5HFJA

Crystal structure of m1.hpyavi-sam complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
201
Chain Sequence
MIQIYHADAFEIIKDFYQQNLKVDAIITDPPYNFKLLEWIARYAPLVNPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNIHRRYVQDTEFALWAVKKKAKWVFNKPKNEKYLRPLILKSPVVSGLEKTKHSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQTAKKRLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of a DNA N6-adenine methyltransferase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori (strain atcc 700392 / 26695)
molecule tags Dna binding protein
molecule keywords Adenine specific DNA methyltransferase (DpnA)
total genus 51
structure length 201
sequence length 231
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hfjA00
2FK8A 1X1AA 1QANA 2QY6A 5HIIA 3JWGA 5IKMA 1UIRA 3HA5A 5EPEA 4DA4A 5EQJB 2IH5A 1D2GA 1RI5A 2OB2A 4YUXA 5HIJA 1X19A 3G5TA 4OBXA 2XYVA 3KPYA 3D2LA 4CXMA 4DCGA 1M6EX 4JXJA 3M6VA 3CGGA 3P9NA 5G02A 3GCZA 3R9XB 3FZGA 2OYRA 2O07A 3CBGA 5CIYA 3EVCA 5DXJA 1KHHA 4YUZA 3KU1A 3UJ7A 3LDUA 5LQAA 3B89A 1DCTA 4GQBA 5FA5A 5K0CA 2VDVE 1O9GA 1KIAA 4RTPA 2VDWA 3BZBA 3HCBA 3KQOA 5CUQA 1Z3CA 4KW7A 2K4MA 1VP9A 5EGSA 4MQ4A 3EVAA 5DTRA 1QAQA 2Y1XA 1YZ3A 2EJTA 5K05A 1SG9A 2JHAA 2ZZKA 2C7QA 4OBWA 3BXOA 3KPJA 3SMQA 4FT2A 3VYWA 1QYRA 1VIDA 1NV9A 1VBFA 4RTRA 5T64A 2UZ4A 1NW6A 2YX1A 2LD4A 3A7EA 2ZWVA 3E23A 3PX2A 3FPFA 4ER7A 4K6MA 4KDRA 2IFTA 3BWMA 4E70A 3A26A 2B2CA 4PGGA 2VP3A 4PYKA 4C08A 3NWBA 3SVZA 3HVKA 3LCUA 1L3BA 2R6ZA 4HH4A 1BKYA 4PYNA 3SR4A 3K0BA 1HMYA 4QPNA 3UJ6A 4R8RA 1TPYA 1XVAA 1T43A 5BP7A 1TW3A 3CJTA 3UJ8A 1B42A 2IIPA 1ZGJA 3IV6A 4PINA 3AJDA 3PFHA 2Z6UA 2P3QA 5DM1A 3KQTA 2ZZMA 4BP1A 2AR0A 4Y2HA 2NXCA 5FCDA 3TPZA 5C0OE 3GXOA 1WXXA 3P2KA 4IV8A 1JTFA 2OB1A 5K01A 1YFLA 3DOUA 2PX8A 2O0LA 4FSXA 2VS1A 5DXAA 5DX1A 3BKXA 3KR9A 4QPPA 4U7PB 5E1OA 5E9WA 5DTMA 2FCAA 3MQ2A 3OFJA 2CL5A 4Y30A 5EVJA 3G88A 4ATNA 3RODA 3DLCA 4GC9A 3KQSA 2IDJA 5KYGA 3GGDA 3OU7A 5BW5A 3GO4A 2VDUE 3I53A 1IXKA 4XUDA 3A4TA 5H02A 2HWKA 4P7KA 4RV9A 2AOVA 2EJUA 2IPXA 3MGGA 4POOA 4RTLA 5EHGA 4OA5A 2P1DA 3KKZA 4QQKA 5BXYA 4M7RA 3OU2A 1R8XA 1U2ZA 4PONA 3V97A 3TFWA 4CTJA 4YV2A 3A7DA 3MAGA 3HCFA 5LQCA 5FWAA 1XXLA 2Z6QA 2Y1WA 3LL7A 3VC1A 5E2AA 4E31A 2C7PA 1M0EA 3EGIA 4PCLA 4ER6A 4YMGA 2YTZA 2NNWB 2BM9A 3G2OA 4XUCA 2I6GA 3NW9A 4FSDA 5FADA 3EVGA 3NTVA 8MHTA 3KR0A 3BGVA 4RSRA 2HNKA 2XYRA 4HRAA 4DF3A 4MHTA 4C4AA 3EMDA 4AUKA 5KS2A 2P40A 3S68A 3B7PA 5DX0A 2NP6A 4DCMA 4E2ZA 4E2YA 1G38A 2AOWA 1VE3A 3LX6A 1RI4A 3E8SA 5HIMA 1KXZA 3HEMA 3GIWA 4RVDA 4LWPA 5LR6A 5GIPE 5LQUA 2IBTA 4HGYA 2P8JA 2PY6A 4LG1A 2ZWAA 5C9ZA 5EMKA 2A14A 3SXJA 2PVCA 2H00A 2P41A 4P58A 5FHQA 2GA9A 2PX4A 1RI1A 4R05A 3LKDA 4ZTBA 2GH1A 3ORHA 4HG2A 4DZRA 5CCBA 1MHTA 3F4KA 3AXSA 5EEHA 2ZZNA 3C0KA 3ELUA 4GC5A 3IYLW 3T7RA 2G1PA 3OZTA 2O57A 5FA8A 1G60A 2PX5A 3OU6A 3FRIA 3TRKA 3EEYA 5K0JA 3NMUF 3KQPA 3FRHA 3LHDA 3M6WA 3GU3A 5K0EA 5CM2Z 2AOTB 1RJFA 1NKVA 2B3TA 4QDKA 4YUWA 1JG1A 1X1CA 3E05A 3BWCA 2IP2A 4A6DA 2OKCA 2FRXA 1D2CA 2NYUA 3M6UA 3G8AA 3LKZA 5EHIA 3H2BA 2DPMA 3OPNA 2EX4A 3R24A 1IM8A 2QM3A 2FPOA 3MCZA 5DTQA 4ER5A 4F86A 3EEOA 3BT7A 3O4FA 2P35A 3RW9A 2H11A 2FHPA 3BWBA 1G6Q1 3WSTA 4RTNA 2UYCA 1FJXA 4HC4A 3FYDA 1KYZA 3NVMB 4ER3A 1EJ6A 1WY7A 1WXWA 1QAMA 3DR5A 1XDZA 4RVHA 1BOOA 4GF5A 4EK9A 5K0GA 3I5UA 5K0FA 5MHTA 1RJGA 5EMMA 3CKKA 1ZQ9A 3PS9A 3ELWA 4OQEA 5DT2A 3T7TA 4WVLA 4HGZA 1N7JA 2ORED 3G8BA 3HCAA 1R6AA 3IHTA 3MCTA 3OE4A 1NV8A 1INLA 3TLJA 1SVUA 4YUVA 2E5WA 2IDKA 2YQZA 5DSXA 3GRRA 3B5IA 5GP1A 4B17A 1NW7A 4CKCA 7MHTA 4GUAA 1YB2A 2JJQA 5DWQA 5DPMA 3REOA 3THRA 2ONZA 1ZGAA 2GAFA 2QRVB 4P7GA 3SSNA 3TR6A 3BKWA 3DULA 4EMSA 3L8DA 3MERA 1AV6A 2AOXA 5EC8A 4L7VA 3V8VA 9MHTA 1ZG3A 4EKGA 2B25A 3G89A 4O29A 1YZHA 5JUWA 2YVLA 5K8VA 4RTSA 3KPVA 4MTLA 2N47A 5E2BA 3PB3A 2AOUA 2PSSA 1O9HA 4IKPA 4NECA 4QVKA 4RVFA 4QTTB 2I7CA 3FTCA 3PVCA 5EKXA 2YXDA 1KPHA 2P3LA 2GPYA 3GJYA 3KHKA 2NXEA 4KDCA 3M6XA 2ZULA 3HP7A 3HCCA 2XYQA 3GRVA 3TKYA 4X1OA 3SSMA 2ZCJA 4Z2YA 5D1HA 2ZBRA 4AZTA 2DULA 4GOLD 2ZBQA 1DUSA 4CTKA 1OR8A 1R74A 3P9CA 1G8SA 5DLYA 5F2KA 4ER0A 3C3PA 5K03A 2O05A 2PWYA 3JWJA 4GEKA 4M38A 2CKDA 5E1BA 4MWZA 2BR3A 5DM0A 5CVUA 2QE6A 5HILA 3GDHA 3MTEA 5LQRA 5M5BA 3R3HA 3BUSA 1EQAA 1FP1D 4PIMA 3TQSA 2CMHA 1RJEA 1L3CA 3B3FA 3FUXA 1I4WA 4RVGA 1P39A 4KRGA 1NBHA 1IY9A 4DMGA 3P8ZA 1EIZA 4RTQA 2JG3A 1SUSA 5DSTA 3PT9A 3FTFA 2UYQA 3PLAE 3MB5A 2UYOA 2GB4A 3JWHA 3KR1A 4GOND 3TM5A 1V39A 2EFJA 3DMFA 3KQVA 3ER8A 1QZZA 1KR5A 3BGIA 3LECA 3UZUA 4PYOA 4AZVA 2G71A 4HTFA 5FQOA 5U4XA 3DMGA 2GLUA 3SM3A 5EEGA 3PTAA 1L3IA 4GOOD 3FPGA 3G7UA 1JG3A 3B3GA 3GRYA 2IH4A 3HNRA 4X60A 2PGXA 4F85A 3PFGA 2JH9A 4HTFB 3FYCA 1VQ1A 5GM2A 3THSA 1XCJA 3HVJA 3LBFA 4C06A 3DXXA 3P2EA 1FPQA 1R00A 5FHRA 4AZSA 2QRVA 1NBIA 3NJRA 4PWYA 3GRUA 3LDFA 4R6XA 2XVMA 5FULA 3TKAA 3FTEA 3TOSA 1N2XA 1RI3A 1SQGA 4V0RA 4R6WA 2PXXA 3ANXA 4PGHA 1F38A 3LCVB 5E8RA 2G72A 3AXTA 1MJFA 4YV0A 1BHJA 4RWZA 3ME5A 3M70A 1XDUA 1R18A 3O31A 5ICCA 5EG5A 5ICGA 3T0IA 1XTPA 3HTXA 5EZQA 2WA2A 2PBFA 4UOEA 2B78A 3FTDA 3G2QA 4LWOA 5HFJA 3HCDA 3RIEA 2ZW9A 4PNEA 2ZVJA 1YF3A 