5HFJA

Crystal structure of m1.hpyavi-sam complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
201
Chain Sequence
MIQIYHADAFEIIKDFYQQNLKVDAIITDPPYNFKLLEWIARYAPLVNPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNIHRRYVQDTEFALWAVKKKAKWVFNKPKNEKYLRPLILKSPVVSGLEKTKHSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQTAKKRLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of a DNA N6-adenine methyltransferase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori (strain atcc 700392 / 26695)
molecule tags Dna binding protein
molecule keywords Adenine specific DNA methyltransferase (DpnA)
total genus 51
structure length 201
sequence length 231
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hfjA00
3FYDA 2AR0A 1YFJA 3LL7A 3GRYA 1ZQ9A 3RIEA 2ADMA 2YUIA 3THRA 5LQCA 2XYVA 3PT9A 3EGIA 2O05A 3TM5A 1X1DA 3SXJA 3UJBA 4IV8A 4KWCA 2NXCA 1P39A 1DCTA 2Z6UA 3LECA 3TKAA 5K0JA 4RTQA 1SQGA 1VBFA 1KR5A 2DPMA 2NXJA 2P41A 3HM2A 2ZWVA 3FRIA 1JQEA 4GOND 4RTKA 2PXXA 2GH1A 2P3OA 3R3HA 4ER5A 3MTEA 1KPGA 4R05A 3KHKA 5FCDA 5KYGA 4XUCA 5EZQA 5LQKA 4E2XA 4PIPA 4ZTBA 5K0LA 5JUWA 3OCJA 5CCXA 3HVJA 2VS1A 4M36A 5ERGB 5DSTA 3JWHA 4BP1A 1NT2A 4C4AA 2ZZMA 1SUSA 2H00A 3JWIA 4GUAA 2PX2A 5EQJB 5HEKA 5ICEA 5DWQA 1KHHA 5C9ZA 4L7VA 2GAFA 3FRHA 3G2OA 1YB2A 2IDJA 2R6ZA 5DX0A 4A6DA 3KR2A 3LCCA 3GO4A 4GF5A 4WVLA 2DULA 3M70A 4FGZA 2BM8A 2G70A 3ELDA 3B3GA 2ZIFA 1BKYA 4HC4A 4K6MA 1FP2A 4OQDA 3ELYA 5E2BA 1EJ6A 1KPIA 2G8NA 4BY9E 3HCAA 5K0NA 1KYZA 3R6TA 2ZBRA 1M6YA 3MCZA 4GQBA 4CKCA 1R8YA 5K8VA 5C0OE 1TW3A 2ZVJA 3LDGA 1NKVA 4NECA 5EMLA 2ZIGA 5HIJA 4HTFB 4ER6A 3UJ9A 1MHTA 3DLCA 3EMBA 4AZVA 1OR8A 4FSDA 1EQAA 1VE3A 4M38A 5E9WA 2I62A 1VP3A 4O29A 5HILA 2IH5A 1H1DA 5T67A 1XCJA 1ZGJA 5CVEA 3HA5A 3VC1A 2ZWAA 2O57A 3OU2A 5DX8A 3O31A 4CWAA 3GRRA 3MERA 5EIWA 2H11A 2YTZA 2WK1A 5GWXA 4Y2HA 10MHA 3G89A 3E23A 4FSXA 4YMGA 5E9QA 2PKWA 4RTJA 3E7PA 4MTLA 3UA3A 2ERCA 4QDKA 5F2OA 1DL5A 3EMDA 3ELWA 4DM3A 2OKCA 2JHCA 3C6MA 3SMQA 2B9EA 3BKWA 3CJQA 3IYLW 4KVZA 2AOTB 5DTRA 3S68A 3C6KA 3UWPA 1WZNA 4YUWA 1R74A 4HH4A 1L9KA 1VPTA 3K6RA 3C3YA 3KQYA 3UJ6A 5LQUA 4DCGA 5BXYA 4DA4A 2C7PA 2ZZNA 4QPNA 4KIFA 3FPJA 3ANXA 5FADA 2QRVB 5T6BA 3M6WA 4P7GA 3EVFA 2OYRA 1XTPA 1XCLA 2IH2A 1WG8A 3HVHA 5FWDA 4C08A 3BT7A 2A14A 2EG5A 