L A;  3T50 A; 
#chains in the Genus database with same CATH topology
 3CWF A;  3IS2 B;  1ZHH B;  4I5S A;  5FAP A;  5DF8 A;  2HDU A;  3MBZ A;  3FYZ A;  1S6R A;  4ZJ2 A;  2Y79 A;  4PPR A;  1E3U A;  1OME A;  2BAS A;  3UY6 A;  2LB9 A;  3VP4 A;  2WK0 A;  1N9B A;  1S4S A;  1FQG A;  1SHV A;  1D7E A;  1L0E A;  1TVF A;  1VEU A;  3BEB A;  4PKY G;  2P9V B;  4EES A;  3HLB A;  1W63 Q;  5CGW A;  2JC7 A;  2P74 A;  5DFX A;  3UDI A;  4JBF A;  3E4P A;  2H28 A;  4KZ3 A;  4HIA A;  1L3L A;  2PR6 A;  1QME A;  3DTI A;  3IXB A;  3ZNY A;  2PRF A;  2NUT C;  3IXD A;  5DKK A;  5M18 A;  3NC8 A;  2VGL M;  2XD1 A;  4JXS A;  4N92 A;  1JWV A;  3IX4 A;  5AJG A;  2V2F F;  5F1F A;  5HDS A;  4I3J A;  4DJ3 A;  3FV7 A;  1H8Z A;  3N8R A;  1TS0 A;  4NXE A;  2HF6 A;  2WGW A;  5J7E A;  2H10 A;  2ZC5 B;  1V9Y A;  4YWZ A;  4K0X A;  1Y54 A;  2JBF A;  4JXV A;  1A0K A;  1G6O A;  1TS6 A;  4GDB A;  4IVI A;  4WEL A;  1ES4 A;  3OCN A;  3QP1 A;  1K4F A;  2G7U A;  3MKF A;  2HV1 A;  1LI9 A;  1K54 C;  1BZA A;  2ZBB A;  2EFX A;  1BLP A;  5EM1 A;  5KSC A;  3PR6 A;  3G32 A;  3WS5 A;  4Y7P A;  3GV9 A;  5EEC A;  1Q2P A;  4LV0 A;  1LSX A;  3BQ8 A;  3NOU C;  4GN2 A;  4EEP A;  3EOI A;  4E3I A;  1G6A A;  1T1A A;  3LYX A;  5TGF A;  5CEB A;  3BYD A;  4WLA A;  3WRT A;  4PM9 A;  5E2F A;  1S1Y A;  1OJG A;  4KUK A;  1C3B A;  4KG5 A;  1KDW A;  3MR0 A;  2PYR A;  3PBR A;  3GSG A;  1XX2 A;  2Y4A A;  1OJ5 A;  3Q7V A;  1JWP A;  3KYQ A;  2Y2L A;  1NWZ A;  3WRZ A;  1NXY A;  5CHJ A;  3DAV A;  1N9N A;  3HLW A;  5HWV A;  2HDQ A;  2J3W A;  4GJ4 A;  4BL3 A;  3N8L A;  3QP6 A;  2OAQ 1;  2JN7 A;  4P6Z S;  4CLC A;  3PAG A;  5M19 A;  1P97 A;  2PBY A;  5L10 A;  3S7Q A;  2Z2L B;  2DMW A;  4X1L A;  2ZM2 A;  3VOZ A;  1P0Z A;  1PFL A;  1TDG A;  3UNW A;  1HVB A;  4DE2 A;  5EFW A;  3LR0 A;  3NUL A;  4GS9 B;  3SS3 A;  2HDR A;  4B9O A;  1RGY A;  4X69 A;  4C6Y A;  2YKH A;  5IS1 A;  4XXR A;  1NYM A;  1XGI A;  1I5Q A;  4EV4 A;  3PBQ A;  2A3U A;  4II7 A;  4P0M A;  4QY5 A;  1XFN A;  1LL5 A;  3VSL A;  2RCX A;  3QP8 A;  3C7V A;  3T1X A;  4D60 A;  3PBN A;  5F82 A;  3UDF A;  4UQI M;  1Z6F A;  2HP9 A;  3LI8 A;  5AQ9 A;  3EQU A;  2YKF A;  2ZQ9 A;  2B95 A;  3CAX A;  2WGI A;  2GX5 A;  3TG9 A;  5JYP A;  2Q9N A;  3M6H A;  4HP4 A;  2GNX A;  3VFF A;  1F5M A;  4JF4 A;  2VEA A;  1ERO A;  4F3L B;  5FA7 A;  3LID A;  4ARZ B;  2J9P A;  5KMW A;  1ESU A;  3OC2 A;  1MKM A;  3CHW P;  4E04 A;  4PMA A;  1PWG A;  5A91 A;  1QMF A;  3U4L P;  3VOY A;  2HZ5 A;  4H6J B;  1KE3 A;  2GDN A;  4MBH A;  4EBN A;  4FCF A;  2EX8 A;  2UWX A;  3Q1F A;  4OQG A;  5CHM A;  