5HEGA

Pentameric ligand-gated ion channel glic mutant p246g
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLGKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Signal Transduction at the Domain Interface of Prokaryotic Pentameric Ligand-Gated Ion Channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hegA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hegA01
4ZJTA 1UW6A 4NPPA 2ZJUA 5AFKA 4A97A 2YMDA 5BP0A 5BW2A 5FJVA 4QAAA 2C9TA 4HFDA 3RI5A 4FRRA 5AFMA 4Z91A 2WNJA 3ZDHA 5LG3A 4WV9A 4Z90A 4TNWA 4D01A 5LXBA 5HEHA 2LKGA 4ZJSA 3PMZA 3UU8A 4BQTA 5CFBA 2LKHA 3JAEA 3UQ4A 2BYSA 2WZYA 3WIPA 2BYQA 3PEOA 5L47A 4UM3A 2BG9E 1OEDB 2X00D 4ZK4A 3RHWA 3SIOA 3T4MA 5AINA 4COFA 4ZZBA 5HEGA 3WTIA 3UU6A 2XYSA 2XNVA 3RQWA 2WNCA 2W8GA 2XNTA 2XZ6A 2LLYA 2M6BA 4AFHA 5L4HA 2MAWA 2YOEA 5HEUA 2BYNA 5J5HA 3TLTA 4XK9A 3C84A 4UY2A 5L4EA 5HEOA 3U8MA 4UM3P 4F8HA 3U8KA 2Y7YA 3TLUA 4ILBA 3RIAA 3WTOA 1UX2A 2YMEA 2VL0A 3UU4A 1OEDA 2XNUA 2BG9B 4PIRA 1OEDE 4TWHA 4HFIA 2Y57A 4QABA 4UXUA 3WTMA 4IL4A 2XQ3A 4QH1A 5AFMB 2WNLA 2XQ5A 5AFJA 2PH9A 3TLWA 2XQ8A 4TWFA 5SYOA 2BR7A 3P50A 2BYRA 4TWDA 3RQUA 4LMJA 5AFLA 1UV6A 2BR8A 5KE4A 5HCMA 2XQ6A 2BJ0A 4ALXA 3WTHA 1OEDC 5IUXA 5AFHA 5AFNA 5J5GA 4UM1A 4NZBA 3WTJA 2Y58A 2WN9A 3WTLA 3WTKA 2LM2A 4ILAA 4ZRUA 4B5DA 4XHEA 3TLSA 4BFQA 2YKSA 4QH5A 4QACA 2KSRA 3JAFA 5HEJA 5CO5A 2XQ9A 2XQAA 4IL9A 4ILCA 4X5TA 5KZUA 3LSVA 4TNVA 3P4WA 3SQ6A 4AFTA 3UU3A 3JADA 2BG9C 4HFCA 4HFHA 2ZJVA 3IGQA 3SQ9A 1I9BA 3GUAA 3C79A 3EAMA 3RIFA 3ZKRA 5TVCA 2XQ7A 3U8NA 3UU5A 2Y56A 2XZ5A 2UZ6A 3U8JA 2M6IA 4HFEA 4ZK1A 4EZ1A 2XYTA 4ZR6A 3U8LA 4AFGA 3UQ7A 4IREA 2W8FA 2YN6A 3ZDGA 4QH4A 5HCJA 2X00A 5BRXA 3SH1A 2PGZA 2BG9A 4UM3S 4LMKA 4DBMA 4ZZCA 4HQPA 3WTNA 2Y54A 2BYPA 4A98A 2QC1B 5J0ZA 4HFBA 2XQ4A 5J5FA 3EHZA 3TLVA 3EI0A 3UUBA 5J5IA 5JMEA 4LMLA
chains in the Genus database with same CATH superfamily
2CXLA 3AEBA 2UXDT 1UCUA 4OYJA 2K9AA 5LJNA 2QVAA 5C8YE 2VK9A 3UU8A 2K5BB 2KINB 1QUUA 2WU2A 3ZYMA 3RQWA 2M6BA 3P4SA 1LVKA 3QK6A 3PU3A 3QB5K 2VL0A 5DJQC 2XNUA 1OEDE 2IDOB 3N9LA 2XQ3A 4O4LE 3NKZA 4C91A 2D2SA 1W9RA 1Y64B 1FMVA 3C51A 2BJ0A 4TX5A 1WYCA 1KFYA 2XY8B 3EDUA 4UM1A 1HTJF 3WTLA 2KWIB 2E9XC 3O9XA 1LVFA 2X0YA 3AA7B 4IE5A 1DU2A 2XQAA 2H88A 4BA9A 2WZIA 3ETVA 5KZUA 3LSVA 1XDPA 3WAKA 5LNKA 3C64A 2ZJVA 4KP3C 3G06A 3AA1B 3KV4A 3AA0B 3KV5A 4HFEA 5JR9B 4U72A 1MMGA 4H9RC 3Q5DA 3ZN1B 1CHUA 4HFBA 3LK42 3TLVA 3UUBA 1BR4A 4LMLA 1ZV4X 2ZJUA 4A97A 5BP0A 5BW2A 3BK9A 4QXHB 3ZCJA 4Z91A 3RRWA 2LSYA 4I4TE 2W00A 3ZJ1A 3F57A 4AIUA 3JAEA 3WIPA 2LOPA 4DMVA 3L09A 3QOFA 3KV9A 2LLYA 4AFHA 2RP4A 4XK9A 3KV6A 5HEOA 5LHIB 3UU4A 1KNPA 1OEDA 4PIRA 3FZLB 4QXCB 3ZT7A 3RC8A 2HPJA 4HWHA 4O2AE 2X9WA 1ZHCA 3P50A 4EEBA 3N9QA 2K48A 3NRXA 4YXDA 2A3DA 4HWCA 4DR3T 2XPKA 2A72A 4TN7B 2F4VT 2L8KA 3K3NA 4U33A 4ADZA 2WN9A 4YT0A 1YKHB 3IF8B 4ILCA 2CXDA 3NRYA 3BQIA 5L3FB 4V1Av 4DR4T 3Q5XA 5FY0A 4UVAB 1UUSA 3NBXX 5GONE 2BS3A 3ANWA 3M65A 2V7LA 5JVDE 4O2BE 2P9BA 5BRXA 2XAJB 3QUJA 4ZZCA 5J0ZA 4DV5T 2XQ4A 4ILUA 5JDNA 3EHZA 3QB5A 5AQGB 2DI4A 5JDMA 3SS1A 2I6HA 4CI3B 5AFMA 1J1JA 2VVSA 5JDQA 4K0UA 2OV9A 2D5UA 2BVLA 2KT9A 1VRBA 3PEOA 5JDHA 4HWFA 3RHWA 1WYBA 4I0UA 5DQVA 4JI5T 2X68A 3RIUC 4CN1A 5AQUB 3IA3A 2OLTA 5CGMA 1JNRA 4EZ4A 2CMRA 3WTOA 5JRCB 4JLEA 2Y57A 4CI2B 3K3OA 2XHEB 3KBUA 4TWDA 2DCFA 2PG8A 2NP9A 2LHRA 3J7Yq 3A8YC 5HCMA 2EHOA 4I50E 5IUXA 3IBPA 3ZMUB 4BAYB 1YQ4A 4ASKA 3WTJA 3BQKA 3CVRA 3F2EA 3UUNA 4QH5A 2WMOA 5AQLB 3PJAJ 4CN6A 3PUQA 4AQFC 1V9DA 3NVOA 4DUZT 4KX6A 3C79A 1US7B 2XQ7A 3A5XA 3CPZA 1S94A 4KBMB 3LK2B 1HX1B 2LHNA 3ONJA 2W63A 3VRAA 3AEGA 4TZ4C 2MBGA 5HXHA 5J5FA 4LFCT 4ZXLA 5KXJA 3C4WA 1UW6A 3AVRA 3K1SA 3FHNA 3AEEA 3CK6A 2ZMAA 4Z90A 3H3MA 3GN5B 5H6RB 5LXBA 3CQGB 5ADXL 5FNVE 4Q25A 2XSBA 2UXNB 4HKAA 5EK2A 2BG9E 4JI1T 3C4XA 3PUAA 5JREA 1D1BA 