5HE9A

Bacterial initiation protein in complex with phage inhibitor protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
168
Chain Sequence
SNADRLDVAMAADDICTAITNGEQVKGLYLYGPFGTGKSFILGAIANQLKSKKVRSTIIYLPEFIRTLKGGFKDGSFEKKLHRVREANILMLDDIGAEEVTPWVRDEVIGPLLHYRMVHELPTFFSSNFDYSELEHHLAMTRDGEEKTKAARIIERVKSLSTPYFLSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Helicase loader
publication title Structure of inhibited replicative helicase loader from Staphylococcus aureus at 1.9 Angstrom resolution
rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 62
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5he9A00
1KI3A 5B64A 1E98A 5EP2A 3HP1A 5GJBA 2JATA 1W0KD 4KV9A 3GJ8A 1ESNA 1WB9A 1CTQA 1FP7A 3EASA 4KHZA 3CZQA 2BJVA 3D31A 3LD9A 3KTAA 1SXJC 1KI1A 3QPUA 1R5OA 2Z5FA 4U02A 5HE9A 3TRFA 2IK8A 4FI3C 4LHYA 1MRNA 5KU1A 2IS4A 2ZROA 4M9ZA 4GI7A 3ND9A 2A3RA 1MO5A 1G17A 1TU3A 1U94A 2G83A 2O8DB 2F3TA 1QHXA 2IYUA 2J7PA 4BFSA 2NZJA 1Q1EA 1DAKA 1C9KA 1PZNA 3DVLA 4OJKA 4DVGA 3GLFA 4EPVA 4LBYA 2IYLD 2GXSA 4MUAA 2ATVA 4O2RA 5D3MB 4BEBA 3IBYA 2MMCA 4EUNA 1ETUA 1E0SA 1EESA 3W8RA 2ZYWX 4QNRA 3NH6A 5FFMA 4RD0A 1N0UA 2ODWA 2ZPTX 1R10A 5BN3A 1ODFA 4HAUA 2WJHA 4JJZA 1G7CA 1RRPA 1GNPA 2W6IA 2UKDA 1XTKA 1KO1A 2FPMA 3IHWA 4TN1A 5EE9A 5J4YA 4NYJQ 4AG5A 1AGPA 2AWNA 5IK2A 2JLYA 4NYMR 2KBFA 3KQLA 4C4PA 4GBMA 1R4AA 3EZ6A 3RRZA 3Q7PA 4EJSB 2IWHA 1E2DA 4ZCIA 4LK2A 2NOAA 4Q4HB 1QHGA 1U8ZA 1JR3D 3SNHA 5DISB 2DYKA 3WMGA 5A4JA 2C95A 2FA9A 1WBBA 2AWOA 3BERA 3EPKA 1I4LD 2IXFA 2ZE8A 3U3MA 1CP2A 4TYWA 2O8DA 1LS6A 2GETA 4KVGA 3CF0A 2YOHA 2NO0A 5D3MA 4UXJA 3KKNA 1RJ9B 2R6AA 1JPJA 2A2ZA 4QBIA 2FN4A 3FHOA 3VR4A 2ZYTX 1CJUC 1HURA 2F3RA 4OYHA 1G5TA 5FTNA 4OQNA 5JHGB 1KI6A 3RANA 5CJ2A 3X1XA 3VR5A 2B7CA 3FGNA 4TLDA 2AN9A 2VHQA 3PUXA 1UKVY 1SHKA 2CEAA 5LBIA 1M7GA 1P9NA 2DFTA 2PH1A 2EFCB 2PZEA 1KJYA 3L0OA 1J90A 4KJZA 1W36D 1NI3A 4UNNA 2W6JD 4DDUA 4BLTA 4QM6A 1Q0UA 2BM0A 4EJSA 3ZJYA 1S9DA 2WTUA 1LF5A 4Q4HA 3DHWC 1U8AA 2IBMA 5FPKA 3NHAA 1DADA 2KSQA 4LJ4A 3C7KA 2WMNB 5TARA 5CYPA 1XD9A 4JLMA 3AEZA 1AS0A 1GKUB 2I1QA 1T3HA 2QRZA 2FPLA 2QP3A 2WWFA 4PC7A 3A1WA 5FOSA 4KITB 1RJ9A 3KKOA 2CCKA 4PSAA 4C2TA 4Q18A 1GRNA 2QE7D 2YZ2A 3EC1A 1R2QA 4FMDB 4BLPA 2F1IA 4PAMA 4A6PA 5KSZA 1NMZA 4HDOB 3A36A 1JR3A 1BIFA 1L8QA 4IOJA 2RHMA 4PAOA 4YONB 1XEFA 2IA5A 2R6GA 2FH5B 3F3YA 4DXAA 4G5SA 4AIIA 1SVSA 4M8NE 4OQMA 4TQAA 5AJWA 4BASA 4UNRA 2J1LA 4DCSA 5LDDC 4D4KA 4RD4A 1OSNA 3K0EA 1CLUA 2A78A 1Q3TA 4PPQA 4QFMA 2PMDA 3IEUA 4BPBA 2WOOA 3B9QA 1XJQA 3KX2A 3DEFA 1E9FA 1XP8A 4FIDA 4B48A 4MGKR 3LY5A 3KJHA 4BFXA 4MGIR 2CL7X 1XD8A 4B3GA 4XOIA 3BD9A 3FDIA 3P32A 5G41A 4NDZA 3P20A 2X19A 2V3CC 3FFBA 3DOEA 3KUDA 3WMEA 3M6AA 1S9HA 4LBWA 3E5HA 1XNJA 1E2JA 3TSZA 2JJ2D 3AP1A 2J59A 4FWIB 3MFYA 1E4VA 3K09C 2JLXA 4Q48A 3T5DA 1E0JA 2CHGA 3BK7A 2B7BA 2HJVA 2WJIA 3NBZC 2OV2A 2XXAB 1S3SA 2F6RA 4DCTA 2BKEA 1G3UA 1IN6A 2VH5R 2W2XA 3DZ8A 2J41A 2ZRAA 5HZKA 4GL2A 4J0QA 3F0TA 3IIMA 1T4GA 4Q9KA 1XXHE 2XJ4A 4KFTA 2PX3A 4ACAA 4BZPA 3U5ZB 3NDBB 3VHLB 5CK4A 2F55A 2CL0X 1FP6A 1N6LA 4D0GA 2BMJA 3X1WA 2PZFA 3EA5A 3TUZC 3FPAA 4HSEA 2QP9X 3RWMB 3PUWA 2EWVA 2LKDA 3QKUA 2XGJA 1NKSA 2EYQA 3SJCA 2FF7A 1FW6A 3LQRA 4G01B 5KOYA 3AVTA 3DPUA 4KVAA 4D82A 2EU8A 3X1ZA 3ZQ6A 2V7QD 2BCGY 5HPYB 3LV8A 4NBSA 2P6UA 1RYHA 5FPTA 2OUKA 2HF8A 1SVMA 3LBNA 5TDHA 4TZ0A 5JJIA 1OHHA 4QOSA 2QRNA 2HYDA 1GRRA 4OK5A 3SE0A 1W4CA 2ANBA 3RWOA 2OCYC 3B9PA 3ZVMA 4JKIA 4AG6A 4GRAA 4KFRA 4G1UC 1F6BA 3Q85A 4QBGB 5BYJA 2FWRA 1F48A 3UMSA 5F9HA 3ZZUA 2JJ2A 2ZUCA 4M1SA 2WSSD 4L5BA 1ZAKA 1T0JB 1F2UB 1XJ0A 1NNEA 1KJZA 5FL3A 1JALA 1QBKC 4WA7A 4YMSA 2VO1A 2KWIA 5LD2B 4N1AA 2E9SA 1ZMXA 2GF9A 2GVZC 3D3QA 1NVVQ 3RSOA 4PZYA 3HYRA 2FGJA 1E2FA 1HE8B 1KSFX 1P2VA 1D5CA 3DL0A 1AS2A 1X6VA 3F8TA 5FUXA 3CUEF 2PZGA 3RS7A 3UG6A 2VP6A 2AX4A 2YWHA 4RVCA 5GVRA 2BJWA 4B34A 2GNOA 4CYMA 3MWLA 1KSHA 1CJTC 3BXZA 4MYUA 3AKCA 3RRNA 5ELXA 3LQQA 5JLJA 2RGEA 4PC3A 1IY1A 2ODNA 2ZR9A 2GJAA 3CX7A 5LB4A 4A8JC 2OCBA 5EJEA 3L43A 1BKDR 3RVBA 4QG7A 3RNLA 4CEIB 5CLQA 2Q0HA 3LVQE 3GFTA 3NC0C 2R2AA 2BWJA 3C16C 1OPXA 3KL4A 4W7SA 4XTRA 1N3BA 1XXHB 1D6JA 2W83A 4HAWA 5GVSA 3LLUA 3QVVA 1DTSA 2DFLA 1BH2A 2D2EA 2REXB 1NN5A 3U2QA 3V9PA 4OKSA 4Z54A 3W6NA 4E07A 3UXMA 2ERYA 2VTKA 5JECA 4DB2A 2C5LA 3DKPA 4G5OA 1T3LA 4GMXA 1S1CA 3AF2A 1KDPA 1T0HB 3AVOA 1A4RA 1T6NA 2OILA 1Q1ZA 3KB2A 4RFVA 4BLSA 1X1SA 4IXMA 1GL6A 4DDTA 3G0HA 3CNLA 4V02A 4KO8A 1US8B 2ZI5A 4G5GA 3B85A 2ZJ8A 1XCGB 3IGFA 4IFEA 1XMVA 4BFZA 2Q3FA 3W90A 4JMPA 2ZE5A 3NHBA 1DO0A 1W5SA 3WNBA 4CEIA 4OHYA 1E2QA 1TL7C 1ESMA 3C5HA 4L4UA 5CJPA 4HZUB 4DEYA 1XXHA 1GUAA 1Q21A 2OZEA 4DLWA 3BS4A 4B2LA 2D7CA 3QG5A 1UFQA 3P1JA 2H92A 3RC3A 1M7HA 1HH4A 3TK1A 3GJ5A 3BH6A 2BM1A 4HAXA 3EWSA 1SXJD 2XX3A 4DUGD 4UKDA 2GCOA 1UADA 4NCJA 4CEJB 1QHSA 4P31A 3T1TA 2VHCA 3ETLA 4KSCA 3KQNA 1GFIA 4D80A 2CMKA 1HEIA 1VPLA 3I1FA 3FMPB 3WBJA 3BWDD 3E70C 5FR2A 3ICEA 5KPJA 1US8A 2OG2A 1IN8A 3I3SR 4CIDA 1KMHB 5SZIA 2O8CA 3LBHA 4GOXA 3UWOA 2O8BB 2R6DA 2EYUA 4Q9JA 1Z0FA 1RKBA 3B6EA 1MABA 1VG8A 4IVQA 4D81A 3C14C 2IS6A 5FPHA 3ZGXA 1VDZA 1W47A 