5HEGA

Pentameric ligand-gated ion channel glic mutant p246g
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
b'PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLGKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Signal Transduction at the Domain Interface of Prokaryotic Pentameric Ligand-Gated Ion Channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hegA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hegA01
4NZBA 4IREA 3UU4A 4COFA 2WN9A 5BP0A 2XQ4A 4ILCA 5J5HA 3PMZA 3UQ4A 2VL0A 2YKSA 5HEUA 2BYQA 2BG9B 4UM3A 5AFHA 3IGQA 2Y57A 4AFHA 5SYOA 2XQ5A 3UU5A 3UQ7A 2BR8A 2WNLA 5AFKA 4IL4A 2BG9A 4QAAA 3EHZA 4HQPA 2BJ0A 5AINA 5BW2A 4EZ1A 4ILBA 3GUAA 2LM2A 4XK9A 5LXBA 5HEHA 4IL9A 2XQ9A 5HEGA 2W8GA 5L4EA 5KZUA 5AFMB 4Z91A 1UX2A 5BRXA 2BG9C 5J5GA 3WTHA 2XNVA 3C84A 5LG3A 4QH5A 5AFMA 4HFEA 3WTIA 2XQAA 3P4WA 3LSVA 1UV6A 5HEOA 1OEDE 3ZDGA 2XQ7A 4HFDA 3WTJA 5HEJA 4Z90A 4UM1A 4TNVA 3RIFA 5IUXA 2PH9A 3SIOA 3UUBA 2WZYA 4UY2A 5HCMA 2XQ8A 4HFCA 3RHWA 2Y56A 2KSRA 3JAFA 3UU6A 4TWHA 4HFBA 2WNCA 5FJVA 3WTNA 2BYRA 2WNJA 3SQ9A 4QH4A 4NPPA 2BYSA 2XYTA 4ZRUA 4PIRA 2YN6A 4HFIA 2UZ6A 3RIAA 2Y54A 3WTMA 4A97A 4AFGA 4UM3P 5J5FA 4ZJSA 4TWFA 3C79A 3RI5A 5CFBA 2Y58A 3JADA 2YMDA 5L4HA 3U8NA 4ZR6A 3U8KA 4WV9A 4ALXA 2YMEA 4QABA 2LKGA 4B5DA 5AFLA 3WIPA 4X5TA 3TLSA 3WTKA 4QACA 2Y7YA 4ZZCA 4DBMA 2PGZA 4ZK1A 3WTLA 5TVCA 4F8HA 5J0ZA 5KE4A 2LKHA 3RQWA 3JAEA 4ZK4A 4UM3S 2LLYA 4HFHA 3PEOA 2XQ3A 4AFTA 2M6BA 5L47A 3TLWA 4ILAA 2XNTA 2XZ5A 4LMJA 2ZJVA 5AFJA 1OEDA 2BG9E 4LMLA 4D01A 2X00A 2M6IA 2YOEA 2XNUA 3ZKRA 3U8MA 5CO5A 3UU8A 3ZDHA 3EI0A 3TLUA 3SQ6A 4BQTA 1UW6A 2C9TA 5JMEA 4ZJTA 2BYPA 2ZJUA 2QC1B 4A98A 4LMKA 3TLTA 4XHEA 4UXUA 3U8JA 2XQ6A 1OEDC 5J5IA 2W8FA 3U8LA 2X00D 3UU3A 2BYNA 4TNWA 3RQUA 2BR7A 4ZZBA 4BFQA 3EAMA 3SH1A 3T4MA 3TLVA 2MAWA 3P50A 1OEDB 4QH1A 1I9BA 5AFNA 4TWDA 2XZ6A 5HCJA 2XYSA 3WTOA 4FRRA
chains in the Genus database with same CATH superfamily
5L3DB 3PUVF 4NUVA 3QUJA 4ILCA 3IGQA 4MBQA 5E0OA 4UVAB 2CBJA 3JC6D 3PU8A 3AAIA 5JR9B 4U72A 5JDHA 4O4LE 1IAPA 5CA0E 2L3LA 2NW7A 4QH5A 2JQHA 3AVRA 3F31A 5HEOA 3ZDGA 4Q25A 4EZHA 2YU1A 5FVLA 3RYFE 2JMHA 1EZ3A 4HWDA 4PJJA 4JUYA 4PIRA 4YJ3E 2E9XB 2V5DA 2WU2A 3PE0A 4N78D 4ZR6A 3S4UA 4DNDA 2Y7YA 4ZZCA 2KZ7B 5JDGA 3KV5A 5TVCA 4F8HA 5J0ZA 3AXJB 4O4JE 1N36T 3NRYA 2FJAA 4AQYT 5IWAT 4LFCT 3SQ6A 3FHNA 1UW6A 4MFRA 4I55E 1SA0E 3AE8A 3H37A 4GKJT 1D0XA 3ZC0A 3EAMA 1HNWT 2W0GA 2WU5A 3P7IA 3WTOA 4YSXA 3HI2A 4GYRA 5LXTE 3C4XA 5ABFA 4COFA 5FYMA 4LF8T 2Y8DA 1HNZT 2BG9B 1W9RA 3CK6A 5L3FB 2WS3A 5L3BB 1VOMA 4MLKA 3DJBA 2XQ5A 3AAEB 2KXPB 5EK4A 2YDSA 3CX8B 2NW8A 3GUAA 1NWMX 2LM2A 2FUPA 2KINB 3NRXA 3O1JA 3I1AA 3OJAA 1KNRA 4JI4T 3DP7A 4DMVA 1FIOA 3AE2A 3KVBA 5HEJA 5F5WA 1WR0A 3SIOA 2WZYA 3WI3A 4IT4A 3VU7H 4TWHA 5BMVE 2ES0A 2WWVA 3VKHA 5CGMA 2V7JA 3BQKA 4IHJE 3JCFA 4WBNE 4H9SE 4MALA 3V5SA 3MXZA 4YFSA 2CLYC 5L4HA 3RRWA 2E9XA 4PJLA 4B5DA 2LKGA 2B1EA 4HKAA 3WIPA 5HYAA 4JLEA 3LK3B 4DBMA 3CQXC 4ZK1A 3AB3B 3O4XE 4ZK4A 5J2TE 3GWHA 2LEHA 3ABVA 4PFOA 5L47A 2XNTA 2Z6EA 4U2ZA 3P4RA 3AXJA 2IHR1 3FB2A 4H9NC 4UV8B 5J1GA 1MMNA 4J2CA 3I0QA 1MMDA 4HWCA 4AKLA 2H7VC 2IUBA 4O2AE 2BKPA 2V6XA 4KMCA 2WY2A 2YU2A 3FZFB 5LYJE 3D0TA 2IAKA 3ZYKA 2HN1A 1W09A 3EDVA 2H7OA 4GKKT 3RYCE 3KFWX 3QOFA 3AE6A 2VURA 3PDYA 1LVFA 4H9PC 2VWAA 2CPTA 1WRDA 2VKOA 1MMGA 2BG9A 4P1NA 5BW2A 1U5PA 4ILBA 4PNIA 4XK9A 1YKEB 5LGTB 1VCSA 2B76A 4GYSA 3PUAA 4CI1B 1YQ4A 1VRBA 2X0HA 2CHOA 2YEVC 1NENA 2X9WA 3N2OA 2UUCT 3K1SA 4O4IE 4A97A 4ZJSA 4TWFA 1WLXA 3RI5A 4LF7T 3N9QA 4EXTA 3IA3A 2WQYA 2X9HA 2LKHA 3JAEA 2YDRA 4DR6T 5LA6E 1OEDA 1ZOYA 3F57A 5LHHB 2XNUA 3VRAA 1HX8A 3UU8A 3G06A 1BR2A 4AQFC 2QC1B 3TLTA 3U8JA 5HXEA 2XAJB 2X0YA 3RQUA 3RYIE 1UUSA 4YJ2E 3R84B 4UV9B 4O2BE 4TZ4C 2JQ9A 4IREA 2XQ4A 2XZEA 4DVDA 2XJ7A 2WP9A 2YKSA 4AISA 3CQGB 2E5VA 