1MIWA 5C2TA 3AEFA 2W8GA 2YOEA 5C3JA 4XZCA 3U8MA 3NWIA 3R84B 2K3WA 4YY3T 4X65T 1MMNA 2WY2A 4DBQA 2IAKA 4UXUA 3WTMA 5JQGE 4IL4A 2WDVA 3CX8B 1EZ3A 2H3RA 4DR1T 2BZBA 4B3RT 5LYJE 1UV6A 1ZEEA 1G8XA 4X20E 3ZPOA 5AQFB 3PURA 1M7KA 3S4UA 4NZBA 2CLYB 5LBMA 5AQJB 4AKGA 4YTNA 5CJ5A 2DWKA 2NTYA 4JI6T 2WBLA 4PJJA 4WYVA 2NW7A 4I43B 4MLKA 2B76A 4JI4T 2Q9QB 2Y56A 4DV6T 1I94T 2Q9QD 1XMQT 3CKDA 5JDFA 2V7KA 4L0RA 2X00A 1KNRA 4IDZA 2BBJA 4DV4T 5LHHB 3P7IA 5AQRB 5FL0A 3ANWB 2JRKA 4ZJTA 2VVNA 2JQKA 2W62A 1SA0E 4TNWA 1N32T 2IUBA 3PUGA 2Q9QC 3PUYF 1SUMB 4X62T 2GK9A 5HAXA 2WZHA 3RYFE 5HEUA 2ZM2A 3H3AA 4GKKT 1J5WA 2UUBT 2J62A 2BG9B 3HR0A 3I9WA 4PJMA 3MKDA 2QA7A 2V5CA 3TLWA 4TWFA 1FMWA 4HFVA 4O4HE 2Q9QA 3AXJA 5CA0E 2XM2A 1UX5A 1BR0A 2CWYA 5LGUB 4B5DA 4BFQA 3JAFA 1J5ET 3JC6D 4X5TA 1CUNA 2ODVA 4WW0A 5AQSB 3ZCIA 4WBOA 3GUAA 4U74A 4KMCA 3AE4A 3X1DA 2J47A 5JR9C 2ES0A 4ZR6A 4WBNE 3ZDGA 2J4GA 3HA4A 3HKCE 1D0XA 4DBMA 3HL6A 5ABFA 2LEHA 5A1LA 2E9XD 3AAEB 4DVDA 2BYSA 2DHRA 4J2CA 5AINA 1HX8A 3PUZF 2CXFA 5IHYA 4YLHA 2H7OA 2HN2A 2JQ9A 2ZM0A 2LSKA 1KF6A 1U4QA 3NZQA 3B57A 5LB7B 3K3QC 1MMDA 1YXRA 2QRXA 3AVSA 4QWNB 2V6YA 1YQ3A 4EOZB 4UIGA 2E2AA 1G73A 3MXZA 3I1AA 3RKOA 1LKXA 1Y01A 4BJNA 4DV7T 4JI2T 4FJOA 2KLQA 4LF9T 3B13A 3ZEFB 4UF0B 4QACA 2KSRA 2BS4A 4DNDA 3RX6A 1YD8G 1HS7A 1B7TA 2IHR1 3AE9A 3AE8A 4DR6T 5IWAT 2XYTA 1UGOA 4H63V 5LP6E 4GOUA 2PJQA 1N33T 2Z6EA 4LF6T 2MTQA 4HQPA 1JNZA 2CCQA 2BYPA 1E1HB 5KX5E 4GKJT 5FJVA 4HGAA 1E2AA 4B3MT 3UUXB 4EXTA 3RGLA 3D0TA 4KHZF 2VURA 4LF4T 2LOSA 4ZK4A 2KXPB 4COFA 4AQYT 3J9X1 5JH7E 1AJ3A 2XNVA 2XNTA 4UM3P 4F8HA 2WB5A 3N9NA 5AQVB 3ZT5A 1XMOT 2XQYA 5AFJA 1O3XA 2E9XB 4K0KT 3ONLC 4AKIA 5KE4A 2BR8A 3AE6A 2WCAA 2WDRA 2H7VC 3ETUA 2SPCA 3AAAB 2VKHA 5FXWA 5HXCA 2LJLA 4XHEA 4X1IE 1MIYA 5AQPB 4DUYT 4EGWA 1ZKEA 4DR2T 3FZFB 4PJNA 2CM0A 3EAMA 3E22E 3EUHA 1H7CA 4I55E 4P09A 2W61A 4YJ3E 2X67A 2NOXA 2YN6A 2YDSA 4H63H 2VB6A 4DV1T 1WR0A 4HWDA 3GWHA 1WLXA 3PE0A 2JPFA 2FJBA 3TKLB 5AQTB 2XAHB 4A56A 3UFGA 3C98B 3QNUA 3HKEE 2FUPA 4GYRA 3UFEA 2V6YB 3E08A 4D01A 3LBXA 4ZJSA 5AQKB 2LKHA 3OKQA 4OHFA 4TV9E 3N9MA 3ZJ2A 3AE1A 2XYSA 2BKPA 2BYNA 3C4ZA 5CB4E 4LF8T 3C84A 4PFOA 5L3EB 2Y7YA 4IHJE 4LF5T 2J1DG 3R6NA 4GK0E 4WNKA 4EAHA 3V5UA 5JRCA 3AXJB 5LXTE 2NR4A 1HCIA 5FMNA 3ZT6A 3JC6C 1YW0A 3MZKB 2MPKA 3LJCA 5KMGP 2UXXB 2YU1A 1NENA 2B1EA 2PTFA 2E8IA 4YSYA 5FVLA 2UUCT 4IT4A 3NZPA 3WTKA 3FBLA 1ZP0A 5HEJA 2AE9A 4G2AA 2XZEA 1T98A 1E7PA 4EB6E 2BKNA 4DV2T 3JADA 2XSAA 3OBVE 1MNEA 2X9YA 4EIWA 2VKOA 3AE3A 2V7IA 4X1KE 2XZ5A 3EABA 2UZ6A 4ZK1A 5EZYE 3U8LA 2IC9A 4EEDA 3OTOT 3LK3B 3SH1A 2D9DA 4UM3S 3OYXA 4L9IA 3FZKB 1WFDA 5AFUL 5J5IA 3WAJA 3MA9A 4QAAA 4FRRA 4IE4A 3UULA 1X9BA 4NXNT 4IGUA 3OJAA 5CA1E 4YHJA 4IDNA 2BKOA 1X79A 3VU7H 2W0GA 3SIOA 2RA1A 4IE6A 2OA5A 3UU6A 4YHHT 3RYHE 4PW8A 2JMHA 4C90A 4HWIB 4MALA 3TLTA 1I6ZA 2CBIA 2X9HA 3O1HA 4ILBA 4FI5A 1UX2A 2W67A 5ETWA 3LG7A 5AFMB 2Y6XA 1T8BA 3AA6B 2EHOB 4DV3T 4LMJA 4UF0A 1XDOA 4NUVA 2PFVA 3FXDB 3HI2A 4E7ZA 2VQFT 3K8PC 4HEAA 4LFBT 5IYZE 3GA8A 5AQNB 3SOLA 5CO5A 1VCTA 3RLFF 3KFWX 1BR2A 4IL9A 2X66A 4TNVA 2ODUA 3F31A 3UT5E 4XAXB 5F3JA 5FL1A 1I9BA 1OXZA 1M62A 5LG4A 4QKNA 5TVCA 4B6XA 4H9QC 4JI7T 2FJAA 3Q2MA 4CQIA 3ZC0A 3UTKA 1HG5A 5FXVA 5LMNT 3ZDHA 3AE2A 5HYAA 3N9OA 4BQTA 3ZC1A 3FBZA 3ONXA 4JI0T 4UXNB 3RH3A 4O4IE 2KZ7B 4KI0F 2LSJA 1SE7A 3OVUA 1QSDA 5HXEA 2MAWA 3FZHB 4ZI2C 3ZYKA 3KVAA 2FBWA 3ZMVB 3T1YT 1N34T 4OFZA 5KDMC 3KBTA 1D1CA 3GN5A 1T7SA 3VHLA 3P8CD 1IZNB 2CLYC 2A9UA 3DTOA 5AQHB 2WMNA 4DV0T 3VR8A 4ILAA 5H6QB 4ZI2D 2XUEA 3U3IA 2YKSA 1XZYA 4L5GA 5EK3A 2XQ9A 4HE8A 4CXYA 2IC6A 3CIRA 3KINB 5HWYA 4F6RC 3ABVA 3SQ9A 3B5MA 3RRCA 4BJMA 3HKBE 1MNDA 3CX6B 4TV8E 4JEUB 4UV9B 3RYCE 1IJ5A 5L2LA 1IBKT 3FB2A 4YSZA 5LGTB 3FZMB 5J1GA 3WTNA 4GK5E 4UV8B 1W0AA 4AKRB 4MHCA 2YMDA 3LBXB 3MJXA 1QLBA 1ZOYA 