4B35A 5E7IA 1G16A 1E2PA 3OF5A 4I4LA 3VAAA 3L0SA 4AYTA 1ZC4A 3UK6A 1HV8A 2YHSA 3AF3A 3D7MA 3PCRB 2OM2A 1E0AA 4B3DA 2PCLA 5EXTA 3C15C 2KI5A 4I1SA 2ZVPX 1KTVA 4TL6A 1P4SA 4FMDF 1T91A 2ONKA 5CB6A 3U60B 3GEHA 2QNRA 2R62A 4DHEA 3NWJA 2LCFA 1HE1C 2ZI6A 2OHFA 3CH5A 5AUQA 3EIHA 4B43A 3FKQA 2Q9AA 4CEJA 2QU8A 4TMZA 2JLVA 1E79D 1GP2A 3BFXA 4ZKEA 4EPXA 1W44A 3BFVA 5IRCD 4ZO4A 4YMWA 1KGDA 4Q01A 2ZRCA 2WAXA 3T06B 1OIWA 5K8LA 3P26A 2GK7A 2CJWB 2V4ZA 3PIRA 2O8BA 1DG3A 1SXJA 2I3BA 4TLAA 5DNYB 4MQBA 1U9IC 5KSOA 3MWKA 1LV7A 1KO8A 5JWHA 3MD0A 1Q1QA 3BORA 1OFHA 1G3RA 1YZKA 1G8HA 1EX6A 1YZUA 3FWYA 3THXB 3VU9A 1H65A 1D2MA 2HEIA 4LHZA 3X2SA 3BB4A 4PHGA 1KO7A 1NRJB 4RJLA 4QGGA 2H18A 2IXGA 4ZKDA 2DB3A 1HT2E 1KZ7B 4URUR 3CB4A 3OIUA 4P3YA 4DLZA 4DLUA 3QJYA 4Q4AB 2VEDA 2XEXA 1TMKA 3WRYC 2VQSA 5DH9A 4CVNA 3AGPA 4EPRA 1AK2A 1ZU4A 5FBQB 5B30A 4DDVA 4JT4A 1SKQA 3SYKA 4OI0A 1ZUIA 2W58A 4ASUD 5AUOB 3TUJC 1ZD1A 3VR6A 3NXSA 4NH0A 5LB2A 1CU1A 1EK0A 4JLAA 4A15A 1KKLA 3I92A 1Z2AA 3W5JA 3ZH9B 1X8JA 4MKHA 1TUEA 3VNVA 5EE1A 5KPDA 2NTYC 4X8MA 1Q3HA 3LXXA 1C1YA 2W00A 2FFAA 4LJ8A 1DELA 1ONBA 3FB4A 3RS5A 3GCGA 4LV6A 5JS8A 5CYOA 1OYYA 3S1AB 3AKDA 5K8IA 3K8YA 1XZPA 3KKPA 3V4RA 4KSBA 3GJXC 1YZLA 4C3ZA 1AN0A 4WVFA 4IXNA 2GA8A 1BMFD 1NBMD 1RW4A 3CRQA 4Q4AA 1S96A 1LVGA 2DFNA 1CJMA 1Z07A 4PXAA 3W6OA 1NSFA 3PVSA 2D2FA 4HAZA 1WCV1 3B1YA 4BLQA 3LBIA 2XTNA 3O8BA 1W49A 4TT3A 1ZCBA 1XMSA 1KMQA 3UMFA 4US1R 3L0PA 4TSFA 3CR7A 3FKSD 1TUIA 4Q9LA 1ZNYA 2ZYVX 1VYVA 4X8LA 1DE0A 2JIZA 4HLUC 4Q7MB 2JCSA 2G0TA 4L9SA 1OIVA 2ZJBA 1E99A 2YC2C 1I2DA 5KYKA 3MUFA 2AL7A 2ZAOA 3U4QB 4UQOA 3K9GA 2ZSBA 4TQUS 3SQXA 1NJFA 2MSEB 2IYXA 4ASUA 4LJ6A 1QRAA 4WBSA 3A1UA 4LJ7A 1SZPA 1YR9A 3GLFE 4BLOA 2VIIA 3IO5A 2J87A 4GFDA 4M1WA 1JI0A 4JVNA 4BGDA 2VP0A 1U98A 2CK3A 1N5JA 4YXWA 1KI8A 4M1YA 2FOLA 4HB4A 1EWRA 2WJVA 4M21A 4Q19A 3K70D 3IO3A 3NG1A 2XTMA 2ZITA 1Z6XA 4BWYA 3AP2A 3CIOA 2FU5C 3THYB 4JBXA 4C0BA 2IYYA 4QBFA 1NG9A 3E2IA 4KI0A 1I4TD 1E96A 4PPNA 621PA 3O8CA 2ZJZA 1BMFA 1CIPA 3UIEA 2VLIA 3LW7A 3K0FB 5CK5A 2GZDA 5G53C 4B44A 4LJ9A 1IONA 1S2MA 4DEXA 2WJJA 4MRRA 5EE0A 5F9FA 3AVQA 4YQFA 4PO1A 3B1XA 3HU1A 4QRHA 4RZ2A 3OEEA 3WYFA 3BAFA 4NYIR 4ESVA 2F1HA 3PJRA 5C18A 1Z5ZA 3WYGA 4A2WA 5FI1B 1XD2A 1GKYA 4B6FA 1ZCAA 2ZUBA 2JDIA 1KAGA 3VHXA 1K5GA 3PR1A 3K09A 5EP4A 2RMKA 1ZU5A 2EVWX 3IQWA 4ZI3A 2NZ8A 2ZAMA 1R5NA 3KB1A 5CIWA 4JBWA 2QPAA 1Z8FA 4UXHA 4UXIA 3THYA 2CNWA 2Q3MA 3WP0A 2QTHA 4YDSA 1YRBA 1E0KA 3TIFA 2ZQ5A 4LHXA 3I8SA 3WMFA 3U3RA 2QUZA 3K0FA 1JPNA 1MRSA 1ZNXA 5HKKD 4Y0VA 4V0KA 1TF2A 2JLRA 3TVDA 4V0LA 2ANCA 3KTAB 5CM8B 2BMEA 3RHFA 2DR3A 3T1QA 3HU3A 4D26A 1AZSC 4EFMA 2FSGA 3U7EB 1OXXK 3U6BA 1G4UR 1G19A 1FUKA 3IPYA 4QC2A 1G8GA 4ERNA 5EE5B 2IUUA 2HCBA 1KO4A 2H8KA 2N46A 2XZLA 3K9LA 1GSIA 1JR3E 2ZRMA 3EIEA 3MJHA 3W34A 3R8FA 4B33A 1CJVC 4JSYA 1PLLA 2XOKA 1KYIA 3IQXA 4TZ6A 5SZJA 3EPHA 1NP6A 1E9AA 1Z47A 2WWIA 1DAGA 3EIQA 4MH0R 4NKRA 3Q9LA 5JFGA 4QM7A 1EFRD 4Q7LA 2G77B 5G3ZA 1OW3B 1EWQA 3CRW1 2A9KA 3WNCA 4OQLA 5EQTA 2X1VA 4DCNA 4YDHB 2BMFA 1SVWA 2REBA 2H16A 3CRRA 2QBYB 3GJ7A 4D0LB 1N2CE 1JQLB 4Q4JA 1KHTA 1EFTA 1LS1A 4AD8A 1QHIA 4RD6A 3WRXC 4XH9B 1X86B 2NO9A 3P4XA 3IILA 1VKJA 4CZ2A 2VL7A 5HKKA 3QPVA 3VR3A 1DVRA 1YRAA 2HJGA 2ZSEA 3QXJA 5LPNA 3R9WA 1FUUA 1KIMA 1UPTA 2O0KA 3LX5A 4R9UC 3KUCA 1N6HA 4BEJA 3CX8A 2WBLC 4P33A 3CBQA 4TMVA 5JI3E 1KI6B 3SEAA 4L15A 1GTVA 4A8JA 5DO9A 2XB2A 4WOPA 1X8KA 3SFZA 2MMGA 1XEWX 2WKQA 1U8YA 4DLTA 1M7BA 4HYYA 1YZNA 1S1MA 4JJKA 2Q21A 4XIGS 2A5GA 1HUQA 2QBYA 4GOKA 3SI7A 2ZRGA 5C4MA 1ZM3A 4M2LA 2RAPA 3OAAD 1G18A 3PEWA 4CGZA 2GVDC 5DLQC 2FSIA 1ELOA 1M8PA 1W0KA 4I1VA 2VA8A 5L3SB 1EFRA 2H57A 1NLYA 1Q1BA 3NKVA 2CVHA 3GJ3A 2HDNB 5FOXA 3L0IB 1NY5A 2JJ8A 1W4RA 4FINA 1TNDA 2YKGA 1IM2A 3ECCA 3WNDA 4D2IA 4PPGA 1Q20A 1QZXA 1U0JA 1VCIA 5FBVB 5IDVA 4L16A 1FTNA 1W46A 1NLFA 3C4JA 4RCZA 5DYIA 2G1JA 4A4DA 1G7RA 2ECKA 1E2KA 1Z0AA 4CF7A 3FHTA 2BBTA 2V55B 3NEJA 1CJKC 1AKYA 2F9LA 4XWKA 3K9NA 3PUZA 3I8XA 1L2TA 2A5DA 4E5UA 1XPRA 2QPOA 4P4TA 2FEMA 4OQXA 1F2TB 1JAIA 3CX6A 3SHWA 3B1VA 1YR8A 3QXSA 3LXRA 1WBDA 2NO1A 2RH5A 1U2RA 5C2JB 5L3SA 2AKAB 1V43A 2ZSFA 4OI4A 3ZZ0A 3NEYA 4GPTA 2J0QA 1Z3IX 1P2UA 3U7HB 4NP6A 2ZS9A 4RD2A 3WY9A 3LAWA 1W36B 1JEEA 2DWPA 3OFND 3R20A 1NIJA 1YHNA 2JLQA 4F4IA 3HR8A 5G3YA 2QT1A 1Y3AA 3REFA 3GLGB 3MLEA 1ZD8A 2VBCA 1RE0A 2ZRIA 3M4YA 4EPTA 2QM8A 4NCNA 1GIAA 1JNYA 4W5HA 2HLDD 2AD1A 2VRWA 4V0MA 1ZIPA 1M74A 1RPZA 1WF3A 4EKDA 3W8NA 3TKLA 4TL9A 4KYUA 1G5RA 2HCJB 3QNUA 1CEEA 4V0OA 3AVUA 3QENA 4IDQA 3V4FA 3TNFA 4Q5IA 1E2NA 1F2TA 4KODA 2CDNA 2EW1A 2IWRA 5J40A 1YQTA 2IT1A 1AGRA 2PBRA 4B75A 1IXZA 3T35A 4YMUA 4AKEA 4OK6A 1N5KA 2W6JA 1RRGA 4ZPXA 1Z6TA 4FN5A 4LYHA 1PUJA 1AIPA 1KDRA 1PUIA 2QG6A 2QMEA 1CKEA 3GLGA 4RZUA 3AVVA 4XD7D 2QN6A 3HYTA 1FMJA 3W6PA 3L2OB 4BFVA 1U9IA 2H7VA 3QF7A 2HUPA 3EX7C 2GBLC 2XTZA 4PQYA 3AKYA 3TLXA 5AJVB 4G5RA 1G3QA 4MKFA 1G3IA 3AB3A 4NPHA 4QHYA 2MSCB 4DSOA 2P2LA 1SVOA 5FOUA 2QE7A 3T1VA 3UKDA 4MYHA 5JCPA 4DIEA 1EG7A 4P4UA 4HUTA 2WPDD 3CPJB 3PEYA 3IIKA 4HDQB 1K8RA 2GEVA 4AKIA 1LFDB 5CB8A 3N2EA 4JLNA 3K70C 1PLJA 4B2PA 3K0CC 