5HE9A

Bacterial initiation protein in complex with phage inhibitor protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
168
Chain Sequence
b'SNADRLDVAMAADDICTAITNGEQVKGLYLYGPFGTGKSFILGAIANQLKSKKVRSTIIYLPEFIRTLKGGFKDGSFEKKLHRVREANILMLDDIGAEEVTPWVRDEVIGPLLHYRMVHELPTFFSSNFDYSELEHHLAMTRDGEEKTKAARIIERVKSLSTPYFLSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Helicase loader
publication title Structure of inhibited replicative helicase loader from Staphylococcus aureus at 1.9 Angstrom resolution
rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 62
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5he9A00
2JDID 1Z5ZA 1JEEA 2FZ4A 4KXFB 1XCPA 2ZE5A 1HEIA 2W2XA 4YMTA 2V9PA 2RGGA 3IO5A 3Q7PA 1WA5A 5FBVB 1OFUX 1XBTA 2GCNA 2WJYA 4PO9A 5BYKA 2PZGA 4QL3A 1UKYA 2DFLA 3QKSA 2ZAMA 5EP1A 1KMHB 1A1VA 1HY3A 1U99A 4HI0E 1DS6A 4WAUA 1SVWA 3GLHA 1RW4A 5J4LA 5AUPB 4AI6A 3NH9A 2QPOA 4IVQA 2GK7A 1J70A 5BN3A 1E1QD 1TF5A 4D4KA 4DBLC 1JEDA 3AVVA 3CNNA 1T91A 5JCPA 1KHTA 1YZGA 2NPIA 2ZSFA 3AM1A 1TQDA 1VCMA 1NF3A 3B2EA 4DKXA 3EIQA 3BS4A 4OI1A 3NVAA 1P2VA 2ZR7A 4F93B 4C0QC 2TMKA 3THWA 1SZPA 4BLQA 4D80A 5FI1B 1G8HA 4E22A 3K1JA 2IL1A 4A36A 2ZRJA 1W49A 2WVJA 3LAWA 4US2R 4TL7A 1WMSA 4S35A 3P20A 4QGHA 2FE4A 3AB3A 4P31A 1E9AA 2ZJ5A 4IOMA 1QHIA 1W2GA 4I1OA 1CULC 4K8OA 3WHLA 3BFKA 1ZM7A 3GJ4A 1KI4A 2WOJA 2VHTA 3NHBA 1NI3A 2GAOA 3A58B 3AGQA 1AM4D 1P2SA 4AC9A 5IDVA 1XMVA 3OIVA 4DSTA 3FFAA 4NYIR 1XXHE 3B6EA 2D7DA 2VPPA 1FNMA 1EG7A 2WJIA 3SI7A 1AA9A 4HZIA 2OBMA 1DAGA 3TQFA 1W36D 1GKYA 4A4DA 2WWFA 1E79A 1UEJA 4B6EA 2VP0A 4GRAA 1E9RA 3CRW1 1RRGA 1EFHA 1G4UR 4M1YA 1S2MA 2BWJA 2ZI6A 4MGKR 4V0NA 2F1RA 4CEIA 2IUSA 1A4RA 3ASYA 3O8BA 3T15A 4EPXA 3T61A 1P73A 3LX8A 3K9GA 1JPJA 2PMDA 1NY6A 2CNWD 2JLQA 2W0MA 3T34A 2WJJA 5FBLB 1T8UA 2ZSEA 2F7SA 2FOLA 2ZRPA 3CF0A 3KQHA 2ZI4A 4XOIA 4JYBA 2CE7A 1Q1ZA 1Z3IX 2D06A 1WP9A 2DR3A 1YR7A 4PHHA 2G0NA 1XRJA 4Q1FA 2BMEA 4IEIA 2GJ8A 4LI0A 2XZOA 3EG5A 4BUJA 1KJZA 2CHQA 3UMRA 3KB2A 3VTKA 2J7PD 3CRRA 3SE0A 4OKSA 4CEJA 3OAAA 1UDXA 4RD3A 1G4AE 3NG1A 3NKVA 4WW0A 2AD5A 3U44B 1Z2CA 3CR8A 2QAGB 1ZD8A 2A3RA 2WWWA 2KI5A 4CYMA 3R7WB 5JHHB 3EIEA 4JS0A 3U3JA 4ZCIA 1EK0A 3B85A 1R7RA 1O87A 5BN5A 1E2QA 1E9SA 3CZQA 2DB3A 2RGNC 4TMWA 3SBEA 2A2ZA 1Z06A 5JI3E 1TEXA 1XXHB 3QBVA 3MWJA 4Q00A 3FDIA 4Z8YA 3WMEA 2O0JA 5KUTA 1IQPA 1J99A 3IQXA 1D9ZA 2IXGA 2P5SA 1VHLA 2VF8A 1KGDA 4V0KA 1G5RA 1CP2A 1WF3A 4L9SA 1KMHA 3KJGA 2RGBA 4JLDA 1ZM4A 4OHYA 3KUDA 2FFQA 4QBFA 2G0TA 1Z22A 2C03A 4PZLA 2IWRA 4GI7A 4FCTA 4JSTA 1P75A 2JIZA 3C41J 5HPYB 1II8B 2W6ID 3NC1C 3TR0A 1XCGB 2QL6A 3TSWA 2B8TA 4TT3D 2ERYA 1KSHA 2EWWA 2DFNA 4NCJA 5TV2A 3TKLA 2RB4A 1S9HA 5JJLA 1E2JA 2GZAA 5AR1A 1VG0B 1UKZA 2BKUA 1KI6B 4UKDA 3I92A 1KK2A 4AY2A 2JLWA 1D9XA 1EFRA 1ZINA 4IXMA 4DSUA 4PHTA 1T5IA 1CBUA 2CCKA 3GJ6A 4XH9B 3IHLA 1BS1A 2XGJA 2GEDA 3T1QA 1OXVA 4OI0A 3CLVA 1UKVY 2WIAA 2WHXA 2PZFA 4B35A 1N0VC 1W36B 3QF4B 4KFTA 5KDOA 1KO8A 4IOLA 5C18A 3L43A 4YDHB 3CKLA 2G6BA 1E9EA 1SXJD 4OHZA 3RSLA 2Q3MA 1GIAA 3N5CA 4F4JA 2BEKA 2YWEA 5TVKA 1EWRA 4IXNA 1OH8A 4XVRA 2V3CC 3IHWA 4CEHB 3O47A 521PA 3U60B 4YLGA 2KJQA 1R5BA 1GVNB 3SJCA 4Q19A 5BXQC 3P32A 2XOKD 3U5ZB 1L8QA 3WY9A 2A5FA 1NLZA 3OE7A 5SZKB 2YWGA 1ZC3A 4ZI3A 1E32A 1MO6A 1OXTA 3AF1A 3HYTA 5IT5A 3IEVA 4HZUB 2Q3HA 4B48A 4MH0R 1ZNWA 1GL9B 1LW7A 2CL7X 3KXLA 1GILA 3QG1A 2A5GA 2FPLA 4P4TA 3SFZA 1W0KA 4EIWA 2QTFA 2ZRMA 3MG9A 1XMSA 4B3CA 4EPRA 4ILEA 3A4NA 1FQJA 4QJ4A 1T3HA 4U7DA 4M1WA 4MGZR 5KPJA 2VSOA 2Q6TA 4XWAA 1QRAA 4D6PA 3BB1A 1DAIA 5FH9A 3T12A 1G5PA 2QAGA 1UADA 2YHSA 2ZTSA 1UDWA 2F3TA 3FOZA 3R7WA 4NH0A 4HDQB 1G9XA 3FKSA 1ZCBA 3CF2A 4LSGA 4BFVA 3F0TA 1N6IA 5FBRB 1SVLA 3UWOA 3SQXA 1UM8A 3D31A 4EPWA 3K0CC 4DSNA 2NTYC 3GD7A 3TUJC 5JHGB 4LBVA 4V0OA 2EFGA 3RLFA 3Q9LA 3FMIA 2R6FA 4FMDF 1CRPA 1XXHA 1VCIA 4LHYA 3ZD7A 1DARA 2IW3A 2EFEB 4XWKA 1E2PA 1AJEA 4TLCA 1RIFA 4ZKDA 2C95A 4QHSA 4TLBA 3EPJA 2QU8A 1NBME 2XTMA 3IQWA 3SYLA 4IHQA 1DPFA 3IIJA 3X1XA 1IM2A 3NDBB 1S9DA 4ZDIA 3PEVA 2ZUCA 3W6OA 2P0EA 2KBEA 4G5GA 4PO8A 3NC0C 2RKOA 5C2JB 3CH5A 1BKDR 3RRZA 5GVSA 1I4LD 1AGPA 2QMEA 3LDAA 2QTHA 2WV9A 2GBLC 4BPBA 3DM5A 2OCBA 2OHFA 4PAQA 2WM9B 1II8A 2A78A 2GJ9A 1CR0A 4L5BA 4V0LA 3X1DA 3LXRA 4F4IA 2O5VA 1KO7A 5TB5A 3IIMA 3A1UA 1E9BA 4M9ZA 3F3YA 3AF0A 4DUGA 3ETLA 3P4YA 4S2EA 4JLAA 1OJLA 3DMDA 2H17A 3NIBA 3GLIE 3HR8A 1SXJB 1I2DA 3LFUA 1OV4A 1ZP6A 5FUXA 1VPLA 4RD1A 3FKQA 3A36A 3THYB 4HB4A 5DHFA 1VDZA 4NPHA 1G8GA 2IYSA 4PSVA 3ZD6A 3QF4A 3SN6A 2GJKA 3K70D 3DM9B 2YWFA 2QNRA 4R2HA 3RS5A 2XJ4A 2F1JA 3BFVA 3ZIAD 2CEAA 3U3RA 3OIUA 3LVRE 4N1AA 2NZ8A 1G3UA 3GEEA 2VP9A 5HZHA 4AG5A 3K0AB 3A1SA 2CNWA 2ATVA 2ONJA 2VP4A 1ELOA 4BLSA 2IYXA 1WE2A 1NJFA 4CEHA 1P9NA 4LOAA 1QHHB 2OO7A 4WBSA 4B3FX 1FUUA 5CB6A 2JLVA 2O52A 4Q9JA 4O3MA 2QROA 2ZS9A 5EUMA 4DCUA 2GCOB 4Q48A 2O8DA 1T4GA 4BECA 1FX0B 1LV7A 1SKYE 3CB4A 1IY2A 2WSSD 4HZUA 1IN8A 2J7PA 2FJUA 2ZR9A 4XSHA 3EARA 2VL7A 1R10A 3RYTC 2ZXUA 1CKEA 1G8PA 2F3RA 5AWFC 2A5DA 1IY1A 1UKEA 2CL0X 4RKFA 5FTLA 3VKHA 5FBWB 4TQ9A 4M9QA 1QF9A 2WJHA 1R6BX 1UEIA 4TZ0A 1UBFA 4LC1A 1N6NA 5GJVC 3EW9A 