5FQI A;  5FEF A;  1Z09 A;  2JKT M;  4RA7 A;  2WKP A;  2Y2P A;  2J7V A;  2LB5 A;  2JKT I;  1PNE A;  4S2J A;  1N9L A;  1LI0 A;  5CGX A;  1K54 A;  1DP9 A;  1MBL A;  5FAQ A;  3JYI A;  2VK3 A;  3NEC A;  1IOU A;  1YLP A;  4X56 A;  2XRO A;  1K4E A;  3P09 A;  2Q0O A;  1T19 A;  3EWK A;  1FIK A;  2R9X A;  1DRM A;  5CED A;  5DTK A;  3RXX A;  1D1J A;  3UB5 P;  1VET A;  3BFE A;  1OTD A;  5E2H A;  1N4O A;  1LSV A;  1NYY A;  4MDZ A;  4E3L A;  2W3H A;  2AVX A;  3HLF A;  5JYO A;  3C4O A;  1Y4O A;  2Y2M A;  4KUO A;  5FAO A;  2I9V A;  3NBL A;  4S2N C;  1H3Q A;  2ZJ9 A;  4IUH A;  5CGS A;  4HP9 A;  3H9W A;  3IWO A;  3MXQ A;  4Q0J A;  3TRC A;  4LFU A;  4KQO A;  2VV8 A;  1X0O A;  3H7W A;  4R3B A;  3WS0 A;  3L7H A;  2E8I A;  5HD5 A;  5AQB A;  2BTF P;  3IQA A;  4HH3 A;  1BSG A;  1ZKJ A;  4MN5 A;  3O5Y A;  1MWS A;  1JNU A;  4G3K A;  3IF5 A;  4UHU A;  2K2N A;  2PYP A;  5AVF A;  4Y2F A;  1YPR A;  4PM6 A;  4KG2 A;  2OWJ A;  4Q0H A;  1K57 C;  3E0Y A;  4HOI A;  3VP0 A;  3T50 A;  1PWD A;  5DJT A;  1MPL A;  4DDY A;  3OPL A;  3CUE C;  1BUL A;  3IH8 A;  3NDG A;  4M3K A;  5EPH A;  3LGO A;  2Z6C A;  3LI9 A;  5DVA A;  2Y55 A;  1JTD A;  4CJN A;  1IFQ A;  5EVI B;  1W8Q A;  2WKR A;  2WGV A;  1K56 A;  3IX3 A;  1KOU A;  3IF6 A;  4RX3 A;  1YLW A;  1OTA A;  3UMD A;  5HPF A;  3E2K A;  3D9Y A;  2R9W A;  2VGK A;  2WAE A;  3A0V A;  3OBF A;  1CI8 A;  1TD5 A;  3LEQ A;  4B4X A;  3ZFZ A;  3CG5 A;  3NOT C;  4IVK A;  5IHV A;  5FEG A;  4R4S A;  2ZQC A;  1L2S A;  1RCJ A;  3IXG A;  1W63 M;  2IWB A;  2Y2O A;  2WKH A;  1MXO A;  3SOI A;  1P9W A;  4NEE D;  4KZ5 A;  3IWI A;  2XA7 S;  3KSF A;  3OZH A;  4GDN A;  3T1Q B;  4MNR A;  4Z1W A;  3BWL A;  1S0W A;  4HES A;  4Q8I A;  5CRF A;  3F1N B;  4OPZ A;  3FC7 A;  2Z2M B;  2ZC6 B;  4FUW A;  4Y15 A;  3C30 A;  3ZQ5 A;  2XFT A;  1WA9 A;  3WS2 A;  1SDE A;  2FFF B;  1GHM A;  2OAP 1;  5GLA A;  4WYY A;  1IEL A;  1N9O A;  1PI4 A;  2EX9 A;  4BD1 A;  4OKP A;  4LRZ E;  3HLE A;  4P6B A;  4KZ8 A;  1KVM A;  5EUA A;  4ZAM A;  3HUO A;  1LL8 A;  5FQJ A;  4O0P A;  4WF0 A;  2JCH A;  3HUM A;  4RVA A;  2ZQA A;  2BLS A;  2KDK A;  3LO7 A;  4ZRR A;  4DKI A;  1JVJ A;  3TSG A;  1E4D A;  4GCZ A;  3ZHH A;  3GR2 A;  4S2K A;  3NIA A;  4PKY A;  2WUQ A;  3H82 A;  2P08 A;  2ZD8 A;  4NK3 A;  1YSP A;  3B47 A;  3BEC A;  4YFM A;  2Y2N A;  3F1P A;  4YIN A;  1YMX A;  2PD7 A;  1YSQ A;  3GMW A;  5HDC A;  3QNB A;  4KEN B;  4L9E A;  3VSK A;  3LR4 A;  2VZW A;  1P9R A;  3UB8 A;  1KGF A;  3P98 A;  2ZQ8 A;  3ZNT A;  2OOL A;  1MWR A;  3KYZ A;  2EX6 A;  4E3J A;  2Y8H A;  3C8C A;  4F94 A;  2W1T