5HEGA

Pentameric ligand-gated ion channel glic mutant p246g
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLGKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Signal Transduction at the Domain Interface of Prokaryotic Pentameric Ligand-Gated Ion Channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hegA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hegA01
3TLSA 3RQWA 3C79A 5FJVA 4IL9A 4COFA 5CFBA 5HCJA 2LKGA 1I9BA 2XYTA 4UY2A 3SIOA 3WTLA 4UXUA 3RHWA 4A97A 5HEGA 3WIPA 5AFHA 4D01A 2X00D 2YMDA 4DBMA 3JAEA 5AFJA 4ZJTA 4QABA 2Y58A 4UM3A 4HFBA 2QC1B 2WN9A 4HQPA 4BQTA 5HEUA 2MAWA 4ILBA 5J0ZA 3SQ9A 4QH5A 2BYRA 2BYQA 3WTKA 2BR7A 5KZUA 5AFLA 4TNVA 2Y57A 4ZRUA 4UM3S 2X00A 4WV9A 5AFKA 2PGZA 2XNTA 5AFMA 3RIAA 5KE4A 5LXBA 1UW6A 3C84A 2Y7YA 5JMEA 5CO5A 3UU8A 3JAFA 4X5TA 5J5FA 3SH1A 2YMEA 4B5DA 2XZ5A 5BP0A 4FRRA 2XQ8A 3P50A 2W8GA 4XK9A 4QACA 3ZKRA 4LMLA 4AFGA 2LM2A 3T4MA 5HEHA 5AFMB 4TWFA 2BG9A 3ZDHA 2BG9E 5J5GA 5SYOA 4IL4A 5HCMA 5L4EA 4ZR6A 3UU5A 4AFTA 4IREA 2BG9C 2XZ6A 3WTMA 3ZDGA 2BJ0A 2XNVA 2W8FA 4A98A 2LKHA 2WNLA 2Y54A 3WTOA 5LG3A 2Y56A 3WTHA 4ILAA 1OEDA 3PEOA 1OEDE 2BG9B 3WTJA 4ILCA 2WNJA 2XQ9A 1OEDC 2YN6A 3TLTA 3RIFA 2XQ4A 2M6IA 4TWDA 4XHEA 4LMJA 3RQUA 3UUBA 2VL0A 5TVCA 2PH9A 2KSRA 5AINA 5BW2A 4LMKA 2ZJVA 4EZ1A 1OEDB 1UX2A 4TNWA 3EHZA 2WNCA 4NZBA 4QH1A 4TWHA 5HEOA 4ZZBA 4Z90A 3IGQA 5HEJA 2LLYA 3EI0A 3U8KA 4ZK1A 3TLVA 2YKSA 4BFQA 2C9TA 4PIRA 4NPPA 3U8NA 2XQ5A 5AFNA 3WTNA 3UQ4A 3EAMA 3UU3A 2M6BA 2XQ7A 4QAAA 2BYSA 3TLUA 4ZZCA 2XQ6A 2XQAA 2ZJUA 3TLWA 2UZ6A 1UV6A 3SQ6A 4ALXA 4AFHA 3WTIA 3U8LA 3P4WA 5L47A 4HFHA 3UQ7A 4QH4A 4HFIA 3JADA 3RI5A 5IUXA 4HFDA 2BR8A 2BYPA 2WZYA 3UU4A 3GUAA 4F8HA 4HFCA 3LSVA 5J5HA 5BRXA 5J5IA 4HFEA 4ZK4A 5L4HA 4UM3P 3PMZA 4UM1A 2XNUA 4ZJSA 3U8MA 2YOEA 2XYSA 3U8JA 4Z91A 2BYNA 3UU6A 2XQ3A
chains in the Genus database with same CATH superfamily
3RIUC 3JCFA 3EABA 3PUXF 4D01A 1E2AA 1MIWA 5HXRA 3RGLA 2N9DA 3N9PA 4IDPA 3O1IA 5FXVA 3DTOA 4WYVA 5AFLA 3AA6B 5IHYA 2VKDA 2ZMAA 4DR6T 1DU2A 4AKIA 3K3OA 1KF6A 4DUZT 3T1HT 4LMLA 2LM2A 1VOMA 5L4EA 2W66A 1UURA 4UELA 4IREA 3ETUA 3BQKA 2CBJA 1MIVA 1WCRA 4KX6A 1M7KA 4JUYA 4P09A 1NENA 3TLTA 5JRCA 2LSGA 3A7MA 4ISTA 3ZN0B 3TLVA 3C50A 4BFQA 2XQ5A 4X62T 2DWGA 3EAMA 2WB5A 4I4TE 4GK5E 2UZ6A 3L09A 4IIJE 4EAHA 2BDEA 4IT4A 5JTGA 4HFCA 4JI5T 4ZK4A 5HXEA 3AE1A 2XNUA 4PNIA 3U8MA 2BS2A 3AEGA 3SOLA 3FHNA 4YY3T 3SFEA 1IBMT 3L39A 3ZPOA 3SQ9A 4BA9A 4DV1T 1XWMA 3Q5XA 1HG2A 5JMEA 4J2CA 5CJ5A 3JAFA 4ILUA 4DBRA 2ODUA 2E8IA 3J7Yq 2LT3A 3VR8A 5SYOA 4H63H 3KBTA 2XNVA 3CVRA 4H9OC 4ILAA 5JDQA 4EZ4A 1OEDE 3F31A 5FL0A 3ANWB 4PK6A 5AQKB 4TV9E 2KSRA 2W62A 2YU1A 2XPKA 4TNWA 4ZS3A 4JI0T 2CLYC 3U8KA 2YKSA 5FY7A 2BZBA 2XY8B 3U8NA 4X20E 2IC6A 3CWZB 3PURA 4XBFB 3P4SA 4HFHA 2A72A 3RI5A 1J5ET 3AEBA 4IDQA 2MYSA 4KBMB 1Y01A 4Q25A 4CI3B 3ZCJA 3VKGA 2W4XA 2KMFA 3C4ZA 3NZPA 4DV4T 3RX6A 1KK7A 5EZYE 2UU9T 4NUUA 2QGSA 5AQJB 5FXXA 5CFBA 2WDQA 3RRWA 1HF8A 3HKBE 3GN5B 2ZM6T 4LF8T 3ETVA 5FL1A 3OYZA 4QABA 1HR0T 1MIYA 5IWAT 3S4UA 4HTEA 2Q9QC 4TNVA 2KT9A 1N33T 3CMLA 5JR9C 5LXBA 1XZYA 5AQVB 2KINB 3PU8A 4MHCA 5ADXL 5J5HA 2HPLA 4QACA 3GA8A 3ZKRA 2ZM0A 5LOVE 3KVBA 5AQRB 4H9NC 2N1GA 3WTOA 1W0BA 1XDPA 3CX8B 4GIWA 4AKHA 4DMVA 5EK2A 2WS3A 1WLXA 2V7JA 5HAXA 2XTLA 4L5GA 2C9TA 3Q9DA 3HKCE 5LCYA 3VRAA 2KLQA 1MMNA 2X0LB 3SQ6A 1T98A 2NP9A 3KFWX 2IUBA 4YTNA 4FI5A 4HFIA 3JADA 4F8HA 3BK9A 5LJMA 2CHNA 4FJOA 1LVKA 2H88A 4JEHB 1UK5A 2BBJA 3WAKA 1IZNB 2XSBA 5AQFB 2WBLA 1FEWA 3U78A 2JMHA 3SIOA 4U3CA 4LF7T 5A1LA 2IIUA 4HWCA 2X00D 3PUWF 3PUZF 4HQPA 4YSZA 2B76A 4I0UA 2BYQA 5AQNB 3OYXA 3LBXA 1SA0E 4WV9A 5FXZA 3LG7A 4JYAT 3C84A 2K48A 4B3ST 4OYKA 3J9X1 4UF0A 4I43B 2BS4A 2IW5B 4B3RT 2LOPA 2BG9A 1JNZA 2MTQA 3ZDGA 4NUVA 4V1Av 4GKJT 1US7B 3N9OA 5CA1E 4ZI7E 3AE6A 3AVRA 4AQFC 2XQ4A 2M6IA 