4NCIA 1F48A 2ZI3A 2WTUA 1E2FA 3VHLB 4PQYA 3BH7A 4UXHA 4LJ6A 3LQRA 3NWJA 3GLFE 3GLIB 2F9MA 4DWJA 1RE0A 4JVNA 3RAPR 3SHFA 1YR8A 4NBSA 3FTQA 3EZFA 3RRNA 2GHIA 1IN6A 2OT3B 4AKEA 1E2KA 1OIVA 2QRNA 4PQRA 1LVGA 2K5UA 1HV8A 1DAMA 2C9OA 3QPUA 5AJXA 1SQ5A 4PPQA 1Z08A 1HQCA 3KKQA 5HE9A 3TW4A 2WMNB 4JZKA 4PZZA 2HEIA 1W48A 1YRAA 1GRRA 2PJZA 2Z83A 4I1SA 4P4SB 5J4HA 2PMKA 3KJEA 1G17A 4C2TA 3I4LA 3KJIA 3SJZA 4A0RA 3ND8A 1CEEA 1KSGA 2CL6X 1MO3A 2P6NA 3DOEA 4DXAA 3GP8A 1OFHA 4A15A 1YKSA 4LV8B 4OI4A 1M6NA 1HE8B 3EZ9A 3PENA 2G88A 2J9RA 5G41A 2W6IA 2ZI7A 2PCJA 2R44A 4TT3A 4LYJA 1GFIA 2FMXA 4TTRA 4UXJA 1W46A 5EE5B 3GJ8A 1DOAA 1E4VA 3AKDA 3QKUA 1Q1BA 1Z29A 1E1RD 2ZU0C 4IFBA 4KHZA 3ZDQA 3KFXA 3AVUA 5A0FA 2XX3A 3C16C 4PO1A 2WWGA 1E0SA 2YZ2A 2XB4A 2R8RA 3QBTA 2QG6A 2RMKA 4M1TA 1W5SA 2GF0A 3NBYC 5FTKA 4BEJA 3ONWA 4G3XA 2WJVA 3GMTA 4QJ3A 3NHAA 2CHGA 4KI0A 3HJNA 3SS8A 3V4RA 2FG5A 4I1UA 3X2SA 4HAYA 2ZPTX 1Z6GA 2GXUA 1UBGA 3HPQA 1W1WA 4Q21A 3K70B 2VLIA 4B76A 5KSPA 1JR3D 2ZR0A 4ZI2A 3U6KA 1W44A 3KXKA 1HURA 2ZYVX 2IYZA 1SXJA 2CXXA 4HAXA 4HAVA 1JPNA 1T6NA 3G5UA 3M4YA 1JALA 4JVLA 3THYA 1U9IC 2EYQA 3EZ7A 2KBFA 5FUVA 1S96A 4ZO4A 4TMXA 3RS3A 2F6RA 1XZPA 1GP2A 1GNQA 2QPTA 3GCGA 4EUNA 4DLTA 3EASA 2UVQA 4UNPA 5IHPA 4DEXA 2XOKA 2ZRAA 121PA 1IHUA 3K0AA 1KDTA 1QVRA 4TYPA 5LPNA 2YOGA 5CK5A 5J47A 1TF2A 2JLSA 1Z28A 1QHHA 5ELXA 3IIKA 2A7QA 1G6OA 5CM9C 4EFNA 4JSYA 3H2YA 1XD8A 4BRUA 2BDTA 1FPMA 1S1MA 2GCOA 2QTVB 3I5XA 4D0NA 1F3OA 1P4SA 3QXXA 1TTTA 4JLMA 1FX0A 2FPKA 5LD2B 1QZXA 2QP3A 4QRHA 4OQNA 4PZYA 5CIQA 1MRSA 4EQ6B 1Z0FA 2NGRA 1NKSA 2QZ4A 4B43A 1D8TA 3QEJA 2H8KA 1CLUA 1F60A 2AHOA 4BFZA 5LB4A 2AKAB 2WOOA 5FPYA 1WXQA 1RC8A 3Q8XB 1PJRA 2GEUA 3B82A 4BFWA 3TMKA 1QHXA 1JQJC 3GLIA 3GLGE 5FFMA 4WXPA 1IN7A 1GNPA 3K09A 3CPJB 1VYTA 2BV3A 3QXHA 3B1VA 2VYFA 4RZ3A 5DLQC 3ZYCA 1A82A 1G3IA 1SVMA 4AKGA 4MRVA 1NIPA 4QGFA 2O8DB 3UMSA 4FXPA 5DISB 4A6XA 2ERXA 4P4SA 1Q21A 1Z47A 4A2WA 1AS0A 5P21A 1E2IA 2GJAA 4DLVA 4LV5B 2Z0MA 4EJSC 3QI2A 1OYWA 1J90A 1KK0A 2YJTD 3SOPA 3AF2A 4DCNA 1FTSA 4L8GA 1G8YA 1R0XA 3E2IA 1D2NA 3EXAA 5GADl 3TUIC 2HJGA 3U61B 1N6RA 5KYKA 5KDDA 1BYUA 1VG8A 5FPKA 4DLRA 3EA0A 3MCAA 4RD4A 2AXPA 5GJWC 3KKNA 4Q4JB 2EWVA 2NO7A 2JLZA 2WAYA 4NP6A 5FL3A 3TJZA 1SHZA 3AVQA 2N46A 4O2LA 4Q9IA 4Q1AA 1JR6A 2JJ2D 2JCSA 2F9LA 3FVQA 3GQBA 2R9VA 3DL0A 4B3XA 3EZ6A 2J45A 2IF2A 3IDQA 2IX3A 4DZZA 2ZRCA 4JKYA 3VHXA 2ZVPX 3W8RA 2EFDB 2CLDX 2CCGA 2D2FA 4GMXA 4BRWA 4C9BA 5DN6D 3BIFA 2PX3A 4P3YA 1HUQA 4M22A 3LW8A 4KJZA 3ZIAA 3AV0B 1VTKA 3T1OA 1W5TA 1B0UA 1XTQA 5EP3A 2UZ3A 2IUTA 3A6PC 1TU3A 1KDRA 1FMJA 2FFAA 4KO8A 1M34E 1T3LA 2QMOA 2X2FA 4PPNA 1MH1A 2G83A 2P67A 3IKJA 4ON9A 4RKEA 4TL6A 4IRUB 4OHXA 1W0JD 4KBGA 4PQFA 3I32A 1KSJA 4BFUA 2BM1A 2BHRA 3FFBA 5FI0B 1NL3A 3JZAA 4K81B 2IYLD 2ZREA 2FGJA 3FHCB 3H86A 2WSSA 1ZC4A 1Z6XA 5AUOB 4GBMA 4JLJA 4ERNA 4BZQA 2BBTA 2GWHA 1G18A 4P4UA 3WRXC 2ZJYA 1VIAA 5CM8B 3BWDD 2EW1A 1P7CA 2CBZA 4L16A 2IS1A 1W0KD 4NE2A 2HJVA 4CZ2A 3TGPA 2FZLA 2J3EA 1U8AA 1UPTA 2GDJA 4EDHA 821PA 1XTSA 4O0MA 621PA 3VAAA 2A5JA 1E2DA 2O0HA 4MUBA 3VR5A 4EQ6A 1QG4A 1W7AA 2V6JA 3P26A 4CW7A 1JNYA 1GWNA 1NLFA 4GP6A 2ATXA 4NCKA 2V1XA 3FKSD 4FMDB 4FCWA 2H92A 1MRNA 4URVR 3I8SA 4HB3A 2GTPA 4BLOA 4OQFA 3TW8B 4BZPA 5K8LA 3MSXA 3QY0A 2AWNA 2VHCA 4TMTA 5TY0A 1G7RA 4C0LA 4Q1DA 5FOTA 1KY3A 1COWA 2AFHE 5FOUA 4LC0A 1Z6YA 4EPVA 1E6CA 1SULA 2RAPA 1G3RA 2OBNA 4BFTA 5FTJA 5LDDC 5C4MA 1E1RA 5L3RA 1TUIA 2ZRKA 4HAWA 4JVMA 4UJ3A 3MGCA 3L8YA 1I4DD 1XB2A 1PZNA 4US0R 4AKHA 1ZM3A 2RGEA 4LYHA 1X8JA 4CF7A 2VP5A 4HLDA 2O0KA 4WXRA 4DLWA 1ZAKA 2ODNA 2WZQA 4AK9A 2FFHA 4C3ZA 1JAIA 2W83A 4Q4JA 2FFBA 4PTLA 1YJ5A 1KZGB 2PLRA 3CRQA 3I73A 3KKPA 1Z83A 2YYZA 2AD1A 4TLEA 3T06B 1JR3A 1QDEA 1W2HA 2FF7A 4A8JC 3FGNA 3GJ0A 4DUGD 1GL7A 3MLEA 4B2PA 1G7SA 4EFMA 1K5GA 4JLPA 2OESA 3HR7A 1EGAA 4D4MA 4Z54A 5CJ2A 4Y0AA 3IPXA 3PG5A 2W2VA 4G01B 4PC7A 1S0UA 3PITA 5LB2A 3WMFA 5F3WB 4FINA 1IOZA 2Q0HA 4AWXA 1VHTA 1XMIA 4BFSA 1HT1E 5JECA 5JEEA 5DHAA 3KJHA 4PC6A 3CO5A 3PVSA 3I1FA 1W4BA 2P2LA 2QT0A 1NKTA 3EC1A 2JLRA 1N6HA 2RGNA 2X1VA 5FTNA 3UWKA 1BYIA 2QA5A 1RJ9B 2AWOA 3AP2A 2FDCA 2GNOA 3MWLA 2YC2C 2QENA 5EZ6B 2FSGA 4IFEA 1P9RA 1ANKA 2H5EA 1JB1A 4OQLA 3HDTA 4LDJA 4WZ6A 3UKDA 1VIYA 5FOWA 3FWYA 4B33A 4DRZA 3J81k 1G16A 3SJBA 2UZIR 1KY2A 3KXIA 2BBOA 2FU5C 3WHKA 1OB5A 3HWSA 3OF5A 4G5QA 3O8RA 4Z1MA 1EX7A 1ESNA 1JJ7A 1U0HC 1BH2A 3LBHA 1XP8A 4CVNA 2ZJZA 5KNDA 2XZPA 4V0MA 3W3ZB 1AZTA 2ORWA 1KKMA 3QSYA 4ESVA 2P3SA 3SNHA 4EKDA 1II9A 5EE1A 3IUYA 1DO2A 3NXSA 3SYKA 3RC8A 4MKGA 2ZYWX 4G5SA 4KSBA 4A2QA 5DYGA 3ZVLA 4EPTA 4TYWA 3GPLA 3N70A 1KI9A 5SZJA 3JZMA 5J40A 1UJ2A 4RD6A 4KU4A 4MDEA 5B64A 2MSDB 1Q22A 1TPZA 3GJ5A 1OFIA 4PANA 2ZUBA 1RVDA 5KSZA 1W4AA 2XITA 1IJEA 2PT5A 1EFUA 1TX4B 3IGFA 4Q1BA 5JS8A 1G20E 1KI7A 2ZROA 3BBPA 3W3AA 2NIPA 2QP9X 3GJ7A 4NL4H 2J7KA 2FSHA 3H0KA 5A4JA 1OXUA 1YZQA 2YC4C 1UBCA 4YDSA 1KJYA 2RH5A 4ASUD 4PC2A 3KFVA 1NIJA 4NZYA 5EXTA 2V6IA 2QSZA 2JJ2A 3CRVA 2V7QA 3LVQE 5FUWA 1ZUNB 4B71A 1WBBA 1S8FA 2IA5A 4ZV4A 4JL8A 2ZQ5A 4LGMA 4LV6A 1OPXA 5AJYA 5J5CA 4QHYA 5CYOA 1VYVA 1YQTA 4RD2A 4GMDA 