B;  5F83 A;  2W1R A;  5LBR A;  4WBG A;  1IYP A;  5IU1 A;  4E6W A;  2HP5 A;  5A90 A;  3G31 A;  2PBD P;  1Y28 A;  1O07 A;  4HI4 A;  4CLC E;  3QP4 A;  2HP6 A;  3NI9 A;  5HAI A;  3F1O B;  1ZG4 A;  1XA1 A;  4E6X A;  2ZM0 A;  5A8B A;  4ME4 A;  5I5L A;  4Y17 A;  1YLJ A;  2QWS A;  3T4O A;  2R78 A;  4KZA A;  4LEN A;  4WMC D;  4LPZ A;  4QD4 A;  1YAX A;  3IBJ A;  2XEP A;  5CXW A;  2Y2Q A;  5M1A A;  5TBM B;  5HL6 A;  4ETX A;  1LT0 A;  3DWK A;  2OLV A;  4I3A A;  4IHQ A;  3MKE A;  5CER A;  3W4O A;  3EGX C;  4EUV A;  3RFB A;  3AGD A;  5DF9 A;  3CPT A;  4DF6 A;  1GSV A;  3HVF A;  3GRJ A;  1CJF A;  1JWZ A;  4HJ4 A;  2HGV A;  3D72 A;  5HZH A;  4UAA A;  3K2N A;  3WS4 A;  1GA0 A;  2M7U A;  5C5K A;  3W4Q A;  3C2W A;  3UME A;  4NXB A;  5GLC A;  3UPN A;  5EV0 A;  2QKP A;  4WN5 A;  2WKQ A;  4LV2 A;  1XP4 A;  3B33 A;  2X02 A;  3G4P A;  4S2M A;  1NZO A;  5F1G A;  3T4T A;  5TJJ A;  4N1X A;  4JLF A;  5KZH A;  2W3F A;  4QU3 A;  3MS6 A;  5J8X A;  4GB7 A;  1OTE A;  3FWL A;  4C3Q A;  3FG8 A;  2QPN A;  4EEU A;  4IBX A;  3W4P A;  4X55 A;  4GHI B;  2XQZ A;  3LR3 A;  1FOF A;  1HTZ A;  1GHI A;  2VV6 A;  5FI6 A;  3N8S A;  5FI7 A;  1VHM A;  3V3S A;  4MN7 A;  4XUX A;  5TR7 A;  2J9O A;  2WAD A;  3ZGA B;  2QHK A;  4MBF A;  5AQA A;  5EVI D;  4YNR A;  3ZG7 B;  4DN0 A;  2ZMA A;  4Y0T A;  4R0Q A;  4R70 A;  3UPO A;  3JVV A;  4FTX A;  4Y0U A;  5DFY A;  1FR6 A;  1ONG A;  1S4R A;  3ZG0 A;  3C7U A;  4OON A;  1ERQ A;  2HDS A;  4PM8 A;  4BD0 A;  4EU0 A;  3HLG A;  2C5W B;  1ES5 A;  3Q07 A;  2QMI A;  4OOM A;  1PIO A;  3NHQ A;  4JXG A;  2EWV A;  3ZDJ A;  3CI6 A;  4P6Z M;  2WZX A;  1H8Y A;  1GCE A;  3OPP A;  3Q7Z A;  1SZV A;  5A93 A;  3IS2 A;  2W3D A;  3AGE A;  1L0F A;  3UO9 A;  1TS8 A;  2G2U A;  2Q9M A;  3KSG A;  4EW7 A;  1ODV A;  4Q0I A;  4LRX C;  4FH2 A;  4NXF A;  3PYP A;  4E3M A;  1OT6 A;  1WYC A;  1S66 L;  1LSW A;  1UGU A;  1LL9 A;  4KQQ A;  4WZ5 C;  1CQA A;  3ICY A;  3T4L A;  1FSW A;  4LV3 A;  3T1R A;  2ZMV A;  1SKO B;  2QJ7 A;  4I3I A;  4X68 A;  5FAS A;  3MZD A;  2PHY A;  4S2O A;  5KSH A;  2UV0 E;  3FKW A;  2C6W B;  4IBR A;  4LGW A;  1YQS A;  4EQ1 A;  4FD8 A;  4KG6 A;  3K3D A;  2NUP C;  3BQA A;  2EXA A;  4CPK A;  1LLB A;  3AGF A;  4MBK A;  5HDD A;  1DP6 A;  3VP1 A;  4Y3I A;  5FQK A;  4O7D A;  5EM0 A;  1HLU P;  5FDS A;  1YMS A;  1YLZ A;  3VP3 A;  2P7J A;  2V1Z A;  5E2E A;  2QJ5 A;  3S7O A;  3R7W B;  3HRE A;  5F5Y A;  4BEN A;  2OLU A;  3PXP A;  3BLM A;  1G68 A;  2B5R A;  4K08 A;  4JGO A;  4JGP A;  2XLN A;  2DNS A;  2X01 A;  2VKS A;  3PHY A;  4WEK A;  2A24 B;  4QJG A;  4WUJ A;  3LY4 