3A8YC 1YQ3A 4YXDA 3EHZA 4HQPA 4UIGA 5LGUB 2VK9A 4IL9A 3OYXA 3EABA 3RKGA 3NBXX 1UX2A 3AEAA 5J5GA 4MHCA 3ONXA 2RP4A 2V8SV 3UFEA 4BJNA 1HNXT 3AE3A 4ISSA 4Z90A 2CXFA 1S35A 1D1BA 4EEBA 2QGSA 2JIWA 2N2NA 3TKLB 2DCFA 3RC3A 4ZS2A 2WNCA 3WAJA 1Z0PA 4WYVA 1NEKA 1IJ5A 1ZHCA 1WR6A 2EHOA 4X65T 3OPCA 2A2FX 3AA1B 3ZMSB 4I4TE 2PBIA 4ASKA 2CA5A 2UXDT 4DMWA 4LF4T 2VKDA 2C0SA 3AE9A 4HFHA 2GK9A 2M6BA 1HX1B 5AFJA 3AEDA 2UXNB 3ZKRA 3MZKB 4YTNA 3AA6B 3K8PC 4ZJTA 4ZS3A 5EZYE 2KLQA 3BQIA 3UU3A 3LK42 4DV0T 4ADZA 4ZI7E 5F3JA 4BFQA 4AKHA 4CI2B 5TAOA 4X1KE 4U7YA 2WDQA 5EK3A 5BP0A 3FZKB 2VQFT 3KDSE 3KBTA 4C91A 4O4HE 4KI0F 3GN5B 1IBMT 2BS2A 3O9XA 4HEAA 3Q5XA 3ZCJA 2XAGB 4UELA 4YSYA 4DR4T 2XQ9A 5FXVA 2K24A 2W63A 2C5JA 4IE7A 1SHZC 5FY1A 5C3JA 2HPJA 2VB6A 5L3EB 3N2GE 3UULA 2PH9A 4AKGA 1BR4A 4QWNB 3I9WA 3B5MA 5FL1A 4LFAT 3ZYLA 3MK7C 2XYTA 3QB5A 4UVCB 3RH3A 2LRLA 4JI8T 2VVNA 3RPUA 3CQCB 4QX8B 2HN2A 4AI6A 2XUEA 2NTYA 3UT5E 2DWKA 3CIRA 4XAXB 2XZ5A 3C98B 1BR0A 4JI5T 5AQRB 2XPKA 4HWIB 4UR9A 2ZM2A 1XWMA 4JBWF 5AQKB 4OK0A 5LNKA 2W8FA 3H3AA 1HF8A 3J9X1 2XQYA 3UUXB 1KEYA 3TLVA 1I9BA 5AQPB 3C50A 2XYSA 4FRRA 1WYBA 3PJAJ 4PK6A 2CE7A 3U3IA 2XAFB 4QXCB 1J5WA 5AQOB 4YT0A 2D5UA 3UQ7A 2J62A 1B7TA 5JDQA 3GN5A 2VQET 2H3RA 3ONJA 4Z91A 5JRCB 4EGWA 2BKNA 4E7SA 3FZLB 3Q5WA 4BAYB 5DQWA 3RGLA 1HS7A 5HCMA 2Y48B 2DHRA 2LSKA 3FZHB 4B3MT 4HTEA 5LP6E 2LOSA 2YN6A 3I9YA 3KVAA 3WTMA 3N9PA 2X66A 4YLHA 5AQUB 3U8NA 5IYZE 4C90A 3HKDE 3LJCA 4H63V 1XDOA 2WDRA 4ZI3C 1FMVA 4DIDB 4LMJA 2NWBA 2BG9E 3K3OA 1ZEEA 2X67A 2C5KT 2BZBA 4EYYR 2W2UA 2JPFA 3KV6A 5AQNB 4JI7T 5EK2A 3U8LA 1AJ3A 1IBKT 2BR7A 4DUYT 2MAWA 4QH1A 2WAUA 3ZSTA 4QX7B 3V5UA 3OTOT 2WN9A 4F6RC 4ZHQE 1QLBA 5SYOA 4TV8E 1UURA 2XHEB 2WB5A 2CEAA 3RIUC 4H9RC 4PW8A 4DR7T 4M1PA 3MACA 5CB4E 5FNVE 3AA7B 4UXNB 1R8IA 3AEEA 3N9OA 4IDZA 5FXZA 3CX6B 4GOUA 5F8PA 5JRCA 1OEDE 4JI1T 2MPKA 2I6HA 5AQMB 4JI2T 2QYWA 3AAAB 2Y56A 2ZM0A 3FBZA 4GK5E 4HFBA 5FJVA 4DR2T 2X68A 1YD8G 4IDOA 4AKIA 2BS4A 4CXWA 5ETWA 4EZ4A 5JDMA 2LRKA 2XQ3A 3Q9DA 4PJMA 2E8IA 1N34T 2LSGA 5HXRA 3UUNA 4OX9T 2K9AA 2ZJUA 5H6RB 1IZNB 1X79A 1YKHB 3A5XA 2W4XA 2UXXB 2X00D 1ZV4X 3PJAA 2VKJA 2EHOD 4PAGA 4JYAT 3O1IA 1OEDB 3OKQA 3AE1A 5HCJA 2XASB 5KMGP 4X66T 5LJMA 3N9LA 5J5HA 1E7PA 2VL0A 4UM3A 5AFHA 2ACXA 1HG5A 2CWYA 5JR9C 1MIYA 4YSZA 2IIUA 1MIVA 2PFVA 2J1DG 4EZ1A 3EUHA 3IHRA 3L39A 5LXBA 3RKOA 5HEGA 4DV5T 5HXHA 2A9UA 1OWAA 5BRXA 4CXYA 1DU2A 2LHNA 4XZCA 3RYHE 4LFBT 3OVUA 5AQVB 1X9BA 3RIFA 2XM1A 3ZLIA 3P8CD 2XAQB 4LF6T 4LF9T 2E9XC 5JH7E 1FMWA 4U7IA 5AQGB 3SWHA 4DV3T 3AEGA 3QB5K 4DR3T 4DO0A 3CPZA 4WV9A 5FY0A 3ZT5A 2YMEA 1L0VA 1E1HB 5H6QB 4UM3S 5AFUL 2AE9A 4K0UA 4AQFA 2EHOB 4HN9A 5LMNT 2WSSV 3ZDHA 2C9TA 1HCIA 4O8SA 2V7IA 4UXUA 5DABA 2W61A 4TNWA 3E08A 3FZMB 4P0BA 3SH1A 2W66A 2Q9QC 5BR8T 3WTLA 5IHYA 5CJ5A 3P4SA 1J1JA 4B3TT 2QA7A 3B57A 4NXMT 2V7KA 1Z8UA 2CHNA 4EB6E 1D1AA 3GA8A 2PTFA 4U74A 1H7CA 2KNDA 5JDFA 1JNRA 1KF6A 4PK5A 2PG8A 3P4QA 3K3QC 2N9DA 2YINA 4X62T 2BVLA 3PV0F 4EYUA 5LG3A 5FKYA 4HFEA 3AE4A 2W00A 3WTJA 3ZCIA 4TNVA 3KV9A 3EVYA 2KSRA 3WTNA 3SFDA 4ERRA 2F4VT 4IDNA 4AFGA 4UM3P 1T72A 3OBVE 1XMQT 2X0LB 2OLTA 4H9QC 4A5XA 4TX5A 5AFLA 4CQIA 2UUAT 2QVAA 4QACA 1XNRT 2NTXA 1QSDA 2XM2A 1OXZA 4ILAA 5A1LA 2L9QA 3ZMZB 4D01A 2X00A 2ZM8A 2L8KA 1UX5A 5KDMC 5HXCA 4BQTA 3HKBE 3LDQB 5FY7A 2LJLA 2XAHB 2HHHT 4X20E 1D1CA 2JRKA 3NVOA 2BVMA 2X9XA 3ZT7A 2Y6XA 5FXWA 4I0UA 3E0ZA 4X64T 4XBFB 1S94A 3L3PA 2LSIA 3HKCE 1WYCA 3PUQA 2IC6A 5AFKA 1W0BA 4YY3T 1I94T 3LBXB 3PUXF 1ZP0A 2E2AA 2WDVA 2MYSA 3KBUA 4YHHT 1LRZA 5HEHA 3AA0B 5L4EA 1QUUA 3C84A 2CRBA 3KV4A 2A3DA 3T8OA 2XQ7A 4BJMA 4EOZB 4CI3B 2LE8A 3DTOA 3UUMA 2D2SA 2FJBA 4H63H 5JREA 4UF0B 2BYRA 4YTPA 2WNJA 3SQ9A 2FBWA 3MKDA 4NPPA 1M7KA 1XZYA 4CN1A 3FXEB 4HWHA 2Y54A 3PU3A 2WWUA 3AVSA 4FI5A 3U8KA 4ILUA 2VL8A 2HH7A 2X9YA 5HXSA 4OHFA 