1KP9A 5DTQA 5K0CA 1BC5A 3EPPA 2IPXA 2P3QA 5EEGA 3HP7A 4BLVA 5BP7A 9MHTA 3LCVB 1D2CA 4RTSA 2JG3A 3DTNA 4OA8A 3G5TA 4PIMA 3I64A 4C05A 1RJGA 3DP7A 1AQIA 3LDUA 5T64A 3PVCA 3THSA 5GIOE 1VIDA 2AOVA 1M6EX 1G60A 2PWYA 2YQZA 3SM3A 5K0EA 5KQRA 3VC2A 2Y1XA 5EHIA 4RTPA 2PJDA 1QYRA 4PINA 3AXTA 1F38A 1WXWA 4EQZA 2JH9A 3QOXA 5DRTA 3TLJA 3LKDA 2VDUE 5DT2A 5HIMA 2V7EA 4RTRA 3NDIA 4C03A 2OB1A 4KRGA 4AUKA 3KPUA 4HG2A 3G8BA 4R6XA 3O4FA 2AVNA 3DMGA 5FTWA 5BW5A 2BH2A 2ZLBA 2QY6A 3B7PA 1QAMA 1QANA 1INLA 3FPGA 3HCCA 4ER0A 5CVJA 5LQRA 2XYRA 2H1RA 1JG2A 2B78A 3T7TA 3U81A 2PX5A 3BZBA 5DX1A 3ELUA 4OX9Y 2AS0A 2GPYA 2N47A 2F8LA 5ICCA 1XJ5A 3HCBA 2FHPA 1FP1D 4M7RA 2EX4A 3QOWA 1N7JA 3P71T 5CCBA 4LECA 3KKZA 1IXKA 4PGHA 4B17A 4YUZA 4LG1A 1R8XA 2JHAA 5DM4A 2PGXA 1N2XA 2FYTA 2YXDA 3GRZA 4RTNA 3EEYA 4QDJA 5P8WA 2PXCA 5EKUA 4C04A 2FK8A 2Z6QA 4GOLD 3EVGA 4U7PB 1KXZA 5JR3A 1M0EA 4FZVA 3AY0A 2NNWB 3EGVA 2IBSA 4GEKA 2HNKA 5EOVA 1X1AA 5CUQA 5F2NA 3DMFA 1RI5A 1G38A 1DUSA 2AOUA 1O54A 3DXZA 4PCLA 2I7CA 3UZUA 3CCFA 5FUBA 3SR4A 1G6Q1 1JQDA 4V0QA 1RI3A 1EAMA 5EZSA 4Z2YA 3LHDA 3I5UA 2VP3A 3KQOA 4P7JA 4R6WA 3KPJA 2QE6A 4CKEA 3R9XB 3OE5A 5HZMA 4HTFA 3BGIA 3A7EA 4CKBA 2UYHA 3GU3A 3HCFA 4E2YA 1QAOA 2AOWA 2HMYB 2ZZKA 4RYLA 5K0FA 2QM3A 2C7QA 4E2ZA 3A7DA 3A4TA 2ZULA 3GGDA 3I53A 4PYIA 4PYKA 4YUXA 5CIYA 2NP6A 2IGTA 2IH4A 4OBXA 2PT6A 3TOSA 2GA9A 4GOMD 5F2KA 4ISCA 1G8SA 2PT9A 4GBED 1RI4A 2AOXA 3FTFA 5U4XA 3V97A 3OFJA 2LD4A 5BW4A 3IEIA 5LQNA 1F3LA 1I1NA 3UJCA 4OQEA 3P97A 2I9KA 3LPMA 2PWPA 4BP3A 5LR6A 4XUEA 4AZSA 2Q41A 2ZTHA 3BGVA 3SSNA 3KPWA 5E1BA 2AN5A 3JWGA 1XDZA 2VDVE 3MTIA 4KW7A 4PYQA 5EMKA 5K01A 2AOTA 4KIGA 4DMGA 2P7IA 1ZGAA 3R24A 1XDUA 1BHJA 1JG4A 2NYUA 1ZG3A 3MB5A 3KR9A 2K4MA 2I6GA 1I4WA 3LX6A 2ORED 1X1CA 5ICGA 3FPHA 1SG9A 2QRVA 5DRYA 2YX1A 1SVUA 3KR1A 3P9KA 2PBFA 1IY9A 1VL5A 1QAQA 2EJUA 1YZHA 2P40A 2XVAA 4RVDA 3CVOA 3WSTA 3FTEA 5DXJA 3OPNA 3SVZA 3SX0A 3LSTA 3TKYA 4C07A 5EKXA 1KPHA 1RI1A 2G72A 3HEMA 2ZW9A 2AZTA 4LWOA 5FA8A 3NVKI 3CGGA 2FRXA 3KQPA 4RSRA 5EIFA 3P2EA 5B1SA 2P3LA 5FQOA 5E9JA 5G02A 2YXEA 1IM8A 4PYMA 3NJRA 5CVVA 4CTKA 4MHTA 3BXOA 3P2KA 4F84A 4DF3A 4EMSA 4QVGA 3UBTA 2YVLA 2E5WA 2OO3A 4PYLA 3BWYA 3IHTA 4X60A 3ORHA 5K0GA 8MHTA 4DQ0A 3ER8A 3NW9A 4AZTA 2O07A 5EMJA 1ORIA 1WY7A 2GB4A 3HCEA 3DLIA 3HNRA 