A;  3PAE A;  4HQA A;  3M2J A;  4EQI A;  4U3T A;  3SW1 A;  1Q2Q A;  4CQH A;  1ACF A;  4ZBE A;  2PU2 A;  2PD8 A;  3GQZ A;  1BUE A;  1SKF A;  4GLQ A;  3EGD C;  3RJU A;  3O87 A;  4BQM A;  4XT2 B;  5GL9 A;  3CIT A;  3T12 B;  5TFQ A;  4OOY A;  1FR1 A;  2KX6 A;  2ZL1 B;  1PZO A;  3ZG8 B;  2KOI A;  3IXH A;  2PDR A;  4MN6 A;  4O8G A;  1GHP A;  2BG1 A;  3BFD A;  4DJ2 A;  1STZ A;  3UE1 A;  1YLY A;  3UB7 A;  5U47 A;  2WKE A;  3NJA A;  2P04 A;  3NY4 A;  1V9Z A;  2QZ6 A;  5GHZ A;  3UE3 A;  4KZ6 A;  2WAF A;  3T4K A;  1G28 A;  3KSI A;  1PI5 A;  4WM9 A;  1NJ4 A;  2ZLY A;  4PAU A;  2XDM A;  1ALQ A;  2FZ0 A;  4EUZ A;  1ZG6 A;  4DXB A;  1EW0 A;  4HNB A;  3BRM A;  2I72 A;  3VE3 A;  4IED A;  2JKF A;  1XKZ A;  3LCE A;  4OQH A;  2EX2 A;  2WYX A;  1VEU B;  4OOL A;  3N4I A;  3BY8 A;  4GD8 A;  4ZJ3 A;  4K91 A;  2V1B A;  2D01 A;  2Y2K A;  5G18 A;  4NXG A;  5HW3 A;  4BL2 A;  5HWT A;  2O0Y A;  5FQM A;  4OP5 A;  2EFU A;  4E3O A;  4EET B;  3RTY A;  4QWO A;  2X71 A;  1YLT A;  3T1S A;  1PW8 A;  5I94 A;  2JHE A;  2PT7 A;  1AWI A;  3FZC A;  2K7S A;  3MXS A;  2OSU A;  5AVE A;  5HD3 A;  5EVI C;  2IWC A;  2WGW B;  3LFV A;  3T4Q A;  5L2F A;  2VA0 A;  1DJA A;  5A92 A;  4GS9 A;  3HUN A;  5KIZ A;  3GDI A;  1F9I A;  2ZM8 A;  3UE6 A;  1BYW A;  3G2Z A;  5G4Z A;  4ZTK A;  4ESP A;  4GOG A;  3EQV A;  4JPM A;  3LIF A;  3D3O A;  3MFD A;  2KLI A;  3M2K A;  3MF0 A;  1TF1 A;  2Y2I A;  4KZB A;  5IT5 A;  2L1M A;  2V1A A;  2FFY A;  4P87 A;  2B18 A;  3QHY A;  4WZ5 A;  3WS1 A;  3ZVT A;  5CTN A;  3VFH A;  1D06 A;  1KGG A;  3W8K A;  4ZDX A;  3DWZ A;  4I39 A;  3Q81 A;  2K31 A;  3IX8 A;  3TW8 A;  3LIB A;  4LRY C;  4Z9Q A;  4LCL A;  4JXW A;  3ZG5 A;  2B02 A;  5E2G A;  1PRQ A;  1T1B A;  4F3L A;  4BBV A;  2JKR M;  5F68 A;  2Y2G A;  3HJK A;  1W7F A;  2D02 A;  4S2L A;  1TS7 A;  3DW0 A;  1VB6 A;  2JKR I;  4HJ6 A;  3GEC A;  3S7P A;  3V39 A;  2XA7 M;  3KX0 X;  4AFI A;  4BMW A;  5MC7 A;  1M40 A;  3LUQ A;  3NCK A;  4DE0 A;  2Y59 A;  3Q7V B;  4JGQ A;  4MEZ A;  3OPH A;  1T1C A;  3A3I A;  4JKT A;  4CLC C;  1KDS A;  3TJZ C;  3K3C A;  3G35 A;  5DTT A;  4DXC A;  4ETZ A;  1CF0 A;  3V3R A;  4CLC B;  3BM6 A;  2MJ6 A;  5HWW A;  4WZ4 A;  2JKG A;  5D3O A;  4JF5 A;  4DRT A;  3MXR A;  4BLM A;  4OH0 A;  4WMC A;  3A3D A;  2OV5 A;  3BFG A;  3A3F A;  1NRJ A;  4G3V A;  1XJ6 A;  2ZC4 B;  1ZC2 A;  2G2W A;  2DCF A;  1OT9 A;  2ACG A;  5HL1 A;  3S1Y A;  3ZG9 B;  1RP5 A;  4MCW A;  3MJQ A;  4N1H A;  5E43 A;  1IKI A;  3A0R A;  1MY8 A;  2EA9 A;  3S7N A;  1VQQ A;  1W79 A;  2XD5 A;  4XUZ A;  3CMZ A;  3UPP A;  2WKI A;  2W3E A;  