5HFJA

Crystal structure of m1.hpyavi-sam complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
201
Chain Sequence
MIQIYHADAFEIIKDFYQQNLKVDAIITDPPYNFKLLEWIARYAPLVNPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNIHRRYVQDTEFALWAVKKKAKWVFNKPKNEKYLRPLILKSPVVSGLEKTKHSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQTAKKRLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenine specific DNA methyltransferase (DpnA)
publication title Biochemical and structural characterization of a DNA N6-adenine methyltransferase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori (strain atcc 700392 / 26695)
molecule tags Dna binding protein
total genus 51
structure length 201
sequence length 231
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hfjA00
2NXCA 3EVGA 5E8JA 1EJ6A 2ZVJA 5EZSA 1TW3A 2AN5A 2ERCA 4PYNA 3FPFA 2FK8A 4YUVA 3UWPA 3ELYA 4RVHA 1NW3A 3M6XA 2WA2A 3P2KA 3HCFA 1YUBA 1R8XA 2E5WA 3DXZA 3LKDA 4QTTB 5IH3A 2XYVA 4RTRA 3AY0A 2C7RA 4GC5A 4OX9Y 1KYWA 4GOMD 5EHGA 2P40A 5HEKA 1XTPA 3C3PA 3HA5A 5GOZA 1U2ZA 3HTXA 4JXJA 5DT2A 3PLAE 4YMGA 1IY9A 3KHKA 4IKPA 1D2CA 2QY6A 3AXSA 3F4KA 3OZTA 4POOA 1AV6A 1EQAA 3E8SA 4LWOA 3NVKI 3HVIA 3R24A 1VLMA 3P9KA 3TMAA 3DOUA 2B25A 5FULA 3KR0A 2NNWB 4RTQA 3BXOA 2C7QA 5F2KA 4E32A 2FYTA 3BWBA 5ERGB 1M6EX 2PBFA 1XCLA 3DLCA 4PYMA 4QQKA 2FK7A 4KVZA 1SKMA 4KW7A 5EZQA 4KRGA 2R6ZA 1X1DA 3KQTA 2UYHA 3EPPA 5ICEA 3TM5A 1YB2A 5C9ZA 4ZTBA 2UYCA 5CVJA 3HP7A 2Q41A 5DSXA 3B89A 5CUQA 4RTLA 1JR4A 4F86A 3IYLW 2G8NA 5CVUA 5DM4A 4AZTA 4FP9A 5FTWA 1G8SA 4AZWA 4PIPA 5EIFA 5DX8A 1NW6A 3M6WA 3B3FA 3HEMA 2ZWVA 1JG2A 2XVAA 3CJTA 3IV6A 2IBTA 4RSRA 1ZQ9A 2GAFA 3UJCA 1KP9A 3KR2A 5EMMA 3EMBA 3MCZA 3M70A 3ORHA 3EEOA 1M6YA 4QDJA 2BM9A 4YUWA 1ZHFA 2PY6A 2ZLBA 2C7OA 4GUAA 3FTEA 3UJDA 4FT4A 4PNEA 4CKEA 1ZGAA 2IDJA 5K0FA 1NBIA 3GO4A 2VDVE 3UFBA 4RTJA 9MHTA 1DL5A 3K6RA 5K05A 2O0LA 5LQRA 3FTCA 4ER3A 5FA8A 3KPWA 4EKGA 1XXLA 3ID6C 4ER5A 3I53A 3REOA 4ATNA 2G1PA 4Y2HA 4E2ZA 3GRRA 1AF7A 4IWNA 1FPQA 4PYIA 3DLIA 4YUZA 3PX2A 1SG9A 3HNRA 2IBSA 4CXMA 3PFGA 3FPJA 3FRIA 4GBED 2PXXA 2AZTA 3HVHA 4MWZA 3PB3A 1KHHA 2PT6A 2NXNA 2P3OA 1WS6A 1QYRA 1T43A 3OZSA 3LCUA 2OBFA 5FA5A 3EGEA 5LQJA 1X19A 3MGGA 4LECA 2AOWA 4OBXA 3GCZA 1QAOA 4RYLA 5D1HA 4C08A 1YFLA 1JG3A 5EOVA 3Q7EA 4DA4A 1D2HA 2IPXA 4RWZA 4XUCA 3P9IA 2ONYA 5DM1A 4H0NA 1I1NA 5E1BA 4RTPA 3G7UA 4HRAA 2GH1A 1RJFA 3FYDA 4PWYA 3U81A 3PT9A 4CKCA 4YMHA 2BR3A 4FSXA 5T6BA 5G02A 3ER9A 5LR6A 2A14A 1JG1A 3EVAA 3PFHA 2I62A 2Z6AA 2B9EA 3UJ8A 1F3LA 2FHPA 2OYRA 1WG8A 3GRUA 2GB4A 3M33A 1QAQA 2P3LA 5M5BA 2QE6A 3T7SA 3UJ6A 2NXJA 3AXTA 4M38A 8MHTA 3EEYA 3NTVA 2ZW9A 3C3YA 2IDKA 1RJGA 3ELUA 4PYLA 2PXAA 3TQSA 2KW5A 4PYQA 3MTIA 4MIKA 5K0GA 5HIKA 1UFKA 1AQJA 5CVEA 2IH4A 3C0KA 2ONZA 3R6TA 1L9KA 2HNKA 4AZVA 3ANXA 4GOOD 4E30A 1FP2A 1JQDA 1NT2A 3NVMB 3GGDA 3I64A 3G2OA 4M37A 1BOOA 1KXZA 3CGGA 1TPYA 3G8BA 3TR6A 2CKDA 2EG5A 1RJEA 3E23A 3GIWA 3IEIA 3P9NA 2P8JA 5DLYA 5EG5A 4C04A 2UYOA 1FJXA 2I9KA 3VC1A 4OQDA 4BLVA 3B5IA 5DX0A 3BUSA 4PGGA 3SMQA 3T7TA 3X0DA 4X1OA 4X61A 2EJTA 3OU7A 5FUBA 3M4XA 4GF5A 2VS1A 1XDSA 2OO3A 3OE5A 5E9QA 3EVFA 1SUIA 3LECA 4KDRA 2PWPA 1TW2A 1B42A 4YV1A 3M6VA 3KPYA 3OZRA 5HOQA 2BR4A 3KPJA 3R9XB 1EIZA 5HILA 1R6AA 3DP7A 3GWZA 3LBFA 4X41A 5EHIA 3FUTA 5C0OE 3CKKA 2OZVA 1O9HA 3SXJA 5E9JA 2HV9A 3KPVA 3OU6A 3FRHA 1KYZA 4HGZA 4PYKA 2O06A 4IV8A 2YXLA 4RVFA 5DM0A 1I9GA 1RJDA 3WSTA 5F2OA 3SSMA 3KKZA 4GEKA 3LPMA 4HTFB 3CC8A 3DTNA 1ZG3A 3KU1A 3AWIA 3FPHA 3GXOA 2OB1A 5K03A 2IGTA 5GM1A 5CM2Z 3UJAA 5DXJA 2GA9A 1PRYA 4PGHA 3LSTA 2EJUA 5MHTA 2AOTA 5DPMA 3G5TA 2NP7A 2PKWA 2FRXA 1QZZA 4L7VA 3NJRA 3HCAA 4OQEA 1XVAA 3C6KA 3BZBA 4CTJA 3DH0A 2Z6QA 2AS0A 2UYQA 3KQSA 5HIMA 4UOEA 3UBTA 3SVZA 1X1CA 2PXCA 5FHQA 1N7JA 5K0BA 2O57A 2ZBRA 3EVZA 5E1OA 5FADA 3MCTA 2P1DA 1IM8A 2XYRA 3SSOA 3KR1A 4HH4A 4ER6A 5K0CA 3P9CA 4MHTA 3KQYA 3B3GA 3GRYA 4R05A 3MERA 5K01A 3ER8A 1UWVA 3G2MA 4F84A 3P8ZA 1XDUA 4C03A 4EK9A 5IKMA 1Q0TA 1NV9A 3QOXA 3DULA 3KQOA 5ICFA 3OPNA 1MJFA 4R8RA 2DULA 3GRVA 4R6XA 3SX0A 3TKAA 3UA4A 1XCJA 5EVJA 1RI2A 3LDGA 3O31A 4OBWA 1M0EA 2ZZNA 4E31A 2K4MA 1WXWA 2VZ9A 5D1NA 2IH5A 2JH8A 5E2AA 3TLJA 1UIRA 3P2IA 3LX6A 5HZMA 3LBYA 3E7PA 1JSXA 4GOLD 5GWXA 3A7DA 3KPUA 5K0EA 1NW5A 5K0LA 2YX1A 2AOUB 3TRKA 1HMYA 4C05A 4ER0A 2YQZA 1F38A 4GOND 5EMKA 5H02A 2BR5A 3SR4A 4YUXA 4R8SA 4E2WA 5GIOE 1ORHA 5K8VA 4BY9E 3M6UA 1NKVA 3DXXA 3DXYA 3TOSA 4BLUA 2ZCJA 3BKXA 2I7CA 5EMJA 4PCLA 2PLWA 2BM8A 2ZZMA 2B78A 3I5UA 3BWYA 5FWDA 4DCMA 3NWEA 2HMYB 2UZ4A 3H2BA 7MHTA 1FBNA 3HA3A 5DWQA 2AN4A 2ZFUA 4RVGA 4Z2YA 1MHTA 4HTFA 1O54A 2JHCA 4YV0A 2O07A 1WY7A 1VBFA 4KDCA 4CKBA 5KYGA 4B17A 4XCXA 4DKJA 3E05A 1EJ0A 3KQQA 4YV2A 3NWBA 5T64A 1NW8A 3P97A 2C7PA 4QPNA 4ISCA 3THSA 4G56A 3MTEA 4MTLA 5ICCA 1QANA 5HFJA 4GQBA 2ESRA 4KIFA 4LG1A 2QM3A 3FYCA 2P7HA 5KQSA 1NBHA 4RV9A 5EMLA 1JG4A 1V39A 1JTEA 3EMDA 2OXTA 1VE3A 3UJ7A 2ZBPA 3NW9A 5EKUA 3G8AA 1R74A 2VP3A 3NDIA 4DF3A 3R3HA 3PS9A 2AOVA 2JH9A 5BW4A 5P8WA 2G71A 1L3IA 3GNLA 1RI3A 2GPYA 5E1DA 5EQJB 1I4WA 3VSEA 1FP1D 2V7EA 4YUYA 5EEHA 3KQVA 5GM2A 2JHPA 3JWGA 5E2BA 1G55A 