2SHKA 4AK9A 4P32A 1AQYA 2AFHE 2FNAA 2ZETA 1CS4C 3SQWA 2QY9A 1GNQA 1P72A 1KK0A 1Z29A 4BFUA 1L4YA 1N6KA 2OCAA 1TEVA 3BOSA 1F5NA 1XCMA 2Y8EA 3EZ7A 3SFVA 1UF9A 3CF6R 1DAEA 2D74A 2QAGC 4IDHA 1RC8A 3T15A 3FHCB 1OLOA 2IYTA 2OT3B 3NH9A 4TTQA 1OYWA 3NBFA 5F98A 2FX3A 2NPIA 4PAQA 1D9ZA 1T5LA 4NTZA 2WJYA 4B6EA 1W4AA 1N6RA 2GTPA 1OE0A 4XD7A 2IS1A 2V1XA 4IFBA 2NGRA 2AK2A 3KFVA 4PSVA 3ADCA 4EIWA 2BC9A 2H17A 3FMOB 1O87A 5FI0B 8OHMA 1U0LA 1SKYE 2XSZD 4GOJA 4S35A 4AI6A 4PO9A 4QBHA 2H5EA 4D6PA 1R0WA 2IYVA 2X2FA 5DYGA 1Z2CA 4LHVA 1MO4A 4Q02A 3X1DA 4C0SA 2XITA 1DAMA 1NIPA 4PQFA 4FD2A 4H9GA 5KUTA 2LWIA 3N70A 4UNQA 4DWJA 4C30A 4HLUA 1YR6A 4TTRA 1SXJE 1XZQA 3B1ZA 5AK0A 2GXAA 5H68A 1TQ6A 2BEJA 3G82C 5SZHB 1RFLA 4HEJA 2O8FA 1VIAA 2HV8A 1WRBA 1XEXB 4JBYA 2ORIA 2V7QA 2O8EA 4D4LA 1F3OA 4HDCA 4BRWA 3O8RA 2Q3HA 5FUWA 4D25A 4NONA 1GDDA 1PLKA 1MO3A 1IAQA 4URYR 2G3YA 5D3QA 4QGHA 1UEIA 1YZTA 4QHSA 3ZD6A 5FPYA 3TBKA 2PLFA 1OXUA 3FYHA 3SU8A 2VP9A 4A82A 4F4JA 5KSYA 1IXSB 1G64A 2J0VA 4JLDA 4RY2A 3QY0A 4H1UA 1A82A 3IHLA 4G3XA 3ZS8A 2ZJYA 1CF4A 1WA5A 1Z08A 5JHHB 1GWNA 2VPPA 1KK3A 3DOFA 4Q4LA 2GILA 2B8TA 4TLBA 2GCOB 2OLJA 4EDHA 3TQCA 2DCUA 1KJWA 1QF9A 2IUSA 2WSSA 4IDOA 4OHVA 1ZP6A 4MUBA 3OZXA 4LCBA 1JJVA 5KDOA 4DC9A 2IYSA 3ZS9A 2XNDD 1G7SA 4DSUA 3QE0A 2O8CB 1DG1G 4QXAA 4FCTA 1XEXA 2ERXA 3H1TA 3E1SA 1GITA 2CHVA 1MABB 4OL0A 3QXHA 1PVOA 721PA 4LRWA 1GG2A 1G41A 4JLJA 4IEEA 4MGZR 4R98A 1J99A 2GCPA 1DEKA 2XB4A 4A36A 1SGWA 1RIFA 1ZYUA 2CHQA 2W2TA 1W0JD 2I4IA 4JLKA 3GEIA 3NTUA 3CONA 4AYXA 2FGKA 2JLSA 4X8HA 1KZGB 3BB3A 4TYNA 3I62A 3WXMA 4HAYA 4GSYA 3I5YA 1DO2A 2AHOA 1SKYB 2QMUA 2ZR0A 5KDLA 5K8TA 2C96A 4FCWA 1XMJA 5TXGA 3RS4A 5AUPB 3K0SA 4JVLA 5J4LA 1XTQA 1VMAA 3BIFA 2YNMA 3OEHD 4MRSA 3R7WB 1SXJB 1P9RA 4W9MC 1R7RA 1GZSA 2D3WA 4XJXA 5E7JA 4LOAA 4P0TA 2WICA 3PITA 3VR2A 4IOMA 3UPUA 4LJ5A 2UZIR 3WYAA 4PQRA 4LYFA 3VU9B 421PA 2A30A 2QP4A 3EA0A 4M1OA 1AZTA 1R6BX 3TAHA 2OAQ1 3GJ0A 2QZ4A 4I1UA 2GJ8A 3T61A 4ABYA 2YC4C 2CE7A 4B3BA 1SULA 1V5WA 3EAQA 2ZS7A 1EFCA 3QKRA 1KSGA 5B2ZA 1UDXA 2QEQA 3PXGA 2KBEA 4A0RA 1QHNA 3B60A 2KE5A 3CZPA 4EFLA 2IS2A 1E32A 1OT3A 1P9WA 4HI0E 3GLHA 1ZUHA 4HAVA 121PA 2ZJAA 1E1QD 4JLPA 5FBWB 5JS7A 1FNNA 4IKEA 2ZU6A 1EFUA 4PC1A 3OHMA 4UNPA 1OXSC 3H86A 1P7CA 1VYTA 2AKYA 3R7WA 4AC9A 4DUGA 5JBQA 5EUMA 3EZ9A 3Q8XB 3VX3A 3A1SA 4EAQA 2AXPA 1GL7A 2RGAA 2WMOB 5DN6D 1SVLA 3H2YA 4KYIB 4DCUA 4XVQA 1UBFA 4NYMQ 2JGNA 4ON9A 1K5DA 1M1YE 2OFWA 2QQEA 2DHRA 3I32A 2D4HA 1VYUA 4TMKA 3MRSA 3QKSB 4E22A 4ZI2A 1X3SA 5BWMA 3CPEA 3KFXA 3TMKA 1TU4A 5KTYA 2NPFA 2N1BA 1J8MF 2WM9B 4II7A 5E95A 2O0HA 4MYCA 5AR1A 1E69A 2EFHB 4C0JA 4RZ3A 3GQBA 3QPWA 3KXKA 1G4AE 1OIXA 2FZ4A 2RCNA 2WV9A 4WIAA 2GEUA 4M22A 4JL6A 2QM7A 4M0LA 4LPKA 5C1BA 2FSFA 1YZGA 3H4MA 2YVUA 3DM9B 2VF7A 1II0A 4NZYA 2ZRDA 1Z22A 3B2EA 1E9CA 1E79A 3AVPA 1JXMA 1P5ZB 4B71A 4URZR 2C99A 2E1RA 4QGAA 1BYIA 2IHYA 4PFSA 3A58B 3I5XA 2W0SA 1E1QA 1CR4A 1YU9A 5A0FA 2RHDA 4MKGA 5HCNA 3KKQA 1DBSA 3QKSA 4JVSB 2W2VA 3B78A 4NE2A 1CR1A 2PX0A 1BS1A 4JZKA 3OESA 2FFHA 4W5JA 4LC0A 1P61B 1T8UA 1QVRA 2ONJA 2XAUA 2N42A 5FTJA 4HUQB 2QSYA 1N0WA 5UKDA 1UAAA 4MRPA 1M2OB 2CVFA 5KSPA 5TV2A 1N6NA 2BEKA 4FWTA 3W3ZB 2IYWA 2WHXA 3P27A 2FSHA 4KBGA 3SC3A 3SYNA 1EX7A 1G8YA 2GDJA 3O8DA 4A2PA 4G0NA 1P60A 2A5FA 1TX4B 2IXEA 4CDGA 4F92B 1FX0A 4PHTA 3X1YA 1I4DD 1QHHA 5JJKA 1UBCA 1N6PA 2F7SA 3WBKA 1G7TA 2QPTA 2R44A 2ZE7A 2ZSDA 4U00A 5BN4A 1VHTA 4PC6A 5J47A 2OAP1 1NN1A 1XRJA 3C5CA 3MJRA 1FQJA 1K6MA 2O5VA 3BE4A 1U81A 2DY1A 3MCAA 2QQ0A 1KAOA 3U7GA 3U3KA 3AGQA 2FMXA 1SVIA 4NHOA 1KDTA 1Z6GA 1ZJ6A 1G8PA 2LKCA 3REGA 4ZDWA 4LZZA 5HZHA 3AV0B 1N6OA 4S2EA 2YYZA 5IHPA 1JBKA 1XD2B 1OJLA 1TTTA 1AJEA 3NBXX 1P62B 2VHUA 2Z0MA 1W1WA 3CM0A 2QMOA 5F2EA 4HUQA 4ZDKA 2CE2X 1G20E 1NL3A 2PJZA 1QG2A 2VYFA 2AK3A 4IDPA 2FE4A 3ASZA 4FMBB 4YMTA 4AURA 2R9VA 3QIAA 1IBRA 2UZ3A 1R8SA 2C77A 1NVUQ 4JS0A 3TE6A 5B58C 1NJGA 3NBYC 4DZZA 2Q9BA 1XBTA 1NBMA 1NF3A 2HXSA 3A37A 3MGCA 2ZRLA 1XB2A 2QTVB 3K70B 4LUCA 1GILA 4B73A 3CW2A 3K9HA 1BYUA 4IW3B 2JAQA 4R2HA 3N5CA 4V0NA 1OKKD 2B92A 1Q22A 2D06A 1D8TA 2G0NA 2PEZA 1MH1A 1I2MA 3FKSA 5EZ5A 1FMLA 2A5YB 1E2IA 3A6PC 4GP7A 5JCZA 1CRPA 1H8HD 2BCJQ 4GZLA 4Z1MD 2GXQA 4CT5A 1FL9A 1U90A 5JSZA 3ZVNA 3B82A 1II9A 4U7DA 3U3JA 4F38A 4MA4A 5FUYA 1E9DA 4ZDIA 2JJ1D 4B3CA 2GBLA 1Q12A 2XZPA 4L8GA 5FOWA 2C98A 2XJ9A 4DLRA 2ZXUA 1A2KC 2ZM5A 1G9XA 3PEUA 3KDSE 1IHUA 1OH7A 2ZEJA 4NMMA 2WKPA 4C0HA 1MR3F 1JJ7A 1KY3A 1Y63A 4LJAA 4PTLA 2OBMA 4G5QA 4Q1AA 4K81B 2BHRA 4WZ6A 1GVNB 5EE3A 4AY2A 4ESHA 3CKLA 3T5GA 3K0AA 2Q9CA 4F91B 5BXQC 2PT7A 2AXNA 2EFGA 1B0UA 3ZVRA 2TMKA 1G21E 4Q4JB 2WVJA 2BVNA 1E2LA 1MV5A 4MRNA 3TGPA 4BRUA 1ZM2A 5CM9C 1FFHA 3BFKA 2C78A 3DM5A 1CRQA 3U7FB 2C03A 2VP4A 4DT1B 2QAGA 2FFQA 2I1VB 2VF8A 1KI9A 2YJTD 5HCIA 4A0HA 3GFPA 4JKYA 1GRQA 1OKKA 3A1VA 2PMKA 4DKXA 1D2EA 4A8JB 3IPXA 1E1RD 4V0ME 3CLVA 1E9EA 1H8HA 2C04A 4D0NA 5DHFA 1P3JA 2P3SA 1XX6A 2VP2A 1ZBDA 3GEEA 4O2LA 5EP3A 4TL8A 5J4VA 1JECA 4LWZA 4XTCS 1E4YA 5CDFA 1G6OA 1TQDA 2JJ1A 5IK2D 4FCVA 2DFKB 4DLYA 1G291 1NN3A 1N0VC 1Z28A 2RGXA 3JZMA 3I61A 3V00A 1E94E 3VQTA 5AJYA 