1QAOA 2OZVA 2PT9A 3SGLA 3G5LA 4C05A 1JG2A 5E1MA 5T6BA 4BP3A 2F8LA 2AOTA 1G8AA 1RI2A 5HZMA 4KIGA 4OQDA 1XJ5A 5CD1A 4C07A 1X1DA 5EOVA 1VP3A 5DRTA 3U81A 2ZTHA 1EG2A 4QQNA 2P7HA 5ICFA 5CVEA 2AVDA 3FUVA 1RJDA 2UYHA 2I62A 1X1BA 2AZTA 2YXEA 1H1DA 2OO3A 4IWNA 1NW5A 3G2PA 3ID6C 3KPUA 5GM1A 5C1IA 3SSOA 3TM4A 2AN4A 3QV2A 5EZSA 3X0DA 2JHCA 1P91A 2HR1A 4R8SA 1AQJA 3P97A 3UJ9A 1M6YA 1EAMA 2ZSUA 3NDJA 4FGZA 1Q0TA 1NT2A 2Z6AA 5F2NA 3KQMA 1JG4A 3EMBA 4G56A 1EJ0A 2JH8A 4EQZA 4F84A 1AQIA 4RTJA 2R3SA 2PXCA 2QYOA 3HVHA 4FP9A 4RX1A 4BLWA 3DUWA 3DMHA 3ELDA 1ORIA 4PYQA 4X63A 2P3OA 3LPMA 4HSGA 1ORHA 4X61A 2BR5A 4E30A 1VPTA 3Q87B 3EVFA 3JWIA 4P7JA 1KP9A 1NW3A 2ZBPA 2GS9A 4PYLA 2IGTA 4DM3A 1F3LA 3LDGA 2Q41A 4M37A 2O06A 2XVAA 1XDSA 2XBMA 1JR4A 4DKJA 1BC5A 2H1RA 4MIKA 4GBED 3EPPA 4U7TB 3A25A 3DP7A 4XUEA 2AN5A 3FPJA 3LSTA 4CWAA 1L1EA 1NW8A 3MTIA 3OZRA 3R0QA 4EVIA 5ICEA 2ZIEA 5LQNA 4PYMA 4BLVA 2OXTA 1UWVA 2PLWA 2PJDA 1I9GA 3CJRA 2G70A 4KVZA 4QDJA 5LSAA 1YFJA 5HEKA 2OPBA 4P7FA 1KYWA 1ZKDA 5DM4A 4RTKA 1WS6A 3MHTA 2BH2A 3HCEA 5D1NA 5EKUA 2FYTA 3BGDA 1JTEA 5T67A 5F2OA 3SX0A 2BZGA 5HOQA 3NDIA 2WK1A 2HV9A 3PX3A 1DL5A 3UA3A 4XCXA 1I1NA 3Q7EA 1SKMA 2PWPA 4DQ0A 5FTWA 2G8NA 2AS0A 4A6EA 2ONYA 2YR0A 3BWYA 2ESRA 3EVEA 3CJQA 3M33A 2CMGA 2AOUB 2WA1A 4E32A 4RYLA 3R6TA 3FUWA 3VSEA 4QTUB 5DX8A 4C04A 10MHA 2ADMA 5EMJA 3QOXA 1JQEA 5IH3A 2FK7A 3ERCA 2B9EA 5EIFA 5LQKA 1JQ3A 3KQYA 3IEIA 4YV1A 1AF7A 1TW2A 3DXYA 4IV0A 4PYIA 5K09A 3EVZA 3GWZA 3I64A 4CKEA 3UA4A 3OZSA 4PIPA 5E9QA 4RTMA 3I9FA 5GINE 5E1DA 3UJBA 5K0BA 3T7SA 2NXNA 5DRYA 3CVOA 3NWEA 4E2WA 1O54A 5FWDA 2NP7A 1PRYA 3DTNA 3HA7A 3M4XA 4E2XA 3A27A 3KQQA 2VZ9A 3TMAA 2EG5A 3CC8A 3UJDA 2NXJA 1NE2A 3EVDA 3HVIA 1XCLA 3VC2A 4AX8A 5DM2A 1D2HA 1Q0SA 3UBTA 1ZHFA 2C7OA 5CVJA 3EGVA 4LECA 3FPEA 1JSXA 3LBYA 1JSZA 5GOZA 2PV0A 5EMLA 1PJZA 1UFKA 4OA8A 3ER9A 3B3JA 1VL5A 2ZLBA 3OE5A 4KIFA 2V74B 5ERGB 3UWPA 3FPHA 4E33A 3NVKI 4OX9Y 3LGAA 5EIWA 2C7RA 5E9JA 2ZFUA 5KQRA 2PKWA 3UJCA 5GIOE 1WG8A 2HTEA 2YUIA 4FZVA 1L9KA 3I58A 3O7WA 4YUYA 2IH2A 5CVVA 5B1SA 2I9KA 3GRZA 4BY9E 1YUBA 2AVNA 4GOMD 3OFKA 3DH0A 2ZIGA 3C6KA 3CCFA 1KPGA 1R8YA 1HNNA 3HA3A 3UJAA 2KW5A 1JQDA 5KQSA 5FUBA 2YXLA 5E8JA 2BM8A 1KPIA 3DXZA 5JR3A 2AN3A 4X41A 1Y8CA 2CWWA 4YMHA 3QOWA 5BW4A 1P1CA 2ERCA 3EGEA 2PT6A 3ELYA 4AZWA 4BLUA 5K0LA 5LQJA 2IBSA 3KR2A 4WXHA 2BR4A 3KPWA 3P9IA 1WZNA 4FR0A 3P2IA 2PX2A 4QVGA 5GWXA 5P8WA 5KVAA 3P9KA 2OBFA 4FT4A 4C03A 4M36A 4PYJA 3KQWA 5HIKA 2JHPA 5K0NA 1N7IA 3DLIA 5FQNA 2V7EA 2PXAA 3FUUA 3P71T 5CCXA 4KWCA 3GNLA 3AY0A 3E7PA 4RTOA 3EVBA 1FP2A 3K6RA 3LCCA 2OY0A 2P7IA 3OCJA 3C3YA 3HM2A 3AWIA 4ISCA 1SQFA 1G55A 4PCAA 4H0NA 4FS8A 1P1BA 1VLMA 3G2MA 5CVDA 4CKBA 1FBNA 2HMYB 3FUTA 1SUIA 4EKIA 4V0QA 3C6MA 2ZIFA 3UFBA
chains in the Genus database with same CATH superfamily
3A2LA 4I1PA 1MUUA 5LLTA 2QW0X 4N8SA 3ZCQA 3SJUA 2ZRPA 1USIA 3LC7O 1M1NA 4L73A 4QPJC 5AKJA 5ALZA 5KSPA 1PV2A 1WZUA 5BRAA 2E4AA 2YUTA 4OBXA 3LYAA 3O26A 2WKSA 3UAVA 4CBVA 3FFWA 4P86A 4AXXA 2OQ2A 1C5KA 5CDYA 5FAKA 1UDBA 3CY6A 4LRQA 3QY0A 4XJTA 5KKAA 4NI5A 1KJJA 3ZS9A 3X1XA 4B84A 1X74A 3KYBA 1KTIA 2A9QA 3CUUA 4WVFA 3ABRB 1KP2A 1TADA 3AIMA 4C4XA 2BUAA 4N82A 2VHEA 2LP4Y 1P81A 4NICA 5JYCA 2Q1WA 3SDBA 1XZNA 2D0OB 2ZTSA 4P8RA 1VB3A 3PA6A 2AMFA 2ZGVA 5JCJA 4ZC1A 3GZTB 4I4LA 1AXRA 1XQ6A 1VKJA 1ZN7A 1YOVA 5EZYA 5IT5A 2Y1XA 4TMZA 3C3MA 4BL5A 1ILWA 1M34E 2Y4NA 2YN2A 3DV9A 4MYHA 4YQYA 1PNRA 2SKCA 4EB3A 2R8BA 3LYLA 3ZDZB 3EWAA 3ZCUA 5I45A 3BXOA 1SBNE 3NHJA 1V5GA 4B4WA 3VYWA 3JD2A 3NP9A 4LOJA 2QVBA 4TV8A 3IC5A 1EFCA 2PKCA 4JB8A 4LDJA 3SC3A 3ZHQA 1H3NA 2LDXA 4OMFG 2W6NA 3K70D 2BGUA 2OSVA 3FPFA 3QXCA 3TXXA 2E48A 2VNHA 3AR7A 1CUXA 2QD5A 5H3CA 3BIOA 5DHQA 1CQZA 4C0BA 4EHKA 1O03A 3T1TA 1Y89A 2GCPA 3EH2A 4MUNA 4UJ5A 1DJQA 2ZVQX 4ZAFA 4QPDA 4IH1A 3SR4A 3UJ6A 3U6BA 2RGRA 3WBBA 3RVNA 5M2QA 5HRCA 2HX1A 1Y5NA 1G42A 3TUIC 4DR3B 4ZQEA 2GO7A 4ARZA 1QFSA 5FTKA 5DI3A 4LQ4A 3TDMA 4M22A 1DXOA 4CM8A 2Z6UA 3WYEA 1UQRA 3REQB 3KQTA 4BU0A 2ZRAA 1ADYA 3L0PA 4TSFA 5FCDA 3VOSA 1CF9A 4ARBA 4K9MA 4ZZ0A 4RGBA 3LE8A 4WPGA 2Y9MB 1JTFA 3HO1A 2Z8YM 1JKMA 3DOUA 2PX8A 3TQCA 2O0LA 2GYYA 5DXAA 3L02A 3D7RA 4I50B 2XQVA 4MLZA 4RORA 2HADA 4WCDA 1R0RE 4B3MB 2EG9A 2F9MA 3QXJA 4TTVA 3VR6A 4PO1A 3N2ZB 4LY0A 3N8DA 2VDUE 3QVLA 4TLAA 3FTQA 1F8FA 1W6RA 1W6UA 1NFRA 2W2OA 3WYCA 1HZZC 2IPXA 4YAEA 3QFSA 2BW0A 1YZKA 3KKZA 5JNWA 2VDQB 3B6JA 1K5PA 2QX8A 1GQOA 2Q3EA 4Z9XA 5DEIA 4EJSC 1YZVA 4HH0A 2R65A 2XNHA 3V46A 5JRDS 2VT7A 2G83A 1YK0A 2NNWB 3G2OA 3QLUA 1RC8A 1F2DA 2B1JA 2FR1A 1P0PA 8MHTA 2BGMA 4RJKA 4IJUA 4M60A 2OCDA 2VAXA 2BP7B 1AK9A 4BRSA 2YV4A 5T4HA 4L0MA 3TE6A 2B7CA 3F3MA 2KYRA 1ODTC 4EGSA 5BR8B 1R0KA 1T3SA 2C1ZA 2YHUA 1CHDA 3VOAA 2BEUB 1A9XB 2Q6TA 4XIJA 4E2ZA 3LA6A 4CEHB 2P0EA 4B43A 3H2IA 1TRKA 1R10A 2ZT8A 3GQBB 3QVSA 4HAVA 3GLUA 4HQKA 1IB0A 4CYMA 3SXUA 3Q5DA 1WUHS 3I2IA 2A14A 1JAXA 1WPRA 1P33A 3MCUA 5DCWA 5DW3A 4PSVA 2OFFA 4OB7A 1C7IA 1USGA 4JYBA 4BMCA 4AF7A 1SO8A 4LOAA 4GM1A 4ZKEA 3JASB 3W04A 1GSHA 2ZR0A 1GU7A 3T7RA 3OZTA 3L6EA 3LHSA 2J7PA 1I5OA 1KSFX 2QU7A 3EXIB 3EC7A 3RRFA 1R5BA 1SOAA 3FRHA 