2AN3A 1R18A 2IP2A 3JWJA 3DMGA 5DM2A 4Y30A 3BT7A 3ELDA 2G70A 3G2QA 1JSZA 2NXEA 5DTMA 3FPGA 4QTUB 2ZZKA 3T0IA 4BLWA 3A26A 2ZBQA 5EEGA 3G89A 3ELWA 3I58A 5EPEA 4E70A 3LCVB 5LQNA 3CVOA 2OPBA 4WXHA 4P7FA 2PGXA 4U7PB 4PYOA 2PVCA 4RTNA 1ZGJA 1BKYA 2V74B 5CD1A 4V0QA 10MHA 3DMHA 1AQIA 3LGAA 1DUSA 2XVMA 3I9FA 1EG2A 4X63A 5ICGA 1NE2A 2IFTA 2B3TA 5EKXA 1O9GA 3PTAA 3R0QA 1IXKA 5B1SA 2QRVB 5CIYA 3C6MA 4AZSA 3B3JA 1G6Q1 5LQAA 2HR1A 5JUWA 2AR0A 2ZTHA 3PVCA 4P7KA 4V0RA 4RX1A 4GC9A 3G2PA 4EKIA 3O4FA 1Y8CA 2HWKA 2PX5A 2ZIFA 3HVJA 5T67A 3L8DA 3AJDA 3FTFA 1VP9A 5CVDA 2H11A 2ZULA 3EVEA 4M36A 4A6DA 5DTRA 4E33A 2B2CA 2YXEA 3UZUA 3LCCA 5K0JA 1RI1A 5BP7A 3BGIA 1VQ1A 2QYOA 3KR9A 5DRTA 1L1EA 5GIPE 1VIDA 2PV0A 3DR5A 1VL5A 4FS8A 4KWCA 5HIIA 3EVCA 3DMFA 4MQ4A 4U7TB 5EIWA 3LL7A 3SM3A 3KQMA 3T7RA 1N7IA 5U4XA 4EQZA 4HC4A 1SUSA 2P3QA 2WK1A 1VPTA 3UA3A 3TPZA 4RTOA 4FZVA 2GLUA 3CJRA 4C07A 2O05A 4C06A 5F2NA 1YZ3A 1G38A 2ZWAA 3SSNA 4PYJA 1G8AA 1X1AA 2WA1A 1KR5A 2Y1XA 4RTSA 5KVAA 3EVBA 3TM4A 1VP3A 3UJ9A 1XDZA 3TFWA 2NYUA 2IIPA 4PCAA 4HSGA 3BWCA 4QQNA 2GS9A 2CMHA 2YVLA 4IV0A 3GDHA 5BXYA 3MB5A 4LWPA 5LQUA 1RI4A 3HM2A 5E1MA 1H1DA 2PX2A 1JQEA 4BP1A 1HNNA 3VC2A 3THRA 4ER7A 2IH2A 4RTKA 1YF3A 1KPGA 2CL5A 5EC8A 4RTMA 4PONA 2PT9A 1BC5A 4QVKA 4P7JA 1KPIA 4PIMA 4E2YA 2VDWA 3CBGA 2ZIGA 3G88A 3IHTA 3RODA 4X60A 1QAMA 2CMGA 2XYQA 5FCDA 2PJDA 1WXXA 1L3BA 1Q0SA 2VDUE 3OU2A 4F85A 3EGVA 4HGYA 4DMGA 5FHRA 4DZRA 2PWYA 3CCFA 3HCDA 3OCJA 2QRVA 5GP1A 5CVVA 1R00A 3OE4A 1L3CA 2OB2A 2YUIA 4FGZA 2EX4A 5E8RA 1YZHA 3MHTA 2BH2A 3CJQA 1ZKDA 3HCEA 2XBMA 3KQWA 2FCAA 1NV8A 4C4AA 4EVIA 2P7IA 4FR0A 4R6WA 3A25A 4EMSA 3TKYA 3PX3A 4DQ0A 2YTZA 4O29A 2AVDA 2EFJA 2YXDA 4WVLA 1KPHA 3FUXA 4DCGA 3JWHA 4E2XA 5KQRA 2BZGA 1RI5A 1XJ5A 3ME5A 4QVGA 1YFJA 2NP6A 5DSTA 2JJQA 2ADMA 4QPPA 3SGLA 4OA8A 2PSSA 1PJZA 3UJBA 5C1IA 5DTQA 4DM3A 5BW5A 1BHJA 1R8YA 3BKWA 3FUUA 5E9WA 5DX1A 1DCTA 5KS2A 5HIJA 3LDFA 3NMUF 4OA5A 2JG3A 3QOWA 1N2XA 1X1BA 3RIEA 5K09A 1P1CA 1EAMA 2F8LA 2OY0A 3ERCA 3KQPA 4KIGA 4BP3A 2YR0A 3HVKA 2P41A 3VYWA 1NW7A 2LD4A 5CCXA 2H00A 2CWWA 1G60A 2G72A 3HCCA 5FQNA 2PX8A 3GRZA 4XUDA 1P91A 4CTKA 5CCBA 2JHAA 1ORIA 3Q87B 3D2LA 3GU3A 3P71T 2ZIEA 1SVUA 3A4TA 4K6MA 4P7GA 1D2GA 5LSAA 2AOTB 1P1BA 2R3SA 4FT2A 3HCBA 5DRYA 3FZGA 2P35A 5LQCA 3O7WA 2ORED 3FUVA 2H1RA 2ZSUA 3HA7A 1SQGA 1OR8A 3RW9A 2DPMA 4NECA 2AOXA 4CWAA 3EGIA 4RVDA 2AOUA 4PINA 3MAGA 3QV2A 4XUEA 3V8VA 2HTEA 4FSDA 3BWMA 4HG2A 5LQKA 2I6GA 3FUWA 3G5LA 3GJYA 4M7RA 3V97A 1Z3CA 2Y1WA 3LKZA 5JR3A 3LDUA 2OKCA 3OFKA 4A6EA 1P39A 4QDKA 1SQFA 3DUWA 1JQ3A 5FWAA 4AX8A 3P2EA 3FPEA 3A7EA 3LHDA 5EGSA 4AUKA 5GINE 2FPOA 1KIAA 1INLA 5DXAA 3A27A 3BGVA 3MQ2A 5FQOA 5K0NA 2AVNA 3FTDA 1WZNA 3OFJA 3NDJA 3S68A 2N47A 2PX4A 3EVDA 1JTFA 2Z6UA 3BGDA 3B7PA 4P58A 3K0BA 3JWIA
chains in the Genus database with same CATH superfamily
2E6KA 1N1EA 2GN2A 5C18A 4JV5B 1XZIA 2BBOA 1RVV1 1IQUA 2RGCA 2FK8A 3CH5A 3ZLBA 4ZHQA 3RVPA 1RT9A 2UUPA 5DYNA 1DTWB 2F43A 3BSFA 1I2MA 3FFWA 1JAYA 3DD1A 2CHGA 2D3WA 4BX0A 1ZC3A 2R8PA 3HA5A 2R7KA 1EE1A 2Y1DA 3PRYA 2QPLA 2DLDA 2BE9A 4MWOA 5C5DA 4P5EA 4CQNA 4UAUA 1QH8B 1XXHB 1Y33E 2OHHA 2OWEA 3RUDA 3G9ZA 4CG3A 4ZZ1A 4LXIA 3TMAA 2W5UA 5ALPA 1GITA 5E4FA 1LPAB 3PU6A 3RWOA 3VPFA 2Z8XA 2VH5R 2ONKA 4HAIA 3GLHE 2OV2A 3H05A 4ND4A 4PLWA 4UUPA 1XRLA 4E32A 2CB0A 4ZEWA 1PYOA 4K86A 1M8FA 4DLWA 3ZHSA 5IBCA 4B2PA 4DDKA 1NXPA 2AJTA 4Y7CA 5A9RA 4YRMA 1H9CA 1R0YA 1HT2E 3SOZA 4Z8XA 1CUWA 2B1QA 3GUHA 4TMKA 4CV0A 4L9AA 1P5JA 1XEFA 1U5AA 1R6DA 2GPBA 4LJLA 5ELLA 5EINA 2FPGB 3UK7A 1E2UA 4JSTA 2TSYB 2Q1TA 3BREA 2ADFA 5AD1A 1G2OA 4JYMA 6REQB 1UPUA 1DJNA 4FP9A 1SUWA 4AMZA 3PC7A 1P74A 4HNGA 4JBHA 1KYXA 3AOEC 4XWAA 1DC8A 4DEYA 2WTMA 4OM7A 3C8ZA 1N75A 5H9WA 1D07A 3UJCA 3C7AA 1P17A 1QFMA 3EYAA 5F7ZA 3NBQA 1RIIA 3AB8A 1IWOA 1KERA 4MWTA 3OMLA 4EPWA 1NBWB 1C0KA 1X2BA 5EKSA 1TK3A 1Y1PA 2F90A 3UJDA 4EB3A 2XNCA 3ORYA 2WRZA 1JHDA 4FOOA 4C3VA 4MK4A 1N9ZA 4DV2B 2L18A 2LKDA 3GCXA 1KH2A 1ZBDA 2GN1A 1P60A 3WB9A 3CXRA 3F90A 3FKSD 3O91A 1ZIXA 2VDMB 2VUSA 4IJVA 4NZYA 3SXPA 3UOWA 4EY6A 3R77A 1ZM2A 3HG7A 2WFAA 1YE5A 4EMBA 4CETA 1JU4A 1NW9B 3I04M 5D00A 3Q6MA 4HNAA 4MSUA 4E2ZA 2ID7A 3Q9SA 3QX8A 1Z4IA 3DLIA 4NH0A 1SELA 4ZHSA 1VIAA 2IBSA 2FEKA 3K70D 5A6SB 5FUVA 3C3JA 3DQQA 3V2IA 1KOLA 3W9BA 4YB8A 1EP2B 4B48A 4NONA 3SR0A 3GLHB 1RXYA 3O90A 5HCIA 1HYBA 1YV9A 2E37A 4R0NA 2Q3EA 1XWFA 1RQGA 3LTEA 2AJDA 2X2FA 3H1TA 1E9BA 2MOKA 1DT3A 3O38A 2JKVA 3M1AA 3Q7PA 4MA5A 4QG3A 2BFDA 1X19A 5FF9A 5F9HA 5SICE 4FDMA 3A0RB 3VOBA 5LN1A 3UWKA 1D2HA 1EZ1A 2D0PB 2QPTA 1LFDB 3W7BA 3CTPA 4C0JA 1QQAA 5J2UB 2QTLA 4TVOA 5B1HA 2C95A 3I0MA 4HRAA 3U3ZA 4D0GA 3D2BA 5FKJA 4GMKA 1J4AA 1TTHA 4EFKA 2HHHB 4WY2A 1A8PA 1P7PA 4WH0A 5CFNA 5FBLB 3O84A 4M1KA 2YC4C 3R0VA 1OLXB 4KV7A 3EC7A 3EXFA 2XUGA 4UDOA 1SULA 4TLAA 1UDCA 2PRIA 4CIDA 5HF5A 3FBWA 4JJ4A 1C1HA 1BQEA 1IXZA 4PFKA 3FLAA 3UJ6A 4ZCMA 1WO8A 1EMDA 3IPCA 4QBFA 1RRFA 4JL6A 1TM3E 5HIKA 1FSGA 1GL9B 2VYVD 5BRAA 2H3EA 5DK4A 1E0JA 3M4YA 1GZ6A 1BMFD 4GOOD 4H3VA 1E1MA 4BFXA 4HLUA 4E30A 1E7YA 2CEAA 2CVOA 3LQKA 5JT1A 3GGDA 2ZSHA 4N7BA 5HTOA 3WWEA 3QE9Y 