1KAOA 1AKYA 4LHXA 2QN6A 4LJ5A 4FD2A 4PX9A 1C4OA 1ZM9A 2NOAA 3EWSA 5DN6A 2C2HA 3PJRA 1QBKC 3AVTA 4E5UA 2G9NA 2HLDD 2OCAA 2ZJ8A 1TF7A 3AUYA 2I1VB 4Q03A 5JEDA 1WQ1R 2CVFA 5CYPA 1LFDB 2I4IA 5F9HA 1OH6A 2ORVA 2ECKA 1XWIA 4JKIA 2EU8A 1LF5A 1NN5A 3EZ2A 1LF0A 3EPKA 4AYXA 1W0JA 2HCBA 5KDLA 1E0KA 3LA6A 2ZVQX 3P4XA 4R7ZA 5H1YA 2IXFA 1ESMA 1RYFA 4MA4A 4ZKEA 3LV8A 1NVWQ 1WDTA 1YE8A 4K46A 3QEOA 1R0WA 4NONA 2HCJB 4QGGA 3A1WA 1Q1QA 3L0OA 1CR2A 2IYQA 3K0CA 1OF1A 1SGWA 2RHDA 1S1CA 1NBMD 4D4LA 4Q02A 1HA3A 5JI2E 1RJ9A 2FEOA 4NHOA 1AS3A 1HT2E 5FR1A 5EJEA 4ITRC 3U7GA 4Q7KA 3CX8A 4XTRA 4DHEA 4PSKA 1AS2A 2J87A 4YMUA 2OBLA 3LO5A 3WXMA 3D6TB 5B30A 4DLXA 5G3YA 4XVQA 1N25A 1IXSB 3IBYA 4QBHA 4YXWD 2VP6A 3HU2A 4A1FA 4ZDKA 1XD2B 3L82B 3U44A 4OK3A 2OV2A 3C14C 1U90A 1XU4A 1QHSA 1N5JA 4DT1B 3CR7A 4A9AA 4XSGA 3LH5A 1N5KA 2GBLA 3NEJA 4IW3B 2V4ZA 5KSOA 4MKFA 2OFOA 1BO6A 3RSOA 4NCNA 1Q3TA 4P0TA 1KMQA 3LLUA 4MGIR 1TUEA 1LNZA 4TQAA 4X8HA 5EZ5A 2NO0A 3CW2A 1R0ZA 1M7BA 1NVVQ 3CPHA 5IRCD 221PA 4DIDA 1DBSA 2XAUA 1XF9A 4HUQB 2OLJA 1WBDA 1P72A 1IJFA 1TAGA 1Z0KA 2E87A 1US8B 1U8ZA 2NO9A 1Q44A 3FYHA 4LPSA 2BEJA 1CF4A 2RGAA 5AJZA 2IK8A 1G8FA 1CS4C 2YOHA 5CLLA 3PUVA 2Y8EA 4W5JA 5JCZA 1P2UA 4TMVA 1ZYUA 3P27A 1VMAA 3PR1A 1EESA 2GAAA 1N5IA 2NO6A 3TBKA 2IT1A 1CJUC 1ZU4A 4II7A 3ZVRA 3UANA 3RRYA 1E69A 2F55A 1KO1A 4KYUA 1R4AA 4LWZA 4RD0A 4B74A 5B2ZA 3X1WA 4NTZA 4YMWA 5HCNA 1NSFA 4QBIA 4MKHA 3CPEA 4ZPXA 4BASA 5JRJA 4MDFA 3CZPA 4ZIRB 4LUCA 1KI6A 4RCYA 2V1UA 2B6HA 3BORA 1GG2A 1R8QA 1ZMXA 2QAGC 4IVPA 1T8TA 4B32A 2X2EA 3B5JA 4RY2A 5KSYA 5KNBA 5JRZA 4OQMA 3CWZA 1LS1A 2FWRA 1TU4A 4TYQA 4ZDJA 1CU1A 4KODA 2EFCB 4DCTA 1OKKA 4WOPA 2PBRA 1KKLA 3RS2A 2CVHA 2BBWA 4AYWA 1I4TD 3PUWA 4I99A 4OQXA 4TTQA 2OFWA 3SHWA 1YR9A 3X1YA 1JBKA 1X6VA 1PLLA 2W0SA 2HT6A 3REGA 4D0GA 4WA7A 4LBYA 4RFVA 3N2EA 2EYUA 3ZQ6A 3A1TA 3RRMA 3RS0A 4QM6A 5KOYA 3GJ3A 1WCV1 1YZUA 1JJVA 2QE7A 3NBXX 4HB0A 5EE3A 3SR0A 2XXAB 6Q21A 2A30A 1HTWA 2QSYA 3C5HA 2L0XA 2YKGA 1JI0A 3R8CA 3BXZA 2ODEA 4JBWA 3UATA 2WKRA 3SEAA 3ZZ0A 4XWOA 4WZAE 5JJKA 4JJZA 5G40A 5KHOC 1FNNA 2B8WA 3RS7A 4AG6A 3AVOA 5E7IA 5CDFE 4PPGA 3PUXA 3B9PA 5TXGA 2J0SA 4KBFA 4QBGB 1N6OA 3JVVA 1N0WA 4G5OA 1B23P 2C78A 1NMZA 1N6PA 2PZEA 1G3MA 4XIGS 3K9NA 1ZM2A 2QPAA 4NCHA 4M1MA 1E96A 1XD2A 3WNBA 4L4UA 3L0SA 2BCJQ 2OUKA 5HTKA 4A0FA 2QEQA 2H16A 3EC2A 3GEHA 1W36C 1KI1A 2LWIA 4Q5IA 2Q3FA 3M1IA 1J7KA 1XTRA 4DT1A 3GJXC 3OEHD 1KO5A 4LYFA 1FP6A 1WB9A 3KTAB 2IF0A 1SKQA 2IYRA 4HAZA 2CHVA 1Q1EA 3BC1A 3B8HA 4TSFA 4AYTA 4KCGA 1RRFA 1AQUA 4ACAA 2O8FB 3U7FB 3C7KA 4TQUS 4HSEA 4PXAA 3WYGA 1IN4A 1Q0UA 5E7MA 1YZTA 5EP4A 2BKEA 2OE2A 5CIWA 2VA8A 3R9IA 4CGZA 4Q4LA 1COWD 1Y63A 4HUQA 4R98A 1ZUIA 3AP1A 3M0EA 4JLKA 2PJRA 2WMOB 3BH0A 1GSIA 3U3KA 1US8A 3CNLA 3KKOA 4ASUA 2BOVA 5G53C 2XEXA 1N3BA 1NG1A 3ZVMA 3WYFA 1F5NA 1U9IA 4F92B 3LQQA 5HCIA 2AFIE 4JVSB 1E9DA 1EFCA 1SKYB 4JIMA 2QRZA 3CX6A 3NBZC 2R62A 2GJSA 4A6PA 3TVDA 4BZXA 1ZW6A 3FHOA 3W6PA 2FNAA 3AKCA 3TH5A 1YU9A 4GFDA 2EQBA 1E2EA 4Q1CA 1KOFA 3CRMA 4ZIRA 1BIFA 3I61A 4BFYA 3C5CA 2HLDA 4HEJA 4G5RA 2W2TA 3IBGA 1A5TA 4A0GA 2QUZA 3GLFB 4C0HA 1JAHA 1N0UA 1FFHA 5DI9A 2R2AA 1X8KA 1HH4A 1V43A 2BJWA 3BAFA 2CK3D 2DWQA 1N6KA 2DCUA 3KDSE 5FPSA 2N1BA 4B3GA 1CIPA 2B7BA 2RCNA 5HR5A 4YMVA 2G3YA 3L2OB 3QPVA 4I1VA 2NQ2C 2AX4A 2E1RA 2VRWA 3BD9A 3SC3A 3TUZC 3T1TA 5C1BA 5DSZA 3B9QA 3RANA 3A4MA 2C9YA 3DKVA 3B1ZA 3BH6A 2RGCA 2C96A 3KZ1E 4LRWA 2C98A 3UG6A 2ZM5A 1X8LA 3GLHE 1OFTA 2MMCA 2ZEJA 1NBMA 3WP1B 4E07A 4PHFA 2WSMA 4QXAA 5H70A 3SDZA 3VR2A 2XXAA 4X8MA 1KYIA 2HYIC 5BW8A 4ABYA 2ZYUX 5FR2A 3A8TA 4RCZA 5DO9A 1NRJB 1XJQA 4YXWA 5JFGA 4QG7A 3B13B 1EWQA 1LY1A 1OB2A 1VCNA 2HXYA 3KKMA 1NMXA 1HQYE 1NMYA 1JQLB 2P65A 3Q5EA 1N6LA 4NMMA 1BMFD 1RKBA 5J4YA 3U6BA 3CF6R 3O8DA 4R9UC 4Z1MD 3MAAC 1AKEA 5FOSA 1W4RA 5CJPA 5CITA 2B7CA 2IEZA 1E94E 2REOA 5JMTA 3R20A 1XNJA 5UKDA 2QORA 1EXMA 1SXJC 4Q9LA 4F7WA 1NVXQ 3QXSA 1DTSA 3AKEA 4QKQA 2ZIAA 4RVCA 4MYCA 4GT1A 2PLFA 2FH5B 1TEVA 4RJLA 2GXAA 5IF9A 3ZGXA 4LPKA 1NN0A 3HPRA 4NYIQ 2ZI5A 4HLCA 4L15A 2OM2A 1NP6A 4LJ4A 4UNQA 5BN4A 5L3QB 4JL6A 1MT0A 4A8JB 4Q7MB 3KTAA 3X1ZA 3BB4A 1KI2A 5SZIA 4A0HA 1E0JA 2IC5A 3EPLA 5EE9A 1NSTA 4M1SA 5J4KA 2W00A 3CNOA 3OZXA 3CX7A 2O8FA 2ANCA 1M7HA 3M6AA 1TADA 1MR3F 4MUAA 2LKDA 3P1JA 2OILA 4RFSB 5TMPA 2AN9A 2R6DA 3DMNA 2J0UB 2EVWX 4LHZA 2ZITA 1OIWA 2FN4A 4JLVA 4BLTA 1S4QA 2VBCA 3FMPB 3QKTA 4MKIA 5E7JA 2V54A 1XMJA 3RWMB 3V4FA 1IONA 2BC9A 2WPDA 2XZLA 2Z5FA 2QGZA 4BLPA 3EPHA 4V02A 2V7QD 4TYYA 2IYWA 4BWYA 2FX3A 4F91B 1F2UB 3AVWA 1NLYA 4OJKA 3RNLA 3W5IA 2IWHA 2GXQA 2PX0A 2W6JA 1OT3A 1L4YA 1D5CA 2MMGA 3OESA 3TSZA 1O3YA 1E4YA 1VECA 1OHHD 1XZQA 3VX4A 4TYNA 1OH7A 4TLAA 2H18A 4LCBA 4A82A 2A5YB 3DZ8A 3GLFA 2F43B 3GLGB 1X86B 2ONKA 4LBZA 1RRPA 5L3VA 1H8ED 2ODBA 5HKKD 3VR4A 1ZNXA 1NG9A 4DLUA 3RWOA 2GF9A 3TVTA 3LD9A 5F98A 2HUPA 5H68A 2GESA 1M7GA 4NU0A 1GM5A 2DHRA 4DLSA 4MQBA 4R71A 2P6UA 3G0HA 3LRPA 2HF9A 2I1QA 2V55B 3AP3A 2JLXA 1DVRA 2YNMA 5JBQA 1MOZA 3B60A 4LJYA 3TQCA 4AD8A 1GUAA 1FW6A 4C30A 3W8NA 1MABB 1KK3A 2GA8A 1EFTA 3G82C 2IBMA 2DFKB 4ESHA 1XX6A 1Q12A 2QY9A 3I3SR 