2ZVQX 3K1JA 3SJAA 2EFDB 3KXIA 4LC1A 5H8WA 3FTQA 3DMDA 1UBGA 1SQ5A 1A5TA 3SBDA 3CWQA 5FTKA 3GLGE 4C7OA 5DSZA 3KJEA 2BDTA 2AD5A 4ZDJA 1OF1A 3RAPR 3QUSA 4IOLA 4POAA 2QA5A 2X77A 4DT1A 2BKUA 3I73A 1ZVQA 3GP8A 2DBYA 1ZRHA 3B5JA 2B8WA 3ADDA 1O3YA 2IEYA 1YVDA 3ZYCA 2KJQA 2YWGA 1XJCA 2NO6A 2D62A 2OO7A 2YWEA 4Q9IA 1CR0A 2RGNC 1E2GA 4DLXA 5GJVC 2GKSA 2L0XA 4Z51A 4U5XA 2OSBA 2C9OA 4N3NA 4M1MA 4H1VA 1Z0JA 3B7GA 1YR7A 1E2MA 4EPWA 3Q72A 4Q1CA 3QG1A 2GXUA 1JAHA 1E1RA 3EARA 1HYQA 1XTIA 1D9XA 1SHZA 2OBNA 5DHAA 4XWAA 1RVDA 4RD3A 3VFDA 2J0SA 3ND8A 2CXXA 2ZRKA 4DB4A 2G9NA 1KI4A 2B6HA 2BOVA 3KXLA 1NSTA 1CULC 4LGMA 1S3GA 2VSFA 3QKTA 5FBRB 3DO6A 4ZIRB 4IVPA 3LX8A 3AVWA 4C0AC 1T3SA 5EXSA 1ZW6A 3IIJA 4B47A 1NMYA 3RS2A 1UBEA 3FMFA 1DPFA 2WWYA 3VNUA 5EXXA 3C41J 3AM1A 1WQ1R 3L8YA 1N5LA 2PT5A 4QJ3A 3I4LA 2GZAA 4LBVA 4ARZB 1WE2A 2RB4A 3AF4A 1C4OA 4A92A 4F93B 1NLZA 3K53A 3QOFA 2CLDX 3U44B 1Z06A 3GLIE 2OFXA 3T12A 1J8YF 3OE7D 2CLCX 3ZZTA 3B1WA 3KQUA 3CNNA 3R9XA 4Q7KA 1XFAA 2X2EA 2ZYUX 1W5TA 2AFIE 3U3OA 4ZV4A 4HB0A 3QQ5A 2AR7A 3ZIAD 4ZIRA 2ZTSA 1VG9B 3AH8A 1Z0DA 3PG5A 3NVAA 3M0EA 1Q44A 2G88A 1T9HA 3OAAA 1M34E 3RRMA 3UMRA 1KI7A 3IBGA 5E7MA 3TQFA 3IEVA 1II8B 1VHLA 4ACBA 4FW9A 2ZRBA 3LFUA 1LTQA 1Z6YA 3BH7A 3NC1C 2GAAA 4HLCA 4Q66C 4ARZA 3ZDQA 2P65A 3H84A 1WDTA 2ATXA 2P5SA 1OB2A 4R71A 5E4FA 4YC7A 3U44A 4R7ZA 5KHOC 1NN0A 3VKHA 1E2EA 2EQBA 4YLGA 1WP9A 4TLCA 2QMHA 4BE7B 2BBSA 2GRJA 1NMXA 2EFEB 1A1VA 5DI9A 1TQ4A 2ASEA 2ZREA 4N0EA 3QXXA 5KNCA 5AWFC 4PR0A 1VIYA 3D8BA 1IY2A 2GJKA 4RD1A 3B8HA 4W5WA 3CR8A 3THOA 3SDZA 2QENA 4QGFA 1EXMA 1KDOA 1FPMA 3Q7QA 4IDNA 4LJYA 2J46A 3PFIA 5TMPA 3LNCA 1OB5A 4TYQA 3RYTC 5F3WB 1P2TA 1Z6AA 3OE7A 3NIBA 5CIQA 4ILEA 4HATA 4EPYA 3GPLA 3SYLA 2ZSAA 1OHHD 2FG5A 2GJ9A 4B2IA 4URVR 3AF0A 1II8A 2WIAA 3KQKA 1ZM4A 3RC8A 2IX3A 4DJTA 4URXR 1XEWY 2IW3A 3OFNA 4TL7A 3ZIAA 3EWAA 4BUJA 5C4GB 4DBLC 4HLQB 2FFBA 4XSGA 1E9BA 3R8CA 821PA 3CWZA 5H70A 3TSOA 1TADA 4CT4B 5GJWC 1VCNA 1T5IA 1MT0A 2IF0A 3ASYA 5FTMA 1F60A 3GLIB 4PHHA 1VECA 2QAJA 2JLUA 4LV5B 4B32A 3RS0A 4A0FA 4I99A 3RLFA 4DSNA 5FPSA 2HLDA 1OH8A 2QTFA 1KK1A 3EZ2A 3OIWA 4TMTA 3THWB 2ZU0C 1P75A 5L3RA 1AS3A 3B13B 3VKWA 2B21A 2X8AA 3QF4B 3TR0A 4M4SA 5JRZA 3HWSA 1OXVA 1ZNWA 4NL4H 2ORWA 2IL1A 4JLVA 2QL6A 3VR1A 5GJCA 4F4CA 5FTLA 3EPLA 4LYAA 3LLMA 4D4MA 3W9YA 1S8FA 4IRUB 2NG1A 5BW8A 4NU0A 5ANRB 2JLWA 3CF2A 1HT1E 5JWRA 2OE2A 2IUTA 1X1RA 3G5UA 4HB2A 4US0R 5B57C 2O8FB 2RGGA 2O8EB 2P67A 5BQ5A 4BFYA 2ZS8A 1RRFA 4NCHA 4Q47A 3MWYW 1DAFA 4Y0AA 5L3QB 2YINC 1JEDA 1B23P 1AM4D 4MGYR 4A0GA 3CO5A 4DLSA 3SHFA 3LRPA 5EXPA 3GLIA 1TPZA 2ORVA 1X8LA 2CCGA 1LB1B 1KO5A 3LDAA 4MYTA 5TY0A 2XXAA 2GZHA 2Z43A 1YKSA 2IHBA 3F5FA 2PCJA 3GFOA 5SZKB 4C9BA 5FOTA 1IJEA 3THWA 4C2UA 2WWWA 2WKRA 4KLNA 1HQCA 1PV4A 1CBUA 2FZLA 1MO6A 2ZRHA 5AJXA 3GLHE 3KKMA 3QF4A 2WPDA 4Q1DA 3SN6A 3FOZA 1J2JA 2OLKA 2PEYA 2OBLA 4UJ3A 4R2IA 3TSWA 1U99A 2P0EA 5JEDA 2ZJOA 2D7DA 2ZUDA 4BZXA 2Z83A 2QGZA 3SS8A 1COWD 2REOA 3FVQA 2C2HA 2EWWA 1P6XA 3A4MA 3CPHA 4Q03A 1W7AA 1W48A 2J3EA 4MDFA 1E2HA 3NDPA 1WXQA 5L3QA 3A1TA 5BYKA 4N0DA 4CW7A 3TR5A 2GEDA 2QGNA 4PANA 1FNMA 3WHKA 3ICQB 2OCPA 2FDCA 4B76A 4FMCB 3QEJA 4MDEA 1HA3A 4NYIQ 1N6IA 4M9XA 4IEIA 4OHWA 4PZZA 2F43B 3LW8A 3CH4B 1H8ED 4M1TA 3RSLA 1OFTA 1W4BA 3PQCA 4QKQA 5GADl 4Q9HA 3MSXA 2WOJA 4RSGA 2NIPA 3WHLA 3VKGA 4E09A 3BGWA 1F2UA 3H0KA 4WXPA 4GP6A 2V1UA 1UEJA 2H1LA 5JI2E 4TQ9A 2GJSA 1U0HC 3IUYA 2XSZA 3Q5DA 4PHFA 3QXCA 5EP1A 3AVXA 5K8UA 1TEXA 3MWJA 2J7KA 1A7JA 2ODBA 4LI0A 1R0XA 2ZI3A 3D6TB 2VSXA 1P2SA 4GNKA 2RKOA 2BIFA 5J4HA 1YJ5A 4O3MA 3KJGA 2YWFA 3RRYA 3EG5A 2HT1A 5CITA 2JA1A 5JRJA 3BRWD 4AYWA 3SR0A 3ZVLA 2K5UA 4P4SB 3LO5A 3LA6A 1TF5A 1COWA 2FEOA 4JSTA 4NYJR 2A7QA 1LF0A 1UDWA 5FOVA 2C9YA 3I72A 1KOFA 5JWOA 2OXRA 2F43A 3QKRB 5FR1A 1OV4A 3GMTA 1IN5A 1XDBA 1XF9A 3BH0A 1XPUA 2V9PA 1ZINA 3U61B 1AA9A 4A6XA 4C0KA 2F1RA 3CNOA 1G1MA 4WAUA 1DARA 1KI2A 5H1YA 5AUNB 3ZD7A 3A4LA 1GNRA 2DWQA 2O52A 3GLHB 4IOKA 2HXYA 3PUYA 4O25A 1RYFA 3PV0A 3HPRA 1MOZA 6Q21A 3AUYA 4EJSC 3MMPA 4M9QA 5L8VA 2ZANA 1XCPA 1QG4A 1R0ZA 1VTKA 4A1FA 2P6NA 3KQHA 1H8EA 1RZ3A 5DGXA 4KU4A 1HY3A 3EZFA 2GESA 1DAIA 1Z0IA 3C8UA 1IQPA 3VX4A 1FZQA 2MSDB 3DKVA 3QBTA 4D4JA 2ZRFA 1JXOA 5IT5A 3UG7A 2OXCA 4RKFA 4UNSA 1OXTA 3RDPA 1GM5A 4WZAE 521PA 3TAUA 2XNDA 1LW7A 3T34A 3BB1A 4LDJA 4P4SA 1D2NA 3VMFA 4X8OA 2PLRA 4DSTA 4US2R 1LY1A 3J81k 1ZM7A 3UWKA 4URWR 2YOFA 4K46A 1IN4A 1G5PA 1UKZA 3MAAC 1W2HA 2QI9C 1R5BA 3FFAA 2KB0A 3JZAA 3Q5EA 4HZUA 4Q7JB 5E3HA 1UKYA 2JASA 1W0JA 3AUXA 4E03A 4OI2A 1T8TA 2Z4RA 1NBME 3TUIC 1S4QA 3W3AA 3PUVA 2IEZA 1TF7A 3RABA 3FMIA 1ZM9A 2FPKA 3HU2A 1YE8A 2VHTA 5JEEA 4OI1A 1WMSA 4LHWA 4LSGA 1OH6A 2ODEA 4CRWB 4ZCMA 4XWOA 5J4KA 4QJ4A 1VG0B 2NQ2C 4HB3A 1Q57A 2DWOA 3GJ6A 2RGBA 1KY2A 2OESA 1W36C 1JQJC 2ZI7A 1NVXQ 2W0MA 4DLVA 2OEPA 1HTWA 1TAGA 3OEHA 4JYBA 1KMHA 2BBWA 1XU4A 4UJ5A 3SBEA 2ZR7A 5TVKA 5HR5A 3LVRE 4JT2A 5DI3B 2CL6X 4B3FX 4RFSB 3CRVA 1UJ2A 4AKHA 4JLOA 2J9RA 1XTRA 1IN7A 1AQUA 3UANA 2JLZA 5TB5A 3KZ1E 3A4NA 4QJ5A 3AQ4A 4DIDA 1S0UA 5JJLA 2NO7A 1QDEA 3M1IA 4PPFA 2RGNA 5FL7D 2WZQA 2RGCA 2GAOA 2A5JA 