2XB9A 3DDHA 1DELA 2RONA 4PU0A 2PGNA 2UYOA 1GA4A 1OJLA 3ENNA 4IRUB 4TS3A 2I1VB 1E20A 3VC1A 4MW1A 2V1UA 3PPYA 3DXFA 5L3SB 3MOSA 3ONDA 2ZUSA 4UJ5A 4C4SA 4D4MA 3QEKA 3K9CA 5FUBA 3AJRA 2WYHA 3TLGB 3RBAA 1R9MA 1B93A 2B82A 1SH7A 3OE5A 4ZWNA 1DIHA 2BCJQ 3BCUA 3CR3C 3T7KA 4WLVA 3UMJA 4J0HA 4A0SA 4X93A 3LBNA 4A92A 4YV1A 5IJ0B 3NYIA 4RANA 4WCVA 4WAUA 4OQMA 1O58A 5HILA 8ABPA 4X41A 1MR3F 3TGLA 1O9HA 1QORA 1CKEA 2Q9UA 5E9JA 5LA6B 2OBBA 4IR7A 1K6EA 5BV7A 4GPAA 4ZIRB 1D2MA 1PJCA 3V4RA 3N2KA 1FIUA 4YTEA 1A4IA 3WSTA 1GV0A 2D59A 1VG8A 1W46A 1ZG3A 3PRJA 2GO7A 2QVGA 4HBGA 4LBYA 4A8JA 5A4JA 4XWKA 1QIDA 3U3MA 3ZJUA 2YBEA 2BFEA 1CQIA 2WVGA 1RWKA 5FPPA 2UUAB 1FTQA 4M9RA 2REQB 2E4YA 2REBA 1L5HB 4C6HA 2VFAA 2HI0A 2WTXA 1UZAA 3M5DA 1MKYA 2R62A 4XD7D 1AQ6A 2PUTA 1TA4A 4X3PA 2BN4A 2FQQA 3ZZTA 5HSGA 1EUYA 5JYDA 2WIAA 5JXIA 2K7ZA 3KUUA 3LXMA 1L4KA 5ELMA 3RRNA 4YCLA 1RMTA 3QYPA 3EVZA 3ICVA 4JLNA 4EW1A 2IPLA 5I51A 2G5CA 1L1RA 1C9KA 1N0UA 3HYRA 3ZZMA 2H3HA 4H77A 4PC6A 5K01A 1GGFA 2IF0A 4ACBA 2CL7X 2HK8A 4GYKA 3KC2A 4MDFA 3GAMA 2QXTA 2ST1A 5ALZA 1SFRA 3L9XA 1YHZA 2X4DA 5T6MA 1UP6A 1Q0TA 3I6ZA 3W8FA 3OT1A 2GK3A 2J32A 1EM8B 2QMEA 3MGCA 3UA4A 1ESNA 3GJ0A 3CZRA 4LTMA 3VAAA 1F8FA 4X24A 2WWYA 4Q4LA 3DW3X 4XSHA 4XJVA 1L5RA 1WMFA 3B2EA 5EQFA 4D9MA 2IY9A 5A5EA 3LBYA 4QYXA 1YCHA 4X3OA 4OY3A 1JSXA 3HXPA 2QRNA 3B20A 1EFRA 1XMPA 2VJOA 3EUAA 5JV5A 1YMQA 3NYQA 4N47A 1PVOA 4LRSB 1HE2A 1IK4A 2I7DA 4WNYA 1F38A 4ZU3A 4ZVSA 4BXOA 2JASA 3DOCA 2OMKA 3G5AA 1Z8NA 2CHUA 3WP0A 2PXHA 2XNDD 1QVAA 4JJZA 3QW2A 4PY2A 4UEKA 2REXB 2OZLA 3DWEX 3GEDA 3GDFA 3UTCA 4MB2A 4YAJA 3H42B 3ZI7A 1ZA2A 1FEZA 3OUUA 1A9ZA 2GCOB 2VA9A 4MVJF 4RGBA 4DCNA 4R1SA 1JFLA 1E2HA 2VO1A 5DHSA 2FXIA 2R65A 3LPNA 3SFZA 4DCMA 5CGZA 3N6XA 3NHMA 4MR9B 3PNYA 1IXRC 1CR2A 3QPCA 4Q9NA 4UPDA 2N42A 5DHFA 3VDRA 1KP3A 4F6RA 2C2ZA 2EIXA 2QMHA 1NDHA 4JWTA 3T7JA 4BAZA 1NTOA 4DKJA 1L4HA 2JCXA 2XTJA 1OZ0A 4M22A 5FPKA 2QP3A 3EAFA 1AKRA 3DGEC 2BDEA 3MZ0A 5HF8A 2JFZA 5BUSA 5IC6A 1PEYA 1RQPA 1HRDA 3ZDDA 3KOOA 2G8LA 1QSGA 2F8MA 1XYYA 4RVNA 4WN9A 1EB8A 1UJ6A 2VQ3A 2Q2WA 3L7CA 5L3QB 5C8VA 1CRPA 1JTEA 3C5HA 5BVHA 1TRHA 2WM2A 3EOBI 3DBHA 5KQGA 3SKXA 4HY3A 4BOYA 4MRRA 5JO9A 5L3VA 4TYWA 5HFAA 2JAOA 4LNUB 1M6WA 1F8UA 4Q7LA 4DCOA 4NZPA 2AQ8A 4MPDA 3AM5A 2BISA 2NZ2A 1PFWA 5CXXA 1CT9A 3HHPA 2PD3A 3ROPA 4Y8VA 2ZUDA 2V65A 2Z1NA 2XXAB 1LW6E 3CHYA 1UH5A 3MMPA 3UMVA 5DYWA 3MM4A 4TKUB 1RR6A 2VNSA 4X1IB 1ULTA 5EEGA 1L5MA 3TLMA 4FE3A 1L8LA 3I58A 1M2FA 4KPUB 4FW8A 4JI2B 5DP2A 5LXTA 4MRNA 3WZ2A 2SHKA 3H11A 1MZVA 4TKMA 3IGFA 2D2FA 2P0YA 2HPVA 3WYDA 4E13A 3RJTA 1UDWA 2W4MA 5MF6A 3ZHQA 2PCLA 1UZMA 4YC7A 2D5IA 1Y9AA 3C70A 3PFCA 1FLNA 4XD2A 3E9ZA 1CUDA 3QU7A 3ZTYA 3PGXA 1C9JA 4WLEA 2GLTA 3R0QA 5HVNA 1M1UA 1DAHA 2G1UA 2I6UA 3FMOB 3JRNA 5J47A 1WR8A 3P2JA 4AICA 2H2WA 4CT0A 4P92A 1IAVA 4RD0A 5IMBA 1YRAA 2DBZA 3BRWA 3ZE1B 4R7TA 4DJDC 5F1KA 5H68A 2G9UA 5HFNA 4DEXA 5AO9A 1XNRB 1BXRB 2HWKA 2VRBA 3PLNA 2VPTA 4LA4A 5T67A 1XD9A 2I9PA 1YT5A 2BWJA 4IUCS 4QHTA 2DCUA 1KU0A 3DZ8A 3B13B 2ACVA 3OPVA 3SU8A 4Q9JA 5KO2A 2YXEA 1WU8A 2X8AA 1ZWLA 3DEYX 5HKAA 2EKPA 3WBBA 3BGIA 3WLRA 1NSTA 4BJHB 5C32A 4EGAA 3CZPA 5TC4A 1PQPA 1QVRA 2YMLA 1GHTA 2VSOA 4WVFA 3LUHA 3MJ4A 3AT1A 4I1UA 2VUIB 3FPAA 3S29A 4Z4QA 1B8VA 4J1NA 1CIVA 1XKTA 4HC4A 2YJ3A 2GZRA 4UVDA 4DWWA 2XZOA 2M1ZA 3GEMA 2NTVA 4UU8A 5AK5A 5HGJA 1XRMA 3PWSA 1FDUA 3TUIC 2P4QA 1BX3A 2GEKA 1W94A 2R85A 2WA1A 1PGNA 2B4KA 5FL7D 4JEIA 4KOEC 3FMIA 3SE0A 1M2HA 1AMOA 1JL3A 3PXEA 2HSJA 2X0EA 4RJTA 4CEJA 2GKSA 4F92B 1E2JA 3I1JA 3M6MD 2F1RA 1EH5A 1KEEA 1GLNA 4AT1A 1O3YA 2PJUA 4Q9DA 4OQYA 5IUKC 4FC6A 5HQ3B 1N6KA 1Z83A 4PONA 3WOHA 4D0NA 1OPXA 5HQTA 4P7JA 2W4QA 2VDWA 4LHXA 4OSEA 3IHTA 3RODA 4ZCTA 2ATIA 3H2SA 3V55A 2NO7A 2PJDA 2OO5A 1TJYA 3OU2A 4PLTA 4ZP1A 5H81A 2NM0A 4OQLA 3WZMA 1R0SA 3D6NB 1YS6A 1F9AA 2HJHA 2OHGA 3Q3EA 5EHXA 5FTLA 3AKZA 3OCJA 4LGVA 4J0CA 4PTZA 2L42A 3GLIA 2VOJA 3BYZA 1UPXA 2J5RA 5EE0A 4QASA 3MHTA 2WPDD 1J49A 3GVPA 2PRJA 4UCWA 3V8RA 2XBMA 3HPQA 3TI9A 3E3OA 4D56A 5I9LA 4Z4IA 4FYIA 4FFBB 2EF0A 4RA9A 3PX3A 4IGFA 4GL2A 2AVDA 4DGSA 1YFLA 3EDRA 1KPHA 1UPAA 1WY5A 1S5PA 1UC5B 1L7VC 3JWHA 3LPAA 3VPGA 5ICMA 4B4VA 3MK31 2H9IA 4WEOA 4XPIA 1X42A 4Y18A 1IBSA 2R1TA 5REQA 3SHFA 3T61A 4IJWA 4AZSA 4FUQA 1PX2A 4I4TB 3ICWA 4IQ4A 4X6YA 3EXHC 2FP4A 4O08A 1KS9A 4IGAA 4KJZA 1RIFA 5IDXA 3AVWA 4X71A 3I34X 1SZPA 2PH3A 1Y9JA 3VVBA 1A5SB 4RK0A 1IOLA 3C85A 3BWVA 1EFDN 1JFFA 1G1AA 1M2WA 1XZLA 2GEVA 2P2DA 2RCNA 3WGMA 4LNAA 4OA5A 3TSYA 3QOWA 4F5DA 3JAMA 2HJSA 4NYIQ 2EJBA 3BGOS 5EHIA 2H0RA 3QPUA 4RZXA 1U99A 4BNJA 4ZMRA 3KQPA 3UB3A 1SQSA 3DB2A 4B82A 2GBFA 4NNJA 1QH9A 2MINA 2YOHA 4D42A 2F00A 3N8GA 4F4IA 5J4VA 1W0CA 2BEWA 1FFBA 3DOJA 2O19A 2V98A 4Q66C 1YOBA 2C20A 1W4AA 3IOBA 3Q87B 2XHEA 3GU3A 3VMMA 3A05A 5FD8A 2P6RA 4KLRA 1CNFA 1R3UA 1Y1KE 2BGNA 3ABRB 4BFCA 1E89A 4LSGA 3TLYA 3C87A 3MN1A 1FZTA 1YR3A 1HFKA 2A0UA 3D8TA 4ZK2A 1P4JA 5CBKA 2XMSA 2H1RA 4EOGA 1OR8A 3B9BA 1QG0A 2XT6A 1N5RA 3ZV7A 3UPTA 5EHZA 1DQNA 1IZ0A 1HBJA 1Y1TA 4DLSA 1TRKA 1OFUA 1N9GA 5BUQA 3CX8A 5KOHA 1WAMA 3L6UA 4EGFA 4DAOA 1YA6A 2QN8A 3B6ZA 3QXGA 