3P7N A;  3D4F A;  1K55 C;  3TE8 A;  3C4P A;  3SZT A;  2VGL S;  3KSH A;  4QHC A;  3S4X A;  1H5X A;  5GHX A;  4S2N A;  3V50 A;  3Q82 A;  3DBA A;  1BLC A;  2V8F A;  1KGE A;  2XF3 A;  3V67 A;  2WZZ A;  3P01 A;  4H8R A;  2PR5 A;  5FQ9 A;  1J3W A;  4U0T A;  4UEY A;  4L0L A;  1WYB A;  4KZ4 A;  5EOE A;  3C38 A;  5J3W A;  5HSQ A;  1FCO A;  4B93 A;  5HAQ A;  4FH4 A;  4DMZ A;  2E8J A;  3BFF A;  3V5M A;  2IA2 A;  3EEA A;  1K57 A;  4MLL A;  4BJP A;  3HL9 A;  3W2Z A;  4OQ0 A;  1RGZ A;  2XH9 A;  1LHY A;  1K38 A;  1UWN X;  3CUE A;  5EVI A;  4QB8 A;  5L09 A;  2J3T C;  1E3U D;  2H5S A;  3CJM A;  4GD6 A;  4BBT A;  3G34 A;  3E98 A;  3MQQ A;  4OVD A;  3RH8 B;  1OPX A;  2XR0 A;  1NLY A;  4X53 A;  2XK1 A;  2OWH A;  3NDE A;  1K25 A;  4HH2 A;  3VP2 A;  1MWU A;  2O9B A;  5FL3 A;  4PM7 A;  3A0S A;  4FSF A;  1NRF A;  1FCN A;  3SH7 A;  3LIC A;  3T4J A;  3MQO A;  4R38 A;  4KQD A;  3NOP C;  3LR5 A;  2ZQ7 A;  2XRN A;  3ZYT A;  1OTB A;  4HBU A;  3UN7 A;  2J80 A;  1XXM A;  4R1G A;  4YOF A;  4Y13 A;  3FKV A;  4U0X A;  3F1N A;  2L0W A;  4NKP A;  4GW9 A;  4KQR A;  4S2P A;  1MC0 A;  3OCL A;  4R23 A;  1O7E A;  1ES3 A;  1VET B;  1MWT A;  2HJ9 C;  3RXW A;  5EOO A;  3JVU A;  4RQ9 A;  3GTC A;  2ZOH A;  2GJ3 A;  2INW A;  5FDH A;  2A2L A;  2W3G A;  5F69 A;  5HAR A;  2DRW A;  1GSX A;  2V8C A;  3G2Y A;  4PHT A;  5BOH A;  3B3X A;  4NG2 A;  2HPB A;  2IWD A;  1DJB A;  4Y5F A;  3PBS A;  1BLH A;  3TOI A;  3ZVW A;  3H7W B;  4DE3 A;  4OPQ A;  1E25 A;  1L0D A;  4KZ9 A;  3UB9 A;  2H0T A;  4JGR A;  4FOF A;  1XA7 A;  2W0N A;  1I2S A;  4EBL A;  5EVL A;  2M7V A;  3LIE A;  5K5B A;  4EXO A;  1M6K A;  1VM1 A;  3JPU A;  4OLG A;  2XFS A;  2Y2J A;  3L9K A;  2ZQD A;  2XSS A;  3E4Q A;  4IJG A;  3O3V A;  4ID4 A;  3HLC A;  4R4R A;  3VE4 A;  1HD8 A;  5HAP A;  4HY8 A;  3OPR A;  4C75 A;  2V20 A;  3IF6 C;  4WL9 A;  1SCW A;  2O9A A;  3PBT A;  5HX9 A;  2ZOI A;  4UQI S;  4QY6 A;  2JE5 A;  2W1T A;  3ITB A;  2EWW A;  3IF6 B;  4JF6 A;  3EEH A;  3DTK A;  2ZMF A;  2P9V A;  1TDL A;  4I38 A;  1WE4 A;  1GSW A;  1ERM A;  3BLS A;  4OP8 A;  5GHY A;  3M6B A;  4NET A;  3FPW A;  2QYB A;  1K55 A;  2VX8 A;  3F1O A;  4Y0O A;  2Y91 A;  3ITA A;  1BTL A;  4E3N A;  4CLC D;  2H0Y A;  1NLZ A;  1K6R A;  3VMA A;  2V9A A;  3N7W A;  4MMN A;  4OQI A;  5DTS A;  3BFC A;  5CHU A;  2FH5 A;  4IUK A;  1PW1 A;  5TBM A;  1CK3 A;  3FPV A;  2PU4 A;  3MMH A;  4L9F A;  1XFQ A;  4E3K A;  3IT9 A;  3O86 A;  4N9L A;  1SDN A;  3G6O A;  2J8Y A;  5CEC A;  4OPR A;  2A49 A;  4B88 A;  3U2A A;  1G5U A;  4P85 A;  3VOL A;  3OOV A;  4RX2 A;  1FIL A;  1XJ2 