4X1OA 5IKMA 4PYJA 3M6UA 3G88A 2ZFUA 4G56A 2OBFA 4LWPA 1B42A 1G8AA 4A6EA 3FPFA 2CL5A 1YF3A 4P7KA 3TPZA 3X0DA 4E32A 3LBFA 5K03A 2IFTA 1N7IA 3FTDA 5LSAA 2PY6A 1JSXA 3DOUA 4IV0A 3M4XA 3BWCA 1PJZA 3MGGA 4RWZA 2AN3A 2AN4A 3MCTA 4F85A 2Z6AA 2XBMA 1Q0TA 3E8SA 3KQTA 1AV6A 2ZIEA 1L3IA 3DH0A 2BR4A 3NMUF 3NWBA 1YUBA 1XVAA 3V8VA 4E70A 5EMMA 3JWJA 3P2IA 5E1OA 3BKXA 1R6AA 5GOZA 4R8SA 2PV0A 1JSZA 5E8JA 3PX2A 4PWYA 1JTEA 3MAGA 1BOOA 3I9FA 1SQFA 5LQAA 5FULA 4DZRA 3KQVA 1NE2A 3AJDA 4P7FA 5DPMA 1NBIA 5IH3A 4YMHA 2OZVA 5E2AA 2AOUB 3KPYA 5EHGA 4DCMA 4UOEA 1JG3A 5M5BA 3KR0A 3GNLA 4MIKA 4MWZA 1NV9A 4X63A 3GJYA 3HA7A 1RI2A 2GLUA 3PFGA 1P1BA 3M6XA 3DMHA 4MQ4A 3OU7A 4RTMA 1ORHA 1UFKA 5CVDA 3SSOA 1TPYA 2ESRA 2Y1WA 4ATNA 5CVUA 2WA1A 1RJDA 3FPEA 3MQ2A 2VDWA 5CD1A 1HMYA 3QV2A 1XXLA 1EG2A 2BZGA 4QTTB 2P8JA 3PFHA 4Y30A 1SKMA 2ONYA 5FWAA 5FHQA 2FK7A 3FUVA 2OXTA 4XUDA 3BGDA 2JHPA 5EVJA 3TQSA 3FUTA 5GM2A 4HGZA 3EGEA 2JJQA 3UFBA 1NW7A 3K0BA 1KIAA 2HV9A 4E30A 2OY0A 3REOA 5FHRA 2ZCJA 2IDKA 3SSMA 4HSGA 5K05A 2O0LA 3R0QA 2BR5A 3EVEA 3KQSA 2CMGA 5EEHA 1JQ3A 2NP7A 1L1EA 3KPVA 4RX1A 1NW6A 2UYCA 3BWMA 4QTUB 1T43A 5GP1A 3OZSA 5DM1A 5GM1A 1Y8CA 1RJEA 3PTAA 2HR1A 4F86A 1HNNA 1I9GA 7MHTA 2B25A 2OPBA 5KQSA 2CMHA 2B3TA 3B89A 3BUSA 4E33A 2EFJA 3GRUA 3UJ7A 1XDSA 3FZGA 3EEOA 5E1DA 3E05A 4PYNA 3GIWA 3LKZA 4RVFA 3HTXA 2P7HA 2ONZA 3C3PA 3GWZA 4EVIA 3AWIA 3G5LA 4KDCA 2ZBPA 3EVCA 4FP9A 5FA5A 3ERCA 3HVKA 1RJFA 4BLWA 5LQJA 4EKGA 3B3JA 3G2PA 3LCUA 3KQWA 3T0IA 1UIRA 3ER9A 4AZWA 2BR3A 4YV2A 3EVAA 1ZHFA 4IWNA 2FCAA 2ZSUA 3PB3A 3TR6A 2XVMA 1L3CA 3BWBA 3G2QA 4GC9A 3DR5A 1AF7A 2FPOA 2P1DA 3NTVA 1VP9A 4GOOD 3VYWA 4WXHA 5H02A 1R00A 4OBWA 3UJAA 3DUWA 1R18A 3A26A 3P9CA 1O9GA 2UYQA 1V39A 2V74B 3NDJA 5EC8A 2C7OA 3IV6A 3CKKA 1O9HA 2OB2A 3OZRA 3I58A 5CM2Z 3TMAA 3PX3A 5KVAA 1TW2A 1X1BA 4C06A 4R8RA 3FUXA 1P1CA 4KDRA 2EJTA 4JXJA 4XCXA 5DXAA 3MHTA 1NW5A 2CKDA 1VLMA 2JH8A 1NBHA 3O7WA 4RVGA 4DKJA 2IIPA 3OE4A 1NW8A 1ZKDA 4FS8A 3G2MA 3HCDA 3Q7EA 4QPPA 4QQKA 3VSEA 1JG1A 1Q0SA 5HOQA 5DLYA 4GC5A 4RTLA 1U2ZA 2UYOA 3H2BA 4M37A 2YXLA 3TFWA 4YUYA 3EVDA 3AXSA 2B2CA 1YFLA 2UZ4A 2G1PA 3PLAE 1FPQA 3T7RA 2ZBQA 1EJ0A 3KQMA 5HFJA 3FYCA 3P9IA 3DXXA 4IKPA 4AX8A 4ER3A 4RTOA 1JTFA 4EKIA 3CJRA 2P35A 2G71A 2NXEA 2PSSA 3Q87B 3ID6C 2IBTA 1YZ3A 4FR0A 5DSXA 