3R44A 3QEMA 1G291 5CM2Z 5H1YA 1U5BB 3GOQA 2GNOA 3OAAA 5EWJA 4GPEA 4RK0A 4DTIA 5KNBA 4Y9RA 3TAXA 4C4SA 2VJOA 3U48A 5JWOA 3K0AB 2EJCA 2NV6A 4GICA 1QE0A 4D80A 1IM8A 4TYQA 4B45A 2ZU0C 4ER5A 2ADFA 4FDUA 1D4FA 2H07A 4KGZA 4OG2A 1VLHA 3E53A 1AD2A 4L72A 1VECA 1TQHA 1UUFA 3EDQA 4LDQA 4NRDA 1KYZA 3DLBA 1WCXA 4L0QA 1XMPA 1DIHA 5CW2A 2MSEB 4GF5A 4UPEA 5KOHB 4OJTA 3WAGA 5ALVA 1NG1A 4EYKA 5CDFA 4DR7B 1DCFA 1RJGA 2D3WA 4NE9A 4DUGD 4M8IA 2AFHA 4ICIA 5EYPB 4F2GA 2JI6A 4UOZA 2Y8EA 4GL2A 1QH8B 1DX9A 2WU8A 2APJA 2IC5A 2WIBA 2H1LA 3H5RA 2J0UA 3OZXA 5K3DA 4CI9A 2SBTA 3GJQA 1INLA 1JI0A 1KYXA 2FZKA 2Q4TA 2WC1A 2HBYA 3GJ6A 4FDLA 2I80A 1XNJA 1MIOB 4X24A 2NZVG 4CKCA 4F4DA 4E6EA 4F4JA 4PLYA 3ASVA 1MKYA 1WXHA 1VE1A 2RGNA 3GJZA 2AH5A 1EFTA 2A67A 3RYIB 3TR6A 4C01A 5JSUA 1D2MA 1E9FA 4C2AA 5HA5A 2H6EA 1J6UA 4QJIA 4XD7D 3I5XA 1KZGB 9MHTA 2PKQP 3HB7A 3TNLA 3SVTA 1SFRA 1TUGA 4RF4A 2M98A 1Q2XA 3F5DA 4NECA 4O2BA 3VKUA 1NNEA 5J43A 5B6IA 1JAIA 5EHZA 1UBGA 3M82A 3NBKA 3LPNA 3PVCA 1VG1A 2YXDA 3LQRA 4GZ5A 4IDCA 3TIFA 5F1YA 3WWPA 2UVPA 1J24A 2WI8A 2X15A 3B38A 3M6XA 2GN6A 4LJ8A 4OF4A 4B6FA 4CW7A 3SKYA 2VNIA 5HJ7A 3IBTA 2WFZA 3QWIA 2WVGA 1JYSA 3K16A 1EDDA 2BDUA 2ZBRA 4MS1B 1PTJC 2FPLA 4CTKA 4I99A 5I5EA 1XRSB 1Q21A 1S2NA 3W2FA 1ZNQO 4WLOA 2GJ4A 4GEKA 1N6NA 4HVLA 2CKDA 3DAOA 4JXXA 1JB1A 2VPTA 3MUFA 2JHFA 4PYRA 1C3EA 5GONF 1C9MA 2QE6A 3FPCA 3CV3A 1Y6ZA 3MN1A 1QU2A 1O0BA 5EJGA 2A9PA 3ZDQA 1H5NA 3EDYA 4MPRA 3AUTA 2IU0A 3CEPB 1MQAA 4F9GA 4WA7A 2WB4A 2CK3D 3GK3A 4HNRA 4JJ6A 3C41J 3GN2A 1YDWA 2JGKA 3BEDA 3CRW1 3HLTA 4AIRA 1U1CA 1OZHA 3P0IA 3SIRA 3MS4A 3HNPA 4WOJA 1H2RS 1E1MA 5JASA 2FLVA 5T3UA 2PXHA 1R0ZA 3BE5A 3D8UA 3JQRA 2OBLA 2EIXA 4FI3F 1GPYA 1RM3A 4IZ6A 5AHOA 2AYZA 2HGSA 3Q7IA 3RVOA 2B99A 4C0XA 3DBRA 4QDOA 3KJZA 2IH4A 1Q1GA 3N07A 4ZMBA 4M6WA 1Q0QA 2V5AA 2O8NA 2W43A 2ZJ6A 4GL4A 1RQ7A 1JJFA 1Z38A 3PFGA 4Q12A 4F85A 5HKBA 5JXIA 3K9FC 3RG8A 4G37A 3BILA 4II3A 1HT2E 3A1FA 1R00A 4NDZA 1XTQA 4DXDA 4JROA 5C51B 4DLYA 1UAGA 1GO2A 2A1UB 3A05A 3O83A 1BD4A 5IMSA 3FGOA 2WV9A 4L57A 4DM7A 1KH1A 2Q99A 2O0MA 2VTBB 2JGEA 5HJEA 1G2QA 3SDSA 2PIAA 1KQOA 5AXDA 4UQLA 3P26A 2P4HX 1P3DA 3M70A 3WG9A 4IP0A 1M1YE 4LW8A 4OYHA 3K0EA 3BTOA 3DJFA 1FSGA 4NARA 1G0NA 3SX2A 2JAQA 3KJXA 4EF6A 1ZXBA 4S12A 3ROXA 1ZSNA 4CF4A 3H3JA 4QATA 1NBWB 3QUTA 3M6IA 2C00A 3QEJA 5B3JA 3VDMA 1YF3A 1FS6A 1YMQA 3QOYA 4JP1A 3V34A 1T3LA 4FLFA 1C7JA 1JPNA 2VBCA 3HGQA 3MJSA 4KNWA 1DRUA 4MKFA 3ESDA 2XDQA 3JSXA 1XF9A 5JDCA 4HEHA 3RYHB 5BUCA 3PITA 2VUHB 1D0VA 1XJ5A 2QUJA 3R5FA 3UUFA 4INPA 1EFUA 5AW5A 2KLHA 1X1DA 2FP4A 3EQ7A 2VTKA 1YSCA 5ICFA 3CH5A 3NPMA 4KGVA 2CXNA 1TM7E 3W5UA 2WUGA 4XKJA 3ZC3A 3EODA 1L5ZA 1GFWA 4LC9A 3V8MA 4DQDA 1THTA 4WXPA 1NATA 4Q9NA 4Z2AA 3UPUA 5G0VA 3CWZA 3UJ9A 2PMKA 5L95A 2H1FA 5JAIA 1A2KC 3BD7A 4TQUS 1YBHA 1Z7BA 3ENKA 1W25A 5CDSA 2GHIA 5KI6A 1H8EA 4F84A 5MFZA 4K9NA 1DT3A 2V6FA 1JXAA 1T6BY 1GPJA 4G5FA 2IOQA 5EP1A 4TSRA 5LNK1 4R1PA 5GONB 1BCRA 1DTEA 1JHQA 3MIIA 1ZGGA 2P3OA 1RWMA 2GBLC 4HSGA 4IAOA 4LA4A 1P80A 4QDXA 4MVWA 4X8OA 3W06A 3WLLA 3K32A 2QL5A 4A2CA 5KJFA 2R4UA 1NLFA 3D5QA 4BFSA 4QO7A 5CA0F 5K9ZA 1E6KA 1SUCA 2Q41A 2OHIA 3PC2A 3PGVA 4K6GA 1EFDN 1FRVA 4FX5A 4EI7A 5DIFA 3EARA 1JTVA 1X39A 3MINA 4XARA 2QRJA 2OA0A 3SPXA 1Y3IA 2AW3A 2QAGA 3G59A 8OHMA 3DZKA 4KVZA 3DOJA 3PQ7A 3DOOA 3ND6A 5JC1A 3L4SO 3UANA 4ZP1A 4A0RA 1E1RD 1QOZA 4C29A 1PFWA 1KDVA 2CE7A 2QG9A 3PE6A 4JJ7A 4PC2A 3TW8A 1BA2A 3OECA 3ZE0B 2NPIA 3IVMA 4Y6SA 5JU6A 4QQ8A 4ZHSA 3SX0A 3O8OA 5JIBA 1PS8A 2WMNB 1PVDA 4RKWA 4PTLA 1GCOA 2HOQA 3JYLA 4XCQA 5HTKA 1O6BA 2FPKA 2ZITA 5IK2D 3VR5D 2ZUWA 1E1RA 1E18A 1RHMA 1RXSA 1YS7A 4WBNF 1G3QA 4GOJA 4MGYR 1XYYA 2ZSKA 4EBFA 3BREA 2JJ1D 2E9SA 3FUCA 1GYPA 2CMGA 4C87A 2GEVA 5LUAA 3VSEA 1OXBB 1C3OA 1QUFA 1SC9A 4PQRA 4V02A 5HP4A 4GECA 2ADMA 1E7YA 2L18A 1GRRA 2VJQA 4MV4A 1XVTA 3CPHA 1HDCA 3U3OA 2B9EA 5B3AA 1GEGA 1HOXA 1P1RA 2VAVA 2W2VA 2VP0A 3CNBA 2FETA 2JJ1A 3OBIA 4MQBA 4MDEA 2HSZA 2Z43A 4MULA 3EVZA 4AX4A 1YOBA 1M0WA 4RM3A 1XZQA 3OQVA 5LBUA 2WQZA 5GINE 2V7PA 1GYQA 2HK8A 1B8VA 3KB2A 5EAIA 4E1BA 2J59A 5T41A 5CFNA 4IHJB 1NGSA 2V55B 5C7YA 3HJHA 3LV8A 5TJ9A 4E2XA 1OGIA 5FUMA 5L4LA 4G5HA 2P5UA 4UD6A 2YIMA 3VZPA 3WV4A 3EVDA 1P7ZA 1U7OA 2HJ9A 3C3EA 3HZRA 5CVJA 3AUAA 2XIJA 1JSLA 3VPHA 1YRAA 3LHFA 1W4RA 2PTHA 4DKXA 4YJDA 1RYFA 1T9BA 4ZVNA 3FSJX 1MO4A 3ICQB 3GNTA 4JB2A 4UMEA 1T4CA 4I2VA 3KD3A 3K5WA 2YVUA 3WB0A 2IXGA 4TKVA 2GUGA 4TLBA 3SDZA 4NPCA 2YS6A 3N5CA 2BKXA 2C7RA 5FIUA 3H1AA 3OCZA 1TK9A 3MCAA 4QARA 4RANA 2VUTA 1E2JA 4F4CA 5KQRA 3A9VA 4X5OA 5D7NA 2SCUB 1BFDA 1WEKA 2J3MA 2OHOA 4U6NA 2W70A 3W6UA 2RHMA 3KV1A 4KOAA 4GOMD 2IHYA 1Q14A 5EXDA 5J4YA 2C0QA 5IUJC 3OZUA 2G6BA 1R8YA 4B8WA 2A33A 2I1VB 2H54A 2PSEA 2RH9B 3DCJA 4JOBA 1RYMA 2XT0A 3E9NA 2YXLA 3KOOA 2FRDC 5ELLA 5DE3A 4JL6A 2J87A 4UUMA 4JYAB 3PNKA 4ZYTA 1PW7A 2XB4A 2HWXA 1EZ4A 3AR4A 4FFWA 1L4NA 1KRHA 2PT6A 2BF4A 3U7GA 1RM0A 1P7WA 4MQ5A 2X9VA 3WIUA 1EWTA 1DMSA 2IZ0A 4G1MB 3AUSA 4OLJA 2HA4A 3AF6A 3ZDBA 2IL1A 1MO6A 2QUBA 1SQSA 3IAUA 3ORFA 2W11A 4KWCA 2E21A 2JRCA 1QRAA 3IPCA 1QC5B 4JBIA 1AKTA 2RI6A 4MQFA 4QGGA 1G55A 2F17A 