2G6BA 2QSZA 2VHJA 4TT3D 3VTKA 2CCJA 2VSOA 5JMTA 1GOTA 4Q1BA 4TSFD 1FX0B 4OJQA 5EZ6B 5J5CA 2JIZD 3BC1A 1QHHB 5HTKA 1G8FA 3LH5A 4NCKA 4Q1FA 5G40A 4TYYA 4GZMA 4DDWA 4AWXA 4LX0A 4K8OA 1XMIA 2IYZA 1E9SA 1N25A 1NY6A 3P4YA 2QROA 4KAXA 2ZJ5A 5AJZA 2CBZA 1G6HA 4QL3A 1XPOA 1VCMA 1J7KA 2VP5A 4Q21A 2HF9A 4BFWA 4JL8A 3ZQJA 1FQKA 3AVYA 1ZIOA 2CJWA 2O0JA 2UVQA 2WWXA 2WWHA 5DI3A 4WZBE 4RFSA 2ZE6A 3JVUA 2ZRNA 5DN6A 1CXZA 1Z83A 1GL9B 2CK3D 1ZC3A 4TLEA 4YXWD 4PSKA 4Q00A 3PENA 2BV3A 2IYRA 4A2QA 1Z63A 5FH9A 4QNMA 3DDCA 1KSJA 5HE8A 3HDTA 4TTPA 4OHZA 4YMVA 1XTSA 3THXA 4I81A 5KO2A 4JLBA 2R65A 3AF1A 4CEHB 2WWGA 4OBEA 5EUQB 4HLDA 4JYCA 4TYPA 1IXRC 1L4UA 1VG1A 3KJIA 1R8QA 4OQFA 5CDFE 2V54A 3GD7A 1ANKA 3TVTA 4ITRC 5CLLA 3SOPA 3EXAA 1M6NA 2QT0A 2J45A 1FTSA 4HZIA 1GAJA 1JR6A 2PL3A 1NKTA 3EC2A 1OFIA 5FL7A 1NVWQ 2J5XA 4GT1A 4BFTA 4M53A 4B74A 3DZDA 3OEED 5L3VA 2P5TB 2HYIC 4JVMA 2F9MA 2E87A 2FJUA 5JSZB 2JDID 2F1JA 3ADBA 1E3MA 1KK2A 2HT6A 2IC5A 3HPQA 4PZLA 3LWNA 4XVUA 3CRMA 4AKGA 1QVAA 5KNDA 2BBOA 1BOFA 3W5IA 4I1OA 3RS3A 4TMWA 1NVVR 4CEHA 3S1AA 2ZRPA 3TJZA 1UKEA 4WXRA 2CNWD 2IF2A 4EFNA 1EGAA 5FBLB 1EFHA 1JB1A 4PC2A 4FXPA 1Z0KA 4M9SA 5LD2C 3N2IA 3SJZA 2RGDA 2DPXA 1P73A 4Q1EA 4M1KA 4V03A 4BZQA 5KDDA 2BMDA 1GKIA 3K0AB 4IVRA 2YV5A 2ZJ2A 3PEVA 4DCVA 4FMCF 5C46F 4ZCLA 1MKYA 3QVUA 4KXFB 4GMDA 5BN5A 1DOAA 2J0UB 4JL5A 1XTJA 2JEOA 2V8OA 1G3MA 4C0LA 3ZLJA 2WSMA 4LY6A 3L8ZA 2Z4SA 2R8RA 3IKJA 4OK3A 3FE2A 4Z8YA 3ONWA 4GDFA 3DMNA 1J70A 3QBVA 4RCYA 3T1OA 1PJRA 2QAGB 1ZD9A 4OHXA 3QI2A 3U4QA 1IJFA 4EQ6B 1KNXA 4BECA 4TWZA 2Q6TA 2IYQA 2XOKD 1IY0A 4KFSA 3BBPA 4KBFA 5M04A 2PJRA 1XWIA 1KNQA 2ZRJA 3QSYA 3TW8B 1NG1A 2OFOA 3HR7A 4JIMA 4LYJA 5JZVA 2GF0A 2V6JA 3MG9A 2C8VA 1RRCA 2ZIAA 4MKIA 3ADKA 5P21A 3K0CA 4XSHA 3O47A 3JVVA 4PO8A 2GHIA 4DRZA 3EPJA 4KFUA 4QHTA 1N5IA 3EW9A 4BQSA 2FV8A 2QORA 4IJMA 4RKEA 1CR2A 1YZQA 2J0UA 4A9AA 1SVKA 4XVRA 1A2BA 1ZNZA 2XZOA 2GCNA 4MRVA 2GK6A 4LPSA 2GWHA 3TH5A 2Z6VA 4B3XA 2XNSA 1DS6A 1LNZA 5A5GA 2J7PD 1E9RA 2G1KA 4L9WA 3R9IA 3Q3JB 3WP1B 4F7WA 4C7OB 1IOZA 1QHYA 3OIYA 3U6KA 2V6IA 4PX9A 2WIBA 4EQ6A 2YOGA 1W2GA 4WW0A 4LV8B 3A8TA 3GJ4A 3QEOA 2WAYA 4KLZA 3SZRA 5KNBA 4LBZA 1KKMA 1OFUX 1L7VC 1DAHA 1FOEB 3OIVA 5FUVA 3SJBA 4BLRA 2NMVA 1TQ2A 5DIFA 3UATA 1VCOA 4Z1MA 1E6CA 2ZI4A 2CLSA 4RZXA 2W6ID 4O0MA 2ZI9A 3L82B 1OH5A 3IDQA 3GLFB 1R0YA 5IF9A 4TMXA 1HQYE 4Z8XA 3AP3A 4C0QC 4IHQA 4NCIA 1BO6A 1ZUNB 221PA 4KCGA 2C9CA 2WJGA 3TW4A 3BJIC 2R6CA 2P6RA 1AKEA 1UM8A 3AKEA 4MITA 3HJNA 5DE3A 2R6FA
chains in the Genus database with same CATH superfamily
1KI3A 1V1JA 1YRWA 3BJMA 4EQZA 4FK8A 3T94A 1N2ZA 1SKAA 3ABSB 3JV7A 4L0CA 3CTPA 2GLXA 4XQEA 5I4KA 4YJFB 3L1KA 2PXXA 3CZQA 2I9KA 3GYBA 3D31A 3K2EA 1SXJC 3KTAA 3QPUA 4HGZA 4TRMA 4U02A 5HE9A 2NU8B 3TRFA 4C1NA 4EG6A 1R6UA 5AVWA 4Y9TA 3C3EA 3HWWA 3ST7A 4EKIA 1JMYA 1MJNA 1IZ8A 2IS4A 2WJ3A 4GZ6A 3WNVA 4DGSA 4MW2A 1O08A 3OOWA 4DZTA 1JQ5A 1Z16A 2G83A 1KFJB 4ZEMA 2G40A 2G7MC 2HQOA 3DMRA 2DHEA 2O8DB 4NQZA 2J7PA 3PWTA 4L8LA 1C9KA 2G25A 2Y2UA 4OJKA 3S0JA 1T9ZA 4XQGA 4MUAA 5J9FA 3D4IA 4O2RA 5HQJA 1ZN9A 3UHPA 4EUNA 3QIVA 4YI3A 1R9GA 3NNDA 5C8XA 3WNZA 3ROXA 2Z57A 3W8RA 2ZYWX 5KYWA 2YXEA 3CGWA 3PNLA 2C7QA 4XGKA 4HH0A 3M49A 3RD5A 4B87A 2ZPTX 1R10A 4JB8A 1IZ7A 4JROA 4OFXA 3PEFA 5BWNA 3DTTA 4HAUA 2WJHA 2BGJA 1GNPA 2CJPA 4H17A 4GVXA 2HCTA 1G5IA 1KO1A 2FPMA 2XUZA 1DAPA 4B7XA 4LOLA 3SIXA 2AWNA 3KQLA 2NAPA 1JAZA 4OA5A 5G1PA 2G70A 4E31A 2DRIA 6GPBA 1JQ3A 2IWHA 4R1OA 3RKRA 1YE5A 3MTGA 5A4JA 3WMGA 4EL0A 1P4HA 3WL6A 2C95A 2HA6A 3JD0A 3TJRA 2FA9A 3K8OE 1WNFA 4ENUA 5I9TA 1W581 1XRMA 1WBBA 3HWX1 4ZOCA 4JELA 1LS6A 1QIKA 2GETA 5EIBC 3VOBA 4CKCB 1KR2A 3V8NA 3CF0A 2YOHA 3TTVA 4CF5A 1TD9A 2BN4A 5F51A 2DJIA 4UCQA 3DW3X 5D3MA 3TZEA 3VU1A 4D6XA 4E70A 3ZHTA 1JPJA 2QF7A 2NXCA 3NZEA 3VR4A 2BI7A 3TECE 2HIGA 3MFQA 4X44A 2SICE 2WHYA 3A3PA 1PT9A 3M81A 4OFZA 4R8VA 2VUIB 1VPWA 1KI6A 3HADA 4QXOA 5CJ2A 1CUIA 3X1XA 4BQFA 4LVCA 5KMGB 2P75A 1TZ2A 3VR5A 5AW2A 1XFDA 1Z5PA 4CCYB 4N01A 3C7CB 2VPXA 2FPPB 3WLQA 5LWHA 1PHPA 3ANYB 4DWOA 2PRKA 2PH1A 1P5JA 2PZEA 1SPXA 2PZBA 3MAGA 1KJYA 4RWEA 3A9CA 4U2KA 4FGWA 2EAUA 1BMDA 2C5BA 2BM0A 2NVWA 3BIJA 3DPSA 4IHJB 1L5LA 3TLAA 1R8XA 3DHWC 5IW8A 1M1ZA 1L5YA 3IP5A 2FWPA 5TRTA 1KC3A 3SSNA 1XOIA 2GO7A 1HFJA 1RAEA 4D9IA 4BO8A 2OL4A 5LQJA 3PTZA 4JLMA 4FSDA 4MAFA 3TRIA 4C0XA 1N57A 1GKUB 2I1QA 1T3HA 4H1WA 5IC4A 3GBSA 5FOSA 4KSYA 4GMGA 4PC7A 1N75A 3LI2A 1J21A 3RSGA 1RJ9A 2NZXA 2GGSA 3KKOA 2O7SA 5L40A 1ZSNA 1NVBA 1JVBA 3PD1A 3P0EA 2F1IA 4EVQA 1E61A 1HE5A 1F5SA 1E3WA 4L5JA 1JR3A 3FLEA 4PAOA 3BKWA 4A5SA 1YTLA 1OA1A 1NVMB 3BWVA 5E7QA 1WKCA 4IUYA 1AQJA 2IA5A 3KZXA 4D8XA 4QLOA 4G41A 5DK6A 3RTEA 4KQMA 1HZZA 4G5SA 3LY7A 2RGUA 3ZU2A 4D74A 3C6KA 4EENA 4HWRA 4EY3A 5MFZA 1J97A 4Q82A 1DQYA 4B4VA 2P11A 3V80A 4AXBA 3OUUA 1OSNA 1CLUA 1Q74A 1Q2UA 5JADA 4QFMA 2QIOA 1EGVB 3NI2A 4L95C 3HXPA 1ES9A 1C0PA 4G0ZA 4QXQA 4BPBA 2BKXA 3I9OA 5C8YA 3KLMX 3UUWA 1VC2A 1WD5A 3V42A 1N0HA 3NUZA 4ZT7A 4KLCA 4MGKR 3HN2A 3KJHA 4UE3S 1I32A 3MJDA 3ZX4A 2ONCA 1YVRA 3TCXB 3BD9A 5JXGA 2I0FA 2MWMA 4INOA 5G41A 4N6NA 3COPA 3GT3A 3LYAA 