2CWOA 4IE5A 3CWZB 3AEBA 4AFTA 4LMLA 4WW0A 3HR0A 1J5ET 4BA9A 2MOZA 1XMOT 3L09A 3NZQA 4FJOA 3IEEA 5LGNB 1SE7A 3ZSSA 4DV6T 1N32T 2NR4A 4KX6A 2H88A 5LG4A 2DWGA 1CUNA 1Y01A 4WZXA 5LBMA 1UGOA 3UU4A 5LCYA 2PJQA 5L3CB 4ZXLA 4YHJA 4U31A 4IE4A 3UFGA 4CN4A 5AINA 3LBXA 3ANWB 5CA1E 3N9MA 2BKOA 2IDOB 5AFMB 3WTHA 5ABHA 2JQQA 5FL0A 3RRCA 2RPAA 3MJXA 2NP9A 4KUMB 5ADXL 4QXHB 5ABEA 4UY2A 2ACZA 3NKZA 5L3GB 3JAFA 5DJQC 3T1YT 1E2AA 5LHIB 5AQFB 2W67A 3UTKA 3SOLA 2E5LT 4UF0A 2I0MA 3F2EA 2M67A 4IDPA 2CLYB 1O3XA 3ZJ2A 2DL1A 3RQWA 2IC9A 3PEOA 5C2TA 4JI3T 2BS3A 4P0AA 4A56A 4DBRA 2MBGA 4H9OC 4IDQA 2BYPA 4XHEA 2SPCA 3ZMUB 3BK9A 5AQLB 1WFDA 1FJGT 2XSAA 3LG7A 3ESLA 4PK4A 4K0KT 2Q9QD 4I50E 4L5GA 4JI0T 1W0AA 3ZC1A 3LFMA 4NZBA 4DV1T 3HL6A 3RIUA 5HEUA 4QKNA 2WMNA 3L8RA 2C5IT 4HGAA 4KHZF 2WZHA 4CXXA 1UCUA 2WM9A 1MNEA 4OYJA 3NZPA 2CM0A 3O1HA 2UUBT 2YK0A 1IBLT 2W8GA 2RA1A 2N1GA 4NUUA 3ANWA 2J4GA 5AFMA 2LM9A 4ZI2C 1LVKA 3LK2B 4UM1A 2QRXA 4JI6T 5IUXA 3FXDB 4LF5T 1VCTA 4P09A 4UVBB 2WBLA 3OYZA 3HKEE 1CHUA 2XSBA 3H3MA 2UZ6A 3J7Yq 2ZM6T 4OYKA 5J5FA 4IIJE 3VR9A 4EEDA 5AQJB 3RX6A 5FXXA 3ZMTB 3WTKA 5HWYA 2PGZA 2LLYA 3ETVA 2CXDA 3CMLA 2MTQA 2M6IA 2D9DA 2Q9QB 1HFAA 2ZMAA 3U78A 3VKGA 5AQHB 4JEUB 4I43B 4AQGA 4LMKA 2VKHA 2BYNA 3Q2MA 5AFNA 1Y64B 2A72A 4TWDA 5JR9A 4WNKA 4JEHB 2ODUA 4NIQA 3PUGA 5HWXA 2BYQA 3CVRA 5JDLA 5L2LA 2WNLA 4IL4A 4QAAA 1SUMB 2BJ0A 2BBHA 3C64A 4ZEYA 1KK7A 2CMRA 5AQSB 4UEMA 4HE8A 4AIUA 5LB7B 4CN6A 5DQVA 4CZZB 4NXNT 4DR1T 2WCAA 1US7B 1UV6A 4HFDA 1U4QA 2XQ8A 3R6NA 2I59A 5J2UE 4DBQA 3RC8A 5AQQB 5KX5E 4EAHA 4X1IE 3RF1A 3TLSA 4L9IA 1XDPA 4U3CA 2KWIB 2LSYA 2VVSA 1KNZA 1T98A 3EI0A 3TLUA 3ZT6A 4B6XA 5ABGA 5JMEA 2Q9QA 1ZKEA 3GMIA 3CKDA 2HPLA 1GQEA 4ZZBA 4JV5T 1NAFA 3M65A 3AECA 2XZ6A 3ZEFB 5M4YA 4L0RA 2JMKA 2VASA 2CCQA 4WBOA 3UQ4A 3VRBA 4AFHA 2CXLA 4KHPT 3JC6C 5LMUT 1WCRA 4KBMB 4G2AA 3HA4A 4V1Av 2NW9A 3X1DA 5KZUA 5AQIB 3T1HT 2K5BB 2BG9C 3VR8A 3SRZA 3PURA 1XNQT 1UX4A 3PTRB 3VHLA 4IGUA 1V9DA 5FMNA 3C51A 3UU6A 5FVKA 3SS1A 2DNXA 2R6GF 2NOXA 2LT3A 1T8BA 3C79A 4PJNA 2Y58A 3JADA 2KWHA 3CX7B 3AE5A 4TN7B 3B13A 1IJ6A 5JTGA 1MIWA 4IE6A 3TLWA 2AXDS 2IW5B 2KT9A 3C4ZA 2H89A 5CO5A 2LSJA 3KINB 3IBPA 1OEDC 4HFVA 3P50A 3ZYMA 1MNDA 4ZI3D 1KNPA 4GIWA 3N5LA 3SFEA 1MMAA 4U2YA 5HAXA 4U33A 2KMFA 5JQGE 3PMZA 1HTJF 1YW0A 2Y57A 5LBQB 3N9NA 2UXBT 2V6YB 2BR8A 2X51A 3C4WA 3MA9A 3W15B 2ZLYA 4TV9E 3Q5EA 4PFPA 1T7SA 3ZMVB 3WTIA 2XQAA 3P4WA 3LSVA 4ANJA 3AE7A 4ZI2D 4B3ST 5LHGB 4Z8XA 3QK6A 3UUBA 3RHWA 2LHRA 4YTMA 2DLRA 1LKXA 4HFIA 2FJEA 3PUSA 3RIAA 2XY8B 2V7MA 2OV9A 5CFBA 2V26A 5FP3A 2YMDA 4QXBB 2WZIA 4X1YE 4X5TA 3ZN0B 4AXPA 2EHOC 2DI4A 2XTLA 3WAKA 5KE4A 3A7MA 4GK0E 1KFYA 3PUZF 3Q5DA 1G73A 3P4PA 5LOVE 3U8MA 4ZOLE 1HR0T 4AKRB 2D0TA 4A98A 5C8YE 5J5IA 2XQ6A 2UU9T 2YDQA 4G63A 1HG2A 2BBJA 4HWFA 1D0ZA 5JVDE 5AQTB 4DUZT 2JQKA 4DV4T 3RLFF 5LJNA 5GONE 4QHOA 3ZJ1A 3I0OA 5KXJA 2V5CA 3PUYF 3UU5A 4IE0A 1I6ZA 1BR1A 2J47A 4TUYE 3BQLA 1G8XA 4B3RT 2V6YA 2ODVA 4DV7T 3QC9A 2LOPA 2WMOA 3QNUA 2XNVA 1D0YA 4E7ZA 3IF8B 2V1DB 3ZN1B 2FJDA 4DR5T 4HFCA 1YXRA 2JJ9A 4QH4A 2BYSA 3EDUA 3ETUA 4ZRUA 1UK5A 3M3ZB 4ISTA 2IMLA 2OA5A 1M62A 4ALXA 4EIWA 4QABA 3ZPOA 2BDEA 2UXCT 4EV6A 2K3WA 4OFZA 2G0UA 2P9BA 2ZJVA 2K48A 2E9XD 3N2KE 3NWIA 2W62A 2YOEA 3E22E 2V7LA 3K3NA 3PUWF 1JNZA 5JDNA 3AEFA 4KP3C 4DV2T 2D0UA 1N33T 3T4MA 3ONLC 5ABFB 3FBLA 1FEWA 2CBIA
chains in the Genus database with same CATH topology