3OEHA 4YN3A 4ZV4A 1SU7A 5E0KB 1UMKA 3ZXIA 5FOWA 5DK4A 1UPBA 1MX9A 3UKDA 1EFVB 5A2QA 4EGQA 1FLDA 1TJYA 2ZIFA 2B8TA 2LKCA 2FUG1 5FBQB 4DLVA 2VL7A 1FEZA 1WKBA 3DMRA 3FHTA 5U4QA 1XMSA 4J29A 2OCXA 3R5SA 2V7VA 2YWDA 3WLRA 1K98A 4D6PA 1NY5A 1XD8A 2N1BA 3QVWA 4NU5A 5AR1A 1WPQA 3KWJA 4D43A 1T5IA 3KJQA 2CC2A 5CXXA 2F55A 4MMXB 1NTOA 2C4MA 1SK9A 4LHEA 5FWYB 2V7GA 2GKSA 1BX1A 2IZ1A 1SVOA 2QRMA 4TMVA 3NNNA 3UFXA 5FV4A 2ZRGA 3M9LA 3UCXA 5B3JC 1GNQA 1RE0A 1YA4A 2VDWA 2ZJFA 4LGMA 4N3GA 5A4IS 4BZQA 5C8ZA 7ADHA 1Q3HA 3E2MA 3K5HA 1A2QA 4OKSA 4PANA 4PNPA 4KW7A 5LA6B 3UGKA 3BN3A 4B7XA 5LMUB 3V6LA 1U11A 1IN4A 1UQTA 4RAQA 4NV0A 2OBBA 2Q6IA 2JIQA 2XSZD 3ZGXA 3O8BA 2RHTA 1OVMA 2K7ZA 5HUHA 2I8CA 5E6UB 2HJGA 1JZSA 2Q5IA 4KBYA 2FKNA 4Q5IA 5DLDA 1TF7A 4W5QA 3R9XA 5BV0A 5D6NA 4RK7A 2XMBA 4CDGA 4NAVA 4LPKA 4RHXA 4P08A 4BO1A 4EPXA 1TCCA 3IELA 2UYYA 4V0ME 2XKBA 3CLRC 3M9XA 4PYKA 3LBIA 3TRFA 3VYUB 2QQEA 2B35A 2R47A 3WGYA 3ROGA 1B41A 1CQIA 4KQXA 1NL3A 1EA7A 4YEDA 2BBTA 6GPBA 1XCBA 3GMSA 1KYIA 1F6WA 5ECDA 3K7EA 2IY9A 4O3MA 2R5FA 3NM5A 1W581 2WP0A 4IUDS 2W8ZA 5JMPA 4D25A 1ZD9A 4V39A 4BNDB 3V8PA 4IIJA 5C8VA 1TA9A 1C7ZA 1JKJB 5E7IA 2XMSA 3ZE6A 1YFLA 4HDMA 1TEVA 4I5IA 1FY2A 5DULA 3U80A 3KKQA 3QIVA 3GFRA 5D5PA 3KR9A 4KN8A 4CL3A 1QORA 2DRIA 1GPNA 2FCAA 2EQBA 1B6SA 4Q03A 1DJOA 1F8GA 4NS1A 3LDAA 3JYQA 1CJKC 3R5XA 3VR4H 3KQSA 3ZVNA 4NCBA 1V96A 2GBCA 1Y34E 5AI9A 1UEXC 5AK5A 3EY4A 2ZRLA 1L5NA 1HO3A 1NP6A 1QQ5A 2XCUA 1XALA 1FFXB 2QPLA 4ZVUA 4D3DA 1TEHA 5A71A 5BXYA 2FP4B 3M7IA 4Q34A 1BFUA 3OCCA 1OXUA 1PCXA 2B3DA 2EBHX 4EPWA 3HSSA 1CG6A 1LBHA 3H13A 3I3SR 2GF2A 3BJIC 1K4YA 4TL6A 1PL6A 5TR9A 2C7PA 1YL6A 3CRMA 2XIQA 1FUUA 1W0KD 4HATA 3HWRA 4JT4A 4YHHB 5E7MA 1V3UA 3T35A 2XYRA 2DJIA 3FAKA 3CZMA 2XMPA 1KZYC 4F6LA 3PHCA 2R7LA 5SY6A 1M2KA 4XSVA 4B87A 5HTOA 3QLVC 5C34B 4FC7A 3OZVA 3V3KA 3C4VA 3L7CA 3JYOA 5HNKA 4IQ0A 1JUDA 5KZMB 4O1IA 1HDXA 3WGIA 1F0PA 2GA9A 1NW9B 2D2EA 3B13B 1CC1S 3EGXA 3N75A 3OEYA 4TM7A 2CV2A 4B3SB 4JLUA 4E5DA 4RV5A 3GLIA 4JBWA 1NOIA 1PLKA 3FXAA 3ES9A 4EB6B 1U04A 5JJ5A 3IEKA 5DP1A 3EBOA 2MMGA 2Y77A 3K70B 1DSSG 2XNDD 1RM4A 3IB6A 3OMXA 5EHXA 5K0ZA 4MH0R 3GU3A 3JASA 4ARAA 1XAGA 1CZOA 3C6YA 2Y92A 3LDHA 4COOA 4JLJA 3UAYA 2O48X 1L5VA 1LBSA 4MVCA 3G8AA 3U1BA 4H6VA 4QLOA 4YJGA 1GT6A 4EI2A 1Y3DE 4JJGA 4JWTA 4QUBA 2GARA 3DYIA 2ZYRA 4G67A 4I50A 3V00A 1J25A 2F67A 1CZNA 1Y48E 2VHYA 3WE7A 3LF1A 1OLOA 3I9MA 1K6XA 5JJCA 2HFKA 2ENUA 5ER9A 4ZOAA 4ANFA 4E7OA 1RC1A 1KMMA 2ZREA 5CT8A 5G4KA 5IBQA 3IEMA 1XDZA 4H7KA 1OI7A 1L5SA 2O7SA 3PCRB 3RSFA 4DLSA 3U6KA 1Z74A 4JC4A 2DBYA 1A1VA 1GRVA 5J5AA 2J4CA 3UT5A 2FQWA 2YVAA 4YR7A 4ZT3A 5HVNA 3THWA 3WHPA 2OAQ1 1PZGA 4A91A 4PSAA 1IBCA 1COWA 1T9HA 1FSFA 2FG5A 2RGCA 2EEZA 4OU5A 2QD1A 4ZREA 2HCBA 4HEA1 5E4FA 3UOGA 3TIIA 4CLOA 1N32B 1WLSA 2FI1A 1V8FA 4MUXA 3W4IA 5AW6A 4B80A 3NBUA 1M6WA 3EZLA 2JLRA 3GLVA 3THRA 1YKFA 4JI7B 4EFLA 1W4BA 5JMTA 3FFXA 1KJ9A 3DZIA 1U65A 1QPBA 1NBAA 1ZKMA 4RESA 5FAXA 5CB6A 3IUSA 3VDQA 4FOOA 3E3NA 4MR7A 5JDCC 5IT4A 2C5GA 4EKGA 2B25A 4RTSA 5DHRA 3FF4A 2VJPA 2G4VA 1T1EA 4MTLA 1G9TA 3OA0A 4ZRDA 3H9GA 1JDJA 3PENA 2ZP1A 2AC7A 1KK3A 3DL0A 1KFKB 1MO2A 3H9BA 2A5GA 1VMEA 3LG2A 1MB2A 1PZXA 1QYVA 2VRCA 2WHYA 2P3LA 1ZD2P 1ZNZA 1Z82A 3PSHA 1WZCA 3LP8A 2I9PA 3HQ4O 1P5HA 1WQ4A 4IVNA 1UBRS 1T9CA 3TGLA 2D5IA 2BN4A 1Z2PX 4DC1A 2V3CC 3ENZA 4DXHA 4NOMA 1Z4PX 2WVAA 4HY3A 3SYKA 1ZK2A 1AHHA 3N0TA 4O63O 2XD9A 2CJWB 3AHEA 4GLLA 4M38A 4DRZA 1L5QA 3U4DA 3UW3A 2GKGA 2QRPA 2V7BA 2Z1DA 1G5TA 3IALA 4IDGA 2IXTA 5EWJB 4FFDA 3GDHA 2I3GA 1T0BA 1W34A 3OJFA 1FFSA 5JS6A 1EQAA 4K7JA 5M5BA 5KC8A 3K4PA 2HAEA 4LV6A 3OZWA 1UM9A 1I4WA 3AOEA 2H9AA 4WBXC 8LDHA 2C1XA 2CMKA 4FQ8A 4PSKA 4RTQA 4DTCA 1C8LA 3GUVA 3OIDA 3N2NA 4FJ0A 3P9ZA 4DQVA 4HRXA 2UYQA 4O5AA 5AK0A 5K0SA 4YY3B 4OXIA 1L4KA 4RL6A 2R25B 2Z58A 4WCFC 3S2GA 5LU9A 3PJRA 2JIDA 3KQKA 1DAIA 3IE1A 5B64A 2JCSA 3KJFA 3DZJA 2OV2A 4KQKA 4BNZA 4YJ2F 3T5TA 4AZVA 1OHHD 4G5YA 2IYTA 3O3CA 2NIPA 3NUGA 4RHUA 1JJVA 5BSMA 4NYMR 3LQKA 5U4XA 3FYUC 4F9FA 3PDCA 1XX6A 3BCRA 2J0UB 4BVGA 2Z2JA 1HGXA 3RVDA 3NRBA 2Q7XA 4OIMA 2ZPUA 4RO0A 1K92A 1Y98A 3G82C 3MJCA 1A82A 2FJUA 4MW0A 3SHOA 1OWNA 1CUUA 3LOUA 3UUGA 4B6RA 4R2WA 2B1GA 2NPOA 2VC2B 1D8AA 3HUEA 1EBBA 2FWRA 2IOHA 3HVJA 2DUJA 4RY0A 4UHDA 1HRDA 3SJAA 5EMHA 4TTAA 1JFRA 1NBIA 3KAJA 4R6XA 3HDGA 3FTEA 2ZBVA 1Y9AA 1ZGHA 3DFMA 3ZE9A 2XRZA 1UBJS 1Y9DA 2LW7A 2W6CX 1G6HA 1M5TA 3AINA 3PPWA 1GAXA 1Z0KA 1CEQA 1Q1BA 4Q4AA 2JLSA 5BUQA 3LQ4A 4NNOA 3HJNA 4MIEA 2R85A 4TM8A 5AKZA 3ME5A 3QYAA 3TLMA 4A2WA 5AJUA 3NP7A 1R18A 2G5GX 1P1IA 3IQXA 4J7AA 3RUEA 4O4JB 1E32A 3CLUD 5I7OA 4Z1OA 2WWHA 3IS3A 1CF2O 1XQXA 4Q05A 5EZQA 1W7AA 1N75A 5HFJA 4E5VA 1QG6A 2I2CA 4BZXA 3TR0A 4X3CA 3T99A 1WR8A 3TH5A 4TS4A 3UMBA 1C4KA 2QTZA 3AL2A 3PFNA 2JLWA 3BL6A 1Q3KA 4AULA 4LOLA 4LRXA 1IJFA 2IK8A 2BSAA 4MCJA 1ZWLA 2AG5A 1D5CA 3ZI4A 3ROZA 3RO7A 2QPTA 1HL3A 3AMVA 2HEGA 4TMXA 2QUZA 4UHFA 4YDHB 5U9CA 1KMHB 1GUDA 3QPAA 2CJPA 2NYVA 4WK6A 3VHXB 2GWRA 2W71A 1U2RA 1GQRA 2Q3HA 4WZ6A 4L2IB 1PG0A 2AVDA 2ILTA 4IF4A 5LP1A 4CR6A 3IR7A 3JQBC 4LJRA 3O3OB 5FI0B 3NDBB 3JAKA 5AH0A 3CSDA 