4LMJA 4DR7T 4EZ1A 2XAGB 1D0ZA 4DV0T 3PUYF 3MACA 4AQYT 4CI2B 3IGQA 4DO0A 5JRCB 1S35A 3MXZA 5CB4E 2M6BA 2VQFT 3WI3A 4HN9A 3AECA 3TKLB 3O9XA 2D2SA 5L47A 3UUXB 2DCFA 2W00A 2E9XA 3VU7H 3L8RA 4DV7T 2JRKA 3HA4A 4TUYE 5JH7E 5AQSB 2YOEA 2BYNA 5C3JA 3K1SA 3VR9A 2ZM2A 5LBQB 3JC6D 5FJVA 5JQGE 3RLFF 5J1GA 4LF9T 1NAFA 5FP3A 4BQTA 4YJ3E 4ILBA 3Q5WA 3JC6C 2J4GA 3N9NA 3PDYA 1WR6A 3AAAB 3GN5A 5J2TE 2IHR1 2WZHA 3SWHA 5DQVA 2BVLA 1H7CA 1HCIA 2ODVA 1YQ4A 1ZOYA 4KMCA 4TWFA 4UIGA 3GMIA 4HEAA 3UFEA 3FBLA 4A56A 3WTHA 1OXZA 4UV8B 5L3CB 2JQ9A 2IDOB 4YHJA 3RQUA 4OK0A 2MBGA 5BW2A 4LF6T 2CEAA 2PG8A 3QOFA 5AQPB 3O4XE 2YDSA 2I0MA 3Q5EA 4PK4A 3EI0A 3T1YT 5AFNA 4ZS2A 4UR9A 3AXJA 2XQ6A 3TLWA 3ZMSB 4JI1T 2C5IT 4U74A 1CHUA 5H6RB 4YXDA 5L3GB 3OVUA 3OJAA 3ZEFB 4ZEYA 5LXTE 4LF4T 2UUCT 3ZLIA 1U5PA 3P4QA 4CN1A 3RC3A 4L9IA 4UVCB 4TZ4C 2X9HA 2XYTA 2GK9A 4IE6A 5TAOA 4ZI3D 5FKYA 5ABHA 5M4YA 2CMRA 4ZJTA 2BVMA 2C0SA 3MKDA 4EIWA 1L0VA 2HPJA 2BYRA 4H9QC 2H3RA 3SRZA 2XNTA 5KE4A 4ZI3C 2JQQA 2LE8A 5KMGP 5CO5A 3UU8A 3PUGA 2XQ8A 4H9PC 3P50A 5KDMC 3H3AA 5L3FB 3F57A 2VKOA 3KBUA 5HCMA 2WWVA 2ZM8A 3HR0A 4XAXB 4E7SA 5AQOB 2FJAA 3I9WA 5LHGB 1KNPA 3C51A 2XQ9A 2QA7A 4GYSA 5AINA 2A9UA 2WMOA 4QKNA 5AQLB 4BJMA 4Z90A 2WP9A 4U7YA 4NXMT 3DP7A 3ZT6A 4C91A 2V7LA 4AKRB 3F2EA 5HXSA 3ZT5A 2CWYA 4CXWA 4AFHA 2H89A 2VVSA 2X67A 3U3IA 2WU5A 3ZSTA 5JDNA 4QXCB 1KEYA 2BR8A 5IUXA 3UU4A 4DUYT 1OWAA 2VB6A 2RP4A 5J5IA 4HFEA 3ABVA 3N9QA 2CXDA 5JREA 4ZJSA 3E08A 4EYYR 3CKDA 3IA3A 3WIPA 1JNRA 5JDMA 3NWIA 2CHOA 2WM9A 2DHRA 2VL8A 2UXCT 5HEUA 4ASKA 4ZI2D 2WMNA 2E5LT 4O4IE 4ZRUA 2V5DA 5HXCA 4WBOA 4G63A 4PJLA 4PJNA 3HKDE 4NIQA 3IBPA 3FXDB 3LBXB 2UUAT 4DMWA 4B5DA 4ZI2C 1MMAA 4XK9A 2HN1A 4KHZF 3ZMVB 4TX5A 2PTFA 5JVDE 1KNRA 1X9BA 3IF8B 4UF0B 5LG3A 2BG9B 2WNJA 1KNZA 3ZT7A 4BAYB 3EHZA 2LHRA 4QHOA 5HEJA 5L3DB 5LNKA 3O1JA 4NPPA 5LJNA 3UQ4A 4QAAA 4DR2T 1UV6A 1E7PA 4GK0E 4DR1T 1D0XA 2LEHA 2ACZA 3AEFA 4AXPA 3K3NA 2ACXA 5L4HA 2UXBT 3FZHB 4Z91A 2E9XB 2IMLA 4NXNT 4AIUA 2W63A 2WU2A 3CIRA 1D0YA 3HI2A 2W0GA 2G0UA 3CQXC 5HYAA 4EEDA 1KFYA 3LDQB 2Y58A 2QC1B 3I1AA 4QH5A 3LK2B 4LFBT 5KZUA 2Y57A 1IAPA 5AFMA 2KXPB 2D0UA 2XAHB 3FBZA 1WRDA 3AAIA 4DV3T 4O4HE 4DVDA 4DR4T 3G06A 2V6YA 2PFVA 3UU5A 4HKAA 4WBNE 2V7MA 5AQGB 2X68A 3RYCE 4AI6A 2X66A 3VHLA 2Y48B 3MA9A 5F8PA 2WAUA 2JJ9A 4PAGA 4U31A 2ZJVA 1G73A 5AQIB 2OA5A 1YKHB 2K24A 4NZBA 4U2YA 3AEEA 4MLKA 4PJJA 4PFOA 5FY0A 2FBWA 3RF1A 1O3XA 1CUNA 2CBIA 2V6XA 4L0RA 4ZOLE 2ZJUA 1BR0A 3P4WA 2AXDS 5ABGA 4YHHT 3AXJB 4GOUA 3PTRB 2MPKA 2FJDA 2YU2A 1ZEEA 4H9SE 1NWMX 1S94A 1VCSA 3O1HA 2K5BB 3X1DA 4WZXA 4X64T 2VURA 3ZMTB 2DL1A 5LB7B 3RYFE 3I0OA 5E0OA 2YMDA 3ZYKA 3AEDA 3P8CD 3AE9A 4H63V 3FZMB 1Z0PA 5AQTB 3AE3A 1YKEB 2IAKA 1IJ5A 5LMUT 1ZV4X 2WWUA 2WCAA 5C2TA 4DV6T 3H3MA 4X5TA 5EK3A 5L3EB 5CA0E 3T4MA 5HEHA 4AFTA 4CXXA 2XZ6A 2W8FA 2LJLA 1YD8G 1BR1A 5F3JA 1OEDA 3WTJA 3R6NA 4DV5T 5CGMA 3AE2A 4TWDA 2A2FX 3M65A 4LMKA 2JQKA 4YT0A 2Z6EA 3PJAA 5C8YE 4ZK1A 5L2LA 1FIOA 3UU3A 4X65T 3KV5A 1N36T 2BYSA 2PBIA 2XQYA 3TLUA 2H7OA 3Q5DA 2NW7A 2X51A 2BKOA 4KHPT 4QH4A 3GUAA 3OKQA 3LSVA 3QC9A 1WFDA 2EHOA 3PE0A 1U4QA 4COFA 2LKGA 5AFHA 4A97A 1WR0A 4UXNB 1QUUA 3PUAA 4HWFA 4M1PA 3KV9A 3PV0F 1YXRA 2MAWA 4UM3S 4U33A 5EK4A 5ETWA 2C5JA 3RIAA 2XHEB 4CI1B 4TN7B 2DLRA 4AFGA 1UX5A 5J5GA 3V5UA 1Z8UA 1SUMB 2BJ0A 2YDQA 3Q2MA 3UUMA 2P9BA 3KV6A 5LYJE 3AE5A 4K0KT 1IJ6A 2CM0A 2V7IA 2V8SV 5BMVE 1T72A 2CRBA 1UX2A 2WNCA 4IDNA 4I55E 1W9RA 2WZIA 3PUQA 3MK7C 2SPCA 1LVFA 3AE7A 4N78D 3RH3A 3C64A 3PU3A 3WTIA 2DWKA 4U7IA 1GQEA 1T7SA 2X9YA 3ZC0A 1ZP0A 4HWIB 3AA7B 4O2AE 4HWHA 5HWYA 3C79A 3N2OA 4LFAT 2VK9A 4AISA 3VKHA 5HEGA 1D1AA 2XJ7A 2XM2A 2NTYA 4ADZA 1I94T 4ERRA 3WTKA 1Y64B 2BR7A 1W09A 1UGOA 3HL6A 2LRKA 4PK5A 1B7TA 4EOZB 4JI6T 2L3LA 3NRYA 3C4WA 2XZEA 4IDZA 3SH1A 2XM1A 1IBKT 3C98B 1MNEA 4DNDA 5ABFA 