1T1JA 2PBRA 2JJ2A 2X5OA 1A8HA 1LLFA 4NC9A 3LDUA 4F1JA 3EIXA 1RAHA 3IBGA 1U7ZA 2BTOA 2J6HA 3H0CA 3MD9A 4GSYA 4YDQA 2IXEA 3WGVA 4X8HA 1IY0A 4FONA 3A6JA 2HDWA 4AUKA 5IWAB 4BRSA 1HG1A 3ZJ5A 2Y2UA 1ULUA 2C54A 3L05A 4KK4A 4WKBA 1SB9A 4OUDA 3MQ2A 1G3IA 5IM5A 4C6RA 4JROA 2AVNA 5AVJA 5JTTA 2CJFA 2VT3A 2ZYAA 4RVOA 4B31A 3EMKA 4LKRA 3K32A 2AT1A 2HIHA 2IZ1A 4NMWA 1NJ6A 3D8BA 4Z7NB 2Z4SA 3NEAA 1OB2A 3OAAD 3GEHA 3VNVA 4REQB 4G1UC 1C3EA 4KR9A 3U7JA 4B73A 3NEJA 4YUVA 2NUPA 2WJGA 5LZ9A 5BWCA 1YR9A 2I34A 3CWCA 1QDUA 3EFHA 3QMPA 1SC6A 3BIFA 4QTTB 3T7EA 1UDAA 4ILEA 3TCKA 4XVUA 2C7RA 1ZJ5A 2PUAA 4EO7A 1C8LA 1T5IA 1C4KA 2JPDA 1ZYUA 2P9GA 4OAQA 3UBMA 1DXYA 2XUJA 1XQYA 3WHPA 5LM3A 2XEXA 2J9RA 3NZEA 3QFTA 5LMUB 3PLAE 3FN4A 5B7GA 1D2CA 2GI4A 1U0BB 2QYSA 2CL6X 2HU2A 3TG2A 3OEHA 3LOPA 4Q19A 3BPSA 1N5MA 5ENZA 4NESA 2BJHA 1W88A 2NOAA 3LH5A 1SXJD 4I3HA 1N2HA 2DCMA 3HCOA 4LSWA 1KMHB 2HZBA 4QNNA 1IM2A 3GGJA 4HRYA 2HHLA 5JCJD 1GNVA 3HKEB 4OLHA 4BQSA 2DR0A 1DFHA 2CN1A 2OK8A 3UYLA 4QZVA 1AZLA 3OPYA 3ETHA 4UHBA 3KLMX 4UBKA 3NKFA 1OLUA 1PLLA 2QMUA 4OU5A 5KHLB 2RH5A 3K6SA 1XWWA 3O83A 4ID9A 4YA6A 2YCLA 4PBRA 4ZTBA 4WADA 1T1EA 3WGNA 2Q41A 2C5LA 4LJ9A 1I4DD 4MYSA 5CUQA 1X1RA 3TD9A 4F86A 5KSOA 2GAOA 3OZXA 2OZEA 1XEWY 4ABYA 4MPTA 1ILEA 1XGKA 1IQRA 4C30A 1U04A 2QN9A 4KI7A 4YRPA 5AW2A 3H5OA 2JIQA 3L0BA 3B3FA 3M81A 5E6UA 1E9VA 2Q0QA 2ZWVA 5PGMA 3GLGB 4RABA 1D0VA 1W4RA 5TSDA 2PMEA 1FUYB 4ZV4A 3MWEB 2Q8NA 3KEQA 4URZR 1GZ5A 3EMBA 2IHBA 3ORHA 2QL7A 2XH8A 2HJVA 3G2HA 2J33A 2IVZA 2IXTA 2PY6A 1UKZA 3LW8A 4I1RA 3ROFA 1QP0A 1I1QB 1JSCA 1YSCA 1Z4OA 2SKCA 3KOZA 4KCGA 1KDRA 1Y3HA 4A2CA 2IT1A 1CY7A 1RXWA 1KRXA 4HDMB 1V1JA 1KAHA 2VQSA 3CYFA 4C2AA 2PU5A 3QMWA 2PZGA 2JC3A 3A4LA 4IHJB 2HT1A 2JFXA 3MLBA 2A1UA 1ZJYA 3OBBA 1R0BA 2G0AA 1LLQA 2ZTUA 3DKKA 4WKOA 1HL7A 4IFEA 1JHQA 4YVFA 4ENUA 5JZVA 2QRPA 3H2ZA 5KNBA 3NO4A 5E0OA 4V03A 5CFRA 2FJUA 4PCVA 3FPJA 5J5CA 5ITWA 4LY0A 1RPTA 4X8OA 4HN2A 4DHEA 3OJLA 3PB3A 1HLDA 1VGQA 1KHHA 3VYTB 3MWDB 5E6SA 5FPQA 2OCGA 1ZAKA 2J5XA 2KLBA 1T43A 5AOAA 3OZSA 2FQWA 2IXBA 2RI0A 1ZEJA 1O89A 4NE2A 1P5FA 4CEHB 2HU8A 3GVHA 2HCFA 1A69A 1YKFA 1Z12A 2E4XA 3Q6IA 4GRIA 1Z6ZA 4OMFG 5FWXA 4BJ5A 5CNKA 3Q7EA 4BFLA 4GI5A 2PMFA 5TQ0A 3DOIA 2ONYA 3M4NA 1GARA 1WUKS 1S2DA 2VHWA 3UMSA 2WHPB 4LK2A 3TZHA 2ETVA 4YMUA 1G9SA 5A7GA 5CB0A 4L73A 1KBOA 4M1EA 1ESDA 4KUEA 1D4AA 4FSHA 2JFYA 1PVDA 3JQPA 3LWBA 2RIPA 4AUNA 1Z63A 3ZVLA 1X7XB 1E77A 2BPOA 2DHEA 1JPVA 4LC1A 4IICA 1GTL1 2TMKA 5DCLA 2B5VA 4OKSA 4AG6A 2J07A 5ALUA 1G8YA 2WYWA 3PENA 1R4NB 5AUOB 4KITB 1JVSA 1XJ0A 4G0OA 2FSUA 3V42A 5K7SA 3EPJA 2EC5A 4U0JA 4IS2A 2D4AA 2G1JA 1FQOA 3Q10A 2A9RA 2AW5A 3VRHA 4RJKA 4LDPA 3RIXA 3ZDXB 5JSZB 3KLNA 1GGHA 3QWBA 2Q6VA 1PEAA 1N2JA 2V0NA 1NBOA 3MTAA 4HXYA 1PYDA 2J7KA 5H0IA 4C01A 5CB4F 2OV6A 5BN3B 2NVBA 1UDBA 2P1RA 3L02A 2O1XA 2Y67A 3QUQA 2RI1A 2JCYA 3GEIA 2CLCX 2P5TB 4UEQA 1X9IA 2A0YA 2G06A 3JQFA 3UWDA 2PH5A 1RJEA 4C7OA 4NCBA 4BU0A 1Z28A 5ITSA 3PE4A 3GT0A 4WT7A 2VYND 1EUDA 3A6FA 3R44A 4J49A 3WY9A 1JWAB 3S28A 1OBHA 5BT8A 1F4LA 4BTLA 4EMUA 4X61A 3QEOA 1SCBA 2Q5JA 3GF4A 3R5SA 1KP2A 4D0RA 2JW5A 2OO3A 4DIBA 2YW9A 3IVXA 3NDRA 1CRZA 3TQHA 3EVFA 3HBNA 4YREA 2XMRA 3L6EA 3JYOA 4JNKA 2DECA 3MIZA 1W96A 1B6TA 4EUFA 4J3FA 3ILYA 4OHYA 1T4DA 4NFLA 3I42A 3ZWOA 2CCJA 2HQSA 3EA0A 4TZ0A 2XWBF 3K53A 3QVGB 3H9CA 4I5DA 3A36A 2Z4RA 1Z34A 1Z62A 3JAKB 4S1PA 3PFWO 4N8EA 4AROA 4YJGA 2DTXA 3KETA 4A9AA 3T3DA 4EUSA 4C0LA 1TYBE 1XZDA 2IGTA 1TF2A 4UU0A 3UMCA 1PRYA 3H2JA 5A06A 3WA7A 1XNQB 2OHVA 5CT6A 2QE7D 2Y05A 3EX7C 1OZAA 1CDOA 5KTRA 1ZY2A 1OXTA 1J21A 1CUAA 1OAOA 2YHUA 1EXVA 4G0PA 2UYQA 4BJ1A 4K9OA 1G3QA 5B55A 1ZNQO 1QQ5A 2JLVA 1N5JA 5C31A 5K3AA 4MQBA 2Q1XA 1UZUA 3DHNA 2GHRA 2ZBRA 4Q1AA 3ZU5A 4JD5A 2P1DA 1J5XA 2BH9A 5EERA 1ORWA 3E1GA 4P86A 1PE0A 5ILGA 3T38A 1A0OA 2A5YB 5HZGA 4F11A 1IVYA 1NMXA 2IEDA 3SY8A 4KO4S 2XUPA 3FNIA 4ZAWA 1TECE 5KVQA 2XIQA 1P2UA 4F2DA 3PHGA 1A2OA 1VCNA 3ORQA 3U1BA 2DULA 3LHSA 1EVEA 3G23A 4LZJA 3P9ZA 4AL4A 3W7AA 2HPAA 2K4MA 2G08A 5BXQC 2ZAMA 3LJKA 3NM6B 2WJWA 5BVGB 5IXJA 1I9CA 3RG2A 2I8LA 5AVTA 2ACWA 1D5CA 3KG2A 3UMGA 4B84A 3E7PA 1JXAA 1IHOA 3F7NA 3P5SA 1G42A 3QG5A 2HCRA 1AKMA 1QIMA 4G5QA 4X7BA 3ZWVA 1NW5A 4G89A 3PPXA 3SF8A 1LPNA 2DERA 5HP4A 3E3AA 4IWXA 2WWHA 3IMEA 2CUZA 1E66A 1NM5A 2BFBA 2MIIA 4LQCA 1UXGA 2X15A 5EMKA 1QRSA 2BI8A 1D04A 1UKBA 1Y7TA 3CA8A 2WDZA 1NQUA 1LBTA 2HRDA 2DVMA 2FLWA 1CUXA 1L4BA 3F3SA 1ECJA 3IVMA 4DWJA 5C5CA 2BFWA 1FTSA 1VMIA 3C7CB 2XITA 1P0MA 3F97A 4C5CA 2D4HA 3IQHX 4RW0A 2FMKA 4NOMA 7REQB 3RDPA 3FE2A 3H17A 3PV0A 3TWOA 2ZTVA 7MHTA 3AFGA 3SEQA 1FBNA 2H2DA 1NUPA 2X9VA 3DUFA 1WKBA 2G7ZA 3PJDA 5BMVB 1D6JA 1WY7A 2WF5A 1UBNA 3OOJA 3UCFA 4LHYA 3G8DA 1P4GA 1XV5A 3CQ9A 1EFLA 1VCIA 3NWBA 3RIMA 4REMA 4PBTA 1NX6A 2QQGA 3DV0A 1LZLA 4Q1BA 2IYSA 4PHFA 2ZXUA 2F8SA 4WJLA 4JP3A 2P6MA 4CG2A 4ZHQB 2F43B 3OJFA 1FC0A 1V39A 1YDHA 2A57A 1RZRD 1NRXA 3HBLA 5BRNA 1E5TA 1YZNA 4XM1A 2Q4BA 2EWMA 4DF3A 1VPLA 1ACJA 1C9NA 2AOVA 2JH9A 1PR6A 5BW4A 4BMOB 1TLTA 4IG4A 1JILA 2PKXA 1L5FA 3FZEA 1BRMA 1ONNA 2G9QA 5CG2A 4LC0A 3WGIA 1RQXA 3F9CA 1ZZEA 1G7CA 1R18A 