4EYUA 5HEHA 2LKGA 2V7MA 4X64T 4CN4A 3ESLA 1HNXT 2VASA 5DABA 3EVYA 2HH7A 1T72A 2V26A 2YU2A 3M3ZB 4DR7T 5FVKA 2CBJA 4NUUA 2CHNA 3V5SA 2CRBA 4TWHA 4QABA 2X51A 2XQ5A 2CHOA 3Q9DA 4AKLA 2BR7A 4IIJE 5ABGA 2PBIA 5AQIB 4JV5T 3AEDA 2I0MA 2VL8A 3RYIE 5AFNA 4AXPA 2C5KT 4P0AA 4AISA 5FY7A 2LM2A 2C5IT 1W0BA 4EYYR 3L8RA 3AECA 2C0SA 3SWHA 5F8PA 2JMKA 2X9XA 3VKGA 2LRKA 3P4WA 4AFTA 3UU3A 4HFHA 5TAOA 4M1PA 5L3DB 5ABEA 3RIFA 4IDPA 3DP7A 3UU5A 2N1GA 4GIWA 2LM9A 3SFEA 3LDQB 4Z8XA 1Z8UA 4JUYA 2W8FA 4QH4A 4U31A 3ZYLA 2PGZA 2BG9A 3RPUA 2NWBA 2NW9A 4PNIA 1KK7A 3EI0A 1UURA 4NPPA 4O4JE 4UEMA 1IAPA 3PUXF 4AQFA 2MYSA 2CEAA 1VOMA 5LG3A 3CQCB 4PK6A 2E5LT 4JBWF 2WZYA 2BVMA 1HNWT 2X00D 4P1NA 1FJGT 4YSXA 3GMIA 2WWVA 4U7YA 4IE7A 2JQHA 1IBLT 4OX9T 2E9XA 3ZSSA 3N9PA 2YMEA 3O1JA 5BR8T 4AQGA 2CE7A 3PTRB 4U7IA 1WCRA 4HFIA 4QH1A 2VWAA 2DLRA 3PDYA 5FY1A 1L0VA 5SYOA 5FYMA 3RQUA 3JCFA 3QC9A 4MFRA 2K24A 3PUVF 1VCSA 1HF8A 5ABHA 1BR1A 2V7JA 3ZSTA 4AI6A 5J5GA 4GYSA 4IDOA 5JR9A 3PUWF 2JQQA 4CI1B 1NWMX 4P0BA 4DIDB 1R8IA 4YTPA 2XTLA 2LSIA 4ZOLE 5L3CB 2I59A 3AB3B 3U8NA 2FJEA 5FP3A 3H37A 5AQQB 4X66T 2G0UA 3U78A 4OK0A 5LCYA 1IBMT 5BMVE 4ZHQE 1MMAA 4JI8T 4B3ST 2CPTA 3WI3A 4LF7T 3PV0F 2DL1A 4YTMA 4NIQA 4HFDA 4UVCB 2V1DB 4WV9A 1LRZA 3ZMZB 1YKEB 3UQ4A 1OEDB 3AEAA 4DO0A 4U3CA 1NAFA 3T4MA 2LRLA 5HEGA 4QX8B 4AKHA 5EK4A 5L4EA 3N2GE 1XNQT 4H9SE 2V5DA 2KNDA 3PJAA 5FXZA 2XQ8A 3FXEB 3OPCA 4IE0A 2XQ6A 4JYAT 4PFPA 4PAGA 4QHOA 2FJDA 3RKGA 4EV6A 2V8SV 3VRBA 3C50A 2WM9A 2R6GF 3Q5EA 2QGSA 4CXXA 5HXRA 3SQ6A 2BG9C 2Y48B 4ZEYA 2NTXA 4ERRA 4ZI3D 1HNZT 3E0ZA 3I9YA 2BBHA 3P4RA 4A5XA 2C5JA 3EDVA 2LSGA 3HKDE 4HTEA 2N9DA 5JDLA 5HCJA 3O1IA 1KNZA 3I0QA 1Z0PA 3ZN0B 4QXBB 1XNRT 2QC1B 4A98A 5L3GB 5JMEA 2KMFA 4ISTA 2N2NA 2WU5A 5HWXA 3AAIA 3RI5A 2WQYA 4U2YA 4IDQA 2YK0A 5LOVE 3N2OA 1OWAA 2ACXA 4ZZBA 3DJBA 2Y8DA 2IIUA 5L4HA 1D1AA 2ZM6T 2W2UA 1UX4A 3LFMA 3T1HT 2ZLYA 3P4PA 2XAGB 2VQET 2PH9A 4O8SA 4B3TT 3RC3A 5LA6E 1WRDA 1NEKA 3SFDA 4DMWA 1SHZC 2W4XA 2HN1A 2ZM8A 5JTGA 3TLSA 2HHHT 1HFAA 3PU8A 3Q5WA 2JJ9A 5L3BB 3MK7C 1S35A 4HFCA 4QX7B 1U5PA 2UU9T 5LJMA 4PJLA 3MACA 3VR9A 4H9PC 2DNXA 5E0OA 4HN9A 4XBFB 4LMKA 2Y54A 3SRZA 4H9NC 2XAQB 1WR6A 2LT3A 2WSSV 1HR0T 1IJ6A 3P4QA 2YDRA 3CQXC 4DR5T 3PMZA 4UR9A 5CFBA 2BYQA 4UM3A 2WDQA 4UELA 3I0OA 5F5WA 3WTIA 2WNCA 2YINA 2L3LA 5J5HA 3U8KA 2ACZA 2UUAT 4YJ2E 1FEWA 4ZI7E 2EHOC 2DWGA 3ZMTB 2BYRA 2V6XA 4U2ZA 5J2TE 3KDSE 1W09A 3CMLA 3L39A 2H89A 1XWMA 5J2UE 2E5VA 5HXSA 3O4XE 3WTHA 2X0HA 2YEVC 4EZHA 2HPLA 2W66A 2MOZA 4ZRUA 1HG2A 4X1YE 2UXBT 5DQWA 2XM1A 2D0TA 5ABFB 3CWZB 3PUSA 1D0ZA 2VKDA 4OYKA 3ZKRA 3AE7A 4DBRA 4NXMT 2KWHA 4UVBB 4EZ1A 3VKHA 3RF1A 3AE5A 4AFGA 4JEHB 4IREA 2WS3A 4WZXA 2QYWA 4MBQA 5LBQB 2RPAA 2JIWA 4TUYE 2L9QA 3OYZA 5AQMB 2EHOD 2WP9A 5AFKA 3N2KE 2C9TA 2WNJA 5M4YA 3ZMSB 4LFAT 2VKJA 2XASB 5L47A 5LMUT 2XAFB 5AQOB 1FIOA 2XZ6A 4H9OC 2CA5A 4UY2A 4ISSA 1MIVA 3TLUA 3RIAA 2X0LB 2NW8A 4ZI3C 5FKYA 2AXDS 2A2FX 1KEYA 1N36T 2WNLA 3T8OA 4CZZB 5AFLA 3IEEA 4ALXA 1GQEA 4N78D 1OEDC 4CXWA 5AFHA 2Y58A 3UUMA 2IMLA 2WAUA 4YFSA 5LGNB 3RIUA 3ZLIA 4KUMB 2YDQA 2WWUA 4ZS3A 3A7MA 3IGQA 4KHPT 4E7SA 3IHRA 2D0UA 3KVBA 3BQLA 2LE8A 1D0YA 2XJ7A 5FXXA 4JI3T 3W15B 3U8JA 2M6IA 4PK5A 2BDEA 2M67A 3UQ7A 5LHGB 4ANJA 4G63A 3N5LA 2IW5B 3L3PA 2CWOA 3CX7B 4ZS2A 4PK4A 2UXCT 1UK5A 2BS2A 5JDGA
chains in the Genus database with same CATH topology
4ZJTA 1UW6A 4NPPA 2ZJUA 5AFKA 4A97A 2YMDA 5BP0A 5BW2A 5FJVA 4QAAA 2C9TA 4HFDA 3RI5A 4FRRA 5AFMA 4Z91A 2WNJA 3ZDHA 5LG3A 4WV9A 4Z90A 4TNWA 4D01A 5LXBA 5HEHA 2LKGA 4ZJSA 3PMZA 3UU8A 4BQTA 5CFBA 2LKHA 3JAEA 3UQ4A 2BYSA 2WZYA 3WIPA 2BYQA 3PEOA 5L47A 4UM3A 2BG9E 1OEDB 2X00D 4ZK4A 3RHWA 3SIOA 3T4MA 5AINA 4COFA 4ZZBA 5HEGA 3WTIA 3UU6A 2XYSA 2XNVA 3RQWA 2WNCA 2W8GA 2XNTA 2XZ6A 2LLYA 2M6BA 4AFHA 5L4HA 2MAWA 2YOEA 5HEUA 2BYNA 5J5HA 3TLTA 4XK9A 3C84A 4UY2A 5L4EA 5HEOA 3U8MA 4UM3P 4F8HA 3U8KA 2Y7YA 3TLUA 4ILBA 3RIAA 3WTOA 1UX2A 2YMEA 2VL0A 3UU4A 1OEDA 2XNUA 2BG9B 4PIRA 1OEDE 4TWHA 4HFIA 2Y57A 4QABA 4UXUA 3WTMA 4IL4A 2XQ3A 4QH1A 5AFMB 2WNLA 2XQ5A 5AFJA 2PH9A 3TLWA 2XQ8A 4TWFA 5SYOA 2BR7A 3P50A 2BYRA 4TWDA 3RQUA 4LMJA 5AFLA 1UV6A 2BR8A 5KE4A 5HCMA 2XQ6A 2BJ0A 4ALXA 3WTHA 1OEDC 5IUXA 5AFHA 5AFNA 5J5GA 4UM1A 4NZBA 3WTJA 2Y58A 2WN9A 3WTLA 3WTKA 2LM2A 4ILAA 4ZRUA 4B5DA 4XHEA 3TLSA 4BFQA 2YKSA 4QH5A 4QACA 2KSRA 3JAFA 5HEJA 5CO5A 2XQ9A 2XQAA 4IL9A 4ILCA 4X5TA 5KZUA 3LSVA 4TNVA 3P4WA 3SQ6A 4AFTA 3UU3A 3JADA 2BG9C 4HFCA 4HFHA 2ZJVA 3IGQA 3SQ9A 1I9BA 3GUAA 3C79A 3EAMA 3RIFA 3ZKRA 5TVCA 2XQ7A 3U8NA 3UU5A 2Y56A 2XZ5A 2UZ6A 3U8JA 2M6IA 4HFEA 4ZK1A 4EZ1A 2XYTA 4ZR6A 3U8LA 4AFGA 3UQ7A 4IREA 2W8FA 2YN6A 3ZDGA 4QH4A 5HCJA 2X00A 5BRXA 3SH1A 2PGZA 2BG9A 4UM3S 4LMKA 4DBMA 4ZZCA 4HQPA 3WTNA 2Y54A 2BYPA 4A98A 2QC1B 5J0ZA 4HFBA 2XQ4A 5J5FA 3EHZA 3TLVA 3EI0A 3UUBA 5J5IA 5JMEA 4LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZJT A;  1UW6 A;  4NPP A;  2ZJU A;  5AFK A;  4A97 A;  2YMD A;  5BP0 A;  5BW2 A;  5FJV A;  4QAA A;  2C9T A;  4HFD A;  3RI5 A;  4FRR A;  5AFM A;  4Z91 A;  2WNJ A;  3ZDH A;  5LG3 A;  4WV9 A;  4Z90 A;  4TNW A;  4D01 A;  5LXB A;  5HEH A;  2LKG A;  4ZJS A;  3PMZ A;  3UU8 A;  4BQT A;  5CFB A;  2LKH A;  3JAE A;  3UQ4 A;  2BYS A;  2WZY A;  3WIP A;  2BYQ A;  3PEO A;  5L47 A;  4UM3 A;  2BG9 E;  1OED B;  2X00 D;  4ZK4 A;  3RHW A;  3SIO A;  3T4M A;  5AIN A;  4COF A;  4ZZB A;  5HEG A;  3WTI A;  3UU6 A;  2XYS A;  2XNV A;  3RQW A;  2WNC A;  2W8G A;  2XNT A;  2XZ6 A;  2LLY A;  2M6B A;  4AFH A;  5L4H A;  2MAW A;  2YOE A;  5HEU A;  2BYN A;  5J5H A;  3TLT A;  4XK9 A;  3C84 A;  4UY2 A;  5L4E A;  5HEO A;  3U8M A;  4UM3 P;  4F8H A;  3U8K A;  2Y7Y A;  3TLU A;  4ILB A;  3RIA A;  3WTO A;  1UX2 A;  2YME A;  2VL0 A;  3UU4 A;  1OED A;  2XNU A;  2BG9 B;  4PIR A;  1OED E;  4TWH A;  4HFI A;  2Y57 A;  4QAB A;  4UXU A;  3WTM A;  4IL4 A;  2XQ3 A;  4QH1 A;  5AFM B;  2WNL A;  2XQ5 A;  5AFJ A;  2PH9 A;  3TLW A;  2XQ8 A;  4TWF A;  5SYO A;  2BR7 A;  3P50 A;  2BYR A;  4TWD A;  3RQU A;  4LMJ A;  5AFL A;  1UV6 A;  2BR8 A;  5KE4 A;  5HCM A;  2XQ6 A;  2BJ0 A;  4ALX A;  3WTH A;  1OED C;  5IUX A;  5AFH A;  5AFN A;  5J5G A;  4UM1 A;  4NZB A;  3WTJ A;  2Y58 A;  2WN9 A;  3WTL A;  3WTK A;  2LM2 A;  4ILA A;  4ZRU A;  4B5D A;  4XHE A;  3TLS A;  4BFQ A;  2YKS A;  4QH5 A;  4QAC A;  2KSR A;  3JAF A;  5HEJ A;  5CO5 A;  2XQ9 A;  2XQA A;  4IL9 A;  4ILC A;  4X5T A;  5KZU A;  3LSV A;  4TNV A;  3P4W A;  3SQ6 A;  4AFT A;  3UU3 A;  3JAD A;  2BG9 C;  4HFC A;  4HFH A;  2ZJV A;  3IGQ A;  3SQ9 A;  1I9B A;  3GUA A;  3C79 A;  3EAM A;  3RIF A;  3ZKR A;  5TVC A;  2XQ7 A;  3U8N A;  3UU5 A;  2Y56 A;  2XZ5 A;  2UZ6 A;  3U8J A;  2M6I A;  4HFE A;  4ZK1 A;  4EZ1 A;  2XYT A;  4ZR6 A;  3U8L A;  4AFG A;  3UQ7 A;  4IRE A;  2W8F A;  2YN6 A;  3ZDG A;  4QH4 A;  5HCJ A;  2X00 A;  5BRX A;  3SH1 A;  2PGZ A;  2BG9 A;  4UM3 S;  4LMK A;  4DBM A;  4ZZC A;  4HQP A;  3WTN A;  2Y54 A;  2BYP A;  4A98 A;  2QC1 B;  5J0Z A;  4HFB A;  2XQ4 A;  5J5F A;  3EHZ A;  3TLV A;  3EI0 A;  3UUB A;  5J5I A;  5JME A;  4LML A; 
#chains in the Genus database with same CATH topology