4MRSA 3EWAA 4GZMA 3HU3A 3K0FB 2A9KA 2IHBA 2PH1A 4HB2A 4NDZA 1F6BA 3AQ4A 4TMKA 1CR1A 2GK6A 3CWQA 2QBYB 2HT1A 2BBSA 2Q9CA 4EFLA 2ZJ2A 3C8UA 3DZDA 4MYUA 2X77A 2ZJBA 2MSEB 2OG2A 2HXSA 3RC3A 1P5ZB 4QOSA 5C4GB 2DY1A 4JBYA 5GJCA 1TL7C 2E9SA 4LBWA 1ONBA 4LJ7A 4NYJQ 1IN5A 1G7CA 4Q9KA 2IYTA 1NN3A 4XVUA 5SZHB 3BERA 4DSOA 1FP7A 2GETA 1H8HD 3OEHA 2P6RA 2J5XA 3AVYA 1C1YA 4TL9A 3QPWA 4OK6A 4JLNA 1Z0DA 3L0IB 4IDOA 1NNEA 2Z6VA 4KFRA 2OAP1 4D25A 3PUZA 1EX6A 3UG7A 2QQEA 3GFTA 3AVXA 1YZKA 2DPXA 2YV5A 3RDPA 1Z6TA 4KFUA 2C04A 1DE0A 3RHFA 4LHVA 1ZVQA 3I8XA 5L3QA 1Z0AA 2CMKA 2BMFA 3N2IA 1KDPA 1OW3B 3L8ZA 4A8JA 4DLZA 4PSAA 1LTQA 4QNRA 3I62A 1XEWY 3FB4A 4WVFA 2GXSA 3QIAA 4HLUC 5D3MB 3MMPA 1G7TA 3FHTA 3UPUA 2B92A 3CM0A 3K8YA 3OEED 1D2MA 3QKRB 2F1HA 2IEYA 2CLCX 1D6JA 4Z8XA 1CJVC 2ZU6A 2PEYA 2ZRGA 2YWHA 4US1R 3B1YA 3Q7QA 3OIYA 3DKPA 4M8NE 2C9CA 4RFSA 4BGDA 2XTNA 2YOFA 1G19A 4JMPA 4PC1A 1KDOA 3NDPA 3UK6A 4GOKA 3T35A 4OHVA 4DDVA 2VH5R 1G5TA 2J0UA 3SZRA 3VX3A 5E3HA 1GDDA 4D81A 3T5GA 1XTJA 1R2QA 1K5DA 4M9XA 3ECCA 4UNSA 4LJ8A 5LD2C 1CRQA 2QP4A 3DDCA 1UFQA 3GEIA 3PV0A 3EX7C 1DADA 4Q66C 1DO0A 1VYUA 5F2EA 2JJ1D 2WAXA 3BB3A 1F2UA 3DOFA 2ZSAA 2CK3A 1K8RA 4G0NA 5GJBA 4PC3A 1C9KA 5B57C 1GTVA 3A4LA 1N5LA 2GVDC 4Q9HA 2W58A 4KSCA 4CDGA 1KNQA 1OKKD 2ZSBA 1E2HA 3IPYA 4Y0VA 4KVAA 3ICEA 2PCLA 2VHUA 3FPAA 2F43A 1FL9A 3GLGA 5AJVB 1DAHA 3U2QA 2PT7A 1R5OA 5FL7D 1AGRA 1AZSC 3UXMA 2QGNA 2VO1A 3D8BA 4TTPA 4FN5A 1G64A 5H8WA 3KL4A 1DEKA 2AL7A 3AKYA 3ZQJA 2QE7D 3K9LA 1AIPA 1MABA 2OCYC 5HE8A 3RABA 5G3ZA 2DWPA 4JBXA 1G41A 1GL6A 2IYVA 2PL3A 1DAFA 3VR1A 3HP1A 1LS6A 3K0FA 5KTYA 4QNMA 2OXCA 4OI2A 1BMFA 1TMKA 1FZQA 2GZHA 3K53A 3VFDA 1MKYA 4C0SA 4JLBA 1QHGA 2QBYA 4JLOA 1E2MA 4B3BA 4MRRA 1U8YA 4C2UA 4EPYA 2J0QA 2DYKA 1JXMA 3QVVA 4M4SA 5C46F 3PUYA 3Q85A 3K0SA 5BYJA 2ZE8A 4FWIB 4BFXA 1PVOA 3AUXA 3OIWA 4BEBA 1Y3AA 3EAQA 3AF3A 2CLSA 4TMZA 2JGNA 3VKWA 3LY5A 2WWIA 2ODWA 1XPRA 4DB2A 2NMVA 1M1YE 3WNCA 5FUYA 2JA1A 4HDCA 3VMFA 2WWYA 4D4JA 2BM0A 5FOVA 3PEWA 4URYR 1UF9A 1RPZA 4B44A 1IBRA 1ZJ6A 1G6HA 5TARA 4TL8A 5FBQB 1T5LA 2C5LA 2OSBA 3ZH9B 2O8CB 4XJXA 1DG3A 5CLQA 4LZZA 1ZIOA 1CTQA 4RZUA 4NYMQ 4TSFD 3B7GA 4LX0A 4HYYA 4OL0A 2J41A 3DO6A 4GOXA 3THOA 2WJGA 2YVUA 1P60A 3THXB 5E95A 2AR7A 5J4VA 5EXSA 2C99A 4LK2A 1OLOA 1U2RA 3ZS8A 1A2KC 3SU8A 3BE4A 3MUFA 3TE6A 3K9HA 5D3MA 5FPHA 2QMHA 3D7MA 1YHNA 2KE5A 4JT4A 3QKRA 3BJIC 4TN1A 5CK4A 4UNNA 1CJMA 1II0A 3BRWD 4XD7D 3ZS9A 1AQYA 3W34A 3SFVA 1R8SA 2QM7A 4JL5A 2JLUA 4JYCA 4Q7LA 3A37A 3TIFA 3TRFA 2IHYA 3QUSA 1P3JA 2B21A 4GPTA 1RZ3A 2F1IA 3NEYA 3S1AB 2UKDA 3ADBA 1L4UA 3PQCA 1XDBA 3MRSA 4I4LA 2G1JA 2V8OA 3VR6A 1R0YA 1QHYA 1T0JB 2KSQA 1TNDA 1OHHA 4TZ6A 2CE2X 5JJIA 4DDWA 3BOSA 1M74A 1J8YF 1AN0A 2VEDA 4B2IA 1H8EA 1J8MF 5HKKA 4U5XA 2J0VA 1KI3A 5L3SB 4GSYA 1OSNA 2GVZC 1VG1A 2FA9A 4A92A 4IDNA 4NYJR 2ZUDA 3LBIA 1OXSC 1FUKA 2ZRIA 1CJKC 1Z0IA 4W5HA 1V5WA 4RZXA 4B47A 3VNVA 3F5FA 3WYAA 3U4QB 3H84A 4N0EA 2R6CA 2XTZA 4DDUA 2D74A 8OHMA 5IK2A 4FIDA 3TAHA 3AVPA 3UIEA 2GKSA 2VIIA 2ZRFA 3KUCA 4LHWA 3MJHA 4TLDA 3B78A 4KAXA 2NZJA 4IVRA 2J59A 1P62B 1CXZA 1VCOA 4W5WA 4C4PA 4HATA 4MYHA 4CIDA 4KFSA 1G1MA 3RS4A 4DDTA 4OBEA 5JZVA 5F9FA 3KX2A 4Q01A 3QF7A 4M0LA 4Q7JB 4URUR 4IJMA 4M1KA 2AKYA 2JLYA 4GP7A 1VG9B 3E5HA 2ZE6A 4Q4HB 4ZCLA 3TAUA 2OAQ1 5AJWA 4C0BA 4L9WA 1XEWX 1Z2AA 1H8HA 5JWHA 4U00A 3BFXA 4LJAA 1ZNYA 4IDPA 3TK1A 3ZJYA 4G1UC 4LJ9A 2FGKA 4JT2A 4I81A 4D82A 1E2GA 3QQ5A 1QHNA 5LBIA 3T1VA 2O8BB 1Z6AA 1OE0A 4B3DA 4Q18A 3QOFA 4KLNA 2CJWB 1XEFA 5FTMA 1KAGA 2MSCB 3B1XA 4FMBB 1X1RA 3QVUA 4H9GA 2JDIA 3NTUA 4IOKA 4O25A 2XSZD 2Z4RA 1SXJE 2O8CA 3AGPA 3MWKA 1XJ0A 4OHWA 1OXXK 3OEEA 2VF7A 3NH6A 4X8LA 4B75A 3T5DA 5FOXA 2Q9AA 3JVUA 1MV5A 2OZEA 1G21E 3U7HB 2H7VA 1LB1B 4PAOA 5DNYB 3MWYW 3THXA 1XPUA 2G1KA 1E9FA 3EA5A 1OIXA 2R65A 1E1QA 1GAJA 4W9MC 3Q72A 3O8CA 4N3NA 4FWTA 2IYYA 2XNDD 3MJRA 2ZS7A 4YONB 5TDHA 4D2IA 2FEMA 5BWMA 2OLKA 3KB1A 2H57A 2I3BA 2WPDD 2JJ1A 5JSZB 3PXGA 1NVUQ 2AK2A 1GZSA 3S1AA 4R2IA 421PA 3SQWA 1W4CA 3REFA 3TSOA 4E03A 3PEYA 2ZRNA 1KI8A 2W6JD 3CIOA 4HUTA 1XD9A 1BOFA 3MFYA 4LYAA 4MRPA 4LY6A 3BK7A 4FI3C 1RFLA 5K8UA 1SVSA 2OEPA 4U02A 1DAEA 4C0AC 5FL7A 5L3SA 2ZETA 4ZDWA 3WMGA 4NKRA 1YZNA 3DEFA 2WKQA 3ADDA 3OFND 1IXRC 2XNSA 1MO4A 1CR4A 1PLJA 2QMUA 2HF8A 4KVGA 2Z4SA 2GEVA 3TLXA 3U4QA 4A2PA 1E9CA 4BQSA 1SVOA 2AK3A 2C8VA 5JLJA 1P2TA 4ZCMA 3R8FA 2O8EB 2IS6A 4QJ5A 1Z07A 4QM7A 4FMCB 4E09A 2XJ9A 4NYMR 4GDFA 3VR3A 3E1SA 3VU9B 4UNRA 2JEOA 2KWIA 4D0LB 2VTKA 4D26A 1TQ2A 4IKEA 2IUUA 1KJWA 3AEZA 5DI3B 3U3OA 3SYNA 1TQ6A 4C7OB 3ASZA 4EJSB 3IEUA 3H4MA 4IDHA 1YZLA 5D3QA 1Z63A 4TWZA 4AIIA 1FTNA 3U7EB 1J2JA 2FSIA 3TR5A 1E2NA 1T0HB 5ANRB 2IS2A 4Q4HA 1FOEB 4IEEA 3W5JA 3PCRB 3C15C 1H65A 3I72A 3WBJA 1S3GA 4HDOB 3LW7A 4YMSA 5AK0A 3GFOA 2NO1A 4F4CA 2O8BA 3ZLJA 4GL2A 1PLKA 4HAUA 2CJWA 5EXPA 4Q4AB 4W7SA 4OK5A 1IXZA 1KZ7B 2IYUA 1DG1G 1KIMA 2IS4A 4DIEA 5JWRA 1PUIA 4FW9A 3TNFA 1GKIA 1X1SA 4QGAA 3VQTA 1E0AA 3GFPA 2DWOA 1X3SA 2GRJA 2BMDA 2JATA 4UJ5A 1ZRHA 2BVNA 2ZI9A 2ZRLA 2QT1A 2WWHA 4XD7A 1KNXA 4ACBA 2ZRHA 4PFSA 2FV8A 4URZR 4KITB 3L0PA 3WNDA 4M53A 1W47A 