4FC6A 4DSTA 1NW5A 4KQ1A 4OREX 1RPJA 2BRUC 2IITA 4C4TA 4V24A 1RFLA 4C4RA 3I05A 4WFQA 1E9VA 2VDKB 4OBBA 5EZSA 1KSHA 5TGTA 1GR1A 5A5VA 1T2UA 3D2BA 1F0NA 4GI7A 3UHJA 3I5AA 3W77A 2VBGA 1R8QA 2J6BA 2PL3A 1YCFA 5TLSA 2QMYA 5HKKA 5THXA 2PSJA 4NJOA 4QXPA 2R3SA 1JSCA 1MZPA 1EJBA 2Y71A 1XZ8A 4BCCA 3GA5A 1YVEI 1DKUA 3BMCA 5JWHA 3U44A 3U4MA 3VNUA 3RGWS 1MXHA 1ORHA 4ZD6A 4UCQA 2KWIA 4K6FA 2WJ6A 1ACJA 2GK7A 2ACEA 2H57A 1IC6A 2HL6A 1Z2OX 2Q3DA 2ZBPA 4FHZA 4QYTA 4M83A 3OQ1A 3AERA 4BEVA 1D1QA 3IKVA 3WIVA 3LL4A 2JRLA 3NGXA 4G63A 3DP7A 1IEQA 2AN5A 2J85A 3FPJA 4MR9A 4R40A 3KKMA 4RJTA 3VZSA 1VPLA 3OPYI 4JDPA 3KXKA 4BLVA 4JNCA 2QXUA 2JD0A 4PLCA 4W7SA 2J9FA 1OYYA 1UEIA 3DWGA 5LSAA 2XE8A 3BOSA 5JTTA 3WFZA 2J67A 4TTQA 3PD1A 3AR9A 4M0MA 2JAOA 4ZPXA 5JC8A 3WR5A 3G0OA 4I6JA 1PG5A 2PL5A 5D1NA 5EKUA 3A3NA 3I8SA 3T7DA 4B8ZA 1W5EA 2OMKA 1JILA 3UWDA 4BC0A 4ZIRB 5EJ2A 1VLJA 2ZIUB 3EIHA 4P0PB 2XVZA 3I52A 4LNAA 2EWVA 4XFJA 3LUAA 13PKA 4E14A 1LA2A 4KXQA 2P1ZA 4FOTA 2J5KA 1Z17A 1P61B 2C8LA 1WUTA 4WKCA 4A0FA 2IS1A 2VDMB 3R0VA 1CUHA 3TZLA 2XCQA 2GWHA 3CX7A 4CQMA 2V8OA 2OZLA 4G97A 3UJPA 3VR4A 3VXKA 2WVHA 4FOLA 5HMLA 3T61A 4JI3B 1RRCA 1KJIA 3FG9A 5IH3A 3KJNA 1WUYA 5CLHA 3U4GA 5K6TA 2K7FA 4CKWB 5LP6B 1MO5A 2WP8J 3TI9A 3K2QA 3N87A 1FYVA 1PJ8A 3LHKA 5JADA 1THMA 2QI9C 1XLVA 3D0RA 3PVSA 5HOEA 1M6VB 2Z4RA 2OL4A 3H9QA 4Q18A 3TDKA 3QEBZ 1PR9A 1R4MB 3E5MA 2HMWA 3CVOA 3H5NA 2GN2A 3BJMA 4UMFA 4YJHB 1XZKA 2FWBA 4J7XA 4K28A 4QTXA 1XYGA 3ZHXA 2J3DA 4HNAA 3HL0A 5JCJD 3H1GA 2VZ9A 1USWA 1QP7A 2DHCA 4EY4A 1BFKA 1IAQA 5BW6B 2ZJ3A 3LFHA 4TQ9A 1ISIA 4UTOA 1MTOA 4WHMA 5ULLA 2A0UA 1U1GA 4KI0A 1B1CA 1R5NA 1OLXA 2FRVA 2ZT7A 3OTHA 1MF7A 1FXWA 5GONA 5CBKA 4Z7QB 4G8DA 3D7LA 4MI9A 1GQQA 5LZ2A 4CFYA 2Y0DA 3GRKA 4HADA 1AF4A 5KTNA 1T3HA 1QCDA 4FYPA 4LHVA 3H16A 1ZAKA 3F4LA 3ON5A 2HREA 2VSFA 4OP2A 2H0RA 1IONA 5E9JA 2MYNA 1KEWA 1SVLA 1G17A 1YQTA 3NTLA 1WG8A 4AUEA 5B7NA 3DHYA 3FCAA 4CIWA 1Q12A 2WYUA 4RVNA 4AECA 4D5GA 3F6PA 2JASA 1XTKA 2OVFA 3AG6A 4YC7A 3URMA 3L8GA 3AHJA 4BP8A 2I22A 4KH0A 1ZR2A 1BN7A 1AMUA 5FUBA 5F5LA 2R7NA 5BOSA 1H2AS 2RB5A 1X9HA 4G0PA 3IKTA 3SBOA 4TSFD 4YBZA 2X0IA 4I14A 3FCOA 5CLGA 3JARA 5JDIA 3D31A 3KQNA 2HBZA 1RDFA 5HCIA 4H7PA 1XEFA 1T26A 1FXWF 3K71B 2ID8A 2B8JA 4F06A 3WL4A 2AUNA 4G36A 4JBXA 4A0QA 1U0GA 4XX0A 4PYJA 1NIPA 4BGDA 1UXJA 4N1AA 3OOEA 4U7GA 5ALJA 4AN0A 1GUZA 3ETCA 5AM4A 5JCOA 3OLYA 3SHVA 2QTNA 3LPCA 4BNKA 1U2SA 3UATA 4QT4A 2ZTUA 3K92A 5FQNA 2MYPA 4B71A 2O20A 2YZGA 3BB1A 4BBAA 4A0HA 3HCOA 1Z6AA 2PRIA 4WEOA 5CVDA 3IV9A 4NNJA 2HMYB 5JQGB 4XQEA 2AI1A 3FUTA 5CIQA 5LWHA 4Y7DA 4YPOA 1YKGA 3A9WA 3AW8A 1A9XA 5A5EA 3PHJA 5E6SA 1LK0A 3H86A 4K6HA 1X1AA 3H3XA 3GQBA 3IA2A 3IXQA 3K1YA 4R2KA 1Z0IA 4RVOA 4AIIA 4ALJA 1BJRE 3OPVA 5B57C 3C43A 1DQSA 5HIJA 1FX0B 5JISA 1PI3A 2OCYC 4HDKB 1W8DA 1J70A 1SBQA 1NHWA 2P77A 2ET6A 3D2LA 4JC5A 4LGYA 3TQFA 3ZD9A 5K8LA 1D1TA 1TZMA 2WM8A 4JXJA 1QRTA 3R5HA 1NC1A 3GCZA 4UQPA 3HKBB 3FZGA 5C1DA 1BJKA 4JUFA 1CUDA 2A1TS 4KBGA 1QLHA 4TLDA 4NQZA 5AKHA 3TLCA 1RRVA 2Q8QA 4KITB 1JT9A 1W0JA 2FNAA 3B89A 4Y6OA 4KOEC 4NFLA 4DPMA 4F5DA 5KTTA 5DZSA 3DMDA 2OV8A 2I4LA 4I3GA 4RTPA 3PLNA 2XUFA 4JYPA 3HCBA 3CH4B 3STWA 3KZOA 4L02A 2DUNA 4F5EA 1G2PA 5IXJA 5KWJA 4XDHA 4ZV9A 4JFRA 1L7OA 4DR1B 3QA3E 4OJNA 3BH6A 3ROKA 3S99A 1BYIA 3DUFB 2YFHA 3GEPA 1MAUA 4M21A 5DLEA 2XGJA 1S5PA 4ASUD 4ZCLA 2F7SA 3D6FA 3ZQ4A 4ENPA 3GBPA 2J7PD 4MYTA 2DTEA 1KC3A 3QVXA 4TRRA 3D43A 4L0DA 1ONSA 5CXUA 3DVQX 1ZDMA 3AGQA 2CFCA 4B5KA 1AO0A 3EHDA 3FZNA 2YFYA 5FJIA 4BV9A 2LD4A 3E23A 1PX2A 1GD1O 1R4ZA 3H7AA 4H77A 4JT8A 2IFTA 3UICA 3AUJB 1RLOA 2FFJA 3I0NA 621PA 3OE1A 4G41A 3AC0A 1L3BA 2AFHB 3L0DA 1NJ1A 1Y9ZA 4CG0A 1LNSA 3S81A 1QIMA 3NEYA 4IOKA 3P96A 1QLWA 3QI2A 1QH1A 2BPOA 4FDAA 2IX3A 4MROA 2Q2OA 3W8DA 2HPHA 5H3LA 1JU9A 6CHYA 5IRCD 5A0TA 1Z75A 3F3SA 2XHEA 3C7CB 1J0DA 2NXCA 3QMMA 3JRWA 3E7XA 4J0EA 4DHEA 2X8WA 3HCPA 5B58T 5JO9A 2UVQA 4ENWA 3AGPA 1AURA 4O2AF 5DEOA 3VBCA 2Q4EA 4CEIA 1DE0A 2VS1A 2AJ8A 4IS2A 4WBNA 1OHHA 4UCFA 3MTBA 5B2FA 1GL9B 1VE9A 2YVKA 3P20A 4HO1X 2IWRA 1SHZA 5PGMA 2QD4A 3O92A 1DRJA 3A4TA 3CUYA 3FNHA 4P7KA 3UFXB 1LZKA 3ZWAA 1FDTA 4AMVA 3IJRA 4GLBA 4POOA 1WETA 2P1DA 1PG2A 4G2NA 4PWZA 2VTVA 1BVUA 2XCTB 4FILA 5K0TA 1SOMA 2KBFA 1GL6A 1Z2EA 3KIPA 1SKQA 3TFWA 4CTJA 4C0SA 3NVAA 5FBKA 3NH6A 1X2EA 4J1NA 4UM8B 5FWAA 3C8MA 3VSAA 2CXSA 2HIAA 3UKOA 3FNIA 3GGOA 4I6GA 2XAUA 3TSCA 4JOSA 2QPAA 2ZYIA 3D5TA 1EI9A 4A73A 2HJRA 3CFYA 4ZO6A 5H7XA 4J76A 1Z6GA 3F1LA 3HDQA 4L6AA 3T9FA 4R3NA 3R7LA 3TUJC 1TF2A 4F7DA 2QOEA 1ECBA 4X6LA 3S40A 3ZUGA 2BCGY 3S68A 3E9ZA 2D1YA 4HLCA 2VPYA 4F45A 4HXGA 1L5KA 1ODCA 3H4TA 5LQSA 1FXUA 1J9EA 1QK3A 1QG4A 4HGYA 3K2EA 4JJAA 4EUNA 2CYAA 5KX5F 2DLCX 4DJ5X 2VG8A 3VUEA 2V4MA 4DNPA 2FE1A 4HDRB 4BASA 1GGJA 1FTQA 2RH5A 1JW9B 4HG2A 4B0OA 1J2EA 1DZ3A 4RLQA 5B2ZA 5D84A 1Y3CE 3L1KA 4Y67A 3RTAA 4LDNA 2ZZNA 5HKAA 3R7BA 5KB3A 1LEHA 3PC7A 3JALB 2AN1A 3O4HA 4HDOB 4QUGA 5BSRA 3E84A 1CNFA 1Q0UA 3AM1A 3KQPA 1CY2A 3X3HA 2VA8A 4KXUA 5K0EA 5EQDA 2H51A 5G40A 2W2PA 1T4GA 4L7QA 5H80A 2IXAA 1H0KA 5EN4A 1T1IA 3LKZA 4CM9D 9ATCA 2C4UA 3BBPA 3OQHA 5A4KA 