4CXMA 3FUWA 5MHTA 3DULA 1Z3CA 1FBNA 2AVDA 2HWKA 5K09A 4FT2A 3D2LA 2KW5A 1X19A 2PXAA 3P8ZA 5HIKA 1FJXA 3M6VA 2PX4A 2HTEA 3CBGA 4PGGA 1JR4A 5KS2A 3A27A 3T7SA 1EIZA 2QYOA 1UWVA 4P58A 3RODA 3PS9A 2CWWA 3GDHA 2R3SA 2O06A 1WS6A 1WXXA 3A25A 1VQ1A 3CC8A 3ME5A 3B3FA 3OU6A 4U7TB 4V0RA 4H0NA 4E2WA 2C7RA 4ER7A 1KYWA 3HVIA 5GIPE 5DM0A 5E8RA 4CTJA 3EVBA 4FT4A 1SUIA 2PVCA 3G7UA 3LGAA 2YR0A 4X61A 3LDFA 4YUVA 1NV8A 5DM2A 3F4KA 3L8DA 5ICFA 2IP2A 3SGLA 4PCAA 5E1MA 1NW3A 4EK9A 5EGSA 5D1NA 2WA2A 3KQQA 3CJTA 4OA5A 2NXNA 3FUUA 5C1IA 1AQJA 1D2GA 3NVMB 2PX8A 4PYOA 3UA4A 3GXOA 2BM9A 3OFKA 5D1HA 3RW9A 3FTCA 4PONA 4X41A 3B5IA 3DXYA 1P91A 3M33A 5EPEA 1MJFA 3KU1A 3G8AA 3LBYA 2GS9A 3HA3A 4PNEA 1D2HA 3UJDA 3TRKA 5DTMA 4YV1A 3NWEA 3TM4A 1QZZA 3GRVA 4RVHA 5FQNA 4E31A 4YV0A 3C0KA 3P9NA 1PRYA 4HGYA 5HIIA 1G55A 1L3BA 3UJ8A 3GCZA 5K0BA 4BLUA 5EG5A 2XYQA 3EVZA 4QVKA 4RV9A 3OZTA 2VZ9A 5GINE 4POOA 2PLWA 4QQNA 4HRAA
chains in the Genus database with same CATH superfamily
3F3YA 1V37A 1MC4A 3PEFA 4KWIA 3ZS9A 4B2IA 3RRNA 4JQOA 1ZQ9A 4LOJA 3EPLA 3ET4A 4C0JA 5IT9A 3SLKA 2BT4A 4GECA 2K7FA 1WKBA 1JAHA 2JEZA 2PX0A 2QVBA 5AM5A 4TS9A 3T3NA 4IFEA 1CT9A 1TT7A 1T0UA 1DCTA 1GSHA 3ENZA 2WDPA 3IVGA 4FXOA 3GP8A 4RQTA 1O3YA 1IHPA 4E1BA 1RXEA 3FMFA 4CDRA 3CKYA 1YRLA 3FRIA 1G98A 2XWPA 3O1HB 3VOBA 1O08A 1WB6A 2P3OA 1XUOA 3TE7A 1QHHB 4KOEC 3L9WA 3QUBA 4U0JA 5FCDA 2FFHA 4Z4CA 2I66A 5IMSA 5CCXA 5K0LA 2FSFA 4ID3A 3HVJA 4DR2B 1MORA 3HI6A 3BC1A 4UU0A 1GARA 1J9ZA 1YC2A 1GTRA 1R0CA 1M54A 1ZZEA 1NFQA 4C4AA 1QS0B 2YWDA 4GUAA 1RFGE 3EH2A 1OB2A 1X94A 2Z4SA 3RSSA 2X3UA 3WICA 5C9ZA 3KSZO 3PEYA 1WVMA 3JXEA 3O03A 1JH9A 1T8TA 3RGWS 1PS8A 1K9VF 2MOKA 4H31A 4B6PA 5J4LA 4L4SA 3PI7A 3WTBA 1U0FA 4UQLA 1CQZA 3TRHA 1SQ6A 4L6AA 4EHHA 1EFCA 4A2CA 3B13B 4IIJB 2XY4A 2HR1A 2M6RA 1RPJA 4IQFA 2R8RA 3SWWA 2H9IA 3HM9A 2O7SA 2I4MA 1GPNA 2WHQA 4LHVA 3LDGA 3IR5A 4RUKA 2WJZB 3MT7A 3JQAA 2HF2A 1ZEMA 3T1HB 2HO5A 3DLCA 4QM6A 1IOZA 5G0WA 4QUHA 3NEAA 4OUDB 3N2YA 4FSDA 4EHFA 5E9WA 1C2TA 2LGJA 3JALA 3H2JA 1UBCA 1YR8A 2ODBA 3MNFA 4L9AA 3R09A 4RHXA 5EP2A 3V4VB 1G4HA 4F4FA 3DDCA 3C3AA 2DQKA 4GOXA 4OYYA 5L6LB 5EIWA 5F5NA 1B8UA 4G89A 3PNKA 2F3UA 5I4BA 3ADDA 2W6JD 3FFBA 3QVKA 2OESA 4TKVA 3IGFA 2OZLA 4HWTA 5F1PA 5AM2A 1OBFO 1USVA 5BMVA 4HNTA 3H9EO 2Q8QA 4CLDA 1NDUA 