1GRQA 1ODFA 2J46A 2OXRA 5EE0A 4PR0A 2GILA 3WP0A 2EFHB 2YINC 1Q20A 1U94A 2ZYTX 3B1WA 3PIRA 5BQ5A 3KQNA 4CT4B 3H1TA 1YRBA 2ZE7A 3V00A 5M04A 4JJKA 4QC2A 3UMFA 4QFMA 1DELA 4AURA 5JSZA 1MO5A 3WBKA 3QNUA 5JS7A 5KNCA 1GOTA 1JXOA 1KSFX 5DH9A 3KQLA 2ZJOA 1ZD1A 3DVLA 5EXXA 1RYHA 2FPMA 2JASA 2R6AA 4YC7A 1R5NA 1ZIPA 2OCPA 4DLYA 1XJCA 2ASEA 1E99A 2RGXA 4BLRA 1KTVA 2R6GA 1OYYA 4DEYA 2Z43A 1P61B 2D7CA 4KV9A 5KPDA 3QG5A 1FMLA 5KO2A 4QHTA 2JJ8A 2AXNA 1L2TA 4EAQA 1HYQA 5K8IA 1M2OB 1VKJA 2C77A 2VSXA 3E70C 2VHJA 3LX5A 4M1OA 2ORIA 2D3WA 3CH4B 1NVVR 5AUQA 2BJVA 2O8EA 1Z0JA 2DBYA 2ZJAA 5GVRA 2X8AA 4DC9A 3R9WA 3AH8A 4V03A 3V9PA 2ANBA 3LBNA 1NN1A 3CONA 3QJYA 4OYHA 4MRNA 1XEXB 3VU9A 1AK2A 1E79D 4M2LA 5E4FA 2OFXA 4B6FA 2P5TB 1FQKA 1I2MA 4POAA 1U0JA 1U81A 2QQ0A 4CRWB 1P9WA 3ADKA 3MD0A 1IAQA 2WICA 3HU1A 4GZLA 5DI3A 4C7OA 1ZD9A 3W6NA 4EJSA 2JAQA 3CBQA 2QM8A 2VQSA 1P6XA 1YVDA 1ZCAA 1GNRA 3ZZTA 3QENA 3SBDA 1ZUHA 3F8TA 2SHKA 1XPOA 2ZS8A 1T9HA 4ARZB 4B2LA 1XCMA 2DFTA 1SVIA 4F38A 5K8TA 4WZBE 1A7JA 1F2TB 4MGYR 4RZ2A 2BIFA 1JR3E 2N42A 2WWXA 1GRNA 2LCFA 5KU1A 4URXR 2XSZA 5FPTA 5JWOA 1OH5A 4M21A 1K6MA 1D2EA 3OAAD 4OJQA 3Q3JB 4HLQB 2ZSDA 1DAKA 2ZAOA 1PUJA 1T3SA 1NJGA 4CT5A 1XFAA 3K0EA 4Q4AA 3KQKA 4PAMA 3QKSB 1CJTC 1GITA 5CB8A 3GLHB 1U98A 2IXEA 5L8VA 3BGWA 5B58C 4MYTA 2XB2A 1N2CE 1HE1C 4H1VA 2CDNA 5DIFA 4KLZA 5DGXA 2GZDA 2XNDA 1L7VC 3VKGA 4RSGA 4YQFA 2VSFA 3ND9A 3LLMA 2Q21A 2G77B 3W9YA 3ZZUA 2VHQA 2WBLC 1Q57A 4DJTA 2WIBA 2X19A 1E3MA 2REXB 3DHWC 5EUQB 2REBA 4UQOA 4GNKA 3IO3A 5CDFA 3THWB 3D3QA 3FE2A 4H1UA 1JECA 3LXXA 3QXJA 2VP2A 4Z51A 2JIZD 4DB4A 5HZKA 1SVKA 4X8OA 1S3SA 2H1LA 2D4HA 1Z8FA 4N0DA 3K09C 1UBEA 3QXCA 4Q47A 3WRYC 4P32A 4O2RA 721PA 4V0ME 3ADCA 4XTCS 1ZNZA 3NBFA 4WIAA 1Q3HA 3OFNA 1YR6A 1WRBA 2ZRDA 1G291 4KYIB 1EFRD 2FSFA 3IILA 4FCVA 2PEZA 4Q1EA 5DYIA 2Q9BA 2KB0A 4B34A 2ZRBA 1GKUB 2CCJA 4AKIA 5EQTA 2D62A 4C0KA 3FMOB 3A1VA 3LWNA 5IK2D 2BMJA 1QVAA 3HYRA 2RHMA 3OHMA 4M9SA 3W90A 4BE7B 4UXIA 4B73A 3QE0A 2NG1A 3PFIA 4FMCF 1XTKA 2J1LA 4PPFA 3KQUA 4CEIB 5DE3A 3R9XA 1NY5A 3VNUA 1KK1A 5EP2A 1M8PA 1E2LA 1ZBDA 3AF4A 1TQ4A 4IOJA 1QG2A 2QI9C 1XEXA 4P33A 2RGDA 2ZANA 4PHGA 3FMFA 3ICQB 4URWR 2HV8A 1E98A 4IDQA 3RVBA 1SHKA 3C4JA 2LKCA 4HLUA 1RRCA 3DPUA 1PV4A 4DVGA 2D2EA 3OE7D 1XTIA 1ZU5A 1KO4A 3LNCA 4C0JA 3K70C 3U3MA 1IY0A 1U0LA 4CEJB 3ZVNA 1UAAA 4GOJA 3I5YA 2HDNB 1G3QA 4MITA 3CUEF 3EIHA 1ETUA 3PEUA 4ARZA 4DCVA 5AUNB 1A2BA 2QAJA 2WKPA 2HYDA 3Q5DA 1F2TA 2GCPA 4DCSA 2NPFA 5A5GA 4J0QA 3SJAA 2BCGY
chains in the Genus database with same CATH superfamily
2Y6VA 5AM5A 4KXFB 1CUSA 2IW1A 2ZE5A 2Z8ZA 4BP1A 1X70A 2BFDB 2J5BA 4D4GA 2CUKA 2C8JA 2WJYA 5DIZA 1IVNA 1T5SA 4U7PB 4NH4A 2PZGA 3C98A 1TJ5A 2DPGA 4XFDA 1OAOC 3DV9A 3C4QA 3EUWA 3QKSA 2ZAMA 3PI6A 3TSAA 1A1VA 1U99A 1DS6A 1VA4A 4FYJA 1B26A 3JQBC 3VU8A 4LOKA 5C81A 3S81A 2NTNA 2R48A 4AQ7A 2QRPA 2ODTX 1TE2A 2HWUA 2QPOA 3QELA 1UK6A 3D6AA 4WBNA 1RBYA 2GK7A 4RVDA 1E1QD 4DBLC 5EPUA 4EOGA 1JEDA 2FSPA 2VNAA 4LMAA 4NZ9A 1DG9A 5AKKA 2NPIA 3D64A 3UVEA 3FN4A 3AM1A 1CSEE 5C32A 4J4TA 1RQRA 3QMWA 1VCMA 4B2YA 5JH7B 2AMYA 3DBOB 3BS4A 3NASA 2NVUA 2X7XA 4DKXA 2JL1A 1MJ5A 3VKVA 5I4IA 1N2HA 2DPYA 2CVQA 3R3HA 2X40A 3V8PA 4D8TA 2XIJA 1G8HA 5FI1B 2R8ZA 2IL1A 4RQBA 1I6MA 1DC8A 1W49A 1K8ZB 2WVJA 4LKOA 3SVTA 4PR3A 1WMSA 4Q3OA 4TL7A 4CR7A 3P20A 4GKAA 2XHZA 5J5AA 4AAYA 5LVAA 1NE2A 1NVFA 3TOXA 5B7QA 2Q9UA 1I1QB 2I5PO 3JPYA 5ERGB 1NPDA 3WWEA 3AETA 4K8OA 3BFKA 3GJ4A 2O1EA 3MJFA 3WDKA 2WOJA 3Q8LA 2HMAA 2Z4TA 3TQRA 4QJIA 1V6CA 1QZ3A 3F4KA 3BDIA 5DSXA 1J8QA 5IDVA 4KMRA 3KPYA 3ROZA 4MLDA 1JVBA 4MVYA 4DSTA 3R1IA 1ADJA 4ZC8A 2EBFX 4YJ3A 3WGLA 3AIMA 4E08A 3PYMA 3V4OA 3JQPA 2A8YA 3E48A 4QGBA 4WGFA 4BO9A 1EG7A 3H13A 1ONSA 4BNNA 3QLTA 4HZIA 2FB9A 1GSHA 1QX3A 1GR1A 1VHDA 2B9VA 2OBMA 3HB5X 3MLAA 4J03A 4DM7A 4EHNA 2WA1A 3TQFA 4QT0A 4A4DA 1UEJA 2ORYA 1JWAB 3T7SA 3QE2A 3H2IA 1UQTA 4I1PA 1EFHA 4ENRA 4DQLA 2BWJA 2F1RA 4CMKA 4REOA 2IUSA 3ASYA 3ZWKA 3T15A 1DUVG 5C3MA 5LKAA 2G7ZA 1TVKB 2PMDA 3NC4A 4BO1A 2WJJA 3PFGA 1UK9A 3RD5A 2F1KA 4FIZA 3O26A 4BO2A 3ZHUA 4DA8A 4PZUA 5IWAB 2GASA 3SU8A 3TTTA 5L40A 1FDTA 4MMYB 1Z3IX 1AURA 2VNJA 1SVUA 3MTQA 4UZEA 4NPAA 1NHWA 1PTKA 3OO0A 2JIRA 1RCUA 3BX1A 4QSMA 4BO6A 3FNHA 3ZGYA 1GNTA 2XZOA 5FORA 1UJMA 4N47A 4ENWA 2P9HA 1KJZA 3KB2A 1DRWA 2GN8A 2LR0A 4F9TA 2BKAA 4O4HF 4OKSA 3RFTA 5LP1A 3OAAA 3IMEA 3ZYZA 1XQ1A 1ULHA 3TKYA 1G59A 1ISHA 1B0PA 3U44B 3DVSX 1ILEA 3PTAA 2QAGB 3KOMA 1CQWA 1NOJA 4I8DA 2UUBB 5FFNA 3R7WB 3V42A 4CM8A 4JS0A 3S1SA 1ZRNA 2BSXA 2VHWA 3WAKA 5EESA 1R7RA 4AICA 4BJ5A 5BN5A 3G0GA 3HLYA 5AM3A 1P1IA 3QLVA 4BNUA 4JU9A 6ABPA 2DB3A 2ON6A 3PP8A 5K3FB 4TMWA 2JNWA 5DXJA 3M5WA 4N5LA 3MWJA 1JHPA 1BXRB 3ABRB 3HO6A 2QZPA 2OECA 3WMEA 3RFFA 2P8SA 4C6RA 2BFDA 4Y6RA 3PK0A 4D1YA 4CLOA 4Z4EA 1J99A 3KT8A 1TLLA 5AQEA 3L18A 4BIIA 2P5SA 1ZMBA 1XLVA 2EHJA 2ATEA 2QUBA 1N9KA 1U8UA 4DW8A 2AI1A 2VF8A 3DE6X 1G5RA 1F4VA 1WF3A 1YSCA 4L9SA 2HIGA 4F5YA 2BD0A 2RGBA 3BHNA 1RI2A 2WIJA 4MV7A 6AT1A 1PJ3A 3KUDA 4ZRMA 3WGHA 1MJGM 3M81A 3HYNA 1NDUA 2B4QA 2WVAA 4C3OB 1PK8A 1QRSA 1ND5A 2ZFUA 4HTFB 1Z22A 2FW7A 3EOAI 