2EX4A 2VLBA 1NPYA 5AIAA 1UH5A 1DLIA 4AG5A 6ABPA 1E0SA 1PGNA 3ZW9A 4Y6PA 4J0DA 4HLQB 2WINI 3C5HA 1PEAA 4L5CA 2YL2A 3I73A 3IHKA 1KDOA 3NVMB 1RHJA 1JA0A 5HQ3A 2C94A 1V6CA 1TB4A 2RGXA 2O3TA 3HEBA 4UBJA 1E5QA 3PCTA 2WJ3A 3DKIA 3T7IA 3IP6A 2XJ4A 4YGXB 3V4ZA 5CYFA 3GFSA 4LRYA 2W6ZA 3GAMA 3MF4A 5HQ3B 5JDIC 4ETWA 1EU1A 5CT5A 1RACA 1OU4A 2OP0A 2J09A 5FDFA 1CRWG 4FKBA 2H7XA 4ZOLB 3RVBA 1V5WA 1E99A 2FZWA 2X3YA 2BOVA 2QG4A 4LY6A 1QB8A 2N46A 5DWQA 1K8RA 5LB4A 2ST1A 4L4YA 4BLOA 3OCXA 5B4VA 1P7YA 3GB9A 2FN3A 2XEXA 3PI6A 2H2GA 1R9NA 1R0BA 3MERA 3PFCA 3JATA 4BU1A 1TZ2A 5KDDA 4L7VA 1PJBA 3DBLB 4MCHA 5L4SA 2VEDA 2VYNA 3Q9LA 2W00A 3A6FA 5G4LA 4I50F 2I6XA 3TIXB 2CNBA 1W88A 2YNMC 2BFDA 3KTOA 1UC4B 2DHQA 3WGMA 1LQUA 3KB8A 4MR7B 3F8WA 3HFGA 4UEJA 1ORWA 5A03A 1D09A 4OV6B 1BS2A 1CE8B 3UHOA 5ICMA 4JJ8A 1XPJA 1CY1A 3EGXB 3F7NA 3PR1A 4RSMA 4AKEA 3K6SB 4OSPA 4QSHA 4FYJA 3DE5X 3PEEA 1OT5A 1E6LA 1B0UA 5CTJA 3F67A 3SSMA 3SZOA 3L6CA 1QVAA 4CE6A 5TMDA 4M9XA 2ZBQA 3JVEA 4NCAA 2CDBA 4E5MA 2ZRCA 1E4OA 2RH4A 2RDMA 2XKAA 4EJ0A 5MDHA 4NU8X 3Q8XB 5K3FA 4KO4S 2F2TA 2VPZA 3ZHBA 4EEZA 1T0PA 5KYNA 3C6XA 5ALFA 4R8KA 4LFCB 3AFHA 2YKGA 1VCHA 3KKKA 3PQDA 1OVGA 2KB0A 3C8UA 3D6AA 2O7RA 2XWPA 3LNTA 4JKOA 1DBQA 1GGNA 1XE3A 4TVKA 5I8WA 4J3FA 4UM5A 3V5NA 3G0HA 4DB2A 1EESA 1P39A 1JIJA 2ZT6A 1OZAA 4UZSA 3ZGOA 4JBLA 5H8WA 4B46A 1QIIA 2VJYA 4KPUB 2G80A 6YASA 2UYOA 1EHYA 1WAMA 4BIMA 1M7HA 1XMVA 2B4QA 5LIRA 2Q9CA 3AB8A 4DSAA 1G64A 2WWGA 3PGMA 5K4AA 3NNSA 4F9TA 4A0GA 3TW4A 2WSMA 4P5EA 3EQ6A 5IMBA 5L3VA 3G2HA 3V4RA 2AG6A 2IYFA 4CMEC 4DJAA 1W49A 4ZFNA 1PT7A 3M1YA 3QLTA 1OI4A 4N3NA 1Y6GA 2XB8A 4HRVA 1W4AA 2CLFB 1KAMA 1QO0D 3PU6A 5A6VA 1MMFB 2A94A 4MJ3A 3FHCB 3KOYA 4CM3A 2XJ9A 3PEWA 1ZA2A 2JI7A 2IYXA 5FPHA 3F5FA 3LKVA 2WUEA 4LBZA 4PR0A 1HQYE 5JHHB 3G23A 3M5DA 5K8UA 1RSZA 2BLNA 3AR2A 5AXBA 2A8YA 4YTEA 2XZOA 1LPAB 3LCVB 3PGKA 3REGA 2E4UA 5E8RA 2G72A 3I4LA 1I6MA 3K1AB 5DHAA 4LYGA 2GPJA 5FKJA 1GG2A 2PBRA 3N28A 1RE1A 3CQ9A 2EGUA 2Z09A 3CMMA 4NPHA 4Q9IA 4P83A 1W87A 5EZYF 4BE9A 4WNCA 1BU5A 4KXYA 1E5TA 5EIBC 5B3LA 5CEJA 1F20A 1GR0A 3GP3A 4NBWA 1UJ6A 1GITA 4TTSA 4UXJA 3W2GA 4OP3A 4RPLA 1ISPA 3ZWVA 2QAGC 3MTQA 1JKXA 4CN8A 1VYUA 4RLSA 4LRUA 3L8HA 2A35A 1BOFA 1JNYA 1JG2A 1Q1EA 1MB9A 5ALKA 1SUEA 2XUOA 5K8TA 1FU8A 1RWPA 3QY9A 4DAEA 2PRKA 5ENZA 3GPDG 3AZPA 4P98A 5BSEA 2G09A 4JZKA 3VJLA 4QFDA 4PF1A 3S4YA 3CLTC 3QVKA 2HFJA 2UYHA 4LJKA 2QGZA 4S1WA 3UOWA 2YV3A 2Q5QA 4DW8A 1H1DA 1FU7A 4IWNA 3ID6C 3B2NA 4YPVA 5JAUA 1M0TA 3EPKA 5FPKA 2UDPA 2WW8A 1F12A 3P45A 4YDRA 1XN4A 1T8PA 1JEJA 2YFKA 1XXHB 3CIOA 3Q9UA 4V0MA 4CM1A 2MMCA 1Z68A 3AHGA 3EHEA 1ID8A 2DCMA 3J80A 3M9WA 3DKPA 2TRSB 3ED1A 4A0SA 4C4ZA 3IT2A 3TG8A 3CEJA 4ERNA 1MAAA 1K6IA 1FFWA 2IXFA 2JGAA 3DFUA 4M0PA 3RKSA 3ZOZA 4A15A 3TRDA 2C9YA 1BVHA 1E9RA 1P18A 2BR5A 4Y9DA 2JFZA 1XRRA 4QNRA 2X19A 4EI9A 4ZGBA 2VXBA 1MV5A 4ML3A 3A3OA 3LDGA 1AKUA 5KMGA 2FMUA 1J4AA 2RHRA 1M6HA 4O4IB 1K27A 4HVTA 3TJMA 5IUKC 3VTKA 3T9AA 4HLNA 3CX8A 2P2SA 1JFLA 3E8MA 2QMUA 4F8EA 2NVUB 1DXHA 5FBLB 3ESYA 1ZW1A 4NCNA 4MCAA 2LIVA 3A6LA 2DFLA 2IYOA 1WCIA 2JLQA 4O1MA 4RIFA 1QZXA 2ZBUA 4BLTA 2WT4A 1AKYA 3PPVA 1M74A 3OJXA 1NUPA 1SJ9A 3WLKX 1XMXA 3A0UA 3M1AA 3MZ0A 5AJZA 4YRRA 5T67A 1YFKA 4U7HA 1KDZA 2IF2A 1N5OX 4Z7OB 4G89A 2R97A 4AF6A 4I1VA 1GPBA 1SCKA 3ENVA 4DQXA 3S1LA 2AS0A 4M0DA 4YAUA 5DYYA 4WOKA 3RFXA 1OXMA 3VAYA 3ZHUA 1QGED 2UZ1B 3IPYA 1JX6A 3M33A 2Q9UA 2XGGA 3G9UA 5A04A 1KJQA 5JSHA 5DX8A 1Y4ZA 4OQPA 4LKOA 1I6KA 3U7JA 5L51A 1KO7A 1I7NA 2ZWMA 4NY1A 4BO2A 2M2IA 1RLMA 2PUFA 2AZ4A 4LYEA 1IHOA 16PKA 5F33A 3TDNA 3DV0A 2W2KB 3TGWA 4TT3D 3DTVA 3OZSA 1L5MA 4KXXA 4MQ6A 3X2FA 1XTIA 2BWJA 4L4XA 4US2R 3VNQA 3QM1A 1WVMA 5JOQA 4J1SA 1PZHA 3KUKA 5FB3A 2I71A 4L76A 1OAOA 5FWDA 5JXWA 4CM9A 3KEMA 2AE2A 2FX5A 5KWEA 3WRYA 1NUSA 3K4HA 2PZJA 4FKMA 5IEJA 1RLJA 4OMDA 1TLFA 3OLWA 1IBKB 3Q3CA 4GM4A 4CODB 1D2AA 1RWBA 2H4YA 3MILA 3SG0A 4AX8A 3I61A 3KYCB 1GSOA 2VNKA 4G4SP 5KYYA 1B2LA 4MVJI 3QMVA 2FB9A 2YW2A 4KIUA 3NETA 2AYYA 4ND3A 2XGSA 5EWMB 3HM9A 1O89A 1G8JA 2FPPB 1FDUA 4GZMA 4JR2A 3T4EA 4BKOA 2FFHA 2FZ5A 3T52A 1XWIA 4KQJA 4GRIA 5LM3A 3T5AA 3S1AB 3BL8A 5BXQC 4LV8B 2ZSHA 4ZZIA 4LDAA 3ZR4B 5EIWA 2BIFA 3WK7A 3KOUA 2Q5CA 5F21A 2VSYA 3U9SA 4IIJB 4MTCA 1UWKA 2ZB7A 3SI7A 3N8HA 4YONB 1B6GA 2FJ0A 5CVVA 3SXPA 3D3EA 1M67A 1SD1A 1YUBA 2CMDA 5I01A 2FPRA 3U31A 1H0RA 1CRLA 2VR1A 3OFKA 3BS4A 2WD8A 1A4UA 3EVTA 4G8BA 2JLXA 5EZYB 4IYJA 1LGYA 2XUZA 4X91A 4G26A 4QICA 4P4UA 1VJCA 5IKOA 4LRTB 3DE2X 4K2HA 1QG0A 4NJMA 3ZGLA 3KYDB 2XB9A 4LCJA 4EEXA 1UOQA 1MENA 4G5GA 2G9ZA 2HN9A 3DDNA 4DMHA 2QW8A 4CNBA 1F0YA 2ZYGA 3LUFA 5K0LA 4K0RA 4U5XA 3KR2A 4WXHA 4AN4A 4IV5A 5BWCA 1EYZA 2B1IA 5KVAA 3GI1A 5C80A 2CL7X 1O2DA 2V6GA 1T3ZA 2HHAA 3NWPA 4X54A 5JAPA 3AF2A 2SKEA 3JRNA 4LJ7A 4OFBA 3TRHA 2HJVA 5JEEA 1KKUA 2A5FA 2R6AA 5AESA 3SEQA 2F59A 3ZH9B 2Q5FA 4RD2A 4LBYA 1LNZA 3VR6H 3ZWMA 4CKWA 2GI4A 3F90A 1DC8A 1N1EA 3QPBA 2Q0HA 4HX9A 4H7IA 4PXSA 4DWJA 4Y18A 4DWWA 4LVUA 1NN3A 1KGDA 1Y7HA 2PX0A 1N0IA 3FCSB 2H31A 4Y1RB 1AGYA 3EZYA 4X94A 4XQCA 1S1CA 2ZRNA 3BFPA 3A6KA 4ESEA 4P38A 4AW9A 2IEGA 5LLDA 