5AFMB 4IL4A 3KVAA 4X1IE 1UUSA 2BG9C 2DNXA 3N9LA 2Y54A 3AA0B 2V6YB 3UFGA 2X0YA 2B1EA 3LK42 2EHOD 4AKLA 2VL0A 3UULA 2W67A 4MBQA 4P0BA 2VWAA 2KNDA 4LFCT 2VASA 3CX7B 5H6QB 2E9XD 3ZYMA 2XASB 1I6ZA 1M62A 3EDUA 3N9MA 4HWDA 3U8LA 3UQ7A 2V5CA 3B5MA 4JEUB 3EVYA 5LGTB 1XMOT 5FYMA 3D0TA 4E7ZA 4P0AA 2E9XC 5FNVE 4O4JE 5ABEA 4IE5A 3WAJA 4EXTA 4HE8A 2XQ3A 2RA1A 2Y6XA 3TLSA 4X1YE 5LA6E 5L3BB 2CA5A 4H9RC 1I9BA 4UY2A 3I0QA 5JDFA 3UT5E 2BKPA 5AFJA 4HGAA 2WN9A 2Q9QA 3CK6A 4TV8E 4KI0F 2X9WA 5JR9A 2YEVC 2JIWA 2VKJA 4IDOA 2V26A 3EDVA 2FJEA 2PJQA 4PW8A 3NVOA 2WSSV 4DBQA 2YMEA 5BP0A 2IC9A 4EEBA 2MOZA 3K3QC 4KUMB 5J2UE 2WNLA 2X9XA 4O2BE 3UUNA 2Y8DA 3ZCIA 4UV9B 2QRXA 3RKOA 3K8PC 2CXFA 2WDRA 1V9DA 1W0AA 4YTMA 1OEDB 2FJBA 4O8SA 4A5XA 1G8XA 3ZYLA 2OV9A 2I59A 1MMDA 4JI7T 1ZKEA 3QNUA 2K9AA 3T8OA 4CZZB 4U72A 2NW9A 4ZZCA 3LFMA 1LKXA 1N34T 4UEMA 1YQ3A 5DQWA 4HFDA 1NEKA 3AE4A 4QWNB 3ZJ1A 3H37A 3EUHA 4EYUA 3PMZA 2K3WA 3AB3B 4EV6A 4IE7A 4OX9T 3NRXA 2BS3A 3RYIE 4UXUA 3FXEB 2EHOB 2JQHA 4DBMA 3SS1A 3KINB 5DJQC 2KWHA 3BQIA 3LJCA 2X00A 5AFKA 5FMNA 5LHHB 2AE9A 4DV2T 1HX1B 2E5VA 2Y7YA 3C4XA 1XMQT 2FUPA 2D5UA 2XAQB 2W8GA 4ZHQE 3OBVE 2BG9E 2BBHA 3ESLA 5BR8T 4B6XA 3PUSA 3I9YA 4ZR6A 3RPUA 4DR3T 4CXYA 3NKZA 3ZN1B 1FMVA 3PUVF 4CN6A 4B3MT 5FVLA 1LRZA 4AQFA 2W2UA 3IHRA 4YSYA 3SFDA 4G2AA 5TVCA 3UUBA 2V7KA 3MZKB 3RKGA 4QXHB 3FZKB 2BKNA 3FZFB 3QB5A 4PIRA 2LM9A 2XAJB 3B57A 4P1NA 5LGNB 2Q9QD 4CQIA 4ALXA 2UUBT 4IHJE 4IE4A 4WNKA 2V1DB 1MNDA 3KV4A 4DIDB 1AJ3A 2WDVA 5BRXA 4QX7B 4EZHA 2XYSA 3UU6A 1J1JA 5KXJA 3OPCA 4DR5T 4IL9A 1VCTA 3QK6A 4OYJA 1HNXT 2JPFA 3ZJ2A 5LP6E 2I6HA 4QXBB 4BJNA 4OFZA 2CE7A 1HFAA 3RYHE 3E0ZA 2PGZA 4XZCA 3CX6B 4K0UA 3AEAA 3ONLC 2DI4A 3B13A 3QB5K 2CXLA 1XNRT 2KZ7B 2XZ5A 4FRRA 4C90A 5IYZE 2QYWA 5HXHA 5AQUB 3ZMUB 4A98A 2Y56A 5ABFB 1EZ3A 3KDSE 4ILCA 2LSYA 3RRCA 2HH7A 3UTKA 3RIFA 2J62A 4XHEA 2UXXB 5JDGA 2C5KT 4YFSA 4JV5T 4AKGA 4QH1A 4UVBB 4U2ZA 2CLYB 3MJXA 1D1CA 3ZSSA 3AVSA 1D1BA 4JI8T 2XQAA 4PFPA 1HNZT 5JDLA 4ZXLA 4YTPA 3AE8A 2OLTA 2VVNA 3FB2A 3CQGB 2WZYA 2L9QA 3A8YC 5FXWA 4I50E 2LSJA 2LSIA 4EGWA 3U8JA 4O4LE 1HNWT 3N5LA 1HTJF 1HG5A 3A5XA 1BR2A 3M3ZB 2CCQA 5HCJA 3WTLA 1E1HB 3RHWA 2HHHT 4F6RC 3JAEA 4WW0A 4Z8XA 2ES0A 3CPZA 1T8BA 2UXNB 4UM3A 4HFBA 5J0ZA 3R84B 4ANJA 3ONJA 3ZC1A 5KX5E 2LRLA 3E22E 5LHIB 1WYBA 3N2GE 1XDOA 3RIUA 5LG4A 2W61A 2Q9QB 1FJGT 4UVAB 4IGUA 1X79A 4JI4T 3HKEE 4YSXA 2YDRA 4PJMA 5JR9B 2L8KA 1YW0A 3P4PA 4EB6E 3ANWA 2NR4A 4JI2T 5AFUL 3NBXX 3FZLB 2LKHA 3P7IA 2JMKA 5AQMB 1QSDA 2NOXA 3IEEA 2ZLYA 2VKHA 2YINA 1QLBA 2NTXA 1R8IA 3LK3B 2H7VC 2YK0A 4TWHA 2QVAA 4GYRA 5HEOA 4ZZBA 4CN4A 4JLEA 3RC8A 1UX4A 5FY1A 4OHFA 4YLHA 2XQ7A 2WQYA 4AQGA 3OTOT 4IE0A 3V5SA 2CPTA 1VRBA 4UM3P 2J1DG 3QUJA 2F4VT 1ZHCA 4LF5T 4QX8B 2WY2A 2R6GF 2D9DA 3BQLA 3DJBA 2HN2A 4JI3T 4X1KE 3RQWA 2NW8A 1MMGA 4ISSA 2RPAA 4MALA 1SHZC 3AAEB 3CQCB 5AQHB 3ONXA 2KWIB 2LSKA 1XNQT 3W15B 1HX8A 2XAFB 2NWBA 2D0TA 1UW6A 2XUEA 5AQQB 5LBMA 4KP3C 3PJAJ 5J5FA 2LHNA 2M67A 5GONE 5HWXA 4HFVA 3ZDHA 4GKKT 1SE7A 5DABA 1FMWA 3WTMA 3ZMZB 2CWOA 3VRBA 3AA1B 4YJ2E 3PEOA 3GWHA 2X0HA 2N2NA 1OEDC 2YN6A 5LGUB 2PH9A 5FVKA 1J5WA 1WYCA 1N32T 2UXDT 1HS7A 2A3DA 2LLYA 2J47A 3WTNA 5F5WA 2VQET 4X66T 1BR4A 2E2AA 1IBLT 5JDHA 3N2KE 2XSAA 2BYPA 1UCUA 4MFRA 4B3TT 3NZQA 5LMNT 3L3PA 4UM1A 3P4RA 2LOSA 4JBWF 2EHOC
chains in the Genus database with same CATH topology