3KZXA 3HJBA 5K0SA 2IWRA 1P4HA 3WQRA 2OC4A 1I7NA 2ZDHA 2JIZA 3RHSA 4KVZA 1EZ4A 3D4OA 5KX5F 5IBCA 5GGYA 5JH7A 4TT3D 2CVZA 1IOVA 2P7HA 3TLKA 2DFNA 3B6KA 3FWKA 3TKLA 4BO7A 4CMHA 3QU4A 2DX7A 5HJ2A 4E46A 3BTSA 3UGJA 3OIFA 1XZHA 4YV2A 4TS3A 3UJ6A 1C1XB 3E9YA 1KI6B 4QYIB 5DGDA 5LP6F 3F78A 4RPJA 4GQIA 3FCAA 1KFCB 5ICFA 4AY2A 2JLWA 1ZINA 1EFRA 3KAJA 3A6HA 3JX9A 2GZ3A 5MFPA 4D98A 3TW0A 5J1SB 4Y2PA 5JLAA 2EEPA 1R16A 1GCAA 2D59A 1CE8B 1SIOA 3CZMA 4I55F 2LDXA 5EXEA 5DCWA 4EDFA 3HZZA 1Q0SA 4QXPA 4O8CA 1DOHA 3KB8A 3CLVA 4LHEA 2P0YA 5G1NA 4KFTA 5KDOA 5A05A 2LP4Y 2RKWA 3NCTA 1UOPA 4B4WA 1X92A 4HYTA 2XUFA 3WKBA 2JJMA 5KHLB 1Q17A 4L6IA 3KSZO 4QU0A 4EKYA 1Z25A 1NQAO 2HIMA 5F12A 2Q3MA 3N5CA 4EO7A 4EGSA 4F4JA 2CNBA 3QTBA 1OTXA 4AN1A 1OH8A 2OP1A 5JASA 1Y8RB 4K6FA 3ZWXA 2V3CC 3IHWA 4YUXA 1JG1A 5I51A 1UZNA 3VV2A 1VJDA 1LEHA 5FFFA 2ID8A 3HCOA 1P5RA 2NV6A 2RI1A 1FNCA 3LQ2A 2CGEA 1ECJA 3NGLA 3VVMA 5I3ZA 3AEKB 3M2TA 2PQ6A 3P32A 4QO7A 3F98A 4ZVTA 5E38A 3WY9A 1QYVA 5SZKB 2IDZA 5CNJA 2X8JB 1SM4A 1TVKA 3AF1A 5IT5A 3IEVA 1VJTA 2Q3HA 5LQJA 3ZE9A 1OASA 4BFLA 4A8PA 2O3JA 1Y9JA 1ZNWA 2PV0A 2Z9BA 4ZMBA 3NVMB 1UBHS 4ENVA 2YXDA 1Z4LA 2WZBA 1W0KA 3JQAD 5HJ7A 2ZRMA 1SUWA 1Y7TA 9GPBA 1I33A 5EIOA 4B3CA 3O0TA 4S1TA 2BR4A 3LGSA 4WT7A 4OXYA 2BH9A 1WJGA 1U0EA 1UMDB 3C2QA 4IKOA 4JNCA 3Q87B 1JHZA 1Q3KA 3WA7A 4MJ3A 3UM9A 4MGZR 3TQHA 5DNCA 1HRKA 1XTBA 2P2NA 1RWPA 5FV7A 1RXIA 1QRAA 1ML4A 4ZVPA 2Q3BA 1TXGA 1THTA 1YL5A 2G5GX 2QAGA 1ZA1A 2Y1GA 3VXKA 2WB2A 3R7WA 1PU2A 1W9HA 3W6UA 1G9XA 5LN1A 4EX7A 3FKSA 2FZVA 4LSGA 1SA0B 3UJ7A 2R84A 1E3IA 3C8MA 4ZAYA 4AS1A 3RSHA 3UWOA 1BKSB 3NEAA 3OQJA 3UHPA 3K0CC 3NHUA 5CB4F 1DC6A 3OZUA 5K3FA 4B0PA 5CFQA 4V0OA 5IVHA 3RLFA 1ZVVA 4MWOA 1BXRA 2IW3A 4Q3CA 1ZOIA 4C4YA 1R8JA 1C2TA 1AJEA 1D7OA 1EBBA 3HA5A 4YP1A 1ORVA 3IURA 4FYKA 4TLBA 4DCCA 2HADA 4EELA 2A0YA 5GOZA 4BNGA 1AXRA 4RPKA 3ECSA 2XTMA 4B8YA 4ZO9A 4RIGA 3KSRA 3QX3A 4IVNA 2I66A 3CNQS 3IIJA 4MWSA 3NDBB 4JXJA 2C9DA 3OECA 3DDNA 2D0IA 1QCYA 4KL8S 2AH5A 4MHTA 4FHGA 2HBZA 1CS0B 1BEUB 4G5GA 3A3YA 1KR2A 3NC0C 4ZVNA 4HTFA 1JBQA 1I4LD 3VOTA 4R6WA 3UY4A 1VIMA 5BRAA 1YQGA 2OHFA 3H19A 3ANNA 4X20B 2WM9B 2GJ9A 1GSAA 3KZKA 4QXMA 3RWBA 3ZOZA 4TKMA 1S7CA 3LXRA 4KJXA 1L5HB 2GFIA 3PQ5A 2I7CA 2G9VA 4E1AA 1IVSA 4YRAA 1K0FA 2AUNA 1V5FA 3E05A 1C1XA 2HRRA 4HS9A 4QYIA 2Q1WA 2Y1EA 2HOQA 3QZUA 4HRVA 4L22A 4DUGA 1T9GS 4JX8A 3OPXA 4D9JA 5PGMA 4ZGGA 3MTEA 2WJ3A 3NIBA 1ZLXA 2PYDA 2VTDA 4MW5A 4RL6A 4C43A 2EP5A 1OGIA 1SH7A 2FQYA 3Q3CA 4HBZA 1CE8A 1J2RA 1GCGA 5FUXA 3A36A 3JQGB 2ZJ4A 2PSEA 2XBMA 1FK8A 3E8SA 4NPHA 1G8GA 1D1TA 1VLVA 2BMVA 3GEBA 2BEWB 2BCEA 4K03A 4PSVA 4BO3A 3AERB 2GJKA 4RTQA 1FE8A 4R83A 1G21B 3W1WA 5KIAA 4ND6A 1B8PA 4JA2A 5HMMA 5BV7A 1EP3B 2XJ4A 1CYDA 3R3XA 3H1PA 3U3RA 1NMEA 4UBNA 3BN3A 3LVRE 1BEZA 1Z4MA 2NZ8A 3R7DA 3ETNA 3GEEA 4G0MA 5CMLA 5HZHA 3D2AA 3RGGA 3A1SA 4JQZA 2JGMA 2KHZA 2ATVA 1A5ZA 1A3CA 1Y8RA 3ZWVA 1Z4KA 1UCFA 2OO7A 2PR2A 3HU5A 4FR5A 3ETEA 4LCEA 2YHIB 4HO1X 4BMNA 1RD4A 3JQAB 3AEKA 2O52A 5FWDA 2GLUA 4O3MA 2BGKA 4OGGA 1J5XA 4ND7A 4M88A 2ZB7A 5E8JA 4ADSG 2X8BA 1NXWA 1FMTA 2X8JA 1T4GA 5GAJA 1PZGA 2FPUA 4H4CA 2BF7A 4XSHA 1ULTA 3AT1A 3EARA 3RVJA 1Z8NA 1DDIA 1TGVA 1Y9DA 2PS9A 3G2QA 4UAUA 1B6RA 3FRIA 1NVTA 5FTLA 1V71A 4GYYA 3VKHA 3E9EA 3URKA 1C3LA 2WJHA 2HB6A 3R6DA 2DH6A 3R2JA 4I3FA 5D3ZA 1YR3A 2VT6A 4LC1A 1N6NA 2I7TA 4P5PA 5AHKA 5GJVC 1UMDA 5C3UA 2JBAA 3R7SA 3UJPA 3WKEA 2NACA 1CQZA 2ADOA 3FFXA 3DFFA 3LKBA 2F9MA 2PL9A 4KQEA 3O8OB 1RE0A 3SHFA 1T9KA 1TM7E 2AQ8A 3RRNA 5IZ4A 5JNRA 3O8LA 4RELA 1O94D 1IN6A 3QITA 4AKEA 3OUTA 3GJYA 4X5OA 5AJXA 4CBVA 1SQ5A 2CVOA 1Z08A 3KKQA 1SA0A 3H5IA 4YJFB 4OFWA 2WMNB 4AQDA 4P4SB 5J4HA 5CURA 5I8WA 2PMKA 2R25B 3N8GA 3KJIA 4F45A 2P4HX 5CVTA 1EWVA 3KQVA 4DYHA 2IH5A 3N8KA 4KGXA 1GD1O 1XDDA 1MO3A 1HPLA 3SZGA 3SIWA 5GM1A 2UDPA 1X7YB 3A2MA 3HMKA 3I6BA 2VOJA 3D8NA 2QMQA 4NJMB 1GFSA 1J0BA 5JCOA 2CC2A 2JZOA 1F0PA 3EZ9A 4J1SA 5G41A 3ZX5A 1DJMA 1NUHA 3WGIA 4CNBA 4TT3A 2FMIA 4BNMA 2FMXA 4DREA 3GJ8A 1XWFA 2IODA 2QXYA 1CS0A 4FT4A 2ZU0C 1Z34A 4H16A 4KHZA 2GVNA 4UEKA 4URFA 3RYCB 4MWBA 2XDAA 5LL6P 2JFWA 4XDYA 4UU7A 2GNAA 5GZ3A 5KKCA 1W96A 2CT8A 3U4DA 5AM1A 3GQBB 4KBYA 2GF0A 3NBYC 4X20A 5FTKA 1E6KA 3KEOA 2YV3A 3PUJA 3BCHA 3B7WA 3GMTA 3HCBA 4QJ3A 3RM3A 1L5HA 3O82A 2WSIA 2J0EA 5SY4A 4KI0A 5EOVA 3M5PA 2OCXA 3PC3A 4WZZA 4BNKA 4I1UA 4KXQA 4M76B 4WSOA 3X2SA 4ND1A 4HAYA 2ZPTX 2ZYHA 5D5QA 5BNZA 2GXUA 4FGKA 3HPQA 2W6CX 4OQPA 2LXNA 4WADA 4IINA 3EEFA 3R09A 1QE0A 4ZI2A 5KREA 3U6KA 1W44A 3JAKB 4WLFA 1ODJA 3MSCA 4ZHQB 3DE1X 2ZYVX 2IYZA 4KYTA 1NUPA 1P6QA 4HAXA 4BY9E 1USIA 1QO0D 3JQGA 4BUCA 4G4GA 2EYQA 1YGPA 2HSDA 3BILA 3EZ7A 5FUVA 5JS2A 3VVLA 4BGIA 1FQOA 4NENB 4RM3A 4HQFA 2BEWA 2IGBA 4TMXA 5FEMA 4WKCA 2C0CA 1XZPA 2F6RA 2O6HA 3AERA 1G21A 3E82A 3HKDB 3I28A 2IY9A 3V8MA 4F3KA 5BR1A 3H6GA 2ZYRA 5F9MA 1BS9A 2DSNA 3RTEA 3OZSA 5U4QA 1FJHA 3B7PA 2K7ZA 4QTZA 4UNPA 2XOEA 3EQ8A 5K6AA 4QULA 1RQGA 1SKAA 4GYWA 1L7AA 3K4PA 1WZ2A 2DUWA 2H9AA 2HTFA 4X45A 1CQIB 3L6CA 3GRUA 1SK8A 1YS7A 4L8WB 3S5JA 3AG5A 5HRCA 3A31A 2Y1FA 5LPNA 2OFPA 1SWVA 4KB5A 5DTRA 4TXNA 4GWLA 