1UZMA 3VPAA 4MW0A 2HXSA 5FV7A 3OZXA 2O14A 2XTJA 2QI9C 3MBKA 1V9CA 2J3EA 3F7TA 5EMHA 3Q8KA 3L04A 2JCBA 2Q6LA 2FPLA 2QYHA 3LVRE 5GGYA 5JDCA 2MYTA 5IKPA 4MV0A 3WBJA 3F6PA 4J7AA 2DVMA 2HF7A 3SQLA 4DEXA 4MQEB 4UARA 4QPNA 2FQXA 3CF2A 2ZJBA 4PY2A 2Y1FA 4NENA 2BONA 2CL0X 2ZAMA 3H2KA 1EQ2A 3W4IA 3AKEA 2ZUVA 3VSCA 1C8LA 3C3EA 2VDQB 3U19A 4QICA 1RPZA 4C08A 1YB4A 1RXSA 5DTQA 1J1ZA 3I72A 1OH6A 3RANA 1E2QA 1V8BA 1XL1A 4PSDA 3ETHA 3GWGA 4WN9B 1HTBA 4RD0A 4MJ3A 2P5TB 3X1WA 5IFLA 3CWZA 2X8JB 3M49A 1PDVA 4KXXA 4LIPD 5F77A 4C22A 3WO0A 3W5BA 4BWFB 2W4MA 1V3QE 1RQLA 1WZCA 4P35A 2ANBA 4P3KA 1F38A 1WL8A 2DHEA 1QGED 2C42A 2QW0X 2ZETA 2JH9A 2ZKIA 2ZU0C 3H5NA 5CP8A 3PQDA 4CODB 2EU8A 1FLNA 2OXFA 2XDWA 5HIMA 4ZOBA 4LI0A 3N8NA 4Q00A 5KQPA 1EJ2A 1ZCZA 2BVNA 4AUKA 4QOSA 1FUKA 3CEJA 4GPD1 5AW9A 2Q3CA 3TBFA 3ZJYA 4DCOA 5LIRA 2IYSA 1E5LA 1QAMA 3FVTA 5D5HA 4C3ZA 1VECA 1WX1A 2XYRA 1O9BA 1Z29A 1NVUQ 3T7TA 4KYTA 4IMRA 4BKRA 2BEVB 4B45A 4EI8A 1JEJA 1GL7A 2RB4A 4M6WB 4B4UA 3PFKA 1Y4ZA 4UE2A 3MD0A 5J2TF 2EZTA 3S5JA 4KQGA 1LNZA 1J00A 5HP4A 2JHAA 4UKDA 4M8KA 2XLBA 1W9MA 2Z08A 3BWVA 3G9TA 3D1LA 3LQQA 2WF7A 3Q3CA 4W9RA 4N40A 3E1KA 5CH8A 4GOLD 3VDNB 3OTWA 2X40A 3DFUA 3OFND 3M6IA 2I8AA 1UQTA 4ABYA 1J7JA 1GT91 3DMFA 1OHHD 1T3TA 4IJQA 3IKJA 4GKJB 3GJRA 2GN4A 3BFXA 3RSHA 2ZSEA 4PC1A 5KVVA 2D1SA 5JAMA 3I5UA 4NU6A 3QIVA 3B38A 4KLNA 2J0UA 3A70A 4KLCA 2SNIE 2Q21A 3O2NA 5AI8A 5F5LA 2WM3A 3UC5A 5IP5A 2BHSA 4LS3A 3DFZA 4AMVA 3TRIA 2HCRA 3CRRA 2XKAA 4JC5A 1PLLA 1Z5PA 3L7DA 3U4IA 5CJPA 5E6UB 3U3OA 3E7WA 3FGPA 2NUTA 4PYKA 4BVBA 5E9AA 1JIKA 1RRMA 2OO7A 3KUKA 1DBRA 1NW9B 1FE8A 2PT9A 1IK6A 3HYSA 2X0FA 1FX0B 1YCGA 4XASA 2BKUA 3VSAA 5D5PA 5AM4A 3I1FA 5C46F 1CE8A 3L6EA 3CPEA 4R1PA 5EQFA 3WIVA 3GLSA 3TN7A 2WKWA 1PBTA 2TMDA 2XUAA 3BE5A 2PZAA 1AB5A 3BGVA 4KQKA 2D06A 6GPBA 5E1BA 2O0MA 5FTMA 4XVRA 2WD7B 1KI4A 3ESRA 2AOTA 4MUJA 1FMTA 4WBNB 3U4AA 1BHJA 2DGDA 1XKLA 2NYUA 1NI4B 3ITNA 3G0IA 1QH0A 2L0XA 3UTDA 3WLAA 3LYLA 3ZX4A 4C7JA 4EABA 3GA5A 3VR2D 1YE3A 5KNLA 2CYAA 1KARA 1NTOA 4JI8B 1V2GA 3RV3A 2GD0A 1PQPA 1Z6AA 4EJ0A 4D42A 2B20A 2CHUA 4JI2B 2CV0A 3W8NA 2GHQA 4F06A 5EWJA 3C1AA 1EMDA 1U2DC 3GVHA 3PITA 2W2TA 1SHTX 3TKYA 1CJBA 3F9IA 4UQOA 2G5TA 2VZ8A 3CGGA 1IAQA 3CSSA 1BS2A 1ZINA 5KKCA 2DMRA 2DBVO 1SWVA 2O7QA 1KFEB 1ZU4A 3O7MA 