4NZBA 4IREA 3UU4A 4COFA 2WN9A 5BP0A 2XQ4A 4ILCA 5J5HA 3PMZA 3UQ4A 2VL0A 2YKSA 5HEUA 2BYQA 2BG9B 4UM3A 5AFHA 3IGQA 2Y57A 4AFHA 5SYOA 2XQ5A 3UU5A 3UQ7A 2BR8A 2WNLA 5AFKA 4IL4A 2BG9A 4QAAA 3EHZA 4HQPA 2BJ0A 5AINA 5BW2A 4EZ1A 4ILBA 3GUAA 2LM2A 4XK9A 5LXBA 5HEHA 4IL9A 2XQ9A 5HEGA 2W8GA 5L4EA 5KZUA 5AFMB 4Z91A 1UX2A 5BRXA 2BG9C 5J5GA 3WTHA 2XNVA 3C84A 5LG3A 4QH5A 5AFMA 4HFEA 3WTIA 2XQAA 3P4WA 3LSVA 1UV6A 5HEOA 1OEDE 3ZDGA 2XQ7A 4HFDA 3WTJA 5HEJA 4Z90A 4UM1A 4TNVA 3RIFA 5IUXA 2PH9A 3SIOA 3UUBA 2WZYA 4UY2A 5HCMA 2XQ8A 4HFCA 3RHWA 2Y56A 2KSRA 3JAFA 3UU6A 4TWHA 4HFBA 2WNCA 5FJVA 3WTNA 2BYRA 2WNJA 3SQ9A 4QH4A 4NPPA 2BYSA 2XYTA 4ZRUA 4PIRA 2YN6A 4HFIA 2UZ6A 3RIAA 2Y54A 3WTMA 4A97A 4AFGA 4UM3P 5J5FA 4ZJSA 4TWFA 3C79A 3RI5A 5CFBA 2Y58A 3JADA 2YMDA 5L4HA 3U8NA 4ZR6A 3U8KA 4WV9A 4ALXA 2YMEA 4QABA 2LKGA 4B5DA 5AFLA 3WIPA 4X5TA 3TLSA 3WTKA 4QACA 2Y7YA 4ZZCA 4DBMA 2PGZA 4ZK1A 3WTLA 5TVCA 4F8HA 5J0ZA 5KE4A 2LKHA 3RQWA 3JAEA 4ZK4A 4UM3S 2LLYA 4HFHA 3PEOA 2XQ3A 4AFTA 2M6BA 5L47A 3TLWA 4ILAA 2XNTA 2XZ5A 4LMJA 2ZJVA 5AFJA 1OEDA 2BG9E 4LMLA 4D01A 2X00A 2M6IA 2YOEA 2XNUA 3ZKRA 3U8MA 5CO5A 3UU8A 3ZDHA 3EI0A 3TLUA 3SQ6A 4BQTA 1UW6A 2C9TA 5JMEA 4ZJTA 2BYPA 2ZJUA 2QC1B 4A98A 4LMKA 3TLTA 4XHEA 4UXUA 3U8JA 2XQ6A 1OEDC 5J5IA 2W8FA 3U8LA 2X00D 3UU3A 2BYNA 4TNWA 3RQUA 2BR7A 4ZZBA 4BFQA 3EAMA 3SH1A 3T4MA 3TLVA 2MAWA 3P50A 1OEDB 4QH1A 1I9BA 5AFNA 4TWDA 2XZ6A 5HCJA 2XYSA 3WTOA 4FRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NZB A;  4IRE A;  3UU4 A;  4COF A;  2WN9 A;  5BP0 A;  2XQ4 A;  4ILC A;  5J5H A;  3PMZ A;  3UQ4 A;  2VL0 A;  2YKS A;  5HEU A;  2BYQ A;  2BG9 B;  4UM3 A;  5AFH A;  3IGQ A;  2Y57 A;  4AFH A;  5SYO A;  2XQ5 A;  3UU5 A;  3UQ7 A;  2BR8 A;  2WNL A;  5AFK A;  4IL4 A;  2BG9 A;  4QAA A;  3EHZ A;  4HQP A;  2BJ0 A;  5AIN A;  5BW2 A;  4EZ1 A;  4ILB A;  3GUA A;  2LM2 A;  4XK9 A;  5LXB A;  5HEH A;  4IL9 A;  2XQ9 A;  5HEG A;  2W8G A;  5L4E A;  5KZU A;  5AFM B;  4Z91 A;  1UX2 A;  5BRX A;  2BG9 C;  5J5G A;  3WTH A;  2XNV A;  3C84 A;  5LG3 A;  4QH5 A;  5AFM A;  4HFE A;  3WTI A;  2XQA A;  3P4W A;  3LSV A;  1UV6 A;  5HEO A;  1OED E;  3ZDG A;  2XQ7 A;  4HFD A;  3WTJ A;  5HEJ A;  4Z90 A;  4UM1 A;  4TNV A;  3RIF A;  5IUX A;  2PH9 A;  3SIO A;  3UUB A;  2WZY A;  4UY2 A;  5HCM A;  2XQ8 A;  4HFC A;  3RHW A;  2Y56 A;  2KSR A;  3JAF A;  3UU6 A;  4TWH A;  4HFB A;  2WNC A;  5FJV A;  3WTN A;  2BYR A;  2WNJ A;  3SQ9 A;  4QH4 A;  4NPP A;  2BYS A;  2XYT A;  4ZRU A;  4PIR A;  2YN6 A;  4HFI A;  2UZ6 A;  3RIA A;  2Y54 A;  3WTM A;  4A97 A;  4AFG A;  4UM3 P;  5J5F A;  4ZJS A;  4TWF A;  3C79 A;  3RI5 A;  5CFB A;  2Y58 A;  3JAD A;  2YMD A;  5L4H A;  3U8N A;  4ZR6 A;  3U8K A;  4WV9 A;  4ALX A;  2YME A;  4QAB A;  2LKG A;  4B5D A;  5AFL A;  3WIP A;  4X5T A;  3TLS A;  3WTK A;  4QAC A;  2Y7Y A;  4ZZC A;  4DBM A;  2PGZ A;  4ZK1 A;  3WTL A;  5TVC A;  4F8H A;  5J0Z A;  5KE4 A;  2LKH A;  3RQW A;  3JAE A;  4ZK4 A;  4UM3 S;  2LLY A;  4HFH A;  3PEO A;  2XQ3 A;  4AFT A;  2M6B A;  5L47 A;  3TLW A;  4ILA A;  2XNT A;  2XZ5 A;  4LMJ A;  2ZJV A;  5AFJ A;  1OED A;  2BG9 E;  4LML A;  4D01 A;  2X00 A;  2M6I A;  2YOE A;  2XNU A;  3ZKR A;  3U8M A;  5CO5 A;  3UU8 A;  3ZDH A;  3EI0 A;  3TLU A;  3SQ6 A;  4BQT A;  1UW6 A;  2C9T A;  5JME A;  4ZJT A;  2BYP A;  2ZJU A;  2QC1 B;  4A98 A;  4LMK A;  3TLT A;  4XHE A;  4UXU A;  3U8J A;  2XQ6 A;  1OED C;  5J5I A;  2W8F A;  3U8L A;  2X00 D;  3UU3 A;  2BYN A;  4TNW A;  3RQU A;  2BR7 A;  4ZZB A;  4BFQ A;  3EAM A;  3SH1 A;  3T4M A;  3TLV A;  2MAW A;  3P50 A;  1OED B;  4QH1 A;  1I9B A;  5AFN A;  4TWD A;  2XZ6 A;  5HCJ A;  2XYS A;  3WTO A;  4FRR A; 
#chains in the Genus database with same CATH topology