 2CXL A;  3AEB A;  2UXD T;  1UCU A;  4OYJ A;  2K9A A;  5LJN A;  2QVA A;  5C8Y E;  2VK9 A;  3UU8 A;  2K5B B;  2KIN B;  1QUU A;  2WU2 A;  3ZYM A;  3RQW A;  2M6B A;  3P4S A;  1LVK A;  3QK6 A;  3PU3 A;  3QB5 K;  2VL0 A;  5DJQ C;  2XNU A;  1OED E;  2IDO B;  3N9L A;  2XQ3 A;  4O4L E;  3NKZ A;  4C91 A;  2D2S A;  1W9R A;  1Y64 B;  1FMV A;  3C51 A;  2BJ0 A;  4TX5 A;  1WYC A;  1KFY A;  2XY8 B;  3EDU A;  4UM1 A;  1HTJ F;  3WTL A;  2KWI B;  2E9X C;  3O9X A;  1LVF A;  2X0Y A;  3AA7 B;  4IE5 A;  1DU2 A;  2XQA A;  2H88 A;  4BA9 A;  2WZI A;  3ETV A;  5KZU A;  3LSV A;  1XDP A;  3WAK A;  5LNK A;  3C64 A;  2ZJV A;  4KP3 C;  3G06 A;  3AA1 B;  3KV4 A;  3AA0 B;  3KV5 A;  4HFE A;  5JR9 B;  4U72 A;  1MMG A;  4H9R C;  3Q5D A;  3ZN1 B;  1CHU A;  4HFB A;  3LK4 2;  3TLV A;  3UUB A;  1BR4 A;  4LML A;  1ZV4 X;  2ZJU A;  4A97 A;  5BP0 A;  5BW2 A;  3BK9 A;  4QXH B;  3ZCJ A;  4Z91 A;  3RRW A;  2LSY A;  4I4T E;  2W00 A;  3ZJ1 A;  3F57 A;  4AIU A;  3JAE A;  3WIP A;  2LOP A;  4DMV A;  3L09 A;  3QOF A;  3KV9 A;  2LLY A;  4AFH A;  2RP4 A;  4XK9 A;  3KV6 A;  5HEO A;  5LHI B;  3UU4 A;  1KNP A;  1OED A;  4PIR A;  3FZL B;  4QXC B;  3ZT7 A;  3RC8 A;  2HPJ A;  4HWH A;  4O2A E;  2X9W A;  1ZHC A;  3P50 A;  4EEB A;  3N9Q A;  2K48 A;  3NRX A;  4YXD A;  2A3D A;  4HWC A;  4DR3 T;  2XPK A;  2A72 A;  4TN7 B;  2F4V T;  2L8K A;  3K3N A;  4U33 A;  4ADZ A;  2WN9 A;  4YT0 A;  1YKH B;  3IF8 B;  4ILC A;  2CXD A;  3NRY A;  3BQI A;  5L3F B;  4V1A v;  4DR4 T;  3Q5X A;  5FY0 A;  4UVA B;  1UUS A;  3NBX X;  5GON E;  2BS3 A;  3ANW A;  3M65 A;  2V7L A;  5JVD E;  4O2B E;  2P9B A;  5BRX A;  2XAJ B;  3QUJ A;  4ZZC A;  5J0Z A;  4DV5 T;  2XQ4 A;  4ILU A;  5JDN A;  3EHZ A;  3QB5 A;  5AQG B;  2DI4 A;  5JDM A;  3SS1 A;  2I6H A;  4CI3 B;  5AFM A;  1J1J A;  2VVS A;  5JDQ A;  4K0U A;  2OV9 A;  2D5U A;  2BVL A;  2KT9 A;  1VRB A;  3PEO A;  5JDH A;  4HWF A;  3RHW A;  1WYB A;  4I0U A;  5DQV A;  4JI5 T;  2X68 A;  3RIU C;  4CN1 A;  5AQU B;  3IA3 A;  2OLT A;  5CGM A;  1JNR A;  4EZ4 A;  2CMR A;  3WTO A;  5JRC B;  4JLE A;  2Y57 A;  4CI2 B;  3K3O A;  2XHE B;  3KBU A;  4TWD A;  2DCF A;  2PG8 A;  2NP9 A;  2LHR A;  3J7Y q;  3A8Y C;  5HCM A;  2EHO A;  4I50 E;  5IUX A;  3IBP A;  3ZMU B;  4BAY B;  1YQ4 A;  4ASK A;  3WTJ A;  3BQK A;  3CVR A;  3F2E A;  3UUN A;  4QH5 A;  2WMO A;  5AQL B;  3PJA J;  4CN6 A;  3PUQ A;  4AQF C;  1V9D A;  3NVO A;  4DUZ T;  4KX6 A;  3C79 A;  1US7 B;  2XQ7 A;  3A5X A;  3CPZ A;  1S94 A;  4KBM B;  3LK2 B;  1HX1 B;  2LHN A;  3ONJ A;  2W63 A;  3VRA A;  3AEG A;  4TZ4 C;  2MBG A;  5HXH A;  5J5F A;  4LFC T;  4ZXL A;  5KXJ A;  3C4W A;  1UW6 A;  3AVR A;  3K1S A;  3FHN A;  3AEE A;  3CK6 A;  2ZMA A;  4Z90 A;  3H3M A;  3GN5 B;  5H6R B;  5LXB A;  3CQG B;  5ADX L;  5FNV E;  4Q25 A;  2XSB A;  2UXN B;  4HKA A;  5EK2 A;  2BG9 E;  4JI1 T;  3C4X A;  3PUA A;  5JRE A;  1D1B A;  1MIW A;  5C2T A;  3AEF A;  2W8G A;  2YOE A;  5C3J A;  4XZC A;  3U8M A;  3NWI A;  3R84 B;  2K3W A;  4YY3 T;  4X65 T;  1MMN A;  2WY2 A;  4DBQ A;  2IAK A;  4UXU A;  3WTM A;  5JQG E;  4IL4 A;  2WDV A;  3CX8 B;  1EZ3 A;  2H3R A;  4DR1 T;  2BZB A;  4B3R T;  5LYJ E;  1UV6 A;  1ZEE A;  1G8X A;  4X20 E;  3ZPO A;  5AQF B;  3PUR A;  1M7K A;  3S4U A;  4NZB A;  2CLY B;  5LBM A;  5AQJ B;  4AKG A;  4YTN A;  5CJ5 A;  2DWK A;  2NTY A;  4JI6 T;  2WBL A;  4PJJ A;  4WYV A;  2NW7 A;  4I43 B;  4MLK A;  2B76 A;  4JI4 T;  2Q9Q B;  2Y56 A;  4DV6 T;  1I94 T;  2Q9Q D;  1XMQ T;  3CKD A;  5JDF A;  2V7K A;  4L0R A;  2X00 A;  1KNR A;  4IDZ A;  2BBJ A;  4DV4 T;  5LHH B;  3P7I A;  5AQR B;  5FL0 A;  3ANW B;  2JRK A;  4ZJT A;  2VVN A;  2JQK A;  2W62 A;  1SA0 E;  4TNW A;  1N32 T;  2IUB A;  3PUG A;  2Q9Q C;  3PUY F;  1SUM B;  4X62 T;  2GK9 A;  5HAX A;  2WZH A;  3RYF E;  5HEU A;  2ZM2 A;  3H3A A;  4GKK T;  1J5W A;  2UUB T;  2J62 A;  2BG9 B;  3HR0 A;  3I9W A;  4PJM A;  3MKD A;  2QA7 A;  2V5C A;  3TLW A;  4TWF A;  1FMW A;  4HFV A;  4O4H E;  2Q9Q A;  3AXJ A;  5CA0 E;  2XM2 A;  1UX5 A;  1BR0 A;  2CWY A;  5LGU B;  4B5D A;  4BFQ A;  3JAF A;  1J5E T;  3JC6 D;  4X5T A;  1CUN A;  2ODV A;  4WW0 A;  5AQS B;  3ZCI A;  4WBO A;  3GUA A;  4U74 A;  4KMC A;  3AE4 A;  3X1D A;  2J47 A;  5JR9 C;  2ES0 A;  4ZR6 A;  4WBN E;  3ZDG A;  2J4G A;  3HA4 A;  3HKC E;  1D0X A;  4DBM A;  3HL6 A;  5ABF A;  2LEH A;  5A1L A;  2E9X D;  3AAE B;  4DVD A;  2BYS A;  2DHR A;  4J2C