4F46A 2ASEA 4R2XA 4U9UA 3MLAA 1YO6A 4YCAA 3O75A 2CL6X 2AMVA 1ENPA 1TGYA 3KPYA 3KKNA 2ZJOA 1JDSA 1QX3A 3FSRA 1N2EA 3EB9A 4GBMA 3M6VA 3CGGA 4LXXA 3LLCA 3A4IA 3AJRA 3JS5A 2Z6VA 3RJ5A 4BE4A 3KJEA 3EVCA 2JEZA 1II9A 5F35A 2PTGA 5EJ5A 3V1TC 3HY6A 4HSEA 3JQPA 2P4QA 4JQOA 5H68A 1DBPA 4RMHA 1VSUA 4UVHA 4L27A 1Z6PA 4KNYA 1C1YA 2E49A 3NHSA 1WNFA 2EGGA 4DCVA 1EP1B 2HXGA 3R6WA 3RS4A 3FYUA 3QXXA 4F11A 2JHAA 5BOSB 1P9RA 3T54A 1TVEA 3G2KA 3HGTA 1S8FA 1G6KA 4PVCA 1OW3B 2GN4A 3W5SA 4C5CA 3KDSE 4ZZ3A 4DV0B 3WIOA 4Z86A 3O4VA 5HGJA 1NDHA 2GEJA 2HCJB 2ZWVA 2GRJA 1CP2A 5F9MA 2G1KA 4ZHQB 4MV6A 2P6UA 3U39A 5A4DA 3HBMA 4DJTA 2J3JA 5F5XA 1CUAA 1KI6A 3FJ1A 2I2DA 3SVZA 1W4CA 3LCUA 3TLYA 3UJ7A 3ZNOA 1NF2A 1XR3A 1MB4A 4J9UE 3FDIA 4UW9A 1WW3A 1TMYA 4IH4A 2XXAA 1CR1A 1D6MA 1HMYA 2CLOB 2NUAA 3OO1A 3RVQA 5JQGA 2ALJA 1X7YB 5BNIA 1VL2A 2X2FA 1PZFA 4RD0A 4UNNA 3UJ8A 3UF0A 1YVRA 1ZGJA 2IIPA 3VVBA 3PFHA 4R2IA 1TD9A 2AR0A 2H2FA 2VP9A 4OL9A 3UO8B 3WQRA 5K51A 3KLOA 1IJEA 1I2AA 1UKVY 1J0BA 1X80A 4PZZA 3NJ4A 5IJ9B 2HSDA 5ECYA 4DMFA 3EA0A 4D4KA 1DTSA 5BN3A 5FNZA 1COWD 1JGTA 3LWDA 4U7PB 4YCJA 1JEYA 4BN5A 4Y30A 1E3SA 2WYOA 3OT1A 4RQTA 1N33B 2LTAA 1HEUA 3S2ZA 1I7DA 1JYEA 4HZUB 4BEWA 3W4KA 4IYRA 5IEBA 3K9BA 3L7OA 5C35A 4DUGA 3K0SA 3FTNA 3QTTA 4LNHA 1DG1G 1Y7IA 3MG9A 3AR3A 4QQKA 4BWVA 4EY7A 4M7RA 2BFBB 3CG0A 4B3GA 3V1YA 3MUNA 5DW0A 2PKXA 5EKDA 1YZNA 1NNSA 2PMCA 3NEPX 1NVGA 4J7UA 3EF0A 2DWPA 1A71A 1QX4A 2NOAA 4RMIA 2CV0A 2X0KA 4B4OA 1TJPB 4P4TA 2XA1A 1W94A 1ULHA 3ESXA 4FSDA 1T4DA 3OCUA 3I2HA 4IEFB 4AUNA 3DT8A 2O8DB 1G5IA 2OCPA 1GSAA 2AWNA 3PHIA 2OFOA 3GD5A 3UYKA 4CL2A 3IE2A 2DHRA 4MI1A 3ZK7A 1AN0A 4TS3A 4DR5B 5EQFA 1BDBA 2BGGA 3BF8A 3G3EA 4PAOA 2R6GA 4TLMB 1GCGA 3KKEA 1GKYA 2HEIA 3NHBA 5EZ6B 5SICE 3AETA 4BV8A 1E62A 3Q5GA 1KVTA 2E4XA 4KPGA 5KJEA 2PCLA 2PRZA 1R9GA 4FKZA 2XRYA 4P58A 3EIXA 5LKAA 5FHQA 3EMVA 3Q0EA 4FR2A 4BMYA 2NUTB 4JX9A 3FVRA 3FNGA 4JP5A 5JI3E 1IM2A 2CF5A 3NBYC 1DCKA 4REQB 1MQSA 3H1PA 5KWSA 1GU0A 3O9VA 5FA8A 1XEXA 2I3DA 2O57A 3QUQA 5TT1A 3RQSA 2AIRA 1T2VA 3EOZA 3KAKA 2YYAA 3FOBA 4W9NC 3QUSA 4WBNB 1Z07A 2AOTB 3TBKA 2EW1A 3DEJA 4W1PA 3J81A 3BWCA 3M1LA 4LOHA 4C2BA 1NXOA 2VWGA 2OKCA 3SZRA 3M6UA 3I5YA 2PAFA 3TAUA 3ADCA 5AKLA 4ABYA 2XNCA 5ELXA 3IXMA 3EVNA 4ZK6A 3OPNA 5I3CA 4CEIB 1X0VA 1IEXA 4JJEA 1II0A 1UJMA 2JFPA 2QX9A 3MCZA 4KX5A 4ZJPA 2ZJZA 2A0KA 3ONNA 4XD2A 5IBPA 4PBRA 1VL0A 3K09C 1E2PA 2H11A 1Z18A 1LTHR 3IILA 3L41A 1R1DA 4HKTA 1Y3AA 2CLCX 2V4ZA 4KQEA 3N0RA 3DBVO 4BZZA 4FM9A 3EZXA 3F49S 4OQFA 1DP4A 3ZZ0A 5JD6A 1YR8A 5AJHA 1KAEA 3OX1A 3LYUA 1WBDA 3ADKA 4U2DA 3U7IA 1UP7A 3DM9B 1NN0A 3OTIA 3PE3A 4PZCA 4F3KA 5MHTA 3HK2A 2QORA 3MCVA 2W6PA 2ANCA 2V9PA 3SYLA 2GO1A 4RPKA 1DIRA 4IDAA 1IEVA 1KIFA 1F2UA 5EJ6A 1VL8A 2YBDA 2ZJ4A 1CIJA 3VNSA 3FCCA 5F7JA 4BB6A 2EAUA 1PJLA 4KLCA 2JJYA 3KLPX 5IVPA 3O47A 4QG3A 2YRFA 4N7MA 4UDNA 1RHRA 4MWDA 2MSLA 5DNDA 2AZDA 4FXPA 2D8MA 5G1PA 4D57A 3AKCA 4XWAA 1X7WA 2QU8A 2AOXA 2GCIA 2YWGA 5KBYA 1K08A 2YIVX 4I5DA 1NJSA 3QFHA 1H2BA 4CKZA 4BFCA 2WZDA 3RHFA 3NBAA 3CE9A 3JQGB 4IKPA 4D8YA 3MGCA 3UK2A 5JG7A 1YQDA 5NULA 2JZNA 3UWKA 1C2YA 1YJ5A 2WHQA 3W8RA 2XD4A 4AY6A 2OO5A 2W6OA 5KYXB 1VRCA 4PXAA 1TDJA 1TVKA 1VPEA 3A3PA 5A06A 2ZULA 4M1QA 1GPAA 2WVJA 4G85A 5GZ3A 5FPTA 3CN9A 1T9GS 4KO1S 1H8HD 4DNOA 5F98A 1YUMA 3I23A 5D1HA 3UK7A 2XMCA 3KELA 2RIPA 3C7TA 3EWSA 2NU9B 1PF7E 1BVRA 5EIXA 1EH5A 3Q2OA 3GJ3A 4OK6A 3G68A 1SBTA 2EWMA 2HQ1A 1ZNXA 4PX5A 1JMKC 4R1LA 3OMLA 4WECA 1TTPB 4NJMB 3ZQKA 1CBUA 4B3JA 1XNRB 1ACMA 3RREA 3O9MA 4RVGA 3UCEA 1XQWA 1DT5A 1FYFA 1ZMTA 2IUTA 3MT8A 4NG5A 5LD2C 4BNYA 4DMGA 1IY9A 4WTOA 3N39C 5TGZA 1HDRA 3KDPA 3MB5A 3OD5A 1Z35A 1DBSA 4YI5A 1UAAA 4ZT6A 3H5TA 2WIKA 1LWNA 2OFPA 3JXEA 3UHAA 1U0FA 4O2AB 1SBZA 1Z6YA 1O6ZA 2ZWIA 4PYOA 4YI3A 4RNDB 4YP5A 3WP0A 1S3SA 4KUEA 1DAKA 3VPCA 5J4VA 1CQPA 1GGEA 3FGZA 1Q7CA 4UTVA 2XMQA 1JYFA 3DMGA 1NXSA 5DBIA 2V03A 3ED5A 2JLYA 1RS0A 1XCGB 1UANA 2DF8A 3OF2A 1JLSA 4S1NA 5LZ4A 2ARKA 3DBLA 3JVVA 3CUVA 2J31A 2L82A 3V4VB 3ZU6A 1EP3B 3INYA 4EW1A 2JIRA 3P2EA 4MGZR 4EKDA 3IMFA 4BPBA 3MUOA 4IXNA 5KYKA 1CZKA 1F6BA 3BFVA 1JDVA 1S01A 4E5PA 3E6AA 4Q9KA 5BN5B 3JATB 4JLNA 1XRNA 3QE9Y 1CE8A 4GXTA 2UU9B 4ARZB 3E35A 3E82A 4UU1A 5BVGB 1F60A 1AZWA 3CZ5A 4LYAA 1MT3A 4F91B 4F2HA 5DU2A 4NK4A 5EXEA 1WD7A 4B9EA 3G2NA 4PZ0A 3T0IA 3IP3A 2YCBA 3ASUA 3F46A 1J1UA 3Q7SA 1QH0A 3H2KA 4M0LA 4IXDA 3NC4A 3RU2A 1Y37A 2R8EA 4X9XA 1YI1A 2C2GA 3S29A 3PUKA 1U9IA 1QAOA 1AKNA 3EUWA 1OA1A 4KVGA 2X0FA 1Z4OA 2J6CA 3RWBA 3ZWOA 1ENZA 3JQFA 5A4AA 3HN6A 5JCPA 1EK0A 2PUVA 5IFLA 1P2SA 1W59A 2SKDA 4GZ3A 4W5HA 3CT6A 5EOVA 5HMMA 1IY8A 1GPH1 4RELA 5DRTA 4PG8A 3VR5A 4CIVA 4I5GA 2G3YA 2ZE7A 2ZXFA 4B34A 4KRXA 4TYMA 5BNZA 1OGYA 5BORA 2BM1A 3VM6A 2AR9A 1DAPA 1JVNA 1SQ5A 1TMOA 5D8DA 3T9EA 2JFVA 1KFJB 3GF4A 3ILSA 1KH2A 3AESB 4Y2SA 2CUNA 5TX7A 4WN9B 4M0CA 3BMNA 5EVCA 1VXRA 1E1CB 3SFZA 5KTKA 5LOVA 2QZJA 1CULC 3E61A 2OAP1 1FMJA 1ZM7A 4H1HA 3ZZNA 2OCGA 4DGQA 1S4MA 2VCEA 1WD5A 4KTVE 5EIOA 4W5TA 2X1MA 2EFDB 3FOFC 2H52A 3DMHA 3ET5A 1OLUA 3EG9B 2FSSA 2FW8A 1BMFD 4N54A 2Q1SA 4M1YA 4X63A 2VPIA 2VH2A 4FWTA 1G8PA 1MP0A 