3P2EA 2GBLC 3BK1A 4TKZA 2RGDA 1SZPA 1KU6A 4EPTA 2Y0DA 4WT7A 1WLYA 3OY2A 5FT9A 2B92A 1ZESA 2PL5A 4IGFA 3GFQA 3EF1A 3PD7A 4JUCA 2YZGA 1SCDA 3NFRA 2O8BB 4NICA 5BPFA 2R8ZA 3V3TA 3DMPA 5L7TA 3F6YA 2Z2IA 1Z18A 3O95A 4IFBA 4HUTA 4IIHA 5IKMA 3RFFA 1QNLA 1GGMA 2WF6A 4O1MA 3WI7A 3AVWA 4YPFA 1M75A 3KVRA 4JJIA 1WHSB 1G8AA 1FY2A 2WJWA 2IV3A 3QV1A 3ZE1B 3AERB 1OW3B 3O1JC 1TQ8A 2A0FA 2C77A 4G0YA 2XOXA 2E89A 3K73O 3QEAZ 4HWRA 2JFFA 4HBZA 4UC0A 3WIUA 5KWIA 3BWCA 1ECPA 1N1EA 3B48A 2P65A 3QHQA 1RAAA 4GS5A 1FVFA 5B7GA 4CF5A 1SQ5A 1PNRA 5HKBA 2R44A 2Q6VA 3FW1A 2Z9CA 3F7NA 2K6GA 2ZIEA 1IZ8A 2H1SA 4NMWA 3AJEA 4LA4A 2C94A 4XDYA 2VCEA 4UBLA 3H5TA 2B69A 1FDRA 4Y2VA 5ALNA 3ZWDA 4YAIA 2VUIB 1AE1A 3DD5A 3DBRB 1JSZA 3B9PA 1OBOA 4N3GA 5EINA 1PYDA 5J3JA 5IC4A 1Z12A 2GBIA 2HMUA 1O1YA 3A1CA 3NBZC 1PT6A 1YS7A 4MUFA 3VZPA 1D2EA 4EHIA 4PO1A 3PDJA 1JG3A 4P3OA 1C7RA 1MB2A 4R98A 5FORA 1SO8A 3GLHA 2XVYA 2W43A 1ZUNB 2JFHA 2PVSA 3LCJA 1HL7A 1T36A 4N7BA 4YAUA 4HMPA 3KEGA 2GLUA 4TTRA 3RAEC 3HDHA 3BH6A 3U09A 2BMWA 4TRRA 3AEQA 2H1VA 5G41A 1LSJA 3AF6A 4L5CA 5F7ZA 2BBOA 2JLCA 3R5JA 3TZCA 1TPYA 2ESRA 2HJSA 2VXCA 1GDHA 1CRWG 3OM9A 4BMCA 1RJDA 2J9YB 3IX7A 4XX0B 1GDDA 1UPXA 4D9IA 1AGNA 1B93A 2P3SA 1G6HA 3RVKA 1SHLA 5FL3A 4XIYA 3FMVA 2VDRB 1E0KA 2YZ7A 1YVRA 1SKMA 6CHYA 1E58A 3EE6A 4EG3A 1Z83A 2CZQA 2FCRA 2GAIA 2HRQA 2VJNA 2BI7A 1QCZA 3BHIA 3GAMA 4OH1A 4MZXA 3OT1A 3NVAA 3AVQA 1VJ1A 2IUSA 3FUTA 3ZY4A 2CJPA 3KXPA 4K9QA 1KK1A 1CQXA 2B0JA 4OV6B 1G17A 3B1XA 1XTTA 4UUPA 2H2DA 4JLMA 1AKUA 2B82A 3UAOA 4QKQA 1OBCA 1XNGA 5AHRA 4RIHA 2BR5A 3Q15C 5DTJA 1GQ2A 1ENOA 1QX3A 2A9FA 4IXTA 3PLRA 2IEYA 1L7DA 1A96A 4NESA 4NJEA 1L4HA 1OUMA 1UODA 3PHIA 3GQBB 3HWRA 2NPOA 3VHXB 3DE7X 1R0RE 3I1YA 5DM1A 5FKJA 2RGXA 1H23A 4G4SP 3UXEA 3VNQA 4AK9A 2G9VA 3O91A 3UAZA 4RSGA 2B25A 4Q3EA 4F86A 1Z2PX 5TQ0A 2J59A 3B89A 3MRVA 3VKHA 3EDOA 4GZ3A 5DH9A 1ZUHA 1UC4B 3KAKA 3UAWA 2K87A 1UM9B 2R7AA 2IXGA 3RKRA 1NDHA 5E1DA 4RVSA 3WWCA 5IJWA 3W5AA 4QQRA 3CHYA 1TCBA 4KJZA 4EYKA 3MJCA 3UC9A 3PTLA 1SCUA 2ZYIA 1WF3A 2Q27A 2GN8A 3G5LA 4HNGA 1PR0A 4PR0A 1OASA 3ZVKA 4RDCA 3S7TA 2OHXA 1NNSA 4EKGA 3C48A 4L8FA 5TQ2A 3T0IA 2Y68A 3TQQA 4QC2A 4Y6OA 1TK9A 3GNTA 2BMJA 2VRWA 4BLTA 1SU4A 3PGA1 2XVMA 1BFDA 4CM4A 2Z5VA 4EGQA 5JH7A 1CLEA 2AN9A 4NFYA 3DR5A 3SC6A 4ACAA 4DLKA 