3F9RA 4AS3A 1QO0D 3DOEA 4JY7A 1K7SN 2ZJ0A 1KEEA 4UCFA 4LBWA 3E5HA 1XNJA 1GQQA 3RFTA 2RE8A 4WLOA 4WK0B 4KVFA 3TSZA 1PEYA 3W8EA 3VNSA 2JJ2D 2P91A 4W8HA 1AKUA 3AP1A 3C3MA 1CPYA 1VBFA 5IANA 4HEA1 5DYWA 1E4VA 5IF3A 4ZGWA 3HBNA 2B7BA 4S0ZA 4CLXA 5B6IA 2HJVA 3PEEA 1Y8AA 4IIFA 2OV2A 1Y4DE 2F6RA 4KEAA 4RWZA 2BKEA 2OCLA 4AT1A 2ZT6A 2K2QB 1MGPA 2Q5IA 4UHFA 2P9YA 1MX3A 4MQEA 1ZRNA 4NPCA 1YOBA 4F72A 4K9DA 4BZPA 2XE4A 3VHLB 5HM6A 4NV1A 3NWOA 2Y6UA 1VLZA 3DCIA 2BMJA 4PYQA 3D9QX 4R8MA 3DWFA 3X1WA 3N0VA 5M2QA 5TQ2B 4L51A 3WGGA 1QMGA 1A0OA 1JI3A 2Y9MB 3DAGA 3HSYA 1SO8A 3K96A 4LGVA 3RWMB 4E4RA 3VUEA 1NR5A 3QKUA 3SJCA 3TLZA 1B14A 2FF7A 3S3TA 5LYJF 3LQRA 2W2LD 2GJ4A 3HY6A 3BGIA 4GKKB 2NVOA 4ETMA 2EU8A 3EXFA 4L75A 3K30A 1H1LA 2Y1OA 1CUHA 2I3DA 1RYHA 4U7PB 4F4CA 4XRGA 3NORA 2XECA 4FE7A 1QQAA 1UH5A 5INTA 5CX1B 1JIIA 3ESDA 2C7BA 3PQFA 4QOSA 2I4TA 3ORFA 1PS9A 1GRRA 4OSOA 5I7HA 1JHYA 3CVJA 2JARA 3BTOA 5ECWA 2W4MA 1W4CA 3SE0A 5TS3A 5A02A 3ACDA 2P9CA 1F6DA 1LD3A 2HWKA 2R1VB 5D00A 4QEKA 4JKIA 5E2BA 3OT1B 3QBEA 4GRAA 1MD9A 5JE8A 3F96A 2PSEA 1ORDA 1ZISA 3N59A 1Y9JA 3Q85A 4G1UC 4QLBA 5KX5F 5BYJA 2FWRA 1KVQA 3K0HA 4JEHA 4MB6A 1F48A 2IUFA 3AUFA 4JASB 2GHQA 3ADOA 3HKBB 4BVFA 5T67A 2WSSD 3MERA 5DT2A 3ZBTA 3ITDA 4UD6A 1N36B 3NETA 1XJ0A 1VMIA 1KJZA 3KOUA 2BFNA 1CRLA 4D8TA 5FA5A 3RASA 4N1AA 4FD3A 1ZMXA 3D2AA 5DTJA 1NVVQ 3P45A 1Z62A 3PCTA 1B6SA 4NV0A 4UMEA 2XMGA 2ZYIA 2AEFA 3HYRA 3D3WA 1T9CA 3UJCA 4EG4A 5C3MA 3G68A 1UZLA 3KPUA 2P7IA 3DT6A 5FEMA 3MTIA 2RKBA 4JBHA 3UG6A 2YWHA 3IUBA 1ZXXA 2Q2QA 4RVCA 5FFNA 5EJ5A 1O95C 4B34A 4LDRA 4FR5A 1K6XA 1QH1A 1VLJA 3DTYA 1V8ZA 3DMTC 3DFUA 5E1BA 1M5TA 3GP3A 4MW4A 5TGDA 5HTKA 3AKCA 2J9YB 5ELXA 1T34A 3B8EA 4GZ5A 1FP1D 3TTWA 1ZH4A 1DC3A 2PRZA 3FKJA 1KP3A 3H5RA 3TOZA 4BGVA 1IY1A 2ZR9A 5MHTA 5LB4A 2GZ3A 2QOEA 4A8JC 5EJEA 2WVGA 3FSRA 4EUKA 4CEIB 4UM9D 2Q0HA 2RC5A 1RMYA 1BQ3A 2R2AA 3NC0C 3OA2A 1OPXA 5KS2A 1BS9A 1CVLA 1UK6A 2P2DA 1D6JA 1M2JA 3M82A 3QVVA 3UFXA 3P2EA 3P9RA 1F2DA 3HVHA 1BH2A 3R8XA 3LQ2A 1PDWA 4MINA 3K5IA 3OZIA 4P7FA 1KQNA 3V1LA 4BB6A 3FOCA 4DR3B 2YNMD 4KR0A 3QU9A 4PBSA 4E07A 1YONA 2VTKA 3BD8A 4P3NA 4LY0A 1BU5A 4EI8A 2AE1A 4G5OA 1C7RA 1AUQA 1UWKA 1Y34E 4FZ3A 1JIXA 1KZ1A 5FCDA 4F4UA 3ZGLA 1PZMA 2OILA 1M1XB 3KB2A 2I6XA 1ZXBA 2WQ7A 1D04A 1I2CA 4WKCA 2VQ3A 5EWLB 1YJQA 4TXLA 2BDEA 1I7NA 3RREA 3CNLA 3EPRA 4KO8A 1US8B 3CV3A 3KSBC 4MX8A 1K06A 4BFZA 3TKAA 4OBBA 3DBLA 3QQPA 3N2NA 1ZMBA 3TCNA 5GGYA 2D5LA 3VPXA 1DO0A 2Q2WA 1TJ4A 1VHQA 3W5BA 1E64A 2VXCA 3KR0A 3L04A 1E2QA 4DUPA 5BN1A 5I7OA 3G7UA 1YDWA 5CJPA 1Q21A 2IXTA 1NX6A 4UUNA 3VZDA 1ZJWA 5G1OA 1WHTA 4K9QA 4MW5A 5E9WA 3EUEA 2VQDA 1M7HA 3PNQA 3U26A 5K2MA 3GJ5A 1M8FA 1UXJA 1QM5A 3QMPA 5C7YA 1JKMA 5IZCA 2BM1A 2A92A 3I9LA 5LOVB 3EWSA 1SXJD 3SY8A 2XX3A 3G0CA 4DUGD 3FBWA 3ID6C 4NCJA 1VBKA 4IIHA 1QHSA 4PGFA 4X1KB 4EBBA 2OQRA 3F97A 2RHRA 4BKPA 4L8WB 1TA9A 1GFIA 1XP5A 3FIJA 3FWZA 4JCCA 4ARAA 3O1LA 3ZCPA 2W2NA 1HEIA 3I1FA 1GN8A 1YBVA 3S5JA 3FLAA 3WBJA 5IBCA 3AI7A 1LX6A 5BVHB 1BE8A 4Y9UA 2O8CA 4RXTA 3FNFA 2IHVA 3LBHA 4GOXA 1KU0A 1LPAB 1RI4A 2R6DA 4I5EA 1B1AA 1Z0FA 2GYYA 1RKBA 3B6EA 3INRA 4IHJF 4ONEA 5DHTA 1VG8A 1L7PA 2EZUA 2X7JA 3H3JA 3DMHA 1W47A 3NOQA 3M89A 1UXHA 1X7XB 2PUTA 1VL8A 3N58A 4P4GA 2GK4A 1G16A 1JG7A 4OP2A 3U7QB 5F3RA 4ZODA 4I4LA 1X80B 1D1QA 4N76A 2QQFA 1V1RB 4UOEA 1HV8A 2D0DA 4N3CA 1GTZA 1SOVA 3AF3A 5D86A 4YXFA 2OM2A 3FR7A 4HR7A 4B3DA 3ZD9A 3E9ZA 5DCYA 1KE1A 2KI5A 5LVAA 1EH5A 2ZVPX 4XGNA 1D6NA 1QK5A 1QYVA 3KM0A 3ZCTA 2E85A 1WTCA 1S89A 4DHEA 2VHZA 2QDKA 4B43A 3EIHA 5JCJD 1JVNA 4TMZA 1U6IA 4MQ6A 1BC5A 1K88A 4HOYA 2QX6A 3DYIA 3MCZA 4UMDA 1LTKA 1LRJA 5EIBD 1SAYA 1FNBA 1EGHA 1S8AA 2BKAA 1RBQA 5K8LA 4ZZ2A 1EA7A 3MGGA 3P26A 2IZOA 2CJWB 2V4ZA 4A73A 1YVEI 2O07A 1NXPA 5B3KA 4BMNA 4C7VA 2I91A 4TLAA 2YXPX 4FIZA 4CM5A 4NVRA 3C6MA 3VVMA 4MQBA 2I76A 1LV7A 1M2WA 1DFIA 2BSAA 1Q1QA 1G3RA 4RH0A 1YZKA 3MK31 3H11A 1G8HA 1B8NA 3FWYA 1P77A 2G63A 2J3QA 4LHSA 5BWBA 3VU9A 1H65A 1J0CA 1MX1A 4NJEA 4RJLA 2QN2A 1NRJB 5H81A 1OLUA 2B1GA 3JALB 2H18A 4QGGA 3KB6A 1O57A 2CVOA 3SMVA 2IXGA 3IA7A 1FDRA 3ISTA 5D01A 1KZ7B 1I33A 4ZU6X 4POOA 4P3YA 4DLZA 3QKWA 4NBUA 4Q4AB 1AB5A 3IUPA 4K6GA 1EIZA 1PR4A 4O4HB 4OIFA 3WRYC 4BKQA 1SOAA 4CKZA 5DH9A 1NDHA 2R8EA 4G5HA 4EPRA 1AK2A 3INYA 4S1PA 1ZU4A 2YJNA 3EXEB 5FBQB 3TRKA 4AN4A 2BP7B 2IYEA 4OREX 1SKQA 4OI0A 5AUOB 1E4OA 1L7MA 4N40A 3RK1A 3J81A 1ZD1A 3H83A 3ED1A 4MARA 2XKAA 4NH0A 5DASA 4J7XA 3RCBA 2F3PA 4IYRA 4M0DA 3VNVA 2HPHA 5EFOA 3VHQA 4AB1A 4AG3A 4W5QA 1QKJA 5SICE 3CE6A 2NTYC 3I6QA 3K2IA 4X8MA 4HGOA 1JIJA 2J0EA 1N4AA 4J0FA 2OZVA 4MV4A 5EIHA 1R6TA 4D4MA 5DPMA 1DELA 4QUHA 3S99A 5JS8A 3RBZA 1UJ5A 1A04A 1OYYA 3S1AB 3K6JA 1J22A 1XCOA 5HQ3B 2B9EA 1T0IA 3EFOB 4LOJA 1EAYA 1QDUA 2XCUA 3CH6A 3GJXC 3Q8WA 3F47A 2GA8A 2O54A 3CRQA 1G42A 1XZGA 2CVQA 4AFNA 3ORSA 3M1LA 3B3JA 1LVGA 3NNNA 3ONFA 4UOQA 3W5AA 1IVNA 3F3KA 3PVSA 2J33A 4G56A 1D2HA 2Q62A 1HMYA 3QHQA 5AK6A 3H4IA 4JMLA 5HW0A 3B1YA 1JH8A 3CXRA 1H3FA 3G6WA 1R0KA 4TT3A 1ZCBA 4C4AA 3NALA 5IXJA 1ABFA 1DUSA 1IH8A 1U1DA 1NZDA 3JZIA 3NAQA 4TSFA 3HL0A 1SHTX 5DXFA 4ZARA 4ALNA 