3HZZA 1F3LA 1HLPA 2A4KA 3R5JA 1MEOA 2FR8C 1JR4A 1XZAA 3DMNA 1Y0BA 4MEJA 3U3DA 5IYZA 3BWXA 3K1AA 1N2CE 3WGOA 4CWAA 2GBLA 4M99A 2Q1TA 1NW8A 4W8GA 5CPBA 1PFGA 1T4CB 1NAIA 1EK2A 2CCGA 1U5AA 1XPOA 4DV2B 4JUDX 1GT91 1PUIA 4G01B 1YFJA 3PCXA 1ZVJA 1PZEA 2QJRA 4C4OA 1YCGA 1JG7A 2WHRA 1ATZA 1VLZA 4E51A 4MV0A 4RJLA 3BJZA 2Q0XA 4J8PA 3N7TA 4H9GA 4ETNA 4YJ2B 4FWBA 2XQIA 2QPOA 4HHEA 2H18A 3RC9A 3L7KA 1M2NA 2EBUA 1B0AA 1X9IA 5L40A 1HKHA 1DUVG 1KI2A 1CUCA 3WLEA 3T5CA 1Z0FA 3GVIA 3HG7A 2RHBA 3E22A 4YAJA 4ZVRA 2QTMA 5L6LB 2RMKA 4A6EA 5K5EA 4X1KA 3PQEA 1FVOA 1P1FA 4RYLA 1WPXA 3VMMA 4C7OA 4IR7A 1ABBA 4EENA 1JEEA 2C3PA 1Q0HA 1ZCFA 3RC8A 4K9KA 4TKUB 3B9RA 3DV2A 3DVLA 2FK7A 2FZCA 4OVKA 4XGRA 4XJSA 5F1OA 1GZ6A 1G1MA 2X4IA 1R3DA 5DHTA 4PYIA 1QH8A 4LK2A 1QIKA 3IDQA 4N6OA 2QLLA 5E9QA 3I9FA 5IJXA 4I1YA 2O19A 3CCBA 4RCVA 5MN6A 2LE0A 2WD9A 5LYJA 3V1LA 4MS3B 2NP7A 3AUXA 1XVIA 3GUCA 5ESRA 1L4MA 1E2KA 1DINA 1NQAO 5C5CA 3A27A 3KQQA 4YMSA 1Y42X 2EG5A 2JJ2A 2O6HA 3N6XA 4DG5A 3D0KA 3UBTA 3L0OA 1YZUA 4PAGA 1SBIA 3PEUA 4Q15A 2CKMA 3AF0A 2YWFA 1P3JA 3GV0A 4U39A 3LBYA 2JFNA 1OI3A 2IDMA 5TY0A 1O94C 2BFPA 3GMDA 2J0QA 4UCWA 2AHOA 3I2GA 2OK7A 3LD9A 3QVGA 1HDZA 1SHLA 2XT6A 3FLMA 2NVUA 4KBFA 3AY6A 4PG4A 2PGIA 4CVNA 2W7TA 2A5JA 1IPEA 3FZYA 2D4HA 5DNWA 3TAHA 3G7SA 2J45A 1I2ZA 2RBEA 2B30A 4C7MA 2C5HA 8ABPA 1BXGB 4E1VA 3FHJA 5FLXA 4GGOA 2C2ZA 3GRZA 4D8XA 4EPVA 4JOQA 5JPDA 3MGBA 3TNYA 3CCFA 5G0TA 3BFJA 1KEZA 3R7AA 1K2VN 3TZCA 3OQIB 1M8PA 1U3FA 1E7SA 1RKQA 2C3MA 4URUR 4HJXA 2OCKA 1ZI6A 2W4MA 3LX8A 5AKXA 4C3OB 3FCEA 3IVRA 1PWEA 2GERA 1ULAA 1T3TA 4EUSA 3LM8A 5LMNB 1XTRA 4Q1FA 3PYLA 3HXLA 2Y2UA 1DKPA 2I1WA 3H2HA 5TXGA 3ELYA 2ZTVA 4KHZA 3V2GA 3WA6A 2QV0A 3MWJA 4BXOB 1FVFA 4HWRA 1I80A 2RHJA 2XDQB 2WYIA 3E2IA 1ZLXA 4CI0B 2QWXA 4Y2XA 4Q9HA 3RWOA 2QZZA 2PEYA 4PGMA 3W8NA 5JHGB 4TZ0A 5JJKA 3K8ZA 3CNNA 3GCWA 3D3WA 3WDKA 2VI5A 3E1KA 2D06A 4ISCA 2I2XB 4L08A 2Q29A 1VLMA 3G2MA 3RRYA 3UMGA 1V7ZA 2VZ0A 5T6MA 1VCIA 5WRFA 5LN1A 2OP1A 2FUG6 2QN9A 2W42A 5D2CA 2I3AA 1XZDA 3C6MA 4P5DA 3RVMA 3INGA 2RK6A 4BO8A 4DCNA 5BT9A 3S1SA 2F1HA 1NRIA 2XYHA 4BQPA 4DA4A 1D4OA 2IYSA 1L5HB 2D2IA 4R3WA 4XRGA 3ZJTA 3NV7A 3DCIA 1QOPB 4TWJA 3R4CA 3RARA 5IJ0A 1E79A 1H2YA 1G4UR 3E3MA 2B4KA 3L84A 3UV6A 4XH9B 1J49A 1S9DA 3IOBA 1DMRA 1R0SA 1EZZA 1BMTA 1HFJA 3N74A 2OYRA 2O07A 2X8JB 1TM3E 4QTYA 1UBUS 4G07A 4AP9A 2WB2A 1N77A 3ZE7A 4ZEOA 3RB8A 4FFVA 1CVLA 5L8VA 4RH3A 1D6NA 2COUA 3NZEA 2NU8B 3JYPA 1JHZA 2VYVD 1HG0A 2MDTA 421PA 1WDKA 3A6ZA 4MR8A 3T4PA 3B51X 5JEDA 1GGFA 1VI6A 3EVAA 1Q6YA 4MQ4A 1GLVA 1TMGE 5JBQA 4QBTA 4W99A 5KDLA 2ZZKA 1FTWA 4CG1A 1GRNA 4IGFA 3ZWNA 3FKSA 4I55F 3OE7A 3BGSA 4WH0A 1SXJD 2X5JO 3RYHA 1ANKA 2AMJA 2Y4OA 3DBHB 1HSOA 3R75A 2YWEA 3VI4B 4JGIA 4XCVA 2MINB 2GZHA 2YOFA 2ZIZA 2WIGA 3OQ6A 1KVSA 5I7HA 1ZJ5A 4KSBA 3OF3A 1P0CA 2B8EA 1T8WA 3HRIA 5A3QA 1YR2A 3HPQA 3GFBA 3I4FA 4XJXA 3VPDA 3WNQA 2Q7DA 4OFXA 3I9LA 3W7AA 1DC6A 3UY4A 1H5UA 1SG6A 2Y1FA 1GAJA 4NCHA 3K1ZA 4FYMA 4W5NA 4F9EA 3HN7A 5ITSA 3A6GA 4G1BA 1URPA 3M5CA 4ZOLA 3DBOB 3HV2A 1WUJS 1WXQA 1N9ZA 2R8RA 5EZ5A 2RK4A 4UNSA 1BCRB 3VRHA 3U3JA 1CS0A 1SKBA 2PANA 2YJ6A 4FEGA 3V1UA 4B3TB 1QPZA 5HUJA 4RD3A 5H4HA 2G1JA 2ID7A 3KEQA 4M3NA 1VSVA 4QGAA 3GPIA 1BDIA 4IWYA 2E87A 4OHFA 4YLGA 2QSYA 5HX7A 3A4LA 4RIEA 3UNXA 1Z8NA 1GQYA 2ZOSA 4RSGA 4CMHA 4RV9A 2I8LA 4M98A 1XZIA 5IFKA 2AOVA 1A5SB 2YV1A 4OKIA 4R8VA 3ZGVA 3AX6A 1UFRA 4OD0A 4NTZA 5HF9A 4D81A 3CG4A 1ECJA 1EP2B 1MDFA 3E58A 2PKEA 4US0R 4D4MA 1B14A 4HL6A 3U4CA 4DARA 4O1HA 1DXQA 4AWBA 1DO8A 2REQB 3HV0A 4MUMA 1Q0ZA 2PK3A 1N2SA 1U31A 2H1VA 3KHSA 4ZOEA 2PGLA 2X9NA 3I01A 4IJQA 1JVBA 3M5PA 3TJZA 4BVKA 2YTZA 3OZCA 4ALKA 2OFXA 2I7DA 1WM1A 3GEIA 3EVGA 4C6RA 1MIHA 5FI1B 3N8IA 3KR0A 3GGJA 4NZNA 3THWB 1UK7A 2FHSA 4OGGA 4UHJA 5JNRA 4GLJA 4LNUA 2R1TA 4FW8A 2VATA 2Q5HA 5AO9A 5KPJA 5IULC 1EM8B 3QGMA 1BN6A 3LK6A 4DDHA 1SIWA 1WB4A 3L01A 5CB4B 2Y05A 4MZDA 3N3BC 3FBTA 4NK5A 1DARA 4D5EA 4JI6B 5JS8A 3IPXA 4TL9A 5F73A 1Z37A 1KTVA 5EUCA 1F0KA 3EZ9A 4B3XA 5J4HA 2ACKA 2RC5A 1U4OA 2ZIVB 4TX1A 1SD5A 2PX5A 1T0JB 4C21A 4GRDA 1WMAA 1GPLA 3NHWA 2YJTD 4FU0A 3AP3A 3O84A 4MVJP 1JEYB 3GZ4A 2IUSA 1NKVA 1J0AA 3X1MA 3ONEA 4BWFB 2HRCA 3DEHA 3FSGD 4M87A 3C3DA 4MRNA 2HCRA 1YULA 3OCVA 1UPCA 2KLBA 4H2DA 4EHAA 3BXFA 1EFLA 2FPOA 3BT7A 1I4DD 1QO7A 1XC7A 3DMTA 3ITDA 2Z2IA 4B7ZA 1G6Q1 1QQTA 3S6JA 1FJXA 2OCBA 3FYDA 2Q3FA 2CZQA 2Z3ZA 1OZFA 2XA2A 3DO6A 3IP7A 3NT2A 1NKTA 5TT0A 1QU3A 3R4VA 3B48A 3KJGA 1ULTA 2CHUA 3FDFA 3PJGA 1TKBA 4L5JA 2JCXA 3AOGA 3HYTA 1YH3A 2GBGA 3JTEA 1I3LA 4KYVA 2G9NA 1X7GA 4O4LA 3ELWA 3T7TA 3UKJA 4ZI3A 5AVTA 2HA6A 1R0YA 2MSNA 5C7OO 5KNDH 4W5OA 1K89A 1J97A 1O5IA 1Q5PA 1L4BA 2FY8A 4TMTA 4Q1CA 1ZLYA 1SVUA 5EA2A 2V5VA 1LTKA 5GP1A 4DJDC 3VKVA 1TM4E 5DCLA 3EGCA 4DMRA 3UXHA 4AG3A 4DWVA 1IM5A 5MGBA 4Z4QA 2NMVA 2GF0A 3O1IC 4F1KA 1LSJA 1YBMA 4XYMA 4JJFA 3QEOA 5AVOA 4BRZA 2BKUA 3G89A 3HE3A 1E3WB 4Z1MA 1E9SA 2POCA 2C5FA 3LO5A 4E2FA 5ITZA 1L7XA 5JY6A 1E66A 2YDXA 4BMXA 2VQ6A 2J6HA 3OVMA 1OB2A 5AW7A 1NR7A 4BVLA 4Z1MD 4DLWA 3QLJA 2IE0A 2FR8A 1LBEA 1UAYA 4U6SA 2J3KA 5CM8B 5A4JA 1CS4C 3HP7A 4IQ8A 1GZ5A