2COEA 3R23A 4FM9A 1H93A 3KOMA 3HR7A 4PSUA 2JKZA 1V37A 1NSYA 3JQAD 2B6HA 3RAFC 2Q21A 3BE8A 1B8NA 1W5SA 2WUFA 3ZVKA 1F0YA 3IUSA 3TTXA 4BX2A 4EKEA 2FTKE 2OG2A 4FJ0A 1TUEA 1YZLA 3GARA 4QTXA 2PGXA 4YFYA 3KZMA 2WQ6A 4HNRA 4KFTA 1XDBA 1RYFA 1UBHS 4AJ4A 4BS9A 4OP2A 1QYDA 3LBHA 5BSFA 4DXHA 2A0WA 2GBPA 4GMHA 5DWVA 1QFSA 5LB4A 4JKIA 1H3NA 4RKEA 1IWPB 4FMDF 4C5BA 2QRVB 3C6MA 1KQOA 1TC1A 1PS0A 2NSDA 3FMPB 1X8KA 3GRAA 4ZJUA 2RHCA 1CHDA 5ER6A 2ZSJA 5CLLA 2PT7A 1E3QA 3JQGB 2GPTA 4GC9A 4IX1A 4PQGA 1M5RA 3D7KA 1M7HA 2Y76A 2Z5GA 3EF0A 2JHFA 1IQ0A 2G3YA 4L5JA 3NHPA 5FV7A 3ZV4A 1MW8X 1FZQA 2WQ7A 2Q3FA 1P2DA 1WVMA 2J0VA 3TDKA 3ZVRA 2XVXA 3UZUA 1ZSNA 2QSZA 2DQ4A 5IARA 3QPAA 1KDOA 2IZOA 3TIIA 5A5VA 4FFLA 4YXWA 1VL5A 1T6YA 1YZUA 4FMPA 1AKWA 1MAUA 1KMQA 4MQ4A 2O2HA 2WTEA 4RORA 4UTZA 3T9EA 5A4DA 3LL7A 2ZKIA 4UNSA 4Y1EA 4FYYA 4BATA 4ZEMA 2ZTMA 4G37A 4UEOA 2O5RA 3C5WP 1JF8A 1ZXLA 1TZKA 1UJ2A 4PQYA 4RTOA 1CEXA 1BXKA 3WV5A 1QQ7A 1V8BA 1F60A 1G38A 3CPHA 1T2UA 3JAWA 4QJ4A 4PHHA 3WOVA 1G5TA 1E3TA 1O95A 4BN4A 2V6BA 2OOSA 2NYUA 2IIPA 3G5UA 3E27A 4CMEC 3BWCA 1OH7A 1MG0A 2VBIA 3ABIA 3HRKA 4FEAA 4IV0A 4B3JA 4FS3A 5E3JA 4PNZA 2FG7C 2FPWA 3GGPA 4JCCA 4BQFA 1V5FA 1RBQA 1BE0A 1FU7A 2A84A 3UGJA 4RTKA 2VTVA 1UM8A 2C0PA 1MB9A 1XTQA 2NTEA 3DE4X 4KGZA 2A7QA 2B21A 2R48A 2WD9A 5CNIA 5EWJA 3ZWPA 1V3UA 4OH1A 4HH0A 4NR0A 3EXFB 2JI9A 2JZOA 5H4HA 4L4ZA 3NIBA 2F9LA 4TUYF 3FPSA 4DMGA 3V1UA 2VDOB 3RSQA 5C1BA 2VL7A 4F46A 3HCDA 1D03A 2BV3A 1JALA 1VE6A 5CVVA 5DOVA 2IYUA 2FE1A 3F2VA 3E53A 3K1JA 1EFHA 4QYWA 3RT9A 4Y6RA 4EF6A 3PI6A 4A10A 5EUMA 4HX9A 1K9VF 4ZI3A 2C1EA 3O8OA 1ECCA 1AIPA 1E1YA 1I3LA 2DE0X 2WTNA 4GM1A 4H15A 1ZIOA 3JWEA 3MOIA 4I66A 2ZU6A 3VKWA 1FS5A 1WBBA 2YTZA 4DCGA 2WYVA 4J2OA 3MCUA 4MJ3A 4DQUA 5JJLA 2EKLA 2ZRKA 1Y7IA 1P1KA 4G0NA 4DMKA 4TZ6A 3RQIA 2AUNA 1P2FA 3MCAA 4O2RA 4RMJA 4L2IB 3RSLA 3I4FA 3BMXA 1W0KD 4EY3A 1RXEA 4U2GA 4XX0A 3GPCA 1E32A 1KK2A 1LBHA 4OEHA 3WRYC 4KQWA 3KTAB 3TNFA 5JCZA 3VR3D 3ND9A 221PA 4C21A 1F2TA 1F2UA 3FOWA 1AB5A 2AA3A 3QLUA 4HX2A 2VK4A 2C9DA 1Q91A 3L4BC 1CZUA 3AGQA 3C15C 3L5KA 1H2AS 1X1BA 3I5XA 1BAPA 1CVRA 1ZJ4A 4WZBB 1LK7A 2MSNA 5CW1A 3VH4A 4ZQEA 3LY7A 1GQYA 4AKEA 5C8ZA 4RIFA 2FDCA 3VYWA 3N2KB 1MJGA 1DKUA 4Q9IA 1P6QA 1QGED 2CLKB 1V11A 3TBHA 1JKFA 4B80A 3GCGA 1SUFA 2YKGA 4Q1FA 2I8CA 1CQIB 5I4BA 3F78A 1FYXA 2JI7A 5EE1A 3OZWA 3VHXB 4BNTA 2OFFA 1HT1E 3BAFA 5DRYA 5IZCA 2B8WA 4YK7A 3VPXA 2Z5LA 1O9BA 3W2GA 3OZGA 4PNPA 3IPYA 2GD2A 4JL8A 1P2TA 5AHRA 3EF1A 4LVOA 4QO7A 4U2KA 2XAUA 4B71A 3G5LA 1FQKA 2P9QA 3A6ZA 4FK8A 1F8GA 3GJYA 4M7RA 5FRDA 3VU1A 5F9MA 1P39A 3DT9A 1THGA 4J0QA 2D1QA 1VSUA 4ITRC 3OT1B 4K2HA 5G0VA 4H6PA 1KZGB 6LDHA 2VHXA 1ENPA 1Q11A 3CZ9A 1G7RA 2FX3A 2WAMA 3CEMA 3ELBA 4H9GA 5AKZA 2CDNA 3NOXA 2DFLA 3KV1A 4OBBA 3FJOA 1F1BA 1GSOA 5DBHX 4AJEA 1C30B 5A3VA 2O8CB 1ISGA 1CZHA 4FEGA 4J0DA 3T1YB 5I7OA 5D7NA 3OH8A 4PZEA 3PPWA 1E3LA 1JIXA 3EGDA 1JEAA 3KFXA 4QGFA 5LYYA 3ELYA 3HVUA 4MARA 2BGRA 3V80A 2PRSA 4DM7A 1YB5A 3LL4A 2XJ4A 3L0DA 3OQVA 3QKTA 1CCWA 2H1FA 3IR7A 3O2SB 3QUSA 4G4GA 4IZIA 2OZLB 2JFBA 5F7JA 1L5NA 1F12A 1MVLA 3F3KA 1HDGO 3EA5A 1YRWA 4W7IA 3HJRA 3IBYA 1XZGA 2XB6A 3IQWA 3KZVA 3KQKA 5F33A 5FBVB 4K0KB 1EQAA 3E8SA 2GUWA 1J2RA 4E88A 5JVDA 3ICOA 4B6JA 3KXLA 4GECA 3K05A 4I9HA 2ZVDA 3G8YA 4N01A 2GDJA 4F6RB 1E0AA 2K2WA 2P90A 3FR8A 1KYIA 16PKA 1JJIA 1ICEA 1RBYA 1X87A 5GTDA 3ACBA 3V2GA 4QQKA 4B6OA 3S8YA 2FSIA 1IVSA 2QP9X 5I3CA 2F2TA 2WR8A 4G67A 4BNKA 2CYAA 3KVNA 4NYJQ 4A6PA 1BN6A 1E3DA 1VRWA 1XZEA 4MUKA 5IVKA 1VKJA 4BQEA 2PJRA 4BNNA 2YY7A 1WHTA 4WN9B 1RXVA 1M1YA 3MS4A 3M4ZA 1UKYA 2QT1A 3CO5A 4PPQA 1HOXA 3TQCA 1DNPA 3G2NA 1SQ5A 1YK1A 3IP7A 5EWMA 3AI1A 3UHAA 3FPLA 2RGNC 4Y2GA 4AZWA 4OK6A 3N8IA 1E4YA 1CG6A 4ZU6X 2RC5A 1YO6A 1EGMB 3UYKA 4G07A 3ZXUB 4QDZA 1N0WA 4ZARA 2OENG 2P68A 2GNOA 1KXJA 4R8MA 1T8PA 4IOLA 2W2TA 4GXNA 1OWLA 1W52X 4N7RA 4XCQA 4CLHA 4F12A 1F7VA 1T5OA 2HF2A 1SK8A 2VTDA 2YXNA 4FNGA 1FDSA 4DYDA 3LPDA 2C1ZA 3IAEA 2VDVE 2AZDA 3ONFA 2G80A 2X5KO 2XI4A 4Q4JA 5K05A 4DNXA 5EHNA 1W34A 4EKGA 3ID6C 3D1LA 4EARA 4POAA 2WICA 4FLFA 5PNTA 4IZHA 4PGFA 2ZR7A 4EX6A 3CVYA 4S2UA 2AN9A 2VWGA 1GUFA 3HI6A 3OHSX 4QRDA 1BDBA 1SG9A 2WIDA 4FWIB 2W2QA 2OQ2A 3MGBA 2XZLA 2BEVA 2I1LA 3E35A 3V8QA 5BSKA 5CDGA 2AZTA 2X1HA 4IZOA 3ZYCA 2DHDA 3D7NA 4KXXA 4BKUA 1GQFA 1XX6A 3VKGA 1Z06A 2F1KA 3GFGA 4JU9A 3RARA 1CBUA 3EXG2 4EY4A 4AURA 3L7AA 4Q16A 1WZUA 2FEWB 4M1TA 3EFOA 1M2OA 1TQ6A 1L5QA 2NO0A 3MGGA 2QZ9A 1QV9A 4QYMA 2DPXA 4ZYUA 4EHBA 3KUXA 2C8KA 1T34A 4V02A 1GYQA 2VTKA 1TAGA 2YMMA 4RO0A 3WRXA 2H4HA 3LCRA 4KREA 1TC2A 1V25A 4RZQA 1E6LA 4JEUA 1ZIYA 5E1BA 1QPZA 2GCPA 3RS7A 4ARCA 1K5GA 1U3CA 2WINI 3Q7SA 4KR0A 5HCNA 2OEPA 2WYOA 4B3XA 2D5AA 2VAVA 2GVDC 2IDZA 3AB7A 3C8HA 3GPIA 1RWMA 3DLTA 4FOPA 1QGAA 4MIEA 3WJ7A 4W6QA 4EBFA 3PHCA 3N53A 3GRUA 2P3LA 1W59A 2XVYA 2VEOA 2IEZA 1YDMA 2BMDA 1HC7A 2CNKA 1OW3B 3E15A 3N0RA 2G5PA 3P0HA 3ZDCA 4D26A 3ELUA 5G40A 2CUNA 1RJGA 4KQFA 3TAXA 1QV7A 2PXAA 3Q15C 4TYMA 2C94A 3A8TA 5D3KA 4CEJB 2CCGA 3MT8A 3NCHA 1OIVA 5CDYA 3MW8A 3DZIA 3ETCA 3WWDA 3ZXIA 4E11A 3NVMB 4FYVA 1MX9A 1C9MA 2IU6A 3QRWA 4ZOAA 1K89A 