3TLSA 3RQWA 3C79A 5FJVA 4IL9A 4COFA 5CFBA 5HCJA 2LKGA 1I9BA 2XYTA 4UY2A 3SIOA 3WTLA 4UXUA 3RHWA 4A97A 5HEGA 3WIPA 5AFHA 4D01A 2X00D 2YMDA 4DBMA 3JAEA 5AFJA 4ZJTA 4QABA 2Y58A 4UM3A 4HFBA 2QC1B 2WN9A 4HQPA 4BQTA 5HEUA 2MAWA 4ILBA 5J0ZA 3SQ9A 4QH5A 2BYRA 2BYQA 3WTKA 2BR7A 5KZUA 5AFLA 4TNVA 2Y57A 4ZRUA 4UM3S 2X00A 4WV9A 5AFKA 2PGZA 2XNTA 5AFMA 3RIAA 5KE4A 5LXBA 1UW6A 3C84A 2Y7YA 5JMEA 5CO5A 3UU8A 3JAFA 4X5TA 5J5FA 3SH1A 2YMEA 4B5DA 2XZ5A 5BP0A 4FRRA 2XQ8A 3P50A 2W8GA 4XK9A 4QACA 3ZKRA 4LMLA 4AFGA 2LM2A 3T4MA 5HEHA 5AFMB 4TWFA 2BG9A 3ZDHA 2BG9E 5J5GA 5SYOA 4IL4A 5HCMA 5L4EA 4ZR6A 3UU5A 4AFTA 4IREA 2BG9C 2XZ6A 3WTMA 3ZDGA 2BJ0A 2XNVA 2W8FA 4A98A 2LKHA 2WNLA 2Y54A 3WTOA 5LG3A 2Y56A 3WTHA 4ILAA 1OEDA 3PEOA 1OEDE 2BG9B 3WTJA 4ILCA 2WNJA 2XQ9A 1OEDC 2YN6A 3TLTA 3RIFA 2XQ4A 2M6IA 4TWDA 4XHEA 4LMJA 3RQUA 3UUBA 2VL0A 5TVCA 2PH9A 2KSRA 5AINA 5BW2A 4LMKA 2ZJVA 4EZ1A 1OEDB 1UX2A 4TNWA 3EHZA 2WNCA 4NZBA 4QH1A 4TWHA 5HEOA 4ZZBA 4Z90A 3IGQA 5HEJA 2LLYA 3EI0A 3U8KA 4ZK1A 3TLVA 2YKSA 4BFQA 2C9TA 4PIRA 4NPPA 3U8NA 2XQ5A 5AFNA 3WTNA 3UQ4A 3EAMA 3UU3A 2M6BA 2XQ7A 4QAAA 2BYSA 3TLUA 4ZZCA 2XQ6A 2XQAA 2ZJUA 3TLWA 2UZ6A 1UV6A 3SQ6A 4ALXA 4AFHA 3WTIA 3U8LA 3P4WA 5L47A 4HFHA 3UQ7A 4QH4A 4HFIA 3JADA 3RI5A 5IUXA 4HFDA 2BR8A 2BYPA 2WZYA 3UU4A 3GUAA 4F8HA 4HFCA 3LSVA 5J5HA 5BRXA 5J5IA 4HFEA 4ZK4A 5L4HA 4UM3P 3PMZA 4UM1A 2XNUA 4ZJSA 3U8MA 2YOEA 2XYSA 3U8JA 4Z91A 2BYNA 3UU6A 2XQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLS A;  3RQW A;  3C79 A;  5FJV A;  4IL9 A;  4COF A;  5CFB A;  5HCJ A;  2LKG A;  1I9B A;  2XYT A;  4UY2 A;  3SIO A;  3WTL A;  4UXU A;  3RHW A;  4A97 A;  5HEG A;  3WIP A;  5AFH A;  4D01 A;  2X00 D;  2YMD A;  4DBM A;  3JAE A;  5AFJ A;  4ZJT A;  4QAB A;  2Y58 A;  4UM3 A;  4HFB A;  2QC1 B;  2WN9 A;  4HQP A;  4BQT A;  5HEU A;  2MAW A;  4ILB A;  5J0Z A;  3SQ9 A;  4QH5 A;  2BYR A;  2BYQ A;  3WTK A;  2BR7 A;  5KZU A;  5AFL A;  4TNV A;  2Y57 A;  4ZRU A;  4UM3 S;  2X00 A;  4WV9 A;  5AFK A;  2PGZ A;  2XNT A;  5AFM A;  3RIA A;  5KE4 A;  5LXB A;  1UW6 A;  3C84 A;  2Y7Y A;  5JME A;  5CO5 A;  3UU8 A;  3JAF A;  4X5T A;  5J5F A;  3SH1 A;  2YME A;  4B5D A;  2XZ5 A;  5BP0 A;  4FRR A;  2XQ8 A;  3P50 A;  2W8G A;  4XK9 A;  4QAC A;  3ZKR A;  4LML A;  4AFG A;  2LM2 A;  3T4M A;  5HEH A;  5AFM B;  4TWF A;  2BG9 A;  3ZDH A;  2BG9 E;  5J5G A;  5SYO A;  4IL4 A;  5HCM A;  5L4E A;  4ZR6 A;  3UU5 A;  4AFT A;  4IRE A;  2BG9 C;  2XZ6 A;  3WTM A;  3ZDG A;  2BJ0 A;  2XNV A;  2W8F A;  4A98 A;  2LKH A;  2WNL A;  2Y54 A;  3WTO A;  5LG3 A;  2Y56 A;  3WTH A;  4ILA A;  1OED A;  3PEO A;  1OED E;  2BG9 B;  3WTJ A;  4ILC A;  2WNJ A;  2XQ9 A;  1OED C;  2YN6 A;  3TLT A;  3RIF A;  2XQ4 A;  2M6I A;  4TWD A;  4XHE A;  4LMJ A;  3RQU A;  3UUB A;  2VL0 A;  5TVC A;  2PH9 A;  2KSR A;  5AIN A;  5BW2 A;  4LMK A;  2ZJV A;  4EZ1 A;  1OED B;  1UX2 A;  4TNW A;  3EHZ A;  2WNC A;  4NZB A;  4QH1 A;  4TWH A;  5HEO A;  4ZZB A;  4Z90 A;  3IGQ A;  5HEJ A;  2LLY A;  3EI0 A;  3U8K A;  4ZK1 A;  3TLV A;  2YKS A;  4BFQ A;  2C9T A;  4PIR A;  4NPP A;  3U8N A;  2XQ5 A;  5AFN A;  3WTN A;  3UQ4 A;  3EAM A;  3UU3 A;  2M6B A;  2XQ7 A;  4QAA A;  2BYS A;  3TLU A;  4ZZC A;  2XQ6 A;  2XQA A;  2ZJU A;  3TLW A;  2UZ6 A;  1UV6 A;  3SQ6 A;  4ALX A;  4AFH A;  3WTI A;  3U8L A;  3P4W A;  5L47 A;  4HFH A;  3UQ7 A;  4QH4 A;  4HFI A;  3JAD A;  3RI5 A;  5IUX A;  4HFD A;  2BR8 A;  2BYP A;  2WZY A;  3UU4 A;  3GUA A;  4F8H A;  4HFC A;  3LSV A;  5J5H A;  5BRX A;  5J5I A;  4HFE A;  4ZK4 A;  5L4H A;  4UM3 P;  3PMZ A;  4UM1 A;  2XNU A;  4ZJS A;  3U8M A;  2YOE A;  2XYS A;  3U8J A;  4Z91 A;  2BYN A;  3UU6 A;  2XQ3 A; 
#chains in the Genus database with same CATH topology