 5L3D B;  3PUV F;  4NUV A;  3QUJ A;  4ILC A;  3IGQ A;  4MBQ A;  5E0O A;  4UVA B;  2CBJ A;  3JC6 D;  3PU8 A;  3AAI A;  5JR9 B;  4U72 A;  5JDH A;  4O4L E;  1IAP A;  5CA0 E;  2L3L A;  2NW7 A;  4QH5 A;  2JQH A;  3AVR A;  3F31 A;  5HEO A;  3ZDG A;  4Q25 A;  4EZH A;  2YU1 A;  5FVL A;  3RYF E;  2JMH A;  1EZ3 A;  4HWD A;  4PJJ A;  4JUY A;  4PIR A;  4YJ3 E;  2E9X B;  2V5D A;  2WU2 A;  3PE0 A;  4N78 D;  4ZR6 A;  3S4U A;  4DND A;  2Y7Y A;  4ZZC A;  2KZ7 B;  5JDG A;  3KV5 A;  5TVC A;  4F8H A;  5J0Z A;  3AXJ B;  4O4J E;  1N36 T;  3NRY A;  2FJA A;  4AQY T;  5IWA T;  4LFC T;  3SQ6 A;  3FHN A;  1UW6 A;  4MFR A;  4I55 E;  1SA0 E;  3AE8 A;  3H37 A;  4GKJ T;  1D0X A;  3ZC0 A;  3EAM A;  1HNW T;  2W0G A;  2WU5 A;  3P7I A;  3WTO A;  4YSX A;  3HI2 A;  4GYR A;  5LXT E;  3C4X A;  5ABF A;  4COF A;  5FYM A;  4LF8 T;  2Y8D A;  1HNZ T;  2BG9 B;  1W9R A;  3CK6 A;  5L3F B;  2WS3 A;  5L3B B;  1VOM A;  4MLK A;  3DJB A;  2XQ5 A;  3AAE B;  2KXP B;  5EK4 A;  2YDS A;  3CX8 B;  2NW8 A;  3GUA A;  1NWM X;  2LM2 A;  2FUP A;  2KIN B;  3NRX A;  3O1J A;  3I1A A;  3OJA A;  1KNR A;  4JI4 T;  3DP7 A;  4DMV A;  1FIO A;  3AE2 A;  3KVB A;  5HEJ A;  5F5W A;  1WR0 A;  3SIO A;  2WZY A;  3WI3 A;  4IT4 A;  3VU7 H;  4TWH A;  5BMV E;  2ES0 A;  2WWV A;  3VKH A;  5CGM A;  2V7J A;  3BQK A;  4IHJ E;  3JCF A;  4WBN E;  4H9S E;  4MAL A;  3V5S A;  3MXZ A;  4YFS A;  2CLY C;  5L4H A;  3RRW A;  2E9X A;  4PJL A;  4B5D A;  2LKG A;  2B1E A;  4HKA A;  3WIP A;  5HYA A;  4JLE A;  3LK3 B;  4DBM A;  3CQX C;  4ZK1 A;  3AB3 B;  3O4X E;  4ZK4 A;  5J2T E;  3GWH A;  2LEH A;  3ABV A;  4PFO A;  5L47 A;  2XNT A;  2Z6E A;  4U2Z A;  3P4R A;  3AXJ A;  2IHR 1;  3FB2 A;  4H9N C;  4UV8 B;  5J1G A;  1MMN A;  4J2C A;  3I0Q A;  1MMD A;  4HWC A;  4AKL A;  2H7V C;  2IUB A;  4O2A E;  2BKP A;  2V6X A;  4KMC A;  2WY2 A;  2YU2 A;  3FZF B;  5LYJ E;  3D0T A;  2IAK A;  3ZYK A;  2HN1 A;  1W09 A;  3EDV A;  2H7O A;  4GKK T;  3RYC E;  3KFW X;  3QOF A;  3AE6 A;  2VUR A;  3PDY A;  1LVF A;  4H9P C;  2VWA A;  2CPT A;  1WRD A;  2VKO A;  1MMG A;  2BG9 A;  4P1N A;  5BW2 A;  1U5P A;  4ILB A;  4PNI A;  4XK9 A;  1YKE B;  5LGT B;  1VCS A;  2B76 A;  4GYS A;  3PUA A;  4CI1 B;  1YQ4 A;  1VRB A;  2X0H A;  2CHO A;  2YEV C;  1NEN A;  2X9W A;  3N2O A;  2UUC T;  3K1S A;  4O4I E;  4A97 A;  4ZJS A;  4TWF A;  1WLX A;  3RI5 A;  4LF7 T;  3N9Q A;  4EXT A;  3IA3 A;  2WQY A;  2X9H A;  2LKH A;  3JAE A;  2YDR A;  4DR6 T;  5LA6 E;  1OED A;  1ZOY A;  3F57 A;  5LHH B;  2XNU A;  3VRA A;  1HX8 A;  3UU8 A;  3G06 A;  1BR2 A;  4AQF C;  2QC1 B;  3TLT A;  3U8J A;  5HXE A;  2XAJ B;  2X0Y A;  3RQU A;  3RYI E;  1UUS A;  4YJ2 E;  3R84 B;  4UV9 B;  4O2B E;  4TZ4 C;  2JQ9 A;  4IRE A;  2XQ4 A;  2XZE A;  4DVD A;  2XJ7 A;  2WP9 A;  2YKS A;  4AIS A;  3CQG B;  2E5V A;  3A8Y C;  1YQ3 A;  4YXD A;  3EHZ A;  4HQP A;  4UIG A;  5LGU B;  2VK9 A;  4IL9 A;  3OYX A;  3EAB A;  3RKG A;  3NBX X;  1UX2 A;  3AEA A;  5J5G A;  4MHC A;  3ONX A;  2RP4 A;  2V8S V;  3UFE A;  4BJN A;  1HNX T;  3AE3 A;  4ISS A;  4Z90 A;  2CXF A;  1S35 A;  1D1B A;  4EEB A;  2QGS A;  2JIW A;  2N2N A;  3TKL B;  2DCF A;  3RC3 A;  4ZS2 A;  2WNC A;  3WAJ A;  1Z0P A;  4WYV A;  1NEK A;  1IJ5 A;  1ZHC A;  1WR6 A;  2EHO A;  4X65 T;  3OPC A;  2A2F X;  3AA1 B;  3ZMS B;  4I4T E;  2PBI A;  4ASK A;  2CA5 A;  2UXD T;  4DMW A;  4LF4 T;  2VKD A;  2C0S A;  3AE9 A;  4HFH A;  2GK9 A;  2M6B A;  1HX1 B;  5AFJ A;  3AED A;  2UXN B;  3ZKR A;  3MZK B;  4YTN A;  3AA6 B;  3K8P C;  4ZJT A;  4ZS3 A;  5EZY E;  2KLQ A;  3BQI A;  3UU3 A;  3LK4 2;  4DV0 T;  4ADZ A;  4ZI7 E;  5F3J A;  4BFQ A;  4AKH A;  4CI2 B;  5TAO A;  4X1K E;  4U7Y A;  2WDQ A;  5EK3 A;  5BP0 A;  3FZK B;  2VQF T;  3KDS E;  3KBT A;  4C91 A;  4O4H E;  4KI0 F;  3GN5 B;  1IBM T;  2BS2 A;  3O9X A;  4HEA A;  3Q5X A;  3ZCJ A;  2XAG B;  4UEL A;  4YSY A;  4DR4 T;  2XQ9 A;  5FXV A;  2K24 A;  2W63 A;  2C5J A;  4IE7 A;  1SHZ C;  5FY1 A;  5C3J A;  2HPJ A;  2VB6 A;  5L3E B;  3N2G E;  3UUL A;  2PH9 A;  4AKG A;  1BR4 A;  4QWN B;  3I9W A;  3B5M A;  5FL1 A;  4LFA T;  3ZYL A;  3MK7 C;  2XYT A;  3QB5 A;  4UVC B;  3RH3 A;  2LRL A;  4JI8 T;  2VVN A;  3RPU A;  3CQC B;  4QX8 B;  2HN2 A;  4AI6 A;  2XUE A;  2NTY A;  3UT5 E;  2DWK A;  3CIR A;  4XAX B;  2XZ5 A;  3C98 B;  1BR0 A;  4JI5 T;  5AQR B;  2XPK A;  4HWI B;  4UR9 A;  2ZM2 A;  1XWM A;  4JBW F;  