5IBQA 3A0UA 1GGVA 3VA7A 2P8JA 3SZ3A 3MEQA 2FETA 2VDWB 5EXSA 4ISBA 3G5MA 5C5IA 4Q3AA 4B3MB 2FH5B 3AF4A 1JEEA 1XMXA 1TAQA 1JZTA 4F60A 5C3UA 1JHVA 2EJTA 3AVYA 2ZRPA 2ON6A 1NAHA 4TRRA 4DANA 2R00A 1P75A 1K86A 4EHLA 3FSJX 4OLBA 4LF7B 1TW2A 4OD0A 2SKEA 3RTDA 3KPYA 4L0CA 3GLIB 2IYXA 1A98A 3NOVA 4ICIA 3CF4G 2Q4TA 5DMXA 1VJTA 1GNQA 1RW4A 1HEUA 1B16A 1UWKA 3A10A 3KVYA 3LC7O 2PEYA 5AXDA 4G01B 1J97A 2P4HX 1CQWA 5DBIA 2VK1A 3HBJA 4RVFA 1AA6A 4HVAA 5F2OA 4DCUA 5LKAA 3KQLA 2COUA 2ECKA 1PL6A 1YZGA 2OA0A 1SA0A 4RACA 3DMPA 5JC8A 1OREA 1C3VA 1NF3A 3W4IA 3LUCA 2PNFA 4OFXA 1KI4A 4B3HA 1DRVA 1PJ2A 4WCFA 4LYDA 3AL0C 4H17A 2R8ZA 5CD9A 4ZRMA 4EZIA 1I0ZA 1Q12A 4KLAA 4AU1A 1O6FA 4RD6A 4HT3B 3RSSA 4WZZA 4A2PA 2QD5A 4TV8F 1NVFA 1OWOA 1L8AA 4M21A 2BY4A 3L5OA 4RVUA 4TM8A 1URPA 1MTOA 2ZE5A 4AMUA 4F5EA 3DPUA 1CF4A 3UAYA 1JBEA 3AHGA 4WOJA 1W25A 4ZAVA 1M7BA 3E3LA 3ZWYA 2YWHA 3FVTA 3OIDA 3RRXA 4C0HA 3KQYA 3ROTA 4QBKA 4WY8A 4UHKA 1DRWA 4ND8B 2OKGA 1QO0A 3GLQA 5IP5A 4CR7A 4Q15A 2QNBA 1XMVA 1T9GR 2BEWB 1UBSB 3L7JA 3LCJA 4BEWA 4MMZB 2IPAB 4JBWA 1R0XA 5LP6A 5EVJA 3LDGA 3O31A 2R6AA 1SRQA 3RB8A 5IZ4A 3DNFA 1FLAA 1WXWA 4MRSA 4P7BA 4W9NC 2XRZA 2Q3BA 2RHOA 3I1FA 3H5AA 2VT6A 3STYA 4PZDA 4OGLA 1BA3A 2KSQA 5D6NA 4MAMA 2EJVA 5IKEA 1SKUA 1WSDA 3GG2A 3N3AC 5K0EA 1L7MA 2P75A 2VRNA 3NUZA 5FO0A 3SJZA 3RGGA 5JS2A 2ZAGA 3T1OA 4EG8A 1I32A 5IXYA 4J7CA 1OOEA 4K7JA 4RAQA 5H02A 1GZDA 1U8EA 4MV6A 4TV8A 3WLNA 2EP7A 3L7NA 4XYLA 4MV4A 4QUDA 5ALEA 2QIPA 5B3KA 1F14A 3HFGA 5GGXA 4C43A 4E5DA 4US0R 1ODKA 5AM2A 4XYMA 4A4DA 1UT6A 4J29A 4KHPB 3HDVA 4ZCIA 1WUYA 2WP0A 3JD2A 1J23A 3UV7A 2HMYB 5JDIA 4Y6QA 2FR8C 1Y6QA 5TDHA 3E1KA 1Z3IX 3E8MA 2FEOA 5H3CA 1P3JA 4YR7A 4UAGA 4UUNA 3KZXA 2ZROA 3RFCA 3UMBA 2A6PA 3LG2A 3Q8MA 4AZ0A 1NW8A 4BQRA 1K8RA 2EFYA 3U19A 3THSA 5P21A 3QNMA 1BCRA 3F7MA 1P8JA 3KDSE 1MNQA 1HUQA 4LS3A 1PT8A 1DSSG 5EMLA 2XOEA 5B1DA 3OKPA 1Y1LA 3ILVA 2PQ6A 3ANYB 3QYJA 3PDUA 1U5BA 5K20A 3BA6A 1QDEA 4LQDA 4TYPA 4LYYA 4DDVA 2FQYA 1PFQA 2BE7A 4ZICA 2YASA 2QSJA 3G0OA 4D74A 3I28A 3PJRA 4B6FA 1Q5PA 2JGKA 3WNCA 1DQPA 1LI7A 4LRWA 1MF7A 1W88B 1R27A 2RCYA 4FE4A 2LIPA 2WKSA 3KQVA 1BG6A 1LJUA 2XTAA 5JG7A 1UBGA 3RIHA 2Y1LA 1PQWA 1VDZA 5BW6B 2CF6A 2DOKA 1L5KA 4KR6A 5LLDA 4O4HF 1GRRA 3HZZA 2FKNA 3OPYB 1I7PA 1QZXA 1OLUB 4GXQA 4JJ8A 3L07A 4RESA 3IIJA 4XDHA 3ZWXA 2V7PA 5J63A 5C4IA 4ENWA 4NBKA 3ZDEA 1CUGA 2ZSFA 4XB1A 3KK0A 2H1HA 2ODAA 1CEEA 2XMPA 3ND5A 1SKYB 4DOMA 2DPHA 5T41A 1S8AA 4UNPA 4ZD6A 4D80A 4KRFA 3H4VA 5BQ3A 2JF0A 5FLXA 2HLDD 4IQFA 4ZDJA 2APJA 3WZLA 1BRTA 4PG4A 3K0SA 5E6UB 3G1UA 2YBDA 2B3TA 1O9GA 1W36B 4DQLA 4KFRA 4MP6A 1MJHA 1KQPA 3C16C 3OOHA 2HK7A 3I52A 3R0ZA 4L76A 5AW9A 1X3LA 3C24A 4YJHA 1UR5A 2GEJA 3N7UA 3DQPA 3J80A 1AQYA 1S3GA 2XT0A 3AG6A 4P7KA 3PEEA 1GKKA 4LRUA 1QDLB 3E6AA 2FV8A 4J0JA 2QUJA 3GA7A 3WLIA 4YS6A 5IW8A 3S7ZA 6ABPA 4I3GA 2VNAA 3IDFA 1FNMA 2R6CA 4M36A 2FMIA 3L49A 2ICAA 1T2AA 2B2CA 3WJ1A 2VRCD 2O5VA 4ID3A 2MR6A 4RPGA 1Z22A 2IOHA 4ITVA 5ENVA 3H99A 2A1UB 4PSVA 1Q20A 1TF7A 2IOFK 2RGYA 3IMCA 3VZRA 5TEVA 2D6FA 1U0TA 3GFRA 3HWWA 4GI1A 4BGDA 1JDBB 2LXNA 3I04A 4HUQA 3R3JA 3NQ41 5CPBA 4M1QA 1PQYA 2VYVA 5DFAA 2OORA 1Z2EA 3CE9A 1FFWA 3M8KA 4IIHA 5IJAA 4TQAA 3U7HB 1MO5A 1BMFA 5L7YA 1W2GA 1IJBA 2QMZA 5C34B 1ZMBA 4GXTA 2P0AA 2D0DA 3N2IA 5CH3A 1OFUX 3TM4A 4A23A 1ISMA 1DKMA 1RABA 5I9SA 4DBLC 3S1SA 3W5AA 1W44A 5A0VA 4IAOA 4HSGA 4HMQA 1HYHA 1UKAA 4MGHA 1CUVA 5KYXA 4UHCA 3H2IA 1ZIPA 2W2LD 1NJFA 1N6IA 1F8YA 4PLHA 2J85A 4RF3A 2JNWA 5AVQA 1LX7A 1OPRA 2OP0A 3FYUC 3GRKA 3IKLA 3KJXA 2PT9A 3RNLA 4HSEA 3NWOA 4A27A 1NUQA 1C9YA 1GCAA 2OHIA 3CLUC 3WYFA 4E5YA 4RHEA 2GERA 2Q3MA 4U2BA 1QAMA 3TLAA 3OF2A 1WXXA 2EQAA 3BD9A 1T13A 3ECAA 3RBXA 3UJ3X 2GESA 4HGYA 1CR6A 2JGAA 3WNVA 4NI5A 5C8YF 1DAFA 3OX4A 3DL7A 4O8CA 3VH1A 2VJKA 3B6JA 3ZE2B 5DLQC 2J9FA 1HDYA 4QYTA 3BTSA 2DHRA 3G85A 4J16C 2CNWD 2E0IA 2EX4A 2FPXA 4MP8A 4RD4A 4JT4A 5E8RA 4J6FA 4IF4A 3RYHA 1CTQA 5CHYA 3S70A 2C9ZA 5B6IA 3NGLA 3QENA 4ZREA 3TQTA 1NV8A 3BMQB 2J3MA 4LAFA 4IRMA 5DNYB 2AG5A 4XD7A 1ZISA 3D5QA 4EMSA 1UC8A 3A9CA 2C88A 2ZIZA 1G17A 4C7OB 3AH8A 2B7BA 2G36A 5FOSA 3RROA 1E7MA 3F8WA 4NDZA 3H9GA 3RTCA 4B9EA 4NBVA 2RB4A 1EUDB 2BUAA 4IDDA 1E2GA 3PYMA 2G7MC 4ZEVA 1VLZA 4F1KA 1DV1A 1PJZA 1B0ZA 5CJPA 1VPEA 3WLSA 3WJAA 4YRBA 1CJMA 3RS3A 4OHKA 5LP1A 3LP5A 2O8BB 2N0SA 4R3WA 4CU5A 3WLFA 2Q28A 3K73O 5EIOA 4LRQA 1E4EA 1TCCA 2EJCA 4GR5A 4KFSA 5L7WA 1GRQA 3DAYA 3RAJA 2WYUA 4WNAB 1AUQA 4BZPA 1JEQA 3K09A 4AYTA 2B9VA 4AY2A 1WB5A 4X6LA 4TT8A 5CB4B 2P41A 4EBBA 2YY6A 1ECPA 2ZYWX 3QU4A 4B47A 1V5IA 4G0XA 3ISTA 3V7WA 1NULA 3KKLA 2IHJA 4KO1S 5LMZA 5K1ZA 3VZPA 4CIVA 3GRZA 3PHHA 2AC2A 3ILHA 5IAEA 4EP1A 5H8WA 2OK7A 4YMWA 4B83A 1M8GA 3OZBA 4DR5B 1JLRA 1W8IA 4MPPA 4MWCA 4COKA 4MW7A 2I3GA 3OI7A 3TLBA 2H2HA 4HPWA 3ZWQA 3K6KA 4M49A 2IZ0A 1P2VA 2DETA 3J81k 2NU9A 1KTVA 4CI9A 1TCUA 1G0NA 5D3QA 5JSFA 1E62A 3GV0A 4MAAA 3LT1A 5KNBH 2ZREA 4URFA 1PV4A 3ZD7A 5CX1A 2H29A 2YJ4A 4D8UA 3KZCA 3OLVA 4FCWA 4Y2QA 5FJIA 4MWGA 5H80A 3R5TA 1QOQB 4KR2A 2YC2C 3AEYA 4TN5A 1QC5A 3LD9A 3Q3CA 4JBGA 2H0AA 3BFJA 2NZJA 5CA1A 1C8BA 2NV2B 1DVRA 3ESZA 5B3JA 3AG5A 