 3RIU C;  3JCF A;  3EAB A;  3PUX F;  4D01 A;  1E2A A;  1MIW A;  5HXR A;  3RGL A;  2N9D A;  3N9P A;  4IDP A;  3O1I A;  5FXV A;  3DTO A;  4WYV A;  5AFL A;  3AA6 B;  5IHY A;  2VKD A;  2ZMA A;  4DR6 T;  1DU2 A;  4AKI A;  3K3O A;  1KF6 A;  4DUZ T;  3T1H T;  4LML A;  2LM2 A;  1VOM A;  5L4E A;  2W66 A;  1UUR A;  4UEL A;  4IRE A;  3ETU A;  3BQK A;  2CBJ A;  1MIV A;  1WCR A;  4KX6 A;  1M7K A;  4JUY A;  4P09 A;  1NEN A;  3TLT A;  5JRC A;  2LSG A;  3A7M A;  4IST A;  3ZN0 B;  3TLV A;  3C50 A;  4BFQ A;  2XQ5 A;  4X62 T;  2DWG A;  3EAM A;  2WB5 A;  4I4T E;  4GK5 E;  2UZ6 A;  3L09 A;  4IIJ E;  4EAH A;  2BDE A;  4IT4 A;  5JTG A;  4HFC A;  4JI5 T;  4ZK4 A;  5HXE A;  3AE1 A;  2XNU A;  4PNI A;  3U8M A;  2BS2 A;  3AEG A;  3SOL A;  3FHN A;  4YY3 T;  3SFE A;  1IBM T;  3L39 A;  3ZPO A;  3SQ9 A;  4BA9 A;  4DV1 T;  1XWM A;  3Q5X A;  1HG2 A;  5JME A;  4J2C A;  5CJ5 A;  3JAF A;  4ILU A;  4DBR A;  2ODU A;  2E8I A;  3J7Y q;  2LT3 A;  3VR8 A;  5SYO A;  4H63 H;  3KBT A;  2XNV A;  3CVR A;  4H9O C;  4ILA A;  5JDQ A;  4EZ4 A;  1OED E;  3F31 A;  5FL0 A;  3ANW B;  4PK6 A;  5AQK B;  4TV9 E;  2KSR A;  2W62 A;  2YU1 A;  2XPK A;  4TNW A;  4ZS3 A;  4JI0 T;  2CLY C;  3U8K A;  2YKS A;  5FY7 A;  2BZB A;  2XY8 B;  3U8N A;  4X20 E;  2IC6 A;  3CWZ B;  3PUR A;  4XBF B;  3P4S A;  4HFH A;  2A72 A;  3RI5 A;  1J5E T;  3AEB A;  4IDQ A;  2MYS A;  4KBM B;  1Y01 A;  4Q25 A;  4CI3 B;  3ZCJ A;  3VKG A;  2W4X A;  2KMF A;  3C4Z A;  3NZP A;  4DV4 T;  3RX6 A;  1KK7 A;  5EZY E;  2UU9 T;  4NUU A;  2QGS A;  5AQJ B;  5FXX A;  5CFB A;  2WDQ A;  3RRW A;  1HF8 A;  3HKB E;  3GN5 B;  2ZM6 T;  4LF8 T;  3ETV A;  5FL1 A;  3OYZ A;  4QAB A;  1HR0 T;  1MIY A;  5IWA T;  3S4U A;  4HTE A;  2Q9Q C;  4TNV A;  2KT9 A;  1N33 T;  3CML A;  5JR9 C;  5LXB A;  1XZY A;  5AQV B;  2KIN B;  3PU8 A;  4MHC A;  5ADX L;  5J5H A;  2HPL A;  4QAC A;  3GA8 A;  3ZKR A;  2ZM0 A;  5LOV E;  3KVB A;  5AQR B;  4H9N C;  2N1G A;  3WTO A;  1W0B A;  1XDP A;  3CX8 B;  4GIW A;  4AKH A;  4DMV A;  5EK2 A;  2WS3 A;  1WLX A;  2V7J A;  5HAX A;  2XTL A;  4L5G A;  2C9T A;  3Q9D A;  3HKC E;  5LCY A;  3VRA A;  2KLQ A;  1MMN A;  2X0L B;  3SQ6 A;  1T98 A;  2NP9 A;  3KFW X;  2IUB A;  4YTN A;  4FI5 A;  4HFI A;  3JAD A;  4F8H A;  3BK9 A;  5LJM A;  2CHN A;  4FJO A;  1LVK A;  2H88 A;  4JEH B;  1UK5 A;  2BBJ A;  3WAK A;  1IZN B;  2XSB A;  5AQF B;  2WBL A;  1FEW A;  3U78 A;  2JMH A;  3SIO A;  4U3C A;  4LF7 T;  5A1L A;  2IIU A;  4HWC A;  2X00 D;  3PUW F;  3PUZ F;  4HQP A;  4YSZ A;  2B76 A;  4I0U A;  2BYQ A;  5AQN B;  3OYX A;  3LBX A;  1SA0 E;  4WV9 A;  5FXZ A;  3LG7 A;  4JYA T;  3C84 A;  2K48 A;  4B3S T;  4OYK A;  3J9X 1;  4UF0 A;  4I43 B;  2BS4 A;  2IW5 B;  4B3R T;  2LOP A;  2BG9 A;  1JNZ A;  2MTQ A;  3ZDG A;  4NUV A;  4V1A v;  4GKJ T;  1US7 B;  3N9O A;  5CA1 E;  4ZI7 E;  3AE6 A;  3AVR A;  4AQF C;  2XQ4 A;  2M6I A;  4LMJ A;  4DR7 T;  4EZ1 A;  2XAG B;  1D0Z A;  4DV0 T;  3PUY F;  3MAC A;  4AQY T;  4CI2 B;  3IGQ A;  4DO0 A;  5JRC B;  1S35 A;  3MXZ A;  5CB4 E;  2M6B A;  2VQF T;  3WI3 A;  4HN9 A;  3AEC A;  3TKL B;  3O9X A;  2D2S A;  5L47 A;  3UUX B;  2DCF A;  2W00 A;  2E9X A;  3VU7 H;  3L8R A;  4DV7 T;  2JRK A;  3HA4 A;  4TUY E;  5JH7 E;  5AQS B;  2YOE A;  2BYN A;  5C3J A;  3K1S A;  3VR9 A;  2ZM2 A;  5LBQ B;  3JC6 D;  5FJV A;  5JQG E;  3RLF F;  5J1G A;  4LF9 T;  1NAF A;  5FP3 A;  4BQT A;  4YJ3 E;  4ILB A;  3Q5W A;  3JC6 C;  2J4G A;  3N9N A;  3PDY A;  1WR6 A;  3AAA B;  3GN5 A;  5J2T E;  2IHR 1;  2WZH A;  3SWH A;  5DQV A;  2BVL A;  1H7C A;  1HCI A;  2ODV A;  1YQ4 A;  1ZOY A;  4KMC A;  4TWF A;  4UIG A;  3GMI A;  4HEA A;  3UFE A;  3FBL A;  4A56 A;  3WTH A;  1OXZ A;  4UV8 B;  5L3C B;  2JQ9 A;  2IDO B;  4YHJ A;  3RQU A;  4OK0 A;  2MBG A;  5BW2 A;  4LF6 T;  2CEA A;  2PG8 A;  3QOF A;  5AQP B;  3O4X E;  2YDS A;  2I0M A;  3Q5E A;  4PK4 A;  3EI0 A;  3T1Y T;  5AFN A;  4ZS2 A;  4UR9 A;  3AXJ A;  2XQ6 A;  3TLW A;  3ZMS B;  4JI1 T;  2C5I T;  4U74 A;  1CHU A;  5H6R B;  4YXD A;  5L3G B;  3OVU A;  3OJA A;  3ZEF B;  4ZEY A;  5LXT E;  4LF4 T;  2UUC T;  3ZLI A;  1U5P A;  3P4Q A;  4CN1 A;  3RC3 A;  4L9I A;  4UVC B;  4TZ4 C;  2X9H A;  2XYT A;  2GK9 A;  4IE6 A;  5TAO A;  4ZI3 D;  5FKY A;  5ABH A;  5M4Y A;  2CMR A;  4ZJT A;  2BVM A;  2C0S A;  3MKD A;  4EIW A;  1L0V A;  2HPJ A;  2BYR A;  4H9Q C;  2H3R A;  3SRZ A;  2XNT A;  5KE4 A;  4ZI3 C;  2JQQ A;  2LE8 A;  5KMG P;  5CO5 A;  3UU8 A;  3PUG A;  2XQ8 A;  4H9P C;  3P50 A;  5KDM C;  3H3A A;  5L3F B;  3F57 A;  2VKO A;  3KBU A;  5HCM A;  2WWV A;  2ZM8 A;  3HR0 A;  4XAX B;  4E7S A;  5AQO B;  2FJA A;  3I9W A;  5LHG B;  1KNP A;  3C51 A;  2XQ9 A;  2QA7 A;  4GYS A;  5AIN A;  2A9U A;  2WMO A;  4QKN A;  5AQL B;  4BJM A;  4Z90 A;  2WP9 A;  4U7Y A;  4NXM T;  3DP7 A;  3ZT6 A;  4C91 A;  2V7L A;  4AKR B;  3F2E A;  5HXS A;  3ZT5 A;  2CWY A;  4CXW A;  4AFH A;  2H89 A;  2VVS A;  2X67 A;  3U3I A;  2WU5 A;  3ZST A;  5JDN A;  4QXC B;  1KEY A;  2BR8 A;  5IUX A;  3UU4 A;  4DUY T;  1OWA A;  2VB6 A;  2RP4 A;  5J5I A;  4HFE A;  3ABV A;  3N9Q A;  2CXD A;  5JRE A;  4ZJS A;  3E08 A;  4EYY R;  3CKD A;  3IA3 A;  3WIP A;  1JNR A;  5JDM A;  3NWI A;  2CHO A;  2WM9 A;  2DHR A;  2VL8 A;  2UXC T;  5HEU A;  4ASK A;  4ZI2 D;  2WMN A;  2E5L T;  4O4I E;  4ZRU A;  2V5D A;  5HXC A;  4WBO A;  4G63 A;  4PJL A;  4PJN A;  3HKD E;  4NIQ A;  3IBP A;  3FXD B;  3LBX B;  2UUA T;  4DMW A;  4B5D A;  4ZI2 C;  1MMA A;  4XK9 A;  2HN1 A;  4KHZ F;  3ZMV B;  4TX5 A;  2PTF A;  5JVD E;  1KNR A;  1X9B A;  3IF8 B;  4UF0 B;  5LG3 A;  2BG9 B;  2WNJ A;  1KNZ A;  3ZT7 A;  4BAY B;  3EHZ A;  2LHR A;  4QHO A;  5HEJ A;  5L3D B;  5LNK A;  3O1J A;  4NPP A;  5LJN A;  3UQ4 A;  4QAA A;  4DR2 T;  1UV6 A;  1E7P A;  4GK0 E;  4DR1 T;  1D0X A;  2LEH A;  2ACZ A;  3AEF A;  4AXP A;  3K3N A;  2ACX A;  5L4H A;  2UXB T;  3FZH B;  4Z91 A;  2E9X B;  2IML A;  4NXN T;  4AIU A;  2W63 A;  2WU2 A;  3CIR A;  1D0Y A;  3HI2 A;  2W0G A;  2G0U A;  3CQX C;  5HYA A;  4EED A;  1KFY A;  3LDQ B;  2Y58 A;  2QC1 B;  3I1A A;  4QH5 A;  3LK2 B;  4LFB T;  5KZU A;  2Y57 A;  1IAP A;  5AFM A;  2KXP B;  2D0U A;  2XAH B;  3FBZ A;  1WRD A;  3AAI A;  4DV3 T;  4O4H E;  4DVD A;  4DR4 T;  3G06 A;  2V6Y A;  2PFV A;  3UU5 A;  4HKA A;  4WBN E;  2V7M A;  5AQG B;  2X68 A;  3RYC E;  4AI6 A;  2X66 A;  3VHL A;  2Y48 B;  3MA9 A;  5F8P A;  2WAU A;  2JJ9 A;  4PAG A;  4U31 A;  2ZJV A;  1G73 A;  5AQI B;  2OA5 A;  1YKH B;  2K24 A;  4NZB A;  4U2Y A;  3AEE A;  4MLK A;  4PJJ A;  4PFO A;  5FY0 A;  2FBW A;  3RF1 A;  1O3X A;  1CUN A;  2CBI A;  2V6X A;  4L0R A;  4ZOL E;  2ZJU A;  1BR0 A;  3P4W A;  2AXD S;  5ABG A;  4YHH T;  3AXJ B;  4GOU A;  3PTR B;  2MPK A;  2FJD A;  2YU2 A;  1ZEE A;  4H9S E;  1NWM X;  1S94 A;  1VCS A;  3O1H A;  2K5B B;  3X1D A;  4WZX A;  4X64 T;  2VUR A;  3ZMT B;  2DL1 A;  5LB7 B;  3RYF E;  3I0O A;  5E0O A;  2YMD A;  3ZYK A;  3AED A;  3P8C D;  3AE9 A;  4H63 V;  3FZM B;  1Z0P A;  5AQT B;  3AE3 A;  1YKE B;  2IAK A;  1IJ5 A;  5LMU T;  1ZV4 X;  2WWU A;  2WCA A;  5C2T A;  4DV6 T;  3H3M A;  4X5T A;  5EK3 A;  5L3E B;  5CA0 E;  3T4M A;  5HEH A;  4AFT A;  4CXX A;  2XZ6 A;  2W8F A;  2LJL A;  1YD8 G;  1BR1 A;  5F3J A;  1OED A;  3WTJ A;  3R6N A;  4DV5 T;  5CGM A;  3AE2 A;  4TWD A;  2A2F X;  3M65 A;  4LMK A;  2JQK A;  4YT0 A;  2Z6E A;  3PJA A;  5C8Y E;  4ZK1 A;  5L2L A;  1FIO A;  3UU3 A;  4X65 T;  3KV5 A;  1N36 T;  2BYS A;  2PBI A;  2XQY A;  3TLU A;  2H7O A;  3Q5D A;  2NW7 A;  2X51 A;  2BKO A;  4KHP T;  4QH4 A;  3GUA A;  3OKQ A;  3LSV A;  3QC9 A;  1WFD A;  2EHO A;  3PE0 A;  1U4Q A;  4COF A;  2LKG A;  5AFH A;  4A97 A;  1WR0 A;  4UXN B;  1QUU A;  3PUA A;  4HWF A;  4M1P A;  3KV9 A;  3PV0 F;  1YXR A;  2MAW A;  4UM3 S;  4U33 A;  5EK4 A;  5ETW A;  2C5J A;  3RIA A;  2XHE B;  4CI1 B;  4TN7 B;  2DLR A;  4AFG A;  1UX5 A;  5J5G A;  3V5U A;  1Z8U A;  1SUM B;  2BJ0 A;  2YDQ A;  3Q2M A;  3UUM A;  2P9B A;  3KV6 A;  5LYJ E;  3AE5 A;  4K0K T;  1IJ6 A;  2CM0 A;  2V7I A;  2V8S V;  5BMV E;  1T72 A;  2CRB A;  1UX2 A;  2WNC A;  4IDN A;  4I55 E;  1W9R A;  2WZI A;  3PUQ A;  3MK7 C;  2SPC A;  1LVF A;  3AE7 A;  4N78 D;  3RH3 A;  3C64 A;  3PU3 A;  3WTI A;  2DWK A;  4U7I A;  1GQE A;  1T7S A;  2X9Y A;  3ZC0 A;  1ZP0 