A;  3LY3 A;  1DJC A;  2W27 A;  3PBO A;  3MFX A;  3DTM A;  4HJ3 A;  1IEM A;  5L07 A;  4LLO B;  2CC1 A;  2XGN A;  3E2L A;  5FAT A;  1IYS A;  3BJN A;  3O88 A;  1KE0 A;  3PTE A;  1ONH A;  1BLS A;  4QPR A;  1XJ4 A;  2V0W A;  1YM1 A;  3QNC A;  3IHB A;  3H82 B;  3MQ0 A;  5G4Y A;  5FQQ A;  1ZTU A;  3F1P B;  5F6A A;  3WWX A;  1U60 A;  4N9K A;  4S2I A;  5DF7 A;  3HLD A;  2Z6D A;  4GHI A;  4BWI A;  3HCY A;  4WEJ A;  5CX7 A;  4PM5 A;  5FSR A;  4G3W A;  4DE1 A;  3KO6 A;  4BBU A;  4D2O A;  1ES2 A;  1S67 L;  4UA6 A;  4X1M A;  4EER A;  5J4E A;  5DJU A;  1OTI A;  1FSY A;  5EE8 A;  1CI9 A;  1EWZ A;  1IKG A;  2J3T D;  2O9C A;  1PYY A;  3A3J A;  4R3A A;  3GVB A;  3HJI A;  1YKD A;  5AQ7 A;  4ZJ1 A;  3SS5 A;  2VGJ A;  3N6I A;  1T18 A;  2O99 A;  2RL3 A;  3BY9 A;  3A3E A;  3QP2 A;  4DDS A;  5HFO A;  1CEG A;  5EVE A;  1JTG A;  4K0W A;  3LEZ A;  3IHA A;  2EXB A;  1J9M A;  1MKI A;  2VJW A;  3ZCZ A;  1F98 A;  2ZC3 B;  1F2K A;  1IYQ A;  3CPT B;  1XJ3 A;  2V0U A;  5DKL A;  2GZA A;  3B42 A;  4O01 A;  1H8M A;  3BW6 A;  4LV1 A;  1ESI A;  4HBT A;  3KYE A;  1XGJ A;  4GZB A;  5L8M A;  2PAV P;  1SKO A;  4GNU A;  1NY0 A;  4EWF A;  2HJE A;  4EBP A;  2L4R A;  3SH9 A;  4LCM A;  3MZE A;  1MZU A;  5FI2 A;  3VV4 A;  1FCM A;  1W8Y A;  4UA9 A;  4L9G A;  4X25 A;  3T4S A;  3C5A A;  1XPB A;  3CLO A;  1PWC A;  4R3J A;  3IWQ A;  3MSH A;  2CMN A;  4HEF A;  1KVL A;  3LIA A;  1TEM A;  1I2W A;  2ZC7 A;  1DP8 A;  4HHD A;  3SS4 A;  4A5R A;  4ARZ A;  1W5D A;  3ULF A;  1NZU A;  3R7W A;  2Y2H A;  5GLB A;  4B4Z A;  1H0M A;  1GA9 A;  5HPI A;  3QP5 A;  1HZO A;  4H6J A;  3DTE A;  2VLG A;  1CEF A;  2A24 A;  1S1Z A;  1K6S A;  3IBR A;  2M1C A;  4M4X A;  4X6T A;  1K56 D;  1EI5 A;  1L0G A;  3E4O A;  3HBR A;  5GLD A;  3UB6 A;  2VV7 A;  1BT5 A;  1K0K A;  1AXB A;  1KE4 A;  1YT4 A;  5CTM A;  4UA7 A;  3CZD A;  3R4K A;  4KZ7 A;  4OPY A;  3UDX A;  3G30 A;  4OLD A;  4XT2 A;  3ISG A;  2ZL1 A;  3S22 A;  3OLO A;  1PZP A;  3I7J A;  1UWP X;  3SH8 A;  1DY6 A;  3UE0 A;  1IYO A;  4GKU A;  3IH9 A;  3MZF A;  4R6L A;  4RYE A; 
#chains in the Genus database with same CATH homology
 3CWF A;  2QJ5 A;  2L0W A;  3F1N A;  4GW9 A;  4NKP A;  5DJT A;  3S7O A;  1MC0 A;  3OCL A;  3IS2 B;  3R7W B;  1ZHH B;  5F5Y A;  4I5S A;  3CUE C;  2HJ9 C;  3PXP A;  3JVU A;  4RQ9 A;  4K08 A;  4JGO A;  4JGP A;  2ZOH A;  2GJ3 A;  2Z6C A;  3LI9 A;  2Y79 A;  2INW A;  2VKS A;  2BAS A;  1IFQ A;  2A2L A;  2W3G A;  3PHY A;  5F69 A;  2LB9 A;  4WEK A;  2WKR A;  1GSX A;  2A24 B;  1S4S A;  4PHT A;  1KOU A;  4WUJ A;  4HQA A;  3SW1 A;  1D7E A;  1OTA A;  