1IRIA 3P8ZA 5ELXA 4EFNA 1QIGA 2JIPA 3WV5A 2YHIA 4DA0A 1OFGA 3JQAA 3TFOA 3BK1A 2VZ9A 1W52X 1QNFA 2D2XA 1TZCA 3LS2A 4RAOA 3UAYA 4K9RA 3I5XA 1RLOA 3AILA 1P80A 1TTTA 4TV9F 4EQZA 3C6QA 1FS4A 1ZD5A 2QVZX 4ZICA 1XPRA 3SMVA 3HCEA 3CVYA 1PQUA 2Z5LA 4LGVA 3K35A 4DANA 2NGRA 1NKSA 4NATA 3LUHA 4JJGA 4BZWA 5MN4A 4FVTA 3ISJA 1PV1A 4KQMA 1CLUA 4PBRA 1RAHA 4ZK6A 4MV5A 4D92A 3MTJA 1P0QA 1QH0A 2EP8A 1LSJA 2WOOA 2BFWA 2E82A 2YY7A 3E0XA 4ALKA 4ENPA 1RC8A 1BE8A 5EKTA 3Q8XB 5AHXA 3ZTWA 4EECA 1UBOS 1VJRA 2GEUA 4ZTZB 3B82A 4BFWA 3TMKA 1QHXA 4BMSA 4EGJA 5A7FA 1GPLA 3P9XA 3D3WB 3O8OA 4QA9A 2VJYA 3C8ZA 3IIIA 3K09A 3E7PA 2APJA 3CPJB 3NW9A 4JQSA 3QXHA 3W3AH 3B1VA 1V5EA 1G3IA 2BP7B 3O3OB 4ZQHA 2AB0A 2WMYA 4LRQA 3ULKA 3INYA 1NI4B 2ECPA 5A2QA 4YJFA 4G4IA 3KTDA 1GCOA 1L3IA 2ERXA 4P4SA 1Q21A 3AHEA 3GC6A 2HQOA 5P21A 4BB6A 4E3ZA 2H3HA 4EKGA 2I91A 4RBNA 5JALA 2A1UB 2GJAA 5TMBA 5F77A 4L0CA 1OYWA 3SOPA 2YJTD 3DTYA 1ESDA 2EKBA 2QS9A 1X7YA 1XA0A 1FTSA 1E3JA 1QORA 2PTGA 3GROA 1OZGA 2CHFA 4ZOAA 3E2IA 4RVSA 4NJMA 3W3AD 1E2BA 1O97C 1VKNA 2DT8A 3U61B 1XJ5A 2DJ5A 3P7MA 3WDMA 2JFZA 2VQDA 3WKAA 4FHZA 1E3SA 4O4LF 5FOQA 4DLRA 3MCAA 3COWA 1WEKA 1AB6A 2C5FA 3KKNA 2EWVA 4I9UA 5CP8A 1WCYA 3RYCA 4OOFA 3TJZA 1SHZA 3GNTA 4F84A 1JR6A 3WLTA 3KPVA 1ZG3A 4F4HA 1HLGA 5FYQA 4E30A 4WPGA 3GQBA 4Q93A 2P1RA 2P77A 3R7LA 4EUKA 1G2QA 5BV2P 5AVRA 3L7LA 1RMYA 2HWYA 1PJCA 2J09A 4MNTA 2IUYA 4DZZA 2HLHA 4BB9A 1SQ0A 1H2EA 4I50F 5H16A 2GPWA 3NVDA 1YU6A 2CCGA 4R1MA 1WU7A 2XB9A 3RHZA 4BRWA 3MXOA 4C4TA 3BIFA 1TM2A 2J3KA 2PX3A 3M1LA 4C9BA 1HUQA 3KT6A 4KPUB 1L4MA 1Y3IA 5B58T 3JAKA 2PA0A 3AV0B 3IP1A 4ZHQA 4CE6A 1W5TA 1B0UA 2UZ3A 2IUTA 5C1IA 4YO7A 2FZCA 2XIQA 3VM6A 1VSUA 3JZDA 3A3PA 3KYIB 1FSZA 3OLCX 4L73A 1EGMB 3EULA 3H99A 4MWDA 4NENA 1M34E 3CA8A 3A7DA 1AZWA 1WB4A 1SC3A 1MH1A 3HVKA 3F71A 1KZ6A 3HKDA 4PPNA 4GUDA 3IV6A 4G67A 3NB0A 1DRUA 1I4WA 4OHXA 1W0JD 1XLTC 3IP5A 3JYNA 2H5LA 5A9TA 2UYCA 3I45A 3JYPA 4BFUA 1D2AA 4F1WA 3WGOA 1NL3A 4EVIA 5DN9A 5KSWB 4WOCA 2PVCA 4R3UC 1NXOA 2IYLD 4D8XA 1MFZA 2FGJA 2BFFB 3BA6A 4LQLA 2O4CA 1CQIA 3FHCB 4OVKA 5D7NA 3IT2A 4D5EA 1Z6XA 1VOTA 1NXPA 4E5MA 1CUUA 2E85A 2I54A 4EW1A 8ABPA 2R4UA 2H7XA 4P4UA 3OSUA 2AN5A 3S5UA 1KC1A 1U2TA 2H1HA 2YXBA 4AUEA 4ZZIA 1H22A 1HYHA 4HNQA 4GRIA 2XKAA 1ISFA 2CBZA 4L16A 3A3NA 4OIFA 3PQFA 4KXUA 4PAWA 3T7TA 2HJVA 2FN7A 4YP9A 1T13A 2GDJA 2B78A 1ZEMA 5EY5B 1ST3A 2JEZA 821PA 1ZJ4A 1LJUA 5FADA 3NJ4A 3VKUA 1EZZA 1H2ZA 2YNMC 3ZI0A 1TO2E 2O0HA 3AFOA 3U13A 4FOLA 1RHJA 3LZDA 4Q39A 1O94A 2WUDA 3KYBA 4GPIB 5FCDA 4JDPA 2Q1YA 4GE0A 2V1XA 2EX1A 4FCWA 3DFMA 1G60A 3U7QB 1NQVA 3E22B 2C31A 3D3WA 2ARKA 3DZBA 3I8SA 2MYPA 4N7JA 3ELBA 5GQSA 3BXOA 1QWOA 2GTPA 2PZAA 5DU2A 4OQFA 3GDOA 4UVHA 2VYCA 3H0EA 2XR1A 5I7UA 1DJQA 3QY0A 4TM7A 4C5BA 1WKVA 3K4QA 2BP7A 1KJJA 3F1KA 2MHCA 4ZTBA 1J0EA 1R5JA 1NI4A 1WD5A 1Y81A 2WUWE 3C5EA 4C0LA 1EUYA 2DE0X 3PRJA 4Q1DA 4XIJA 2JGAA 5HGXA 2PUFA 2RAPA 2F67A 5FTJA 1VQ1A 5AO9A 3PT5A 3MYRA 2A1UA 4HJXA 1B73A 1GQQA 2ZBRA 1OWNA 1LA2A 4QO8A 5DZSA 4B6OA 1YRHA 3I2JA 4QRDA 1I51A 3L40A 4KI7A 4JVMA 1KHHA 3ZDFA 3TLYA 1CZHA 1I4DD 1PZNA 3K72B 3OBIA 3TB4A 5KNBH 4YCNA 4LYHA 1CX9B 3LDUA 4P3KA 4CF7A 2O0KA 3R6GA 3COYA 4RSRA 3VAZA 1EDOA 1XNRB 1ZWKA 4HVLA 2E4YA 4LFAB 4ZO8A 4WOBA 1JAIA 2BGJA 2VI5A 1QV6A 3AZQA 1YJ5A 1KZGB 4XDHA 4CM3A 4ETMA 5ESRA 1QGED 3VUEA 2YBDA 4KQXA 1AHIA 3LOUA 3T5PA 4UUOA 2BR3A 4KX5A 3ZU6A 2XECA 1ATIA 1JI3A 4UQLA 3DXFA 4J2TA 3ZN2A 1WOMA 4XUCA 5JJ5A 3HEMA 5AKHA 4EFMA 1QO0A 1XLUA 1ZD3A 1ZO8A 1UC9A 5KNBD 1PFVA 4JLPA 2OESA 1GGVA 4BFCA 4D9BA 3ERCA 2R4TA 3QQPA 5AW6A 1GTZA 4OXKA 4KPUA 3IPXA 1E9VA 4HFMA 4G97A 4G01B 2WYWA 4OJNA 4DABA 1XG5A 2IYAA 2ZB4A 4X91A 1EXDA 3S7ZA 1VHTA 5DM70 4ZVLA 4GMHA 4V0RA 1NBOA 3GMDA 4ZRDA 3HNOA 3I5AA 4DDKA 3H8JA 5TVGA 2OHIA 2VKQA 1LCIA 5A62A 1JFTA 3MAGA 5CA0A 3PFBA 2GRAA 4P5DA 2HQRA 3PVSA 5E4JA 1OUMA 4LRSB 5EXDA 5IT0A 4R0MA 4FYYA 2QA5A 2HQBA 5I7RA 3AP2A 4DR3B 3HXLA 4IZ6A 4BQIA 5BUQA 3H1AA 1XHLA 1QF6A 1XEAA 2ROQA 5FA6A 4FEGA 1RSZA 2FSGA 4LJSA 2FWPA 2GK3A 2BFFA 1P9RA 4JX9A 3FCXA 1ANKA 3T3PB 4WZ6A 4F3RA 3HCNA 4L08A 2PSHA 1FNBA 4LDJA 4OQLA 5LZ7A 5I7FA 1I3KA 5K20A 3J81k 4MPDA 2D0DA 3HBJA 5DLEA 2VP3A 4EAAA 4IQFA 3HUTA 3WZLA 4LF5B 1BDMA 3QVTA 3DKKA 1UFKA 2BBOA 2XMSA 4PBSA 3L4SO 3OF5A 5FLEX 1K08A 1OB5A 2YWCA 1EX7A 1U0HC 3VV3A 3W7BA 2ZJZA 4LNHA 3S2GA 2XZPA 4V0MA 1K97A 2Y1XA 5JADA 1G1AA 2FMHA 5AOCA 3S2EA 2YJNA 3QSYA 3E7FA 3U7IA 3PLRA 5IDYA 1AKWA 3NXSA 5HZGA 1Z17A 5MF6A 4RK7A 4F2WA 1Y9AA 3RC8A 1NLMA 2ZYWX 5ELLA 1LLFA 2FJ0A 2R5WA 1BD4A 3ZVLA 3ZXSA 2WTMA 3GAZA 3VNQA 4EPTA 2QZ9A 1I9CA 3EQ6A 3CE9A 3GPLA 1J2EA 5SZJA 2X9GA 3D5TA 2GMWA 1UJ2A 1IJKA 3JZMA 2EG5A 5J40A 5THXA 3U7QA 3D2CA 3E22A 4B8WA 3H5NA 2UZ1B 3C3EA 3KQYA 3OLVA 2WQ6A 2MSDB 3L77A 4U9IS 2ZJ1A 4PANA 1OFIA 1WV1A 3G88A 1GUFA 4B46A 5KSZA 1W4AA 3EIUA 2CNLA 4IUCS 1IJEA 1UWLA 1OX6A 1O96B 3IGFA 1V4BA 3QW4B 4XJVA 1K75A 1KI7A 1X9HA 3BBPA 3LG2A 3W3AA 4PS0A 2NIPA 2QP9X 5TMEA 2OPHA 3RVSA 2Q3JA 4IMPA 3WYNA 2I7XA 1VL5A 4AMYA 1TDJA 4C22A 1VGVA 4NL4H 4D0RA 4EY6A 3H0KA 2ZAIA 4J07A 3PE3A 4MI6A 4FLFA 3WOHA 1NBWB 3FPKA 1SG9A 3UHFA 3NDJA 