5AQK B;  4OK0 A;  5LNK A;  2W8F A;  3H3A A;  1HF8 A;  3J9X 1;  2XQY A;  3UUX B;  1KEY A;  3TLV A;  1I9B A;  5AQP B;  3C50 A;  2XYS A;  4FRR A;  1WYB A;  3PJA J;  4PK6 A;  2CE7 A;  3U3I A;  2XAF B;  4QXC B;  1J5W A;  5AQO B;  4YT0 A;  2D5U A;  3UQ7 A;  2J62 A;  1B7T A;  5JDQ A;  3GN5 A;  2VQE T;  2H3R A;  3ONJ A;  4Z91 A;  5JRC B;  4EGW A;  2BKN A;  4E7S A;  3FZL B;  3Q5W A;  4BAY B;  5DQW A;  3RGL A;  1HS7 A;  5HCM A;  2Y48 B;  2DHR A;  2LSK A;  3FZH B;  4B3M T;  4HTE A;  5LP6 E;  2LOS A;  2YN6 A;  3I9Y A;  3KVA A;  3WTM A;  3N9P A;  2X66 A;  4YLH A;  5AQU B;  3U8N A;  5IYZ E;  4C90 A;  3HKD E;  3LJC A;  4H63 V;  1XDO A;  2WDR A;  4ZI3 C;  1FMV A;  4DID B;  4LMJ A;  2NWB A;  2BG9 E;  3K3O A;  1ZEE A;  2X67 A;  2C5K T;  2BZB A;  4EYY R;  2W2U A;  2JPF A;  3KV6 A;  5AQN B;  4JI7 T;  5EK2 A;  3U8L A;  1AJ3 A;  1IBK T;  2BR7 A;  4DUY T;  2MAW A;  4QH1 A;  2WAU A;  3ZST A;  4QX7 B;  3V5U A;  3OTO T;  2WN9 A;  4F6R C;  4ZHQ E;  1QLB A;  5SYO A;  4TV8 E;  1UUR A;  2XHE B;  2WB5 A;  2CEA A;  3RIU C;  4H9R C;  4PW8 A;  4DR7 T;  4M1P A;  3MAC A;  5CB4 E;  5FNV E;  3AA7 B;  4UXN B;  1R8I A;  3AEE A;  3N9O A;  4IDZ A;  5FXZ A;  3CX6 B;  4GOU A;  5F8P A;  5JRC A;  1OED E;  4JI1 T;  2MPK A;  2I6H A;  5AQM B;  4JI2 T;  2QYW A;  3AAA B;  2Y56 A;  2ZM0 A;  3FBZ A;  4GK5 E;  4HFB A;  5FJV A;  4DR2 T;  2X68 A;  1YD8 G;  4IDO A;  4AKI A;  2BS4 A;  4CXW A;  5ETW A;  4EZ4 A;  5JDM A;  2LRK A;  2XQ3 A;  3Q9D A;  4PJM A;  2E8I A;  1N34 T;  2LSG A;  5HXR A;  3UUN A;  4OX9 T;  2K9A A;  2ZJU A;  5H6R B;  1IZN B;  1X79 A;  1YKH B;  3A5X A;  2W4X A;  2UXX B;  2X00 D;  1ZV4 X;  3PJA A;  2VKJ A;  2EHO D;  4PAG A;  4JYA T;  3O1I A;  1OED B;  3OKQ A;  3AE1 A;  5HCJ A;  2XAS B;  5KMG P;  4X66 T;  5LJM A;  3N9L A;  5J5H A;  1E7P A;  2VL0 A;  4UM3 A;  5AFH A;  2ACX A;  1HG5 A;  2CWY A;  5JR9 C;  1MIY A;  4YSZ A;  2IIU A;  1MIV A;  2PFV A;  2J1D G;  4EZ1 A;  3EUH A;  3IHR A;  3L39 A;  5LXB A;  3RKO A;  5HEG A;  4DV5 T;  5HXH A;  2A9U A;  1OWA A;  5BRX A;  4CXY A;  1DU2 A;  2LHN A;  4XZC A;  3RYH E;  4LFB T;  3OVU A;  5AQV B;  1X9B A;  3RIF A;  2XM1 A;  3ZLI A;  3P8C D;  2XAQ B;  4LF6 T;  4LF9 T;  2E9X C;  5JH7 E;  1FMW A;  4U7I A;  5AQG B;  3SWH A;  4DV3 T;  3AEG A;  3QB5 K;  4DR3 T;  4DO0 A;  3CPZ A;  4WV9 A;  5FY0 A;  3ZT5 A;  2YME A;  1L0V A;  1E1H B;  5H6Q B;  4UM3 S;  5AFU L;  2AE9 A;  4K0U A;  4AQF A;  2EHO B;  4HN9 A;  5LMN T;  2WSS V;  3ZDH A;  2C9T A;  1HCI A;  4O8S A;  2V7I A;  4UXU A;  5DAB A;  2W61 A;  4TNW A;  3E08 A;  3FZM B;  4P0B A;  3SH1 A;  2W66 A;  2Q9Q C;  5BR8 T;  3WTL A;  5IHY A;  5CJ5 A;  3P4S A;  1J1J A;  4B3T T;  2QA7 A;  3B57 A;  4NXM T;  2V7K A;  1Z8U A;  2CHN A;  4EB6 E;  1D1A A;  3GA8 A;  2PTF A;  4U74 A;  1H7C A;  2KND A;  5JDF A;  1JNR A;  1KF6 A;  4PK5 A;  2PG8 A;  3P4Q A;  3K3Q C;  2N9D A;  2YIN A;  4X62 T;  2BVL A;  3PV0 F;  4EYU A;  5LG3 A;  5FKY A;  4HFE A;  3AE4 A;  2W00 A;  3WTJ A;  3ZCI A;  4TNV A;  3KV9 A;  3EVY A;  2KSR A;  3WTN A;  3SFD A;  4ERR A;  2F4V T;  4IDN A;  4AFG A;  4UM3 P;  1T72 A;  3OBV E;  1XMQ T;  2X0L B;  2OLT A;  4H9Q C;  4A5X A;  4TX5 A;  5AFL A;  4CQI A;  2UUA T;  2QVA A;  4QAC A;  1XNR T;  2NTX A;  1QSD A;  2XM2 A;  1OXZ A;  4ILA A;  5A1L A;  2L9Q A;  3ZMZ B;  4D01 A;  2X00 A;  2ZM8 A;  2L8K A;  1UX5 A;  5KDM C;  5HXC A;  4BQT A;  3HKB E;  3LDQ B;  5FY7 A;  2LJL A;  2XAH B;  2HHH T;  4X20 E;  1D1C A;  2JRK A;  3NVO A;  2BVM A;  2X9X A;  3ZT7 A;  2Y6X A;  5FXW A;  4I0U A;  3E0Z A;  4X64 T;  4XBF B;  1S94 A;  3L3P A;  2LSI A;  3HKC E;  1WYC A;  3PUQ A;  2IC6 A;  5AFK A;  1W0B A;  4YY3 T;  1I94 T;  3LBX B;  3PUX F;  1ZP0 A;  2E2A A;  2WDV A;  2MYS A;  3KBU A;  4YHH T;  1LRZ A;  5HEH A;  3AA0 B;  5L4E A;  1QUU A;  3C84 A;  2CRB A;  3KV4 A;  2A3D A;  