4W63A 3KT3A 3MTQA 4RETA 4HDNA 1W49A 1P2UA 2BKAA 4DIMA 2AG5A 4CV1A 2CMFA 3O4GA 5DCWA 3T5TA 4DLPA 2ZJ8A 3BVPA 1J5PA 4LWZA 3HDJA 4X94A 2CJYA 3ZBTA 1JKMA 4WXEA 1CDEA 4J2OA 1X1BA 2H4WA 3W2IA 5HYVA 4YRDA 1Q6YA 4TPKA 1VLMA 2AFHE 2OK7A 3MT8A 2WILA 3GBSA 3TCNA 4FCTA 4HUJA 1U28C 3G2MA 4N3CA 1O0CA 2GFHA 5KU7A 1GP2A 5T8KC 2RGNA 3UYLA 1K97A 4ZU1X 3OAAA 4R69A 1OIXA 1RWBA 3LZCA 4HAZA 3VU8A 3BTSA 1CUEA 2PX3A 5IVHA 4JI5B 5A5EA 2ZJ0A 3O26A 3ETNA 2BEUB 3HGTA 1CF4A 5JLAA 4CKCB 1XCMA 1GPYA 2XZDA 1H4SA 5GJBA 2IXFA 2UVPA 3LO5A 5FJIA 5DSXA 4Z3DA 3CNBA 2COKA 3EJ6A 1KMHA 1LJ8A 1PJSA 2HHLA 4ITRC 1UMDB 3EW7A 3WL3A 1JS1X 3EEFA 3ND7A 4JYAB 1B4DA 4DS3A 3D43A 1I32A 3FAKA 1UXKA 3H9CA 4BU1A 3S81A 3RODA 2Q3FA 4I3HA 3EXFB 3WL6A 2V7PA 1XD2B 3GDHA 4O2BB 1G16A 1AKYA 1KI9A 3OU6A 3ORSA 4DGQA 5IASA 3MOIA 4YJFA 4RZXA 5LQSA 5A5VA 3OJLA 5ARDA 2V4UA 1O58A 4PAGA 1IHDA 2FOXA 2I1LA 2J3QA 3R3UA 4MR8B 2RGAA 3GROA 4PRYA 3WLOA 4HH1A 2FPXA 2OCLA 4C87A 1DAFA 4MB6A 2OVFA 1HG0A 4H16A 3TOXA 5FWNA 1IQRA 1MX3A 3L8EA 2A58A 5HQTA 5JS1A 2RJNA 2AG0A 1LDNA 4L5IA 1GKKA 5AKGA 4PCAA 1HEYA 2J4CA 4RA9B 3RTEA 5JSYA 2VNJA 1GFSA 1NQAO 2F9FA 1P0MA 3MMPA 5AR1A 3GEMA 3HO6A 4QG3A 1DCKA 3SN6A 4GM1A 2CZGA 2ROQA 1JZSA 3B5IA 3FKSD 1MLDA 4RF2A 5JMTA 3R3ZA 3S2GA 2H1OA 1CUWA 1LPOA 2P4EA 1DAHA 1RC8A 4OQFA 4JBWA 4EH1A 4E5MA 2P9FA 3JRWA 1I4TD 3UK6A 3PUJA 2ZUCA 4RIIA 4GM4A 5CCDA 1SD2A 5FTNA 1BYIA 2JIDA 1GCOA 3PTZA 1N92A 5HIIA 4NZYA 3ZKWA 2XA9A 2FU5C 4KQXA 4YI3A 5JLJA 4RZQA 4DW8A 3ZGLA 5LQMA 4PANA 1DC4A 3GJ5A 5AJTA 1Y3CE 5AKXA 1EM6A 3PGKA 3OIDA 2L69A 1A9PA 4HRAA 1ORVA 4B3SB 1RC0A 4NBUA 5BNWA 4D8VA 4KXQA 1DOZA 4TL6A 1I4OA 5LQCA 2D1FA 2QR5A 3ZWQA 4A0GA 3NNSA 1ESEA 1JMYA 1W1UA 1XZAA 3RU3A 3Q8XB 2P9CA 2CB9A 4AO8A 3IVMA 5ES3A 3IR6A 1E79A 4PX9A 2G1JA 2QP4A 2R68A 4A0QA 3DCYA 4RJJA 1APBA 2DPMA 3RR2A 3HM2A 3ZDQA 2BP7B 1G8MA 4C7OA 5JCXA 5CDTA 3K32A 2C5FA 3WAJA 1Y3FE 4IZHA 3OI7A 4XSGA 2GR9A 3BICA 2R6FA 4YP9A 4NCJA 3U4HA 1P2FA 1TT5A 3KLOA 3OCJA 2QLMA 1N0HA 3KBBA 4J0DA 4S0ZA 4UUOA 4EYOA 1EFTA 1NQTA 2IHZA 4I6EA 2WPNA 3JWHA 3T95A 3L1IA 4EG4A 1OD6A 2Q49A 4Y1RB 5ENZA 3SBDA 4QBTA 5H3HA 2DHQA 1L7NA 1AGPA 1GCGA 4F5YA 4A6DA 3LCCA 1SA0A 4F5ZA 4MS4A 2FWPA 2W6CX 4ZT7A 1G8GA 1I3LA 2NV0A 3D7MA 3L02A 4K6MA 4LHXA 5E2BA 1KAHA 1T0JB 2E3JA 4NYMR 1RE1A 3QELA 1PFGA 2FWNA 