2AXEA 5EGSA 1PJLA 1B15A 2VJMB 4D4KA 3U61B 1KIAA 1H2RS 3F6PA 3A3KA 1F0NA 1Y9EA 2J9GA 5LC1A 4NPHA 4GIBA 5K0NA 3S68A 3NDJA 4JI0B 3PSHA 4BZWA 3KQTA 3T9FA 4D92A 1SVOA 3LWNA 4QT4A 5B1YA 2OC4A 1FFCA 2M6SA 2COKA 3ZHVA 1DX6A 3D0RA 4HN4B 3DBVO 2BFBB 1UUFA 3HCFA 2I3AA 4L5YA 2ZB3A 1UFVA 2EX0A 5IH3A 2OXRA 4UEWA 3RU7A 1WF6A 1MH1A 1UJ4A 1XRRA 5HEKA 1UFQA 1VA4A 2FU5C 1ZH4A 4NYMR 2YYZA 3WJ2A 4ARAA 1VA5A 3CIFA 2ENUA 1R0WA 2XE7A 1AA9A 3DFFA 2FW9A 1XTIA 4JK3A 3CH7A 1LDEA 5AVWA 1IC6A 4L02A 1CQJA 3QYFA 3BWDD 3REFA 4BNMA 3KQHA 1RQRA 3TTSA 1D7OA 3E3NA 5C46F 3ECCA 1XCLA 2JEOA 4UD2A 4UPEA 1Q1EA 1LA2A 2FK7A 1LTHR 1T3GA 4XQEA 3QTBA 4ERXA 1SKMA 1YRHA 1Z68A 4HKTA 1JI0A 4MROA 1NJ5A 3IO3A 4DJAA 4JX9A 1HQDA 3EPPA 3UB2A 2VHJA 4MKFA 2J67A 4NV1A 4TGLA 2EZ9A 1S2IA 2V6MA 5CFMA 3AUJB 2WHRA 4QJBA 5DSXA 3HJTA 2H4ZA 3NT5A 1Y4SA 1F20A 1JR4A 4D4LA 4OP1A 5DP1A 3OZUA 2XNSA 1Y8AA 2GJAA 3O73A 3LPCA 2VUHB 5EJIA 3VUFA 3FF4A 1OXMA 4B1FA 3TQFA 3OA0A 3N0TA 3PNMA 2BKLA 2FWMX 4MI1A 5DKFA 1W5TA 4R1MA 3KR2A 5BQ5A 3V1MA 3I5AA 3ZHYA 4ODIA 3C39A 3ZDZB 2EFCB 2HRRA 3K0FA 4I0WB 1A7UA 3STHA 4Y6GB 3DEHA 4AJKA 3JYPA 1GCGA 3VZQA 1XPJA 2N1BA 2FGKA 4AF8A 1KIFA 2CLFB 3NS7A 4CKXA 5K0FA 3HU3A 3KELA 2OAP1 3UV3A 3ZTTA 4Z1MA 4CMJA 5K6AC 4YHHB 1Q95A 4X7MA 1V47A 1ZOSA 5D85A 4MDEA 2GJSA 1QYVA 1K6JA 2DTDA 3LI2A 3U3XA 5CFZA 4CIAA 1REQA 2PV7A 2YWGA 4S24A 4PXYA 5HHTA 1KI1A 1YNSA 3AK4A 3HSSA 4Y2HA 2CZCA 3ULKA 5A5FA 3QFHA 3LT4A 3ZHRA 2JFNA 3RREA 3DVAA 2X9NA 4RFLA 5G1OA 2LVBA 1RKXA 1DZIA 1US8B 3Q9NA 4EHHA 5TLSA 3GPLA 3MELA 1D1TA 1G66A 1NWHA 4EHJA 3OO1A 2HJ9A 3HXKA 4S12A 4IIJF 3Q41A 4X94A 3DB1A 1QYRA 4Y6OA 1QHHA 3UW3A 2MSDB 1JQ5A 4BP8A 4F9EA 3L1KA 1EJ2A 4G63A 1RLJA 2Y1FA 4XDYA 3HLKA 1S9HA 3MYYA 2BBTA 1RHJA 4BKRA 4X84A 4Q4CA 4DA4A 3BULA 2IPXA 4MO9A 3ZCQA 3BICA 4RWZA 3N87A 2D1RA 3OM8A 3RFUA 5K8CA 2P4UA 3M34A 4GX0A 9LDBA 1QP7A 2RB5A 4H7HA 4PXSA 1LW7A 3GJ6A 3G7UA 4BNYA 3CVXA 5CA0A 1WXQA 2C4NA 1KDZA 4CKCA 3Q6NA 2ES4A 3VZBA 3RGWS 2R4UA 2HA2A 2FF7A 2ZT5A 3A11A 4LQLA 5IANA 3R4CA 2C7GA 2XD9A 3GMSA 3TNLA 3O47A 4DSNA 3QPDA 2IX9A 1UMBB 2B9EA 2H4FA 4JOBA 2JJ8A 3PKZA 4MGZR 4E08A 3WB0A 3PC3A 1T9CA 1S2GA 1H3EA 1Z7BA 1DO2A 1V5EA 4UD6A 3HVRA 3A6PC 1NURA 4ZU1X 1TLLA 5B7NA 3QXHA 3RO7A 3FXAA 1Y9ZA 4K26A 3JAWB 4FMDB 4O2LA 4RF2A 4WDRA 1PR0A 2OHOA 4ZO9A 5BWBA 1NG9A 821PA 4IIJA 1QP4A 8MHTA 4KWTA 4H3HB 4BO2A 4YAIA 3TQSA 3RC3A 3TR0A 3LS2A 3AIOA 1JMYA 5NLLA 5IK2D 3QFRA 3D3NA 3VTFA 5ITZA 4DS3A 5KNDD 1ONPA 3OPXA 4WMLA 4Z4HA 3UUGA 3E7DA 3DEJA 4UPVA 1M1NA 4FLMA 4LNHA 4IV5A 2HMVA 1T15A 1Z56C 2LTAA 4G4SP 2PS0A 1L4GA 4N3CA 1T9HA 3HO6A 1E99A 5EWJB 3DA8A 1Y6GA 4P6VF 3TLEA 2P2ZA 3ADKA 3K5WA 4GNKA 2HIMA 3RK0A 5JHGB 2DY1A 3C41J 3KTFA 1IUKA 1YVRA 3OU7A 3AIMA 3ZCUA 4LF8B 3Q0EA 1QGZA 4JUDX 1E6KA 1EB9A 5KNCD 3U4QA 3U60B 1XF1A 1JLLB 2HRBA 3E84A 4I2VA 4GM0A 5IH7A 4G5SA 2KE5A 3WYCA 1B42A 1PZMA 2GASA 1V2GA 2YZGA 5HOQA 4ZA2A 3KPJA 4MH0R 4H27A 3USES 5JPDA 2BUBA 1IPFA 4HFRA 4Q47A 4PICA 5ER9A 4FHGA 4BNXA 1MUUA 3LY9A 3SXJA 3QU9A 4DADA 1AKQA 3O8OB 4EHIA 3HLTA 2X8JA 5JASA 1KYZA 4GICA 1QUFA 1U9IC 3FG9A 3NH6A 2HJGA 1NXWA 1YE3A 2H2IA 3LPMA 1G8KA 3AWIA 3EPKA 4BYMA 3IQGX 1FSZA 4BMZA 3RFXA 1XA3A 2F48A 2N75A 1OYWA 2RDMA 3N1UA 3Q3HA 1G1MA 4KQCA 4NMMA 3ZS8A 3K2BA 2O7RA 2AOTA 3I2IA 5DPMA 2OBNA 4O2AF 1EBFA 1DKLA 2ID9A 1AKTA 1QZZA 1ES9A 1XZMA 1H2ZA 2FSGA 2HB6A 3DH0A 4O02B 1F2TB 5HIMA 3SLKA 4BFUA 4KFCA 4HNQA 1YI0A 2HUNA 4YAKA 1P80A 3WMGA 5LZ7A 3OJ0A 4TUYB 3LHIA 1SHKA 4JB8A 1J09A 1R6TA 3RC8A 3L7MA 5ADVA 3P1JA 1Z17A 2O8DA 2WD8A 2D5BA 3F7OA 3WL3A 1AJEA 2R5NA 3N2LA 3RJ9A 5HJ5A 3LLMA 1OC4A 3PDIB 4KWHA 5CYPA 5JI2E 2J31A 2AZXA 3TW4A 1CQPA 4DRZA 4KPYA 1NV9A 2W6JD 3BMOA 3L9WA 4BV2A 3OAAA 3GJXC 2VXBA 3I0ZA 4X20B 2F9FA 4A0QA 4U0KA 3ITKA 5F7XA 2J0EA 1K6IA 3ED5A 1U1IA 3P2IA 3LX6A 3NHAA 2VDNB 3KKMA 2R7LA 4OB6A 4Z0PA 1JYFA 4UAVA 4FUTA 4R8LA 5E7JA 4HMPA 4EFLA 5MGBA 3REQA 3SR4A 2H9AA 3DMTA 4R8SA 4J6EA 1CULC 3DE2X 2G4VA 3F9RA 3L8MA 4OCZA 2R8EA 3M6UA 3W2IA 5HKKD 3HP4A 4XR4A 3TOSA 2DX7A 2ZCJA 1IHYA 1TIPA 2WKQA 3C8MA 4QDTA 2GF2A 5JCJA 3SJ7A 4QJ5A 3TAUA 3VKUA 1U3TA 4N1AA 4B74A 1D9XA 1NZDA 2GAJA 2ZB7A 4OYHA 2GBIA 3F0TA 3N5CA 2Y3IA 4PFJA 4TKLA 1JFTA 3BWYA 4C9BA 2NPFA 5JNSA 5EZ6B 1YACA 1GQRA 5HUJA 2VP0A 1EQUA 3ROGA 5LQSA 1DJQA 1JEDA 3PEWA 1Y4ZA 2JGFA 2NQ2C 4K87A 4JI1B 4D79A 2EAUA 4LX0A 1HDZA 4KDCA 3UQZA 1IHPA 5JH7F 5JSUA 2H85A 3SQWA 2QPAA 4NXNB 4AP9A 1EJ0A 5LDHA 1EUQA 4FDAA 5FWNA 4UHEA 2Q07A 2C7PA 3D0KA 2QQEA 1I24A 1PJAA 2M9MA 3SDBA 1AO0A 2OLEA 2QR5A 1QANA 4H0FA 3BJRA 4AJJA 1Z5PA 4PLCA 4CHGA 5ADUS 1KQGA 1LJ8A 3OZVA 1XP8A 4PX9A 4F1WA 2OBXA 5GGYA 2OXTA 3BIOA 2IWRA 4N7JA 1Z6AA 4FCCA 1JKMA 1OWMA 2OP1A 1O8BA 2YRXA 3DOOA 3BDAA 4TLCA 5T8KA 3KFLA 2ZWIA 1A9SA 4HRVA 4R1QA 5KHAA 5TJ9A 3RRZA 1XUOA 3DF7A 2G71A 2YJGA 1ZVKA 3LNCA 4II3A 2HTFA 2ZSAA 4XB2A 2AI3A 2ZJ7A 4H7PA 3B7GA 4NG5A 4U9IS 5TXGA 3K0CA 2A92A 3U9LA 3A1WA 1JIVA 1RACA 5GM2A 3JWGA 2AN3A 1L7RA 4UHHA 3RKUA 2X40A 4B81A 1QE3A 1X1SA 2E4AA 1DBIA 2G70A 2VAXA 4DG5A 4DT1A 5JU6A 2ZZKA 3L0ZA 2GWRA 4FPXA 5IEBA 5JJCA 3LQYA 4UUAA 1Q7TA 1BJTA 4LE1A 1IBMB 1DX4A 2ZATA 1KVQA 1K63A 4BFYA 4ZQGA 1WHTB 