4ZJPA 5KZMB 2QD4A 4ZAXA 2JIZA 4Q7MB 2QTBA 3LUJA 2YYSA 3MPUA 3U0BA 4FSXA 5ALQA 2Y27A 3IMKA 1R66A 4BMYA 1GZUA 4KTVE 1P0QA 1GVHA 4H7PA 3BK2A 3GVXA 5EKTA 5IAAA 2QL9A 3U4QB 2R5WA 1P7YA 4PN7A 3K9GA 1Z18A 4TQUS 1FX1A 3GP5A 1BW9B 2MSEB 1MOSA 5K0SA 4AY6A 1RZRA 2QVZX 1QRAA 4LJ6A 4WBSA 1OI4A 3BGDA 3SEZA 4LJ7A 3EF3A 5AMXA 4BLOA 1M1YB 1NF8A 2VIIA 3VH2A 3OY2A 4GFDA 1JKJB 1QC5A 1JI0A 1XMOB 1GQFA 2PFSA 2ODPA 4INZA 1KI8A 3IXLA 4YXWA 4CM4A 4RA6A 4GL4A 2EKLA 5LQMA 4MIOA 5LZ4A 2RH4A 1ECLA 2WJVA 1GGNA 1CG6A 4IP0A 1HEYA 1REQA 4M21A 4EW3A 6REQA 3K70D 4Z4GA 2PKYX 2XE8A 4UUOA 1T9BA 1M2OA 4J16C 3UWMA 3ZHSA 1PQUA 3CIOA 1ZWLA 3H0CA 3ZHBA 3SG0A 2XW6A 1XNHA 4NFSA 1M6YA 1APBA 3G17A 4PY2A 3PKZA 3E2IA 1CEQA 1KXZA 1UINA 4HWPA 5AH0A 4FN4A 5HZGA 4PPNA 2ZT5A 2B1RA 4NZPA 3M6LA 1CIPA 3M6IA 1WVMA 3UIEA 4UTNA 3L05A 1NI4B 3MHTA 1IONA 1S2MA 3WIVA 5I7SA 3CTMA 4MRRA 3REQA 1TYZA 4HFJA 2GUGA 4P4LA 5JDIC 3WDMA 3WAGA 3AMVA 3WYFA 3BAFA 5LNK1 4NYIR 4Q9DA 3VZRA 2IQIA 4DMKA 2P0AA 2F1HA 2Q6LA 4ESVA 3PJRA 5H7XA 3L8GA 4OLJA 2G67A 4WCFB 3SFTA 2I7DA 4TVKA 4A2WA 5FI1B 5BUZA 1GKYA 2CNOA 4KQXA 3I2YX 3VHXA 1Y33E 3PR1A 4KX3A 3K09A 1RZVA 4WXHA 2A33A 2G28A 2PU5A 3IQWA 4PZAA 5AVKA 3STXA 1G60A 5B7PA 5C1DA 2Z6UA 1CUXA 1N1GA 1EU1A 2BRUC 4IZHA 2ADOA 3QTBA 4DYVA 1XJ5A 1DV2A 5BSTA 4MHOA 4OXXA 5CVEA 5BUCA 1Z8FA 2JFOA 4UXHA 1GT6A 3OWHA 4PF1A 4BNIA 1NP7A 1KJIA 1EFAA 1IG0A 2VZLA 3DMPA 2QTHA 1WNTA 3INGA 2X1MA 2YHUA 1E0KA 4OXRA 3PHGA 2R7MA 2JAOA 1O95D 4XW2A 4QATA 3NHYA 3FN4A 5HKKD 2C7RA 1QGED 4MW1A 1XZCA 2PPLA 1B41A 1TF2A 2EJCA 3RRZA 3B36A 4V0LA 3KTAB 3R3YA 3G5MA 3RHFA 1XQXA 3ZXYA 1V7PC 4LXIA 4WE3A 5LOVF 2FCAA 5F2KA 3CT6A 1N2EA 1N2HA 2COEA 3BGVA 3R44A 4G8JA 4GLJA 4O2BB 1DC5A 3U7EB 3ZTWA 1G4UR 4V0SA 3VPGA 2VPWA 4R0MA 3AO0B 1CY0A 2HSWA 2X8LA 3IMFA 3ZE7A 2XNHA 1XQ6A 2H8KA 4DXHA 3IIEA 1HDXA 2L17A 1JEOA 4H31A 1Q95A 2BFCA 4HUJA 1JR3E 3W34A 1NOJA 3EMBA 4MTCA 3ME5A 1Y1SA 3V7NA 1CJVC 4JSYA 1LBSA 4MS1A 4W5RA 1KYIA 3IQXA 4QG3A 3HCCA 3H0EA 2WWIA 3IDFA 4FFMA 1EJ2A 3VR6H 2AFVA 2VEOA 4M46A 4NKRA 1YZVA 3Q9LA 2OGZA 3LGSA 5L4SA 3CJRA 1XTPA 4DXDA 3UOGA 5A1JA 2CHEA 2OK8A 2EBFX 3CRW1 4ZI7A 5KYXA 3WNCA 2JEZA 3B48A 2X1VA 4B3RB 4NNOA 2IUEA 5F52A 2JLBA 1SVWA 2REBA 3ZHVA 4H35A 3CRRA 1JHAA 2JGEA 3N6XA 3GJ7A 4HYQA 4FUTA 2FOXA 1LPOA 1V48A 4J6EA 2D0OB 3HLKA 1JQLB 2V98A 4JJ4A 1PGQA 4QECA 3MWGA 5CPFA 2QE6A 3TG8A 3LC1O 1QHIA 4WA8A 1F8YA 4XH9B 1X86B 3P4XA 3VI4B 4CZ2A 1VB3A 1NQVA 5C1IA 2GEFA 2H0QA 3ZDZB 4EY7A 2W2OA 3HCFA 4GBJA 3GRCA 2HJGA 5DFAA 5A9TA 3GCXA 3R9WA 3DFFA 1FUUA 2GPAA 3PIIA 1QZ3A 2X22A 3LX5A 5THQA 2VNKA 1QBGA 4OFBA 3TLGA 5GINE 5KVQA 2WBLC 3CG0A 2AKEA 3F5SA 1KI6B 1KEKA 1OC4A 3WLKX 4HNVA 1I6LA 5DO9A 2WTXA 3AHGA 3IMGA 3N74A 3OTHA 4J75A 5K3BA 4CPDA 2F17A 1J0DA 4NZ9A 4TMFA 4UZEA 2GQ0A 4BXOA 1GZVA 2Y0EA 1Z82A 4BQIA 3DGEC 4E2YA 1EVYA 3W5UA 1M7BA 3CO0S 2IY8A 4FLEA 1YZNA 1MG5A 1S1MA 2GCIA 3DE3X 3E4CA 4C07A 1QK3A 2PKQO 4LW8A 1SXQA 4GOKA 4K8RB 3ZXXA 2EKPA 3PX7A 1J6UA 5KJ1A 1E4EB 2VG8A 3OJXA 1ARZA 1QR6A 5IMBA 4B6SA 4D3YA 1G18A 3GLSA 3EYWA 5BV7A 4CGZA 2Y67A 4AJKA 5JS6A 3D54D 3V46A 1P80A 4LNHA 2H57A 4RV4A 1V3VA 2JKZA 5DX8A 4K6FA 4O4HF 4W99A 4UEOA 1PRYA 4X6LA 3ZCQA 4YX9A 5C7OO 5GQSA 3PKIA 3NKVA 4YI5A 2CVHA 3CUTA 3FTFA 2IHJA 2OV1A 5HGJA 4DWVA 2YKGA 4TGLA 3WNDA 2UVPA 1SKMA 1N7IA 1EVZA 5TNXA 1AGYA 3R5KA 3LF2A 3ZBQA 4PPGA 5B1HA 3MMXA 4TWIA 2LDBA 5FBVB 4M1QA 1XKTA 4KDFA 2CGEA 5BUQA 4RETA 3LF1A 3GT7A 3UXEA 3COYA 2O1EA 3AX6A 3C4JA 5U1PA 5U4XA 1O5IA 2G1JA 2R4QA 3DFZA 1Z0AA 4GYKA 5AM4A 1L4MA 1CJKC 1Z2EA 3NEJA 4XWKA 2UXBB 3K9NA 3LY9A 4MAAA 4O2AB 4Q39A 4RIFA 2CLKB 4RTMA 3H87A 3I8XA 2F3UA 3HB1A 3HJUA 3OETA 4I4NA 2A5DA 4BBJA 3IULA 2G17A 4P4TA 3NEAA 5C8YB 5CNMA 3ZV4A 2B4RO 2WHRA 2YXLA 1JAIA 2WT9A 1YR8A 1U0FA 1Z74A 3QXSA 4P4NA 3L40A 5DTIA 2WAAA 2XIQA 1AC5A 2QN9A 3VDMA 5EWMB 1Z2PX 4OI4A 3FYUC 5C2JB 4KNYA 3PGKA 4GPTA 1MW9X 1K1EA 1T5TA 4NP6A 5EAIA 1W29A 3U7HB 4PIMA 1DX6A 2IPLA 4WEQA 4I36A 2F4VB 1GCUA 1KEEB 1UC4B 2DKFA 2DWPA 3R20A 3GRZA 3K1AB 4WLEA 1VA4A 2BKVA 4C08A 4TTVA 3GMDA 3P7MA 5G3YA 1F12A 2QT1A 1DNPA 1Y3AA 2FEKA 3GIWA 5FJJA 4EUSA 3GLGB 1W85A 4NDAA 3H9BA 4CIVA 3CFYA 1VXOA 2VBCA 3N2ZB 3MTAA 4DM7A 5H4GA 1OBVA 3ZJ4A 1JLHA 3M4YA 1UAYA 4EPTA 2QM8A 4DARA 3VPFA 1L7XA 3WKCA 1UODA 1JNYA 1SBCA 1YCGA 2H1WA 3F4BA 4PEVA 4LVNA 2HLDD 2XMDA 4J1TA 2VRWA 4HC4A 3SKXA 4X64B 4ZYLA 5LXTA 1WB4A 1QYIA 4KREA 3D0RA 4DGQA 3S2GA 4P2GA 2G1PA 1Z38A 1AD2A 5HUJA 1Q1GA 2HLNA 3EVCA 4KYUA 3QNUA 1BVYF 1V8OA 3BWCA 4QUKA 1VRWA 3M9LA 4IX1A 4V0OA 4I1IA 1Z4MA 1P3DA 1PUXA 3PQ5A 3UJAA 3V4FA 3H9CA 3TNFA 3T6KA 4GMKA 1F2TA 3WQHA 4D9GA 5EMKA 5JCJA 2EW1A 4CMEA 3RUAA 5J40A 1JSXA 4LNAA 4G0UA 1H94A 2D4AA 4JHXA 2O2DA 3T35A 5K4GA 2XQGA 4YMUA 3H6HA 1W8IA 1BTOA 1E1YA 1Z33A 3AC0A 2WK1A 2DR0A 1JUDA 2VLBA 3U3ZA 2ZLBA 3LK7A 3O1HB 4X66B 2VJYA 2ST1A 1KDRA 3CU5A 4GKAA 3UK0A 3A6ZA 1EDEA 1MCZA 2DTDA 1YKFA 1JU3A 2X0KA 4LF7B 3W6PA 1EX9A 1GU7A 1U9IA 2ATCA 2GBIA 3QF7A 1RJDA 2HUPA 3EX7C 2FWNA 3G2MA 2QT9A 4ZO7A 4Y7CA 1PT6A 3STYA 5JSYA 4B1FA 2RJNA 2P2GA 5SYNA 3EGVA 3AR8A 3ETGA 5H80A 2WTNA 1SEPA 2JKYA 4PHCA 3DONA 3RUHA 1EG7A 4L4ZA 1C9DB 2BFDA 