3UMD A;  4Y5F A;  5HPF A;  4PKY G;  3PBS A;  4CQH A;  4EES A;  3A0V A;  3OBF A;  1W63 Q;  1TD5 A;  3H7W B;  3UB9 A;  2PD8 A;  5DFX A;  3NOT C;  4FOF A;  4JGR A;  3E4P A;  2H28 A;  4GLQ A;  3EGD C;  4HIA A;  2W0N A;  2PR6 A;  4XT2 B;  1W63 M;  3CIT A;  1P9W A;  2NUT C;  5DKK A;  2KX6 A;  2VGL M;  2M7V A;  2KOI A;  4MN6 A;  2PDR A;  4O8G A;  4NEE D;  3LIE A;  5K5B A;  4DJ2 A;  4EXO A;  2XA7 S;  3KSF A;  1STZ A;  5AJG A;  4Z1W A;  5HDS A;  3BWL A;  4I3J A;  3UB7 A;  4DJ3 A;  3F1N B;  3NJA A;  2P04 A;  1V9Z A;  2XSS A;  3E4Q A;  3FC7 A;  4IJG A;  3UE3 A;  1TS0 A;  4NXE A;  3VE4 A;  3C30 A;  2HF6 A;  3ZQ5 A;  5J7E A;  1WA9 A;  4HY8 A;  1V9Y A;  2OAP 1;  4WL9 A;  3T4K A;  1G28 A;  1N9O A;  3KSI A;  2O9A A;  4YWZ A;  3PBT A;  4PAU A;  2ZOI A;  4UQI S;  2FZ0 A;  1G6O A;  1EW0 A;  1TS6 A;  2W1T A;  4HNB A;  4LRZ E;  4WEL A;  2EWW A;  3OCN A;  3EEH A;  3VE3 A;  2ZMF A;  2G7U A;  1LL8 A;  2HV1 A;  4O0P A;  4WF0 A;  4I38 A;  1GSW A;  4OOL A;  2KDK A;  2ZBB A;  3FPW A;  3BY8 A;  4ZRR A;  3PR6 A;  2QYB A;  2VX8 A;  3F1O A;  2V1B A;  2D01 A;  4GCZ A;  1LSX A;  4NXG A;  3BQ8 A;  4CLC D;  3NOU C;  5HWT A;  4EEP A;  1NLZ A;  2O0Y A;  4PKY A;  3EOI A;  2V9A A;  4EET B;  3RTY A;  4MMN A;  3H82 A;  1T1A A;  2P08 A;  1YSP A;  3B47 A;  3LYX A;  2JHE A;  2FH5 A;  2PT7 A;  4IUK A;  5TBM A;  3F1P A;  2K7S A;  4WLA A;  2PD7 A;  1YSQ A;  5AVE A;  3FPV A;  5HD3 A;  5HDC A;  4L9E A;  3MMH A;  4L9F A;  3LR4 A;  1XFQ A;  3LFV A;  2VZW A;  1S1Y A;  3T4Q A;  1P9R A;  2VA0 A;  3UB8 A;  5KIZ A;  4GS9 A;  3GDI A;  3G6O A;  1OJG A;  1F9I A;  3UE6 A;  2OOL A;  1BYW A;  3U2A A;  3KYZ A;  4KUK A;  3VOL A;  3MR0 A;  3OOV A;  2Y8H A;  2PYR A;  3PBR A;  3C8C A;  5G4Z A;  1XJ2 A;  2W1T B;  3EQV A;  2W1R A;  2W27 A;  1OJ5 A;  5LBR A;  3LIF A;  3PBO A;  3D3O A;  3KYQ A;  3MFX A;  1NWZ A;  5IU1 A;  2KLI A;  4HJ3 A;  3MF0 A;  1N9N A;  4LLO B;  1TF1 A;  5HWV A;  2J3W A;  4GJ4 A;  1Y28 A;  4HI4 A;  4CLC E;  5IT5 A;  3BJN A;  2L1M A;  2V1A A;  2OAQ 1;  2JN7 A;  3F1O B;  4P6Z S;  4CLC A;  2B18 A;  1P97 A;  5A8B A;  4ME4 A;  5I5L A;  1D06 A;  3S7Q A;  2QWS A;  3T4O A;  4I39 A;  2R78 A;  4QPR A;  1XJ4 A;  2V0W A;  2K31 A;  3H82 B;  4LPZ A;  2DMW A;  3TW8 A;  3LIB A;  1YAX A;  3MQ0 A;  5G4Y A;  4LRY C;  3IBJ A;  5TBM B;  5HL6 A;  1ZTU A;  1LT0 A;  4ETX A;  3F1P B;  2B02 A;  1P0Z A;  5F6A A;  1T1B A;  4F3L A;  4I3A A;  4IHQ A;  4BBV A;  2Z6D A;  4GHI A;  5EFW A;  4BWI A;  3EGX C;  3HCY A;  2JKR M;  3LR0 A;  4WEJ A;  5CX7 A;  4EUV A;  3RFB A;  5F68 A;  5DF9 A;  3HJK A;  4G3W A;  2D02 A;  