2A1IA 4PC2A 5AD1A 5ITVA 1NIJA 2A9RA 1P0PA 5E2AA 5J58A 1O54A 5GIOE 4EMBA 2C7GA 1Z2DA 3FF1A 4B71A 4JP2A 2OK7A 4ZV4A 2VPXA 4JL8A 4LGMA 5ALLA 5DNDA 4RKRA 1C9YA 1P81A 3GCWA 3HCWA 3ANMA 5CYOA 1YQTA 4RD2A 3RS8A 2Q6OA 4GMDA 4ZAZA 4BNYA 4YX9A 3TLEA 4FD2A 5AKLA 3ZWNA 3PGJA 4DY6A 2NOAA 2IP4A 2C2HA 1GZ4A 1MJNA 4FILA 1QBKC 4F2DA 3PJRA 1B8OA 1L4FA 1Y3DE 1Z4IA 4E5UA 3AVTA 5JEDA 2I1VB 1ORWA 2IPAB 5IBPA 4NDAA 4L4RA 1QP7A 4ZT7A 3HTXA 4EARA 1TLFA 3N0VA 4CHGA 5TF4A 1CY6A 1XUOA 1LLDA 2ACKA 2ORVA 2ECKA 1UPBA 2PBLA 3AUUA 3FNRA 2COEA 3LC1O 1MBZA 3HXOA 3U56A 4D74A 1JYSA 2EU8A 5HBGA 3I01A 1U31A 1LF0A 2O48X 4LVUA 1W0JA 3OHPA 3A6FA 3IXQA 4TSRA 1L3CA 3I12A 4Y98A 3JU3A 4LDPA 4DM3A 2YVLA 4R8SA 3GGOA 4KQWA 3PIIA 1CEQA 3NJ8A 4FZVA 4QGGA 5K45A 4FGWA 1BWPA 1SB9A 5G02A 2IYQA 4RULA 1YQWA 1ZN2A 1NBMD 2DTEA 4Q02A 1HA3A 2MOKA 2WVHA 3WSTA 2FEOA 4D4LA 3QNMA 3WK7A 4NHOA 4G26A 1HT2E 2AZMA 1GUDA 4MVJG 3D4PA 4RNCA 1AMNA 1XZCA 3MTBA 3TZHA 3QUCA 4ND3A 3VPSA 3VH1A 1CFZA 3W8EA 4IMJB 1AS2A 2O2EA 3LXUX 3X43A 5BVGB 5TPZD 1HC7A 2WT9A 4GLJA 4M8IA 3NRCA 2OHOA 5CVCA 1OR8A 1CB0A 4XVQA 1P5JA 1IK4A 1ZJJA 4LYDA 2NAFA 1RM4A 1XD2B 1YE5A 5ICEA 3C8DA 2YZ7A 1BVYF 2B3TA 3KYJB 1PZEA 1V8ZA 3EVTA 4P7FA 2O1SA 5A7GA 2IZ5A 3T54A 4K1LA 4XIFA 1JYEA 2QL7A 1K3UB 3BL6A 2WM3A 3E4CA 3FMGA 3R5FA 3CR7A 4J29A 3A6EA 3H2KA 3BD8A 1D6MA 5KWSA 1XR3A 4CKEB 2VF4X 5CVEA 2V4ZA 1RLTA 3QX7A 3SYTA 4X62B 4ZCSA 2N47A 1WZNA 3OLZA 3D4NA 3SSAA 3KAPA 1BO6A 3RSOA 4QOHA 4J94A 1G63A 3ZY2A 1E6LA 3RK0A 1KMQA 2DLDA 4MGIR 1P3Y1 2YMQA 1LNZA 4TQAA 5C0OE 5EZ5A 1TMGE 2DFVA 4GO1A 4J7XA 4KUEA 221PA 4DIDA 3LHSA 3CR3C 5CFLA 1TAGA 2UZ1A 2AZDA 3RF6A 3LBYA 4UEWA 3FOAA 5KU7A 1U8ZA 1WZIA 3DS8A 4L5IA 1ZSNA 4Q9AA 4EY8A 1C14A 3MJ4A 2FPXA 2IK8A 3AJ9A 2G08A 2RIRA 3N8DA 3LSYA 4BAUA 4MVJF 1TKAA 3PUVA 4IF4A 1RXEA 1O96A 4JJ6A 2GWRA 4KQHA 1VI2A 3P27A 1EESA 2YXLA 3I6YA 4S0ZA 3TBKA 1CHNA 1N2BA 1ZU4A 2GZ2A 3G1UA 3JY6A 4JQOA 4QUIA 3ZVRA 5A0TA 3BTVA 2E89A 3RRYA 3UANA 1E69A 1AKNA 1KO1A 1XXLA 3CZCA 4IGEA 1LGYA 1TIBA 2ATCA 4IXTA 2AYXA 4GX5A 1N3IA 4NTZA 4WGGA 5B2ZA 3LECA 3X1WA 4G56A 2QRLA 4BASA 5JRJA 3UENA 3KLMX 2IZZA 3GA5A 4YIHA 3B51X 1O0BA 4LUCA 4OB7A 3RKSA 4FDMA 3ITKA 2B6HA 1JEQB 3VR4H 4BGVA 3BORA 3NP7A 4TWAA 3TB6A 2X2EA 1BQ3A 3ANYB 2XZTA 4E5PA 5KSYA 5KNBA 2L19A 2B8EA 5G0WA 1UK7A 1QYCA 1Z5WA 1L7PA 1CU1A 4P84A 2BDEA 2PIDA 2JI8A 2Q4OA 2ZYSA 3F6BX 1DL5A 4TTJA 4WOPA 5T6BA 3U62A 1NPYA 3IOEA 1A95A 1XVUA 2A9FA 1UMKA 2CVHA 2ZPUA 2M9MA 3VPHA 1OLXB 4RFLA 2R6ZA 2BFEB 3C6KA 2JI7A 3C1AA 3L7MA 4BO0A 2OFWA 1Z4NA 2ENUA 1XRPA 1FDWA 4DWWA 4D57A 4EBFA 3I6IA 1PLLA 2HT6A 4D0GA 2ZT5A 5AI9A 4LBYA 4RFVA 3N2EA 3M1AA 4LAFA 2F64A 3RRMA 1JMYA 3EY9A 4YUYA 3RJZA 3VPFA 1KJNA 2OMEA 2BSAA 4ZP1A 3GJ3A 5J3JA 2OC9A 2QE7A 1TKRA 3NBXX 5EE3A 3TO5A 2A30A 4N5NA 1GARA 5ENDA 5JC8A 1WR8A 4FQ5A 2VDKB 3F6PA 5A3SA 4ZJYA 1FDVA 3E0QA 3R8CA 1RZRD 5EZQA 3S3TA 1W1UA 1ZIXA 4JBWA 4NFSA 3U19A 3TTYA 3KC2A 1RZUA 1T9DA 4JJZA 5G40A 3B2QA 4EKNB 2IU4A 4MQLA 1H6AA 1DWUA 3AVOA 3OZBA 1LBTA 1A71A 5TXGA 1HNNA 2FY8A 2O2JA 2FZGA 3DONA 2XCIA 4IM7A 1QDUA 2LPMA 2WIKA 3BWYA 3JVVA 4DZRA 3NVKI 1N0WA 2Y1LA 3PC2A 5B1IA 5BVGA 4ZAGA 3E8MA 5EPEA 4UTZA 4MW1A 2H2FA 1RTTA 2IHJA 2SKCA 5EPOA 1R00A 3GWGA 2JFFA 1XD2A 3QLUC 4L4UA 4YMHA 4QYTA 3K2QA 1XMPA 4CMEA 2PZKA 1RT9A 1FFEA 3GEHA 3HJUA 1KI1A 3MQ2A 4IHAA 5BN4B 4FD3A 3GJZA 3O4VA 3GJXC 1FP6A 4NFYA 4HEA6 3TS1A 3WK6A 4CKEA 4GOLD 5SYMA 1U8CB 4GH5A 1Y1PA 1RRFA 2X9VA 3CEMA 1V6AA 4UVIA 4B5KA 3OHSX 4J6FA 3RC2A 3U7FB 5J2UF 1SZDA 1IFXA 5A9RA 1Q0UA 1HDYA 2YV2A 3QV2A 4OXNA 1YZTA 5E7MA 4XR9A 5C8VA 2ZUEA 1P91A 5CIWA 3E23A 3R9IA 4NJEA 3NTLA 1ZUIA 3AP1A 4TGLA 2XQFA 3RAGA 3OWOA 1IZ8A 2FHSA 3CNLA 2MU1A 3CT4A 4UEQA 2ZBDA 4FYHA 3WBBA 1EVJA 1F5NA 1NTRA 1U9IA 4QELA 4UBKA 2I2BA 5B53A 3VDNB 4JIMA 2Z1NA 1DTWB 4L75A 1TJ3A 4LJKA 4TX1A 5HG0A 5FBKA 3FLAA 2B1RA 2GJSA 1J8DA 1PT8A 2BE7A 2JFQA 2P3QA 3IOCA 1CUXA 3JWIA 4GKKB 5CTAA 2WQ7A 4RESA 3G5AA 2I9PA 4AF6A 2C4MA 5KMGB 2EQBA 2V7WA 4ER0A 1MG5A 2V7BA 1RM3A 4PFQA 2E55A 3T7CA 4G5RA 1JEQA 2FPRA 2W2TA 2LV8A 4ENTA 1CB7A 2CXQA 3OH8A 1NMQA 4N39A 3EDCA 4DGQA 2R2AA 3P45A 3D0QA 2BJWA 3GVIA 4O4IA 2D0OB 3KDSE 3MTDA 3OTIA 4CMBA 3HRHA 4KLAA 4OMUA 4KZPA 1BROA 1CIPA 3VI3B 3T3DA 4YMVA 3H9JA 1FXWF 4Z9XA 4EYQA 4DNPA 1I7LA 4D02A 1L5OA 4PG8A 4UMVA 1AGYA 2GRUA 3BD9A 5D6NA 3SC3A 4KVFA 5JAIA 1OLXA 4RTPA 2BFEA 5C1BA 1JFLA 3F3MA 1BE0A 3RANA 3JR7A 2H4YA 2F8LA 3C6YA 2C9YA 2FUG1 3P9ZA 1FMCA 1SC6A 4OHPA 2RGCA 2C96A 4UHDA 4EUHA 3KZ1E 2C98A 4J3JA 5BYAA 3BXGA 3RNOA 3UG6A 2ZM5A 4OFBA 2MMCA 5E0KB 1CDOA 1PK9A 5LSAA 1NBMA 1YJ8A 4PHFA 3OCWA 2HX1A 1TM5E 4LDNA 4QXAA 1QIIA 4X24A 2FVYA 4PF1A 3V33A 1KYIA 4IKPA 3TRHA 2OKGA 4M9CA 5KYNA 3MGBA 4D9EA 1XMXA 4UE3S 3QU5A 4Z7QB 4HC4A 3KSDO 4RIFA 1EXNA 5TPZA 4I4CA 3W4KA 2DHCA 5T67A 2JANA 1YJCA 4RCZA 3TOCA 1AQJA 1XJQA 5AMXA 1L6RA 4DJEC 4D42A 3B13B 1LY1A 3L4EA 4XARA 3WIOA 1OB2A 1QGAA 5F2OA 4LTMA 3WMWA 2XXJA 4H4DA 4C0XA 1N6LA 2HA7A 1L8LA 1RKBA 3CUUA 3JQFC 3KOWA 3TNDA 1GTRA 2XYPA 3C3WA 3COZA 1T1RA 1AKEA 4CMCA 1W4RA 3C6XA 2WI8A 5JMTA 1J1ZA 3R20A 1JWLA 3MBIA 5UKDA 4C06A 4DE5A 4OHUA 1U02A 2NVBA 2P5YA 5EI5A