A;  5AIN A;  1HX8 A;  3PUZ F;  2CXF A;  5IHY A;  4YLH A;  2H7O A;  2HN2 A;  2JQ9 A;  2ZM0 A;  2LSK A;  1KF6 A;  1U4Q A;  3NZQ A;  3B57 A;  5LB7 B;  3K3Q C;  1MMD A;  1YXR A;  2QRX A;  3AVS A;  4QWN B;  2V6Y A;  1YQ3 A;  4EOZ B;  4UIG A;  2E2A A;  1G73 A;  3MXZ A;  3I1A A;  3RKO A;  1LKX A;  1Y01 A;  4BJN A;  4DV7 T;  4JI2 T;  4FJO A;  2KLQ A;  4LF9 T;  3B13 A;  3ZEF B;  4UF0 B;  4QAC A;  2KSR A;  2BS4 A;  4DND A;  3RX6 A;  1YD8 G;  1HS7 A;  1B7T A;  2IHR 1;  3AE9 A;  3AE8 A;  4DR6 T;  5IWA T;  2XYT A;  1UGO A;  4H63 V;  5LP6 E;  4GOU A;  2PJQ A;  1N33 T;  2Z6E A;  4LF6 T;  2MTQ A;  4HQP A;  1JNZ A;  2CCQ A;  2BYP A;  1E1H B;  5KX5 E;  4GKJ T;  5FJV A;  4HGA A;  1E2A A;  4B3M T;  3UUX B;  4EXT A;  3RGL A;  3D0T A;  4KHZ F;  2VUR A;  4LF4 T;  2LOS A;  4ZK4 A;  2KXP B;  4COF A;  4AQY T;  3J9X 1;  5JH7 E;  1AJ3 A;  2XNV A;  2XNT A;  4UM3 P;  4F8H A;  2WB5 A;  3N9N A;  5AQV B;  3ZT5 A;  1XMO T;  2XQY A;  5AFJ A;  1O3X A;  2E9X B;  4K0K T;  3ONL C;  4AKI A;  5KE4 A;  2BR8 A;  3AE6 A;  2WCA A;  2WDR A;  2H7V C;  3ETU A;  2SPC A;  3AAA B;  2VKH A;  5FXW A;  5HXC A;  2LJL A;  4XHE A;  4X1I E;  1MIY A;  5AQP B;  4DUY T;  4EGW A;  1ZKE A;  4DR2 T;  3FZF B;  4PJN A;  2CM0 A;  3EAM A;  3E22 E;  3EUH A;  1H7C A;  4I55 E;  4P09 A;  2W61 A;  4YJ3 E;  2X67 A;  2NOX A;  2YN6 A;  2YDS A;  4H63 H;  2VB6 A;  4DV1 T;  1WR0 A;  4HWD A;  3GWH A;  1WLX A;  3PE0 A;  2JPF A;  2FJB A;  3TKL B;  5AQT B;  2XAH B;  4A56 A;  3UFG A;  3C98 B;  3QNU A;  3HKE E;  2FUP A;  4GYR A;  3UFE A;  2V6Y B;  3E08 A;  4D01 A;  3LBX A;  4ZJS A;  5AQK B;  2LKH A;  3OKQ A;  4OHF A;  4TV9 E;  3N9M A;  3ZJ2 A;  3AE1 A;  2XYS A;  2BKP A;  2BYN A;  3C4Z A;  5CB4 E;  4LF8 T;  3C84 A;  4PFO A;  5L3E B;  2Y7Y A;  4IHJ E;  4LF5 T;  2J1D G;  3R6N A;  4GK0 E;  4WNK A;  4EAH A;  3V5U A;  5JRC A;  3AXJ B;  5LXT E;  2NR4 A;  1HCI A;  5FMN A;  3ZT6 A;  3JC6 C;  1YW0 A;  3MZK B;  2MPK A;  3LJC A;  5KMG P;  2UXX B;  2YU1 A;  1NEN A;  2B1E A;  2PTF A;  2E8I A;  4YSY A;  5FVL A;  2UUC T;  4IT4 A;  3NZP A;  3WTK A;  3FBL A;  1ZP0 A;  5HEJ A;  2AE9 A;  4G2A A;  2XZE A;  1T98 A;  1E7P A;  4EB6 E;  2BKN A;  4DV2 T;  3JAD A;  2XSA A;  3OBV E;  1MNE A;  2X9Y A;  4EIW A;  2VKO A;  3AE3 A;  2V7I A;  4X1K E;  2XZ5 A;  3EAB A;  2UZ6 A;  4ZK1 A;  5EZY E;  3U8L A;  2IC9 A;  4EED A;  3OTO T;  3LK3 B;  3SH1 A;  2D9D A;  4UM3 S;  3OYX A;  4L9I A;  3FZK B;  1WFD A;  5AFU L;  5J5I A;  3WAJ A;  3MA9 A;  4QAA A;  4FRR A;  4IE4 A;  3UUL A;  1X9B A;  4NXN T;  4IGU A;  3OJA A;  5CA1 E;  4YHJ A;  4IDN A;  2BKO A;  1X79 A;  3VU7 H;  2W0G A;  3SIO A;  2RA1 A;  4IE6 A;  2OA5 A;  3UU6 A;  4YHH T;  3RYH E;  4PW8 A;  2JMH A;  4C90 A;  4HWI B;  4MAL A;  3TLT A;  1I6Z A;  2CBI A;  2X9H A;  3O1H A;  4ILB A;  4FI5 A;  1UX2 A;  2W67 A;  5ETW A;  3LG7 A;  5AFM B;  2Y6X A;  1T8B A;  3AA6 B;  2EHO B;  4DV3 T;  4LMJ A;  4UF0 A;  1XDO A;  4NUV A;  2PFV A;  3FXD B;  3HI2 A;  4E7Z A;  2VQF T;  3K8P C;  4HEA A;  4LFB T;  5IYZ E;  3GA8 A;  5AQN B;  3SOL A;  5CO5 A;  1VCT A;  3RLF F;  3KFW X;  1BR2 A;  4IL9 A;  2X66 A;  4TNV A;  2ODU A;  3F31 A;  3UT5 E;  4XAX B;  5F3J A;  5FL1 A;  1I9B A;  1OXZ A;  1M62 A;  5LG4 A;  4QKN A;  5TVC A;  4B6X A;  4H9Q C;  4JI7 T;  2FJA A;  3Q2M A;  4CQI A;  3ZC0 A;  3UTK A;  1HG5 A;  5FXV A;  5LMN T;  3ZDH A;  3AE2 A;  5HYA A;  3N9O A;  4BQT A;  3ZC1 A;  3FBZ A;  3ONX A;  4JI0 T;  4UXN B;  3RH3 A;  4O4I E;  2KZ7 B;  4KI0 F;  2LSJ A;  1SE7 A;  3OVU A;  1QSD A;  5HXE A;  2MAW A;  3FZH B;  4ZI2 C;  3ZYK A;  3KVA A;  2FBW A;  3ZMV B;  3T1Y T;  1N34 T;  4OFZ A;  5KDM C;  3KBT A;  1D1C A;  3GN5 A;  1T7S A;  3VHL A;  3P8C D;  1IZN B;  2CLY C;  2A9U A;  3DTO A;  5AQH B;  2WMN A;  4DV0 T;  3VR8 A;  4ILA A;  5H6Q B;  4ZI2 D;  2XUE A;  3U3I A;  2YKS