3KO6 A;  4GS9 B;  1GSV A;  1TS7 A;  4BBU A;  1VB6 A;  2JKR I;  4HJ6 A;  4B9O A;  3GEC A;  3S7P A;  4HJ4 A;  2YKH A;  2HGV A;  2XA7 M;  3KX0 X;  4AFI A;  4BMW A;  5MC7 A;  5IS1 A;  3D72 A;  5HZH A;  1S67 L;  3LUQ A;  3K2N A;  4JGQ A;  2M7U A;  1T1C A;  5C5K A;  4EER A;  3C2W A;  3PBQ A;  3UME A;  4CLC C;  5J4E A;  3TJZ C;  4II7 A;  5DJU A;  1OTI A;  3K3C A;  4NXB A;  4ETZ A;  1XFN A;  2QKP A;  3PBN A;  4WN5 A;  4CLC B;  2WKQ A;  2J3T D;  4UQI M;  2O9C A;  2MJ6 A;  5HWW A;  3B33 A;  4R3A A;  3LI8 A;  3HJI A;  1YKD A;  3EQU A;  3T4T A;  2YKF A;  1NRJ A;  4G3V A;  5TJJ A;  1T18 A;  3CAX A;  1XJ6 A;  2W3F A;  2GX5 A;  2O99 A;  3BY9 A;  4HP4 A;  2GNX A;  1OTE A;  1OT9 A;  3FG8 A;  1F5M A;  2VEA A;  4MCW A;  3MJQ A;  4F3L B;  4EEU A;  2VJW A;  3A0R A;  1F98 A;  4GHI B;  3LID A;  4ARZ B;  2EA9 A;  3LR3 A;  3S7N A;  1XJ3 A;  2V0U A;  3OC2 A;  1MKM A;  5DKL A;  2VV6 A;  4E04 A;  2GZA A;  3B42 A;  1VHM A;  4O01 A;  4MN7 A;  1H8M A;  2W3E A;  3BW6 A;  3P7N A;  4H6J B;  2QHK A;  3TE8 A;  4YNR A;  5L8M A;  4DN0 A;  2VGL S;  3KSH A;  2HJE A;  2L4R A;  4R70 A;  2JKT M;  1MZU A;  3JVV A;  2WKP A;  3DBA A;  3VV4 A;  5DFY A;  3V67 A;  3P01 A;  2LB5 A;  2JKT I;  2PR5 A;  1S4R A;  4L9G A;  1N9L A;  4UEY A;  4L0L A;  3T4S A;  3C38 A;  3CLO A;  1DP9 A;  5J3W A;  4EU0 A;  5HSQ A;  4B93 A;  2CMN A;  3LIA A;  1IOU A;  4DMZ A;  4OOM A;  1DP8 A;  2XRO A;  3NHQ A;  2EWV A;  1T19 A;  4HHD A;  2IA2 A;  3EEA A;  3CI6 A;  3EWK A;  4P6Z M;  4ARZ A;  1DRM A;  3ULF A;  3IS2 A;  3R7W A;  4BJP A;  2W3D A;  1OTD A;  1TS8 A;  3KSG A;  3W2Z A;  4EW7 A;  1LSV A;  1ODV A;  4MDZ A;  4Q0I A;  4LRX C;  5HPI A;  4NXF A;  3PYP A;  2W3H A;  1OT6 A;  4H6J A;  1UWN X;  3CUE A;  1S66 L;  1LSW A;  1UGU A;  2VLG A;  4KUO A;  2A24 A;  2I9V A;  2J3T C;  1S1Z A;  3IBR A;  2M1C A;  1H3Q A;  4IUH A;  3ICY A;  3T4L A;  4BBT A;  4HP9 A;  3E98 A;  4M4X A;  2ZMV A;  3MQQ A;  2QJ7 A;  4I3I A;  3H9W A;  2PHY A;  3E4O A;  3MXQ A;  3RH8 B;  1OPX A;  5KSH A;  3UB6 A;  4Q0J A;  1NLY A;  3TRC A;  2OWH A;  2VV7 A;  2VV8 A;  1X0O A;  4KQO A;  3H7W A;  4EQ1 A;  4HH2 A;  3K3D A;  5HD5 A;  3BQA A;  2O9B A;  3R4K A;  2NUP C;  5FL3 A;  3A0S A;  4HH3 A;  4FSF A;  5HDD A;  1DP6 A;  4XT2 A;  4MN5 A;  3LIC A;  3O5Y A;  4Y3I A;  3T4J A;  3MQO A;  1JNU A;  4R38 A;  4G3K A;  3NOP C;  4KQD A;  3LR5 A;  2K2N A;  2PYP A;  5AVF A;  2XRN A;  4Y2F A;  3ZYT A;  3OLO A;  1UWP X;  1OTB A;  2OWJ A;  4Q0H A;  2J80 A;  2P7J A;  3E0Y A;  4HOI A;  4YOF A;  4R6L A;  3T50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...