2V59A 2FRDC 3DHYA 3L4SO 1M1YB 5L6LB 4GP9A 1TVCA 3E7XA 5IC4A 4OBEA 2X14A 1LXCA 2HREA 4WXYB 3F98A 3G9UA 3OLCX 1M2VA 1QRDA 3ZWNA 1JXQA 1P9RA 4C0XA 1FXWF 4DV7B 2IUTA 3TDNA 4DC1A 1XZJA 3A14A 3AVUA 2FOXA 4X63A 2D2IA 5FPHA 4MVJG 4F45A 4AK9A 4JY7A 1XZCA 2ZQYA 2KBFA 4LEIA 4J0IA 3WLOA 1R8QA 1YNOA 3NBFA 4XVCA 5JUWA 2PZBA 3RVSA 1XC7A 3ZNQA 2XDWA 5BUZA 5B53A 4RHTA 1A8UA 3RHSA 2ZETA 2V7XA 5LNK6 4YN3A 4EPVA 3G0GA 2PX5A 3HVJA 4Q4JB 5FPYA 4AKGA 4ZVLA 5L8VA 4QM7A 2YFQA 3LYUA 3FTFA 3OZCA 6GPBA 1LSJA 3T9CA 5KDDA 3H0KA 4KH0A 4MV0A 5HTKA 3G0HA 4I5GA 4K1LA 4K9RA 1EK5A 4XSVA 3Q72A 2B7CA 5D3ZA 2ODEA 4YMTA 2GXAA 3AU8A 3TXXA 4TVSA 4FNAA 3IT3A 3BFKA 4AUEA 3WGZA 3DZJA 1XU9A 2P6OA 1JHAA 2BEVB 3QKWA 3SM3A 3T7RA 4DY6A 3CR8A 1WPQA 2X4IA 4JJIA 4FXOA 2PZLA 3TTVA 4YCCA 4IF6A 4FZVA 3QZUA 5CK5A 4INZA 1ZD9A 2QTVB 2GJ9A 2X3FA 3NRBA 3QX9A 4GPTA 2OFOA 1HDEA 3V7YA 1UBUS 4INPA 1CPYA 4HLQB 1M2OB 4UM8B 2C7BA 4MPRA 2PKRA 1G18A 4E4RA 4BWVA 2LCQA 2O50A 3GDOA 3Q8XB 2QI9C 5LDDC 3K1AB 4H4CA 4C22A 3CM0A 1KQ3A 1JHZA 1NZJA 3WKCA 2PAAA 1OHHD 4PGAA 3OZIA 4E3WA 4EVRA 2VNJA 3FCSB 5M29A 1KWKA 3QE4A 2PO5A 1L4EA 4BRUA 2UYYA 3O2NA 3NWPA 4IJKA 3RU2A 2BUCA 2ZIGA 3NBAA 4LOHA 1BE1A 2W2KA 3CT4A 5AJHA 2XYQA 1Q3TA 5INTA 2AJLI 1RZUA 1CFJA 3LM8A 4WRRA 5CBPA 4GOKA 1C0IA 4JUIA 1SVLA 4DUGA 2JAQA 2D7JA 2AZMA 2XCRB 2PO7A 2V4UA 2AFRA 5GP1A 3ETJA 4YAWA 4BPBA 4UCQA 1QF9A 3SBDA 4M9CA 1YZHA 3BXPA 4WSOA 2VDPB 1GU7A 3UK2A 3ZIAA 2ET6A 1M54A 1NJ2A 2R8XA 3O94A 2FUG6 4JNCA 4JI5B 3F6BX 2QE7A 3CX6A 3RVLA 3ZK9A 1OT5A 4FR0A 2BM1A 1K6XA 1JKIA 3H5TA 1THTA 4JA2A 3TKYA 5KOJA 2AR7A 2JGDA 2EBFX 2Q6LA 1K9SA 2XUHA 2ZJ3A 3JZDA 3OY2A 4Q1VA 3ME5A 3VPAA 3HZRA 4Y2TA 1SZCA 2CLMB 2FZ5A 2SICE 8GPBA 3MJHA 2SKDA 2ADMA 1J56A 4GLFA 4QPPA 3V9AA 1BH6A 3U4CA 1WZIA 4CG1A 2X23A 5EGNA 4DMRA 3PGMA 1VL8A 3TF5A 3VSCA 1Q7BA 3VR0A 4DKXA 4C2BA 1VE9A 3TBFA 1PQUA 4LX8A 3A4VA 1T9GS 1DAOA 2CLEB 4EFNA 1LPMA 3RWBA 3HDTA 5LKRA 1U8ZA 1PDVA 4GX1A 3RIEA 2C9BA 2TMDA 1T24A 5F1YA 1Y9DA 2YR0A 5K8JB 3DZFA 1NKSA 2UYGA 3N3BC 1NW7A 5U4QA 1GY8A 2I4OA 1Y6ZA 2XB4A 4TRJA 4EA6A 5KSWB 3HH8A 1HZZC 1EWRA 1H8ED 1SA0B 1Z5WA 3A2LA 3ET4A 4LKOA 1PL7A 2FPLA 5YASA 5LLTA 5BSWA 1XROA 3IVCA 4ZGGA 3JSAA 3IALA 3DLHA 3WYBA 13PKA 2QR2A 3Q12A 1G5PA 4YECA 3DKVA 1GUBA 4OGWA 2DP4E 3KSAC 1XO1A 2O23A 1HX7A 1JJFA 3OF5A 4WBNF 3GR6A 4FBMA 2LIVA 3N6VA 3RW9A 1KI9A 4NECA 5TV2A 4MEBA 3C74A 4RVDA 2E18A 4HXGA 4L3WA 4I1VA 4ZI7A 1T8RA 3L0PA 4IILA 5IYZA 5A5DA 2GVZC 4RM2A 2J5QA 4FYJA 2IPMA 5F78A 3MC1A 3H8WA 2PBZA 3DD5A 3FA2A 1STOA 3OQMA 1TU3A 1H2XA 1VBKA 1Z39A 4ZAYA 2G82A 3WIVA 4K1XA 4R8KA 1OKKD 4YRAA 3EB9A 5HS4A 3P2EA 4PM4A 1ZRNA 2B1IA 2ZJYA 5COAA 5C4MA 2Z8YM 3E4DA 5JJKA 3N8KA 3TIVA 4B3FX 1LZKA 5KJFA 1OA0A 3L8HA 3UGQA 5IFKA 3DEIA 2WHXA 2FF5A 3LE8A 3EHDA 3PITA 4YI5A 3CLSD 3OTHA 2PWAA 3KOYA 4WLNA 2LCIA 2GYUA 3DTVD 1KAOA 1A4RA 3E61A 4WL0A 1PNVA 4RSHA 2J3DA 2W37A 3LW7A 1YUBA 5ALWA 2E5WA 4TYYA 4TV8B 3ITEA 1J1IA 3D1VA 1L4UA 3QM1A 1Q83A 1HKUA 3LXRA 4GOMD 1SZDA 3B5EA 2L17A 4ZAGA 1E79D 5JQGA 3EZ2A 1BVYF 1EZ4A 1F48A 4KPFC 4GPEA 1ONBA 4EYQA 3CY6A 1QYXA 3ZY2A 4POOA 5KTMA 4JLSA 1JHPA 4M60A 3HVIA 4KLCA 4RH3A 4N5HX 3MAAC 1N2EA 4F71A 1NBAA 2MMCA 3AHJA 4XFJA 3HKCB 2YWFA 1HTBA 3AM1A 2O7NA 3CURA 2CBGA 3MWJA 4UDYX 5EZYF 4XEHA 2NU7A 3HJAA 4KRGA 3VOTA 2WW8A 2G17A 1JSLA 2J0UA 3TW8A 4NZMA 1PKEA 3KEGA 1SHLA 2IGBA 2NO4A 3KTDA 4TSFD 5ESXA 3EG9A 1ZD4A 5EUBA 2CVHA 4KKVA 4GKAA 1BDMA 3B89A 3I1YA 1BDIA 1PG5A 4AO7A 3IYLW 2CDAA 4HHEA 3ANMA 3MJSA 4KAJA 1QRUA 2BEUA 3FMVA 4M0DA 3WA6A 1VI5A 1YQUA 1WA5A 1CR1A 2VWPA 3M6WA 2G83A 1KFBB 2C3PA 2PZAA 4UREA 4F8JA 2GT1A 2ZYDA 3IV6A 4KAAA 2Y6UA 2Q3HA 3PC6A 1FFXA 1CUZA 2XE8A 4JJEA 3AOGA 1TB4A 1PGPA 1T8WA 3NYWA 4LXYA 1S1CA 2BM9A 2M2IA 3E18A 3R76A 1TAHA 2AJ8A 2YXBA 2JJYA 4IJQA 5FWYB 3VAZA 3VNRA 1E18A 3FOBA 1L5YA 4D6YA 5C81A 4CV1A 3OIVA 4DMLA 4YCMA 2V7QD 1CQZA 2B8EA 3FNHA 4M8SA 3O95A 1N4AA 4IHAA 3K70B 3D3QA 4ER3A 3PWZA 1UWLA 1ITZA 1GPBA 2Z2XA 4TLMB 2O7VA 3TAHA 4E1AA 3DVLA 3R5JA 3KHUA 3PWKA 4P53A 5EXDA 4ZQFA 1I7QB 3L8CA 4E5MA 3H2KA 4GWKA 4IIEA 3K3PA 1FPQA 3NATA 4ES6A 3RPEA 4TRMA 1QLWA 2QSYA 3VNBA 4PPYA 4EO9A 4CXMA 1F3OA 3K6JA 3A9SA 4BP9A 2BGGA 1QK3A 4QHYA 1FJ2A 4V24A 5D6OA 1JDVA 2QAJA 1FVXA 2OE2A 3PQ5A 5SZHB 4LXHA 1JAZA 1Q1NA 1T3TA 2Q3DA 1PDWA 1VMEA 4YJHB 3TQIA 4DNQA 1Z9BA 3NBZC 4UTNA 4FR5A 2H7CA 3EGEA 4LDZA 1N6LA 4LECA 2UU9B 3SI7A 4RYLA 2YW2A 3MJVA 4EG1A 2GDZA 3B1YA 4PLYA 4UUBA 4B34A 4QFCA 4RPJA 2R4TA 3HS3A 4O4HB 4GH5A 4Q7KA 4QXRA 5KMGA 4LY6A 1L5ZA 1VI2A 3LT5A 5ELXA 3AR5A 4YJKA 2GH1A 2PE5A 2FPPA 4XVRA 5JAMA 3D7LA 3U81A 2HH9A 2ECPA 1USKA 2FVYA 1SUCA 3GI1A 3F8TA 3LX8A 4ER7A 3HB7A 3ER9A 3ZJVA 2ZJAA 4AQYB 2WE8A 1YXMA 2WM8A 2EW2A 1YJCA 2ABWA 2VPWA 3O3OB 4PYRA 2QGZA 1UFRA 2XOKA 3UMMA 1AN9A 1VPDA 4HUQB 1ZMRA 5CCEA 2BFOA 4WK6A 1YB6A 1QGOA 4FKZA 2Q1SA 1RTKA 8ADHA 2C5EA 1WQ1R 3CUTA 3EGOA 4BMYA 1H0KA 3H18A 3ZBTA 3AR2A 3TXYA 5K3OA 4UHFA 2HN9A 2B8JA 2B2NA 2AMJA 2D54A 2IDKA 2ZU0C 4JZKA 2VA8A 4V38A 5ALOA 4ENVA 9GPBA 3ORFA 3IAS1 5U1PA 2C82A 1TUBA 4J43A 2YVAA 3QWHA 5F3RA 1DRKA 2BEJA 2WJZB 5KYXB 3B9PA 2YNMC 4I1SA 3PC8A 4UNRA 2XPCA 1J20A 3TR6A 4FZRA 3H19A