3T8O A;  2XQ7 A;  4BJM A;  4EOZ B;  4CI3 B;  2LE8 A;  3DTO A;  3UUM A;  2D2S A;  2FJB A;  4H63 H;  5JRE A;  4UF0 B;  2BYR A;  4YTP A;  2WNJ A;  3SQ9 A;  2FBW A;  3MKD A;  4NPP A;  1M7K A;  1XZY A;  4CN1 A;  3FXE B;  4HWH A;  2Y54 A;  3PU3 A;  2WWU A;  3AVS A;  4FI5 A;  3U8K A;  4ILU A;  2VL8 A;  2HH7 A;  2X9Y A;  5HXS A;  4OHF A;  2CWO A;  4IE5 A;  3CWZ B;  3AEB A;  4AFT A;  4LML A;  4WW0 A;  3HR0 A;  1J5E T;  4BA9 A;  2MOZ A;  1XMO T;  3L09 A;  3NZQ A;  4FJO A;  3IEE A;  5LGN B;  1SE7 A;  3ZSS A;  4DV6 T;  1N32 T;  2NR4 A;  4KX6 A;  2H88 A;  5LG4 A;  2DWG A;  1CUN A;  1Y01 A;  4WZX A;  5LBM A;  1UGO A;  3UU4 A;  5LCY A;  2PJQ A;  5L3C B;  4ZXL A;  4YHJ A;  4U31 A;  4IE4 A;  3UFG A;  4CN4 A;  5AIN A;  3LBX A;  3ANW B;  5CA1 E;  3N9M A;  2BKO A;  2IDO B;  5AFM B;  3WTH A;  5ABH A;  2JQQ A;  5FL0 A;  3RRC A;  2RPA A;  3MJX A;  2NP9 A;  4KUM B;  5ADX L;  4QXH B;  5ABE A;  4UY2 A;  2ACZ A;  3NKZ A;  5L3G B;  3JAF A;  5DJQ C;  3T1Y T;  1E2A A;  5LHI B;  5AQF B;  2W67 A;  3UTK A;  3SOL A;  2E5L T;  4UF0 A;  2I0M A;  3F2E A;  2M67 A;  4IDP A;  2CLY B;  1O3X A;  3ZJ2 A;  2DL1 A;  3RQW A;  2IC9 A;  3PEO A;  5C2T A;  4JI3 T;  2BS3 A;  4P0A A;  4A56 A;  4DBR A;  2MBG A;  4H9O C;  4IDQ A;  2BYP A;  4XHE A;  2SPC A;  3ZMU B;  3BK9 A;  5AQL B;  1WFD A;  1FJG T;  2XSA A;  3LG7 A;  3ESL A;  4PK4 A;  4K0K T;  2Q9Q D;  4I50 E;  4L5G A;  4JI0 T;  1W0A A;  3ZC1 A;  3LFM A;  4NZB A;  4DV1 T;  3HL6 A;  3RIU A;  5HEU A;  4QKN A;  2WMN A;  3L8R A;  2C5I T;  4HGA A;  4KHZ F;  2WZH A;  4CXX A;  1UCU A;  2WM9 A;  1MNE A;  4OYJ A;  3NZP A;  2CM0 A;  3O1H A;  2UUB T;  2YK0 A;  1IBL T;  2W8G A;  2RA1 A;  2N1G A;  4NUU A;  3ANW A;  2J4G A;  5AFM A;  2LM9 A;  4ZI2 C;  1LVK A;  3LK2 B;  4UM1 A;  2QRX A;  4JI6 T;  5IUX A;  3FXD B;  4LF5 T;  1VCT A;  4P09 A;  4UVB B;  2WBL A;  3OYZ A;  3HKE E;  1CHU A;  2XSB A;  3H3M A;  2UZ6 A;  3J7Y q;  2ZM6 T;  4OYK A;  5J5F A;  4IIJ E;  3VR9 A;  4EED A;  5AQJ B;  3RX6 A;  5FXX A;  3ZMT B;  3WTK A;  5HWY A;  2PGZ A;  2LLY A;  3ETV A;  2CXD A;  3CML A;  2MTQ A;  2M6I A;  2D9D A;  2Q9Q B;  1HFA A;  2ZMA A;  3U78 A;  3VKG A;  5AQH B;  4JEU B;  4I43 B;  4AQG A;  4LMK A;  2VKH A;  2BYN A;  3Q2M A;  5AFN A;  1Y64 B;  2A72 A;  4TWD A;  5JR9 A;  4WNK A;  4JEH B;  2ODU A;  4NIQ A;  3PUG A;  5HWX A;  2BYQ A;  3CVR A;  5JDL A;  5L2L A;  2WNL A;  4IL4 A;  4QAA A;  1SUM B;  2BJ0 A;  2BBH A;  3C64 A;  4ZEY A;  1KK7 A;  2CMR A;  5AQS B;  4UEM A;  4HE8 A;  4AIU A;  5LB7 B;  4CN6 A;  5DQV A;  4CZZ B;  4NXN T;  4DR1 T;  2WCA A;  1US7 B;  1UV6 A;  4HFD A;  1U4Q A;  2XQ8 A;  3R6N A;  2I59 A;  5J2U E;  4DBQ A;  3RC8 A;  5AQQ B;  5KX5 E;  4EAH A;  4X1I E;  3RF1 A;  3TLS A;  4L9I A;  1XDP A;  4U3C A;  2KWI B;  2LSY A;  2VVS A;  1KNZ A;  1T98 A;  3EI0 A;  3TLU A;  3ZT6 A;  4B6X A;  5ABG A;  5JME A;  2Q9Q A;  1ZKE A;  3GMI A;  3CKD A;  2HPL A;  1GQE A;  4ZZB A;  4JV5 T;  1NAF A;  3M65 A;  3AEC A;  2XZ6 A;  3ZEF B;  5M4Y A;  4L0R A;  2JMK A;  2VAS A;  2CCQ A;  4WBO A;  3UQ4 A;  3VRB A;  4AFH A;  2CXL A;  4KHP T;  3JC6 C;  5LMU T;  1WCR A;  4KBM B;  4G2A A;  3HA4 A;  4V1A v;  2NW9 A;  3X1D A;  5KZU A;  5AQI B;  3T1H T;  2K5B B;  2BG9 C;  3VR8 A;  3SRZ A;  3PUR A;  1XNQ T;  1UX4 A;  3PTR B;  3VHL A;  4IGU A;  1V9D A;  5FMN A;  3C51 A;  3UU6 A;  5FVK A;  3SS1 A;  2DNX A;  2R6G F;  2NOX A;  2LT3 A;  1T8B A;  3C79 A;  4PJN A;  2Y58 A;  3JAD A;  2KWH A;  3CX7 B;  3AE5 A;  4TN7 B;  3B13 A;  1IJ6 A;  5JTG A;  1MIW A;  4IE6 A;  3TLW A;  2AXD S;  2IW5 B;  2KT9 A;  3C4Z A;  2H89 A;  5CO5 A;  2LSJ A;  3KIN B;  3IBP A;  1OED C;  4HFV A;  3P50 A;  3ZYM A;  1MND A;  4ZI3 D;  1KNP A;  4GIW A;  3N5L A;  3SFE A;  1MMA A;  4U2Y A;  5HAX A;  4U33 A;  2KMF A;  5JQG E;  3PMZ A;  1HTJ F;  1YW0 A;  2Y57 A;  5LBQ B;  