A;  1XZY A;  4L5G A;  5EK3 A;  2XQ9 A;  4HE8 A;  4CXY A;  2IC6 A;  3CIR A;  3KIN B;  5HWY A;  4F6R C;  3ABV A;  3SQ9 A;  3B5M A;  3RRC A;  4BJM A;  3HKB E;  1MND A;  3CX6 B;  4TV8 E;  4JEU B;  4UV9 B;  3RYC E;  1IJ5 A;  5L2L A;  1IBK T;  3FB2 A;  4YSZ A;  5LGT B;  3FZM B;  5J1G A;  3WTN A;  4GK5 E;  4UV8 B;  1W0A A;  4AKR B;  4MHC A;  2YMD A;  3LBX B;  3MJX A;  1QLB A;  1ZOY A;  4EYU A;  5HEH A;  2LKG A;  2V7M A;  4X64 T;  4CN4 A;  3ESL A;  1HNX T;  2VAS A;  5DAB A;  3EVY A;  2HH7 A;  1T72 A;  2V26 A;  2YU2 A;  3M3Z B;  4DR7 T;  5FVK A;  2CBJ A;  4NUU A;  2CHN A;  3V5S A;  2CRB A;  4TWH A;  4QAB A;  2X51 A;  2XQ5 A;  2CHO A;  3Q9D A;  4AKL A;  2BR7 A;  4IIJ E;  5ABG A;  2PBI A;  5AQI B;  4JV5 T;  3AED A;  2I0M A;  2VL8 A;  3RYI E;  5AFN A;  4AXP A;  2C5K T;  4P0A A;  4AIS A;  5FY7 A;  2LM2 A;  2C5I T;  1W0B A;  4EYY R;  3L8R A;  3AEC A;  2C0S A;  3SWH A;  5F8P A;  2JMK A;  2X9X A;  3VKG A;  2LRK A;  3P4W A;  4AFT A;  3UU3 A;  4HFH A;  5TAO A;  4M1P A;  5L3D B;  5ABE A;  3RIF A;  4IDP A;  3DP7 A;  3UU5 A;  2N1G A;  4GIW A;  2LM9 A;  3SFE A;  3LDQ B;  4Z8X A;  1Z8U A;  4JUY A;  2W8F A;  4QH4 A;  4U31 A;  3ZYL A;  2PGZ A;  2BG9 A;  3RPU A;  2NWB A;  2NW9 A;  4PNI A;  1KK7 A;  3EI0 A;  1UUR A;  4NPP A;  4O4J E;  4UEM A;  1IAP A;  3PUX F;  4AQF A;  2MYS A;  2CEA A;  1VOM A;  5LG3 A;  3CQC B;  4PK6 A;  2E5L T;  4JBW F;  2WZY A;  2BVM A;  1HNW T;  2X00 D;  4P1N A;  1FJG T;  4YSX A;  3GMI A;  2WWV A;  4U7Y A;  4IE7 A;  2JQH A;  1IBL T;  4OX9 T;  2E9X A;  3ZSS A;  3N9P A;  2YME A;  3O1J A;  5BR8 T;  4AQG A;  2CE7 A;  3PTR B;  4U7I A;  1WCR A;  4HFI A;  4QH1 A;  2VWA A;  2DLR A;  3PDY A;  5FY1 A;  1L0V A;  5SYO A;  5FYM A;  3RQU A;  3JCF A;  3QC9 A;  4MFR A;  2K24 A;  3PUV F;  1VCS A;  1HF8 A;  5ABH A;  1BR1 A;  2V7J A;  3ZST A;  4AI6 A;  5J5G A;  4GYS A;  4IDO A;  5JR9 A;  3PUW F;  2JQQ A;  4CI1 B;  1NWM X;  4P0B A;  4DID B;  1R8I A;  4YTP A;  2XTL A;  2LSI A;  4ZOL E;  5L3C B;  2I59 A;  3AB3 B;  3U8N A;  2FJE A;  5FP3 A;  3H37 A;  5AQQ B;  4X66 T;  2G0U A;  3U78 A;  4OK0 A;  5LCY A;  1IBM T;  5BMV E;  4ZHQ E;  1MMA A;  4JI8 T;  4B3S T;  2CPT A;  3WI3 A;  4LF7 T;  3PV0 F;  2DL1 A;  4YTM A;  4NIQ A;  4HFD A;  4UVC B;  2V1D B;  4WV9 A;  1LRZ A;  3ZMZ B;  1YKE B;  3UQ4 A;  1OED B;  3AEA A;  4DO0 A;  4U3C A;  1NAF A;  3T4M A;  2LRL A;  5HEG A;  4QX8 B;  4AKH A;  5EK4 A;  5L4E A;  3N2G E;  1XNQ T;  4H9S E;  2V5D A;  2KND A;  3PJA A;  5FXZ A;  2XQ8 A;  3FXE B;  3OPC A;  4IE0 A;  2XQ6 A;  4JYA T;  4PFP A;  4PAG A;  4QHO A;  2FJD A;  3RKG A;  4EV6 A;  2V8S V;  3VRB A;  3C50 A;  2WM9 A;  2R6G F;  3Q5E A;  2QGS A;  4CXX A;  5HXR A;  3SQ6 A;  2BG9 C;  2Y48 B;  4ZEY A;  2NTX A;  4ERR A;  4ZI3 D;  1HNZ T;  3E0Z A;  3I9Y A;  2BBH A;  3P4R A;  4A5X A;  2C5J A;  3EDV A;  2LSG A;  3HKD E;  4HTE A;  2N9D A;  5JDL A;  5HCJ A;  3O1I A;  1KNZ A;  3I0Q A;  1Z0P A;  3ZN0 B;  4QXB B;  1XNR T;  2QC1 B;  4A98 A;  5L3G B;  5JME A;  2KMF A;  4IST A;  2N2N A;  2WU5 A;  5HWX A;  3AAI A;  3RI5 A;  2WQY A;  4U2Y A;  4IDQ A;  2YK0 A;  5LOV E;  3N2O A;  1OWA A;  2ACX A;  4ZZB A;  3DJB A;  2Y8D A;  2IIU A;  5L4H A;  1D1A A;  2ZM6 T;  2W2U A;  1UX4 A;  3LFM A;  3T1H T;  2ZLY A;  3P4P A;  2XAG B;  2VQE T;  2PH9 A;  4O8S A;  4B3T T;  3RC3 A;  5LA6 E;  1WRD A;  1NEK A;  3SFD A;  4DMW A;  1SHZ C;  2W4X A;  2HN1 A;  2ZM8 A;  5JTG A;  3TLS A;  2HHH T;  1HFA A;  3PU8 A;  3Q5W A;  2JJ9 A;  5L3B B;  3MK7 C;  1S35 A;  4HFC A;  4QX7 B;  1U5P A;  2UU9 T;  5LJM A;  4PJL A;  3MAC A;  3VR9 A;  4H9P C;  2DNX A;  5E0O A;  4HN9 A;  4XBF B;  4LMK A;  2Y54 A;  3SRZ A;  4H9N C;  2XAQ B;  1WR6 A;  2LT3 A;  2WSS V;  1HR0 T;  1IJ6 A;  3P4Q A;  2YDR A;  3CQX C;  4DR5 T;  3PMZ A;  4UR9 A;  5CFB A;  2BYQ A;  4UM3 A;  2WDQ A;  4UEL