A;  4HWI B;  3AA7 B;  4O2A E;  4HWH A;  5HWY A;  3C79 A;  3N2O A;  4LFA T;  2VK9 A;  4AIS A;  3VKH A;  5HEG A;  1D1A A;  2XJ7 A;  2XM2 A;  2NTY A;  4ADZ A;  1I94 T;  4ERR A;  3WTK A;  1Y64 B;  2BR7 A;  1W09 A;  1UGO A;  3HL6 A;  2LRK A;  4PK5 A;  1B7T A;  4EOZ B;  4JI6 T;  2L3L A;  3NRY A;  3C4W A;  2XZE A;  4IDZ A;  3SH1 A;  2XM1 A;  1IBK T;  3C98 B;  1MNE A;  4DND A;  5ABF A;  5AFM B;  4IL4 A;  3KVA A;  4X1I E;  1UUS A;  2BG9 C;  2DNX A;  3N9L A;  2Y54 A;  3AA0 B;  2V6Y B;  3UFG A;  2X0Y A;  2B1E A;  3LK4 2;  2EHO D;  4AKL A;  2VL0 A;  3UUL A;  2W67 A;  4MBQ A;  4P0B A;  2VWA A;  2KND A;  4LFC T;  2VAS A;  3CX7 B;  5H6Q B;  2E9X D;  3ZYM A;  2XAS B;  1I6Z A;  1M62 A;  3EDU A;  3N9M A;  4HWD A;  3U8L A;  3UQ7 A;  2V5C A;  3B5M A;  4JEU B;  3EVY A;  5LGT B;  1XMO T;  5FYM A;  3D0T A;  4E7Z A;  4P0A A;  2E9X C;  5FNV E;  4O4J E;  5ABE A;  4IE5 A;  3WAJ A;  4EXT A;  4HE8 A;  2XQ3 A;  2RA1 A;  2Y6X A;  3TLS A;  4X1Y E;  5LA6 E;  5L3B B;  2CA5 A;  4H9R C;  1I9B A;  4UY2 A;  3I0Q A;  5JDF A;  3UT5 E;  2BKP A;  5AFJ A;  4HGA A;  2WN9 A;  2Q9Q A;  3CK6 A;  4TV8 E;  4KI0 F;  2X9W A;  5JR9 A;  2YEV C;  2JIW A;  2VKJ A;  4IDO A;  2V26 A;  3EDV A;  2FJE A;  2PJQ A;  4PW8 A;  3NVO A;  2WSS V;  4DBQ A;  2YME A;  5BP0 A;  2IC9 A;  4EEB A;  2MOZ A;  3K3Q C;  4KUM B;  5J2U E;  2WNL A;  2X9X A;  4O2B E;  3UUN A;  2Y8D A;  3ZCI A;  4UV9 B;  2QRX A;  3RKO A;  3K8P C;  2CXF A;  2WDR A;  1V9D A;  1W0A A;  4YTM A;  1OED B;  2FJB A;  4O8S A;  4A5X A;  1G8X A;  3ZYL A;  2OV9 A;  2I59 A;  1MMD A;  4JI7 T;  1ZKE A;  3QNU A;  2K9A A;  3T8O A;  4CZZ B;  4U72 A;  2NW9 A;  4ZZC A;  3LFM A;  1LKX A;  1N34 T;  4UEM A;  1YQ3 A;  5DQW A;  4HFD A;  1NEK A;  3AE4 A;  4QWN B;  3ZJ1 A;  3H37 A;  3EUH A;  4EYU A;  3PMZ A;  2K3W A;  3AB3 B;  4EV6 A;  4IE7 A;  4OX9 T;  3NRX A;  2BS3 A;  3RYI E;  4UXU A;  3FXE B;  2EHO B;  2JQH A;  4DBM A;  3SS1 A;  3KIN B;  5DJQ C;  2KWH A;  3BQI A;  3LJC A;  2X00 A;  5AFK A;  5FMN A;  5LHH B;  2AE9 A;  4DV2 T;  1HX1 B;  2E5V A;  2Y7Y A;  3C4X A;  1XMQ T;  2FUP A;  2D5U A;  2XAQ B;  2W8G A;  4ZHQ E;  3OBV E;  2BG9 E;  2BBH A;  3ESL A;  5BR8 T;  4B6X A;  3PUS A;  3I9Y A;  4ZR6 A;  3RPU A;  4DR3 T;  4CXY A;  3NKZ A;  3ZN1 B;  1FMV A;  3PUV F;  4CN6 A;  4B3M T;  5FVL A;  1LRZ A;  4AQF A;  2W2U A;  3IHR A;  4YSY A;  3SFD A;  4G2A A;  5TVC A;  3UUB A;  2V7K A;  3MZK B;  3RKG A;  4QXH B;  3FZK B;  2BKN A;  3FZF B;  3QB5 A;  4PIR A;  2LM9 A;  2XAJ B;  3B57 A;  4P1N A;  5LGN B;  2Q9Q D;  4CQI A;  4ALX A;  2UUB T;  4IHJ E;  4IE4 A;  4WNK A;  2V1D B;  1MND A;  3KV4 A;  4DID B;  1AJ3 A;  2WDV A;  5BRX A;  4QX7 B;  4EZH A;  2XYS A;  3UU6 A;  1J1J A;  5KXJ A;  3OPC A;  4DR5 T;  4IL9 A;  1VCT A;  3QK6 A;  4OYJ A;  1HNX T;  2JPF A;  3ZJ2 A;  5LP6 E;  2I6H A;  4QXB B;  4BJN A;  4OFZ A;  2CE7 A;  1HFA A;  3RYH E;  3E0Z A;  2PGZ A;  4XZC A;  3CX6 B;  4K0U A;  3AEA A;  3ONL C;  2DI4 A;  3B13 A;  3QB5 K;  2CXL A;  1XNR T;  2KZ7 B;  2XZ5 A;  4FRR A;  4C90 A;  5IYZ E;  2QYW A;  5HXH A;  5AQU B;  3ZMU B;  4A98 A;  2Y56 A;  5ABF B;  1EZ3 A;  3KDS E;  4ILC A;  2LSY A;  3RRC A;  2HH7 A;  3UTK A;  3RIF A;  2J62 A;  4XHE A;  2UXX B;  5JDG A;  2C5K T;  4YFS A;  4JV5 T;  4AKG A;  4QH1 A;  4UVB B;  4U2Z A;  2CLY B;  3MJX A;  1D1C A;  3ZSS A;  3AVS A;  1D1B A;  4JI8 T;  2XQA A;  4PFP A;  1HNZ T;  5JDL A;  4ZXL A;  4YTP A;  3AE8 A;  2OLT A;  2VVN A;  3FB2 A;  3CQG B;  2WZY A;  2L9Q A;  3A8Y C;  5FXW A;  4I50 E;  2LSJ A;  2LSI A;  4EGW A;  3U8J A;  4O4L E;  1HNW T;  3N5L A;  1HTJ F;  1HG5 A;  3A5X A;  1BR2 A;  3M3Z B;  2CCQ A;  5HCJ A;  3WTL A;  1E1H B;  3RHW A;  2HHH T;  4F6R C;  3JAE A;  4WW0 A;  4Z8X A;  2ES0 A;  3CPZ A;  1T8B A;  2UXN B;  4UM3 A;  4HFB A;  5J0Z A;  3R84 B;  4ANJ A;  3ONJ A;  3ZC1 