3N9N A;  2UXB T;  2V6Y B;  2BR8 A;  2X51 A;  3C4W A;  3MA9 A;  3W15 B;  2ZLY A;  4TV9 E;  3Q5E A;  4PFP A;  1T7S A;  3ZMV B;  3WTI A;  2XQA A;  3P4W A;  3LSV A;  4ANJ A;  3AE7 A;  4ZI2 D;  4B3S T;  5LHG B;  4Z8X A;  3QK6 A;  3UUB A;  3RHW A;  2LHR A;  4YTM A;  2DLR A;  1LKX A;  4HFI A;  2FJE A;  3PUS A;  3RIA A;  2XY8 B;  2V7M A;  2OV9 A;  5CFB A;  2V26 A;  5FP3 A;  2YMD A;  4QXB B;  2WZI A;  4X1Y E;  4X5T A;  3ZN0 B;  4AXP A;  2EHO C;  2DI4 A;  2XTL A;  3WAK A;  5KE4 A;  3A7M A;  4GK0 E;  1KFY A;  3PUZ F;  3Q5D A;  1G73 A;  3P4P A;  5LOV E;  3U8M A;  4ZOL E;  1HR0 T;  4AKR B;  2D0T A;  4A98 A;  5C8Y E;  5J5I A;  2XQ6 A;  2UU9 T;  2YDQ A;  4G63 A;  1HG2 A;  2BBJ A;  4HWF A;  1D0Z A;  5JVD E;  5AQT B;  4DUZ T;  2JQK A;  4DV4 T;  3RLF F;  5LJN A;  5GON E;  4QHO A;  3ZJ1 A;  3I0O A;  5KXJ A;  2V5C A;  3PUY F;  3UU5 A;  4IE0 A;  1I6Z A;  1BR1 A;  2J47 A;  4TUY E;  3BQL A;  1G8X A;  4B3R T;  2V6Y A;  2ODV A;  4DV7 T;  3QC9 A;  2LOP A;  2WMO A;  3QNU A;  2XNV A;  1D0Y A;  4E7Z A;  3IF8 B;  2V1D B;  3ZN1 B;  2FJD A;  4DR5 T;  4HFC A;  1YXR A;  2JJ9 A;  4QH4 A;  2BYS A;  3EDU A;  3ETU A;  4ZRU A;  1UK5 A;  3M3Z B;  4IST A;  2IML A;  2OA5 A;  1M62 A;  4ALX A;  4EIW A;  4QAB A;  3ZPO A;  2BDE A;  2UXC T;  4EV6 A;  2K3W A;  4OFZ A;  2G0U A;  2P9B A;  2ZJV A;  2K48 A;  2E9X D;  3N2K E;  3NWI A;  2W62 A;  2YOE A;  3E22 E;  2V7L A;  3K3N A;  3PUW F;  1JNZ A;  5JDN A;  3AEF A;  4KP3 C;  4DV2 T;  2D0U A;  1N33 T;  3T4M A;  3ONL C;  5ABF B;  3FBL A;  1FEW A;  2CBI A; 
#chains in the Genus database with same CATH homology
 4NZB A;  4IRE A;  3UU4 A;  4COF A;  2WN9 A;  5BP0 A;  2XQ4 A;  4ILC A;  5J5H A;  3PMZ A;  3UQ4 A;  2VL0 A;  2YKS A;  5HEU A;  2BYQ A;  2BG9 B;  4UM3 A;  5AFH A;  3IGQ A;  2Y57 A;  4AFH A;  5SYO A;  2XQ5 A;  3UU5 A;  3UQ7 A;  2BR8 A;  2WNL A;  5AFK A;  4IL4 A;  2BG9 A;  4QAA A;  3EHZ A;  4HQP A;  2BJ0 A;  5AIN A;  5BW2 A;  4EZ1 A;  4ILB A;  3GUA A;  2LM2 A;  4XK9 A;  5LXB A;  5HEH A;  4IL9 A;  2XQ9 A;  5HEG A;  2W8G A;  5L4E A;  5KZU A;  5AFM B;  4Z91 A;  1UX2 A;  5BRX A;  2BG9 C;  5J5G A;  3WTH A;  2XNV A;  3C84 A;  5LG3 A;  4QH5 A;  5AFM A;  4HFE A;  3WTI A;  2XQA A;  3P4W A;  3LSV A;  1UV6 A;  5HEO A;  1OED E;  3ZDG A;  2XQ7 A;  4HFD A;  3WTJ A;  5HEJ A;  4Z90 A;  4UM1 A;  4TNV A;  3RIF A;  5IUX A;  2PH9 A;  3SIO A;  3UUB A;  2WZY A;  4UY2 A;  5HCM A;  2XQ8 A;  4HFC A;  3RHW A;  2Y56 A;  2KSR A;  3JAF A;  3UU6 A;  4TWH A;  4HFB A;  2WNC A;  5FJV A;  3WTN A;  2BYR A;  2WNJ A;  3SQ9 A;  4QH4 A;  4NPP A;  2BYS A;  2XYT A;  4ZRU A;  4PIR A;  2YN6 A;  4HFI A;  2UZ6 A;  3RIA A;  2Y54 A;  3WTM A;  4A97 A;  4AFG A;  4UM3 P;  5J5F A;  4ZJS A;  4TWF A;  3C79 A;  3RI5 A;  5CFB A;  2Y58 A;  3JAD A;  2YMD A;  5L4H A;  3U8N A;  4ZR6 A;  3U8K A;  4WV9 A;  4ALX A;  2YME A;  4QAB A;  2LKG A;  4B5D A;  5AFL A;  3WIP A;  4X5T A;  3TLS A;  3WTK A;  4QAC A;  2Y7Y A;  4ZZC A;  4DBM A;  2PGZ A;  4ZK1 A;  3WTL A;  5TVC A;  4F8H A;  5J0Z A;  5KE4 A;  2LKH A;  3RQW A;  3JAE A;  4ZK4 A;  4UM3 S;  2LLY A;  4HFH A;  3PEO A;  2XQ3 A;  4AFT A;  2M6B A;  5L47 A;  3TLW A;  4ILA A;  2XNT A;  2XZ5 A;  4LMJ A;  2ZJV A;  5AFJ A;  1OED A;  2BG9 E;  4LML A;  4D01 A;  2X00 A;  2M6I A;  2YOE A;  2XNU A;  3ZKR A;  3U8M A;  5CO5 A;  3UU8 A;  3ZDH A;  3EI0 A;  3TLU A;  3SQ6 A;  4BQT A;  1UW6 A;  2C9T A;  5JME A;  4ZJT A;  2BYP A;  2ZJU A;  2QC1 B;  4A98 A;  4LMK A;  3TLT A;  4XHE A;  4UXU A;  3U8J A;  2XQ6 A;  1OED C;  5J5I A;  2W8F A;  3U8L A;  2X00 D;  3UU3 A;  2BYN A;  4TNW A;  3RQU A;  2BR7 A;  4ZZB A;  4BFQ A;  3EAM A;  3SH1 A;  3T4M A;  3TLV A;  2MAW A;  3P50 A;  1OED B;  4QH1 A;  1I9B A;  5AFN A;  4TWD A;  2XZ6 A;  5HCJ A;  2XYS A;  3WTO A;  4FRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...