A;  3I0O A;  5F5W A;  3WTI A;  2WNC A;  2YIN A;  2L3L A;  5J5H A;  3U8K A;  2ACZ A;  2UUA T;  4YJ2 E;  1FEW A;  4ZI7 E;  2EHO C;  2DWG A;  3ZMT B;  2BYR A;  2V6X A;  4U2Z A;  5J2T E;  3KDS E;  1W09 A;  3CML A;  3L39 A;  2H89 A;  1XWM A;  5J2U E;  2E5V A;  5HXS A;  3O4X E;  3WTH A;  2X0H A;  2YEV C;  4EZH A;  2HPL A;  2W66 A;  2MOZ A;  4ZRU A;  1HG2 A;  4X1Y E;  2UXB T;  5DQW A;  2XM1 A;  2D0T A;  5ABF B;  3CWZ B;  3PUS A;  1D0Z A;  2VKD A;  4OYK A;  3ZKR A;  3AE7 A;  4DBR A;  4NXM T;  2KWH A;  4UVB B;  4EZ1 A;  3VKH A;  3RF1 A;  3AE5 A;  4AFG A;  4JEH B;  4IRE A;  2WS3 A;  4WZX A;  2QYW A;  4MBQ A;  5LBQ B;  2RPA A;  2JIW A;  4TUY E;  2L9Q A;  3OYZ A;  5AQM B;  2EHO D;  2WP9 A;  5AFK A;  3N2K E;  2C9T A;  2WNJ A;  5M4Y A;  3ZMS B;  4LFA T;  2VKJ A;  2XAS B;  5L47 A;  5LMU T;  2XAF B;  5AQO B;  1FIO A;  2XZ6 A;  4H9O C;  2CA5 A;  4UY2 A;  4ISS A;  1MIV A;  3TLU A;  3RIA A;  2X0L B;  2NW8 A;  4ZI3 C;  5FKY A;  2AXD S;  2A2F X;  1KEY A;  1N36 T;  2WNL A;  3T8O A;  4CZZ B;  5AFL A;  3IEE A;  4ALX A;  1GQE A;  4N78 D;  1OED C;  4CXW A;  5AFH A;  2Y58 A;  3UUM A;  2IML A;  2WAU A;  4YFS A;  5LGN B;  3RIU A;  3ZLI A;  4KUM B;  2YDQ A;  2WWU A;  4ZS3 A;  3A7M A;  3IGQ A;  4KHP T;  4E7S A;  3IHR A;  2D0U A;  3KVB A;  3BQL A;  2LE8 A;  1D0Y A;  2XJ7 A;  5FXX A;  4JI3 T;  3W15 B;  3U8J A;  2M6I A;  4PK5 A;  2BDE A;  2M67 A;  3UQ7 A;  5LHG B;  4ANJ A;  4G63 A;  3N5L A;  2IW5 B;  3L3P A;  2CWO A;  3CX7 B;  4ZS2 A;  4PK4 A;  2UXC T;  1UK5 A;  2BS2 A;  5JDG A; 
#chains in the Genus database with same CATH homology
 4ZJT A;  1UW6 A;  4NPP A;  2ZJU A;  5AFK A;  4A97 A;  2YMD A;  5BP0 A;  5BW2 A;  5FJV A;  4QAA A;  2C9T A;  4HFD A;  3RI5 A;  4FRR A;  5AFM A;  4Z91 A;  2WNJ A;  3ZDH A;  5LG3 A;  4WV9 A;  4Z90 A;  4TNW A;  4D01 A;  5LXB A;  5HEH A;  2LKG A;  4ZJS A;  3PMZ A;  3UU8 A;  4BQT A;  5CFB A;  2LKH A;  3JAE A;  3UQ4 A;  2BYS A;  2WZY A;  3WIP A;  2BYQ A;  3PEO A;  5L47 A;  4UM3 A;  2BG9 E;  1OED B;  2X00 D;  4ZK4 A;  3RHW A;  3SIO A;  3T4M A;  5AIN A;  4COF A;  4ZZB A;  5HEG A;  3WTI A;  3UU6 A;  2XYS A;  2XNV A;  3RQW A;  2WNC A;  2W8G A;  2XNT A;  2XZ6 A;  2LLY A;  2M6B A;  4AFH A;  5L4H A;  2MAW A;  2YOE A;  5HEU A;  2BYN A;  5J5H A;  3TLT A;  4XK9 A;  3C84 A;  4UY2 A;  5L4E A;  5HEO A;  3U8M A;  4UM3 P;  4F8H A;  3U8K A;  2Y7Y A;  3TLU A;  4ILB A;  3RIA A;  3WTO A;  1UX2 A;  2YME A;  2VL0 A;  3UU4 A;  1OED A;  2XNU A;  2BG9 B;  4PIR A;  1OED E;  4TWH A;  4HFI A;  2Y57 A;  4QAB A;  4UXU A;  3WTM A;  4IL4 A;  2XQ3 A;  4QH1 A;  5AFM B;  2WNL A;  2XQ5 A;  5AFJ A;  2PH9 A;  3TLW A;  2XQ8 A;  4TWF A;  5SYO A;  2BR7 A;  3P50 A;  2BYR A;  4TWD A;  3RQU A;  4LMJ A;  5AFL A;  1UV6 A;  2BR8 A;  5KE4 A;  5HCM A;  2XQ6 A;  2BJ0 A;  4ALX A;  3WTH A;  1OED C;  5IUX A;  5AFH A;  5AFN A;  5J5G A;  4UM1 A;  4NZB A;  3WTJ A;  2Y58 A;  2WN9 A;  3WTL A;  3WTK A;  2LM2 A;  4ILA A;  4ZRU A;  4B5D A;  4XHE A;  3TLS A;  4BFQ A;  2YKS A;  4QH5 A;  4QAC A;  2KSR A;  3JAF A;  5HEJ A;  5CO5 A;  2XQ9 A;  2XQA A;  4IL9 A;  4ILC A;  4X5T A;  5KZU A;  3LSV A;  4TNV A;  3P4W A;  3SQ6 A;  4AFT A;  3UU3 A;  3JAD A;  2BG9 C;  4HFC A;  4HFH A;  2ZJV A;  3IGQ A;  3SQ9 A;  1I9B A;  3GUA A;  3C79 A;  3EAM A;  3RIF A;  3ZKR A;  5TVC A;  2XQ7 A;  3U8N A;  3UU5 A;  2Y56 A;  2XZ5 A;  2UZ6 A;  3U8J A;  2M6I A;  4HFE A;  4ZK1 A;  4EZ1 A;  2XYT A;  4ZR6 A;  3U8L A;  4AFG A;  3UQ7 A;  4IRE A;  2W8F A;  2YN6 A;  3ZDG A;  4QH4 A;  5HCJ A;  2X00 A;  5BRX A;  3SH1 A;  2PGZ A;  2BG9 A;  4UM3 S;  4LMK A;  4DBM A;  4ZZC A;  4HQP A;  3WTN A;  2Y54 A;  2BYP A;  4A98 A;  2QC1 B;  5J0Z A;  4HFB A;  2XQ4 A;  5J5F A;  3EHZ A;  3TLV A;  3EI0 A;  3UUB A;  5J5I A;  5JME A;  4LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...