A;  5KX5 E;  2LRL A;  3E22 E;  5LHI B;  1WYB A;  3N2G E;  1XDO A;  3RIU A;  5LG4 A;  2W61 A;  2Q9Q B;  1FJG T;  4UVA B;  4IGU A;  1X79 A;  4JI4 T;  3HKE E;  4YSX A;  2YDR A;  4PJM A;  5JR9 B;  2L8K A;  1YW0 A;  3P4P A;  4EB6 E;  3ANW A;  2NR4 A;  4JI2 T;  5AFU L;  3NBX X;  3FZL B;  2LKH A;  3P7I A;  2JMK A;  5AQM B;  1QSD A;  2NOX A;  3IEE A;  2ZLY A;  2VKH A;  2YIN A;  1QLB A;  2NTX A;  1R8I A;  3LK3 B;  2H7V C;  2YK0 A;  4TWH A;  2QVA A;  4GYR A;  5HEO A;  4ZZB A;  4CN4 A;  4JLE A;  3RC8 A;  1UX4 A;  5FY1 A;  4OHF A;  4YLH A;  2XQ7 A;  2WQY A;  4AQG A;  3OTO T;  4IE0 A;  3V5S A;  2CPT A;  1VRB A;  4UM3 P;  2J1D G;  3QUJ A;  2F4V T;  1ZHC A;  4LF5 T;  4QX8 B;  2WY2 A;  2R6G F;  2D9D A;  3BQL A;  3DJB A;  2HN2 A;  4JI3 T;  4X1K E;  3RQW A;  2NW8 A;  1MMG A;  4ISS A;  2RPA A;  4MAL A;  1SHZ C;  3AAE B;  3CQC B;  5AQH B;  3ONX A;  2KWI B;  2LSK A;  1XNQ T;  3W15 B;  1HX8 A;  2XAF B;  2NWB A;  2D0T A;  1UW6 A;  2XUE A;  5AQQ B;  5LBM A;  4KP3 C;  3PJA J;  5J5F A;  2LHN A;  2M67 A;  5GON E;  5HWX A;  4HFV A;  3ZDH A;  4GKK T;  1SE7 A;  5DAB A;  1FMW A;  3WTM A;  3ZMZ B;  2CWO A;  3VRB A;  3AA1 B;  4YJ2 E;  3PEO A;  3GWH A;  2X0H A;  2N2N A;  1OED C;  2YN6 A;  5LGU B;  2PH9 A;  5FVK A;  1J5W A;  1WYC A;  1N32 T;  2UXD T;  1HS7 A;  2A3D A;  2LLY A;  2J47 A;  3WTN A;  5F5W A;  2VQE T;  4X66 T;  1BR4 A;  2E2A A;  1IBL T;  5JDH A;  3N2K E;  2XSA A;  2BYP A;  1UCU A;  4MFR A;  4B3T T;  3NZQ A;  5LMN T;  3L3P A;  4UM1 A;  3P4R A;  2LOS A;  4JBW F;  2EHO C; 
#chains in the Genus database with same CATH homology
 3TLS A;  3RQW A;  3C79 A;  5FJV A;  4IL9 A;  4COF A;  5CFB A;  5HCJ A;  2LKG A;  1I9B A;  2XYT A;  4UY2 A;  3SIO A;  3WTL A;  4UXU A;  3RHW A;  4A97 A;  5HEG A;  3WIP A;  5AFH A;  4D01 A;  2X00 D;  2YMD A;  4DBM A;  3JAE A;  5AFJ A;  4ZJT A;  4QAB A;  2Y58 A;  4UM3 A;  4HFB A;  2QC1 B;  2WN9 A;  4HQP A;  4BQT A;  5HEU A;  2MAW A;  4ILB A;  5J0Z A;  3SQ9 A;  4QH5 A;  2BYR A;  2BYQ A;  3WTK A;  2BR7 A;  5KZU A;  5AFL A;  4TNV A;  2Y57 A;  4ZRU A;  4UM3 S;  2X00 A;  4WV9 A;  5AFK A;  2PGZ A;  2XNT A;  5AFM A;  3RIA A;  5KE4 A;  5LXB A;  1UW6 A;  3C84 A;  2Y7Y A;  5JME A;  5CO5 A;  3UU8 A;  3JAF A;  4X5T A;  5J5F A;  3SH1 A;  2YME A;  4B5D A;  2XZ5 A;  5BP0 A;  4FRR A;  2XQ8 A;  3P50 A;  2W8G A;  4XK9 A;  4QAC A;  3ZKR A;  4LML A;  4AFG A;  2LM2 A;  3T4M A;  5HEH A;  5AFM B;  4TWF A;  2BG9 A;  3ZDH A;  2BG9 E;  5J5G A;  5SYO A;  4IL4 A;  5HCM A;  5L4E A;  4ZR6 A;  3UU5 A;  4AFT A;  4IRE A;  2BG9 C;  2XZ6 A;  3WTM A;  3ZDG A;  2BJ0 A;  2XNV A;  2W8F A;  4A98 A;  2LKH A;  2WNL A;  2Y54 A;  3WTO A;  5LG3 A;  2Y56 A;  3WTH A;  4ILA A;  1OED A;  3PEO A;  1OED E;  2BG9 B;  3WTJ A;  4ILC A;  2WNJ A;  2XQ9 A;  1OED C;  2YN6 A;  3TLT A;  3RIF A;  2XQ4 A;  2M6I A;  4TWD A;  4XHE A;  4LMJ A;  3RQU A;  3UUB A;  2VL0 A;  5TVC A;  2PH9 A;  2KSR A;  5AIN A;  5BW2 A;  4LMK A;  2ZJV A;  4EZ1 A;  1OED B;  1UX2 A;  4TNW A;  3EHZ A;  2WNC A;  4NZB A;  4QH1 A;  4TWH A;  5HEO A;  4ZZB A;  4Z90 A;  3IGQ A;  5HEJ A;  2LLY A;  3EI0 A;  3U8K A;  4ZK1 A;  3TLV A;  2YKS A;  4BFQ A;  2C9T A;  4PIR A;  4NPP A;  3U8N A;  2XQ5 A;  5AFN A;  3WTN A;  3UQ4 A;  3EAM A;  3UU3 A;  2M6B A;  2XQ7 A;  4QAA A;  2BYS A;  3TLU A;  4ZZC A;  2XQ6 A;  2XQA A;  2ZJU A;  3TLW A;  2UZ6 A;  1UV6 A;  3SQ6 A;  4ALX A;  4AFH A;  3WTI A;  3U8L A;  3P4W A;  5L47 A;  4HFH A;  3UQ7 A;  4QH4 A;  4HFI A;  3JAD A;  3RI5 A;  5IUX A;  4HFD A;  2BR8 A;  2BYP A;  2WZY A;  3UU4 A;  3GUA A;  4F8H A;  4HFC A;  3LSV A;  5J5H A;  5BRX A;  5J5I A;  4HFE A;  4ZK4 A;  5L4H A;  4UM3 P;  3PMZ A;  4UM1 A;  2XNU A;  4ZJS A;  3U8M A;  2YOE A;  2XYS A;  3U8J A;  4Z91 A;  2BYN A;  3UU6 A;  2XQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...