5ESDA 4HDQB 3GA0A 1K8RA 2AGVA 2GEVA 2XDYA 1IIBA 3SZGA 2QIPA 3N2EA 1YCDA 3R3UA 2H8GA 3HL4A 2X3YA 4NY1A 5D5HA 3K0CC 3W5SA 4FKBA 2CFIA 1OFUA 2FNAA 3WDSA 2ZETA 3SQWA 4G1CA 1GNQA 2O06A 5JECA 3USCS 5FA6A 4OYRA 1EB8A 1Z29A 4PX3A 3SPXA 3A6EA 3W2GA 1L4YA 1YR2A 2Y68A 1AMUA 4I1PA 2VJAA 1XCMA 2XUGA 4IF6A 3DOHA 3IV9A 3B1FA 3OBIA 1QH1B 3EZ7A 3Q3GE 4OHMA 2WTMA 1UF9A 1M2EA 3CF6R 3RT1A 5AW6A 4C29A 4WCVA 3LY8A 3ECSA 3PPXA 3FOEC 2QAGC 1RC8A 3FHCB 4DQVA 1OLOA 3PD7A 2OT3B 2V74B 3NH9A 3HDHA 4FKMA 4L6AA 1TMOA 1EUCA 2ID7A 3LKVA 3UK2A 2BTEA 1WL8A 1WMDA 3PPWA 5JCXA 2RBEA 1D9ZA 3GN2A 1JQKA 1V2GA 1KY5A 5J58A 3FB1A 4O2BF 4LJKA 1RM5A 1KS9A 4AU1A 1L5RA 2GTPA 4XD7A 2IS1A 2V1XA 3UFXB 2AK2A 3HGTA 3KFVA 2GF2A 3VYVA 4R9VA 1H1DA 3OU7A 1IPFA 2ZDQA 4OJNA 5FI0B 1O87A 5LMUB 3S29A 4S35A 1SCNE 4GOJA 4YO7A 3L41A 3T3PB 1PZXA 2DVMA 2H1VA 4QBHA 2X2FA 2IIVA 1E1LA 2NVUA 4PG7A 3AUKA 3X1DA 3BL6A 2HCFA 1VSQA 4ZVTA 1WZEA 2FR1A 4DABA 4H9GA 4CWAA 4YR7A 3U4GA 4FDAA 4DWJA 3BF8A 4HLUA 5AHKA 4HPWA 2X86A 4TTRA 5DWVA 2R1UA 1NF2A 1T24A 3FNGA 3IA2A 2I6TA 1KP2A 1LKZA 3DXFA 3DNPA 4FZJA 2Q1XA 4N39A 1RAAA 1RACA 1VE5A 4R3UC 2WVAA 5A6SA 1TEZA 1M34A 3G82C 3TB4A 5K4HA 1GGJA 1RFLA 1WRBA 2ZM6B 2ORIA 2N47A 2V7QA 4O4LA 4ZVLA 5L7WA 4FHGA 5AXAA 2FMHA 1BJRE 2PS0A 2V58A 4HDCA 5LCXA 3U48A 3LUKA 4BRWA 2MYNA 3AESB 4DIBA 2UUAB 3AI1A 3PFBA 1R4NA 1STOA 2EF1A 4G0QA 4GI5A 1HYBA 4Z0NA 3JW8A 4URYR 4UTZA 3UJ6A 4QGHA 2PX2A 4QHSA 3UT0A 4CFSA 1WHTB 4F4JA 2PLFA 3ZDRA 3FYHA 4L2IA 1BDJA 4B7ZA 1H93A 4DPKA 4WOCA 1V37A 3PQ7A 3UGTA 1G64A 1JDVA 2X3UA 1X9GA 4JLDA 4RY2A 4ESEA 3DZHA 1O5OA 4H1UA 2QUBA 3ZS8A 4F7DA 5IDQA 1RQ7A 1WA5A 1T13A 4H08A 1YMVA 5F1PA 5AXDA 3DOFA 2Z30A 2JFWA 4TLBA 4EDHA 3IAXA 2DCUA 2Z8XA 4D8YA 3ZIUA 2HQRA 3HZZA 2CC2A 4RBNA 1L6RA 4HMOA 4MUBA 4DQDA 4BU1A 1U0BB 4Q3BA 3HA5A 5K45A 3R6GA 1D2GA 1JJVA 2TECE 3FR8A 4LCBA 5KDOA 1GZ7A 1G6Q1 1M9NA 1FSGA 3DQQA 4DSUA 2BI8A 2O8CB 4DA9A 3UAXA 3H5WA 5IAEA 4GLFA 4JENA 1AO3A 3HMQA 4QXAA 2OENG 4FCTA 2WKWA 5CH3A 2WYIA 4E4TA 1L4HA 1RXUA 2GD0A 4OL0A 4TWBA 3N07A 1PVOA 3FGPA 2V0CA 721PA 4X93A 1ZGCA 2OHHA 4MWZA 8ADHA 1I3KA 1CEXA 1JEJA 3TZCA 1EM6A 3NAGA 3TLCA 2XB4A 4A36A 1ZYUA 1C4XA 1CK4A 1MAVA 1ORHA 2TSYB 3DEAA 3GEIA 2OM6A 3NTUA 3CONA 3HXQA 4YRTA 4I5DA 5BR7A 3OPMA 1FUEA 2CDCA 1R3DA 3O4RA 1KZGB 3ROZA 3V7WA 3ZLBA 2HRZA 1T8WA 1ZGHA 3I5YA 2XT6A 1KFBB 4XGRA 2AHOA 3ZH2A 2QMUA 4EWLA 3GNSA 2R7AA 4BV3A 3ZVKA 4G67A 4ZVQA 2C5HA 1H05A 1L7BA 2PMFA 3L4SO 4N5HX 3WG9A 4BP1A 4EUFA 2HC9A 1S2GA 2O3UA 3AG5A 1BE1A 4JVLA 3UMVA 1IZ0A 1RD4A 3PRKE 4EPVA 1TM4E 3KTFA 3OEHD 1CFZA 1DJQA 2IPAB 2P8JA 4MRSA 1IOVA 1K08A 2NUAA 4O2AF 3R7WB 3ZCUA 2ABWA 5DJ5A 3KKKA 3MWFA 1GZSA 5TR9A 1UEXC 4ZANA 4DV4B 1SPBS 4KQ2A 5E7JA 5E6SA 4P0TA 3C3WA 5C8YF 5JQGB 3VR2A 1TEHA 4CCWA 3ZV5A 4B9EA 1A3CA 3H11B 1A77A 3ZW7A 4LJ5A 5LKRA 1VSUA 4PQRA 3TZ6A 4LYFA 3VU9B 8ABPA 2M6KA 3UHFA 5CLFA 4QBKA 2O7NA 4A26A 4AY4A 3EA0A 1UFOA 1OLUB 1BGVA 3W8DA 3I5AA 3GJ0A 2QZ4A 1SXHA 3MS7A 2G09A 4RQAA 1NVKA 5K3DA 1V5WA 2ZS7A 2HDOA 3QKRA 1KSGA 1D2RA 4Y2QA 1UMCA 1UDXA 4XVHA 1OI7A 2X6TA 4FGSA 4ISCA 3MCUA 4XI9A 1Y7IA 3K3PA 4EECA 3HVKA 1Y4AE 1ULUA 2RBKA 1WF6A 2H07A 3RJZA 2ZTHA 4OA8A 3GLHA 1ZUHA 3EHDA 121PA 4KKVA 1YB4A 4LXTA 1A5ZA 3J7AC 1OXSC 1JLLA 1JZSA 4ALMA 4DNFA 4MP6A 4N8SA 4L74A 2PVSA 3VX3A 2AZXA 2XKJE 4XEUA 2JHGA 3K15A 4WN9A 3VC2A 4QPNA 4DIFA 3M4NA 5K7SA 2YZ7A 1SVLA 3KD2A 5LDHA 3EQ7A 3B52X 5T4BA 3L7JA 4DCUA 1W25A 1WUYA 4PZ0A 4N18A 3DHEA 2VK4A 1Z17A 4JYZA 2JGNA 5K0GA 1K5DA 2VYND 3ML1A 4NE7A 4NMXB 3ZDFA 3ZPXA 5DTMA 3PCXA 1ZITA 4QOJA 3SZUA 1VYUA 4TMKA 4XSVA 5ALJA 1M6EX 2ZTLA 2FUG6 2J3DA 2X4LA 4BTVA 4EB6A 4ND6A 4GKBA 1TCCA 5H3CA 1ODTC 2R6ZA 2CMGA 2ZOSA 1XPJA 2LBPA 3IUMA 2N1BA 3I2IA 1YB5A 3GDOA 3TTTA 5AVVA 2PJDA 4M83A 2P27A 3OEYA 5AR1A 1YHYA 3QPWA 1OROA 2MU1A 1G4AE 3SR4A 4FC7A 2Q28A 1QGZA 2RCNA 2WV9A 2XEDA 1NONA 1UJ4A 4EF5A 2Q5QA 1IN1A 4KQ9A 1EWKA 2UXDB 1SIBE 2I3AA 4LPKA 1TO1E 5C1BA 3O03A 3UKJA 1IEVA 2R60A 4FX2A 4YRAA 2UYCA 3GEBA 3A9WA 2VF7A 1FZTA 4MUNA 4DCJA 1II0A 4WOBA 3CUSA 4C20A 3RVDA 3B2EA 1E9CA 1GG8A 3AVPA 2COKA 3O8OB 4FFNA 3NJ8A 4M7WA 4URZR 3TW6A 4C88A 2I4NA 2YCLA 3I5XA 1SA0A 2W0SA 1ZH6A 1E1QA 4CL0A 3OECA 2BDUA 3IVMA 2RHDA 3JS5A 4MKGA 5K09A 5MF6A 1OBCA 5HCNA 1JKXA 3BT7A 3BTUA 3WRWA 2ZIFA 2W2VA 4C4TA 3ZJUA 3V2IA 1HSOA 2XVMA 1FP2A 3RVJA 1RQRA 5A4AA 1HFEL 2C1EA 2GT1A 3F6CA 4LC0A 4W5JA 4ZOQI 1MDFA 1YBMA 2L42A 4CM4B 5FTJA 5DHPA 3OZAA 4R51A 1REQB 1F3LA 5UKDA 3QHAA 3BXOA 3VU3A 1M2OB 2D5AA 5G2OA 1ODIA 3UCXA 2HMVA 4CV3A 2C3YA 4H6WA 1TGYA 2BW0A 1X7YB 2FSHA 1Z2DA 3L7YA 3E05A 1EX7A 1G8YA 3O8DA 3RJTA 1LXCA 3SC3A 1VQ1A 3IKLA 1PK7A 3LFHA 3IH5A 5BRAA 1LH0A 5CFRA 1GA1A 2QTNA 5HS4A 4RHFA 3X1YA 4UARA 1UBCA 4XQCA 1N6PA 4ZOLA 3WBKA 2QPTA 2ZE7A 3REQB 4OCZA 2CLEB 2RG1A 3U31A 5CD9A 4DVJA 6PFKA 2OAP1 5FV7A 1XL0A 2XRYA 4ENRA 1L1FA 1KAOA 3NVKI 3T3GA 4KRYA 1LRKA 3BXPA 4R3NA 1PK9A 5HZHA 2OQIA 4G23A 1NUQA 4H77A 3HHPA 2Q1UA 3TDKA 1TLLA 1B16A 1JBKA 4KGDA 4QYWA 4BKOA 1T2NA 1YB6A 3VHXB 2FZ5A 1GKLA 5CFOA 4Z3DA 3DTVD 3DMGA 5BSGA 1YAHA 4AY5A 1S5PA 4ZDKA 6NULA 2Q5OA 1QG2A 4IDPA 5BNTA 4E5SA 3ASZA 3GPIA 3ZE8A 4EGQA 4AURA