1D1TA 2JFWA 3AIOA 3OC6A 4IR7A 4OHBA 4DRYA 2VPTA 3BERA 5K8VA 2ZVJA 4F6RB 5HPYB 5LLDA 1HX7A 2BUAA 3D4NA 1YB6A 3N8HA 1CF2O 4XWAA 4P32A 4D4GA 2CFOA 2E49A 1W4BA 5GPBA 3ZHYA 1K98A 2VH5R 4A15A 3SIRA 1HBJA 1TEVA 1VSUA 2A9RA 5EJ5A 1N5MA 2PBZA 1UT8A 4BJHB 2FUCA 1TFUA 2L19A 3HA5A 3MZ0A 4NBLA 1Q11A 3UGJA 3O31A 5IYZF 4RMJA 4NMLA 1JEYA 2PUWA 2JF0A 4I4IA 1QO0A 1C1DA 1OA0A 3RC3A 5SZHB 3UA3A 3EXG2 3N05A 1DFHA 2J07A 3ONDA 3QEKA 5T6MA 4C20A 5ADWA 3T61A 1KYQA 1P17A 2WICA 3ORFA 4D82A 1MFPA 1UC9A 3ETJA 3FETA 4G8CA 1AF4A 4M1ZA 3OQMA 1N4DA 3GAFA 3CNEA 1CS0A 4RK5A 1P0PA 4IXNA 2H7XA 4WK6A 3D8HA 2C61A 1CEEA 2C2KA 4REQB 3DLPX 4ZI7B 5C34B 2FMUA 1NC1A 3TFQA 1ZY2A 3OPVA 4MV6A 2ZYSA 3PNSA 4EG5A 2HUNA 3DJYA 1YAHA 2GTPA 3QKRB 4WZZA 5A05A 3VR6D 4R7ZA 4BE7B 2AC4A 2G1UA 5JWRA 1UFQA 4ZU6X 3GEDA 1KZHA 3ZCQA 3A6PC 1LX6A 4I8XA 1Y4UA 1BG6A 3MMSA 1IEXA 2X1MA 3Q7TA 1R8SA 1D2CA 2ONKA 3SOZA 2HCBA 3TLYA 6Q21A 4OA8A 1ZJJA 3T3MB 3ZXIA 2PK3A 3SQXA 4BVFA 1XRLA 1CRQA 3D6MA 3ACDA 1ZBDA 4D6YA 4KH0A 421PA 5KWVA 5IHXA 2IXEA 4RDIA 4B2LA 2QNBA 3D1JA 3TLKA 5ICSA 2Y1XA 1DEKA 1IBSA 1T3SA 2MSKA 1KYVA 4OYHA 1BRTA 1QUFA 5NULA 5DGHA 2EF0A 3WDKA 5C53B 1J1UA 2OECA 5T4FA 3KB8A 1MOQA 2I2BA 3S44A 3DAGA 3A6HA 3PQ4A 2GVNA 1YVPA 1GYQA 2OB1A 4NL4H 4DREA 3QK7A 4A8JA 4ZAGA 3OZWA 1YDHA 3MWLA 4QHTA 4EO9A 2HK9A 2GYWA 4HG2A 4KBGA 3W7BA 3KJEA 3IVCA 6PFKA 1AXGA 2BCEA 2PL1A 3EH1A 1QXSA 2FRDC 3F9CA 4BJ1A 2HQBA 3REQB 3BZBA 3NAQA 3RLIA 1Q2UA 3MJEA 2AC2A 5DYYA 3V8NA 4KB5A 4EA8A 2HF9A 3OPXA 3PX7A 2ODAA 2VAVA 2AMJA 2P2CA 3VVBA 4OG2A 2V6IA 5JBQA 4FX2A 5A3RA 5IZ4A 2QRMA 1FSZA 1USWA 1SXIA 1N2XA 5AW0A 1IJEA 4KV9A 3GLKA 2VZEA 4GEGA 2XF8A 1BO6A 2LE0A 4FWBA 1AV7A 4GLLA 4U7HA 1NQXA 2IU3A 1N25A 2VI5A 2WB4A 2QN7A 3ZNNA 8LDHA 3NIDB 1N5DA 3PUKA 3IAS6 3WXBA 5JPDA 2WE8A 4UTRA 3BGOS 5BN1A 2HM7A 1OLXA 1RI3A 4F9FA 1U7WA 3ORRA 1QRTA 2QYTA 1Z5GA 2IHKA 5FPPA 2EX0A 3SC4A 5ED4A 3KSDO 3SX2A 3HBAA 1WMSA 1TVKA 2GZHA 3NYWA 4TS3A 3M9XA 2LP4Y 3E3AA 5L4LA 3WQSB 1CTQA 1PJ8A 1NF2A 2DKFA 2P5SA 3C8HA 3CO5A 4I4NA 2IRWA 5DO9A 5CB4A 1JLHA 4O8CA 3FIUA 4TZKA 1P6UA 2HK7A 3V8PA 3A7DA 4YUXA 4PYIA 3T1YB 1TTHA 1WDTA 1M72A 3RKUA 2L82A 3R1IA 3WB9A 5BQXA 2PT6A 3TOSA 3I0ZA 4C6RA 3KETA 2QTNA 1UDWA 3Q3JB 2PWAA 3P5BA 4FYVA 3OMLA 4HN9A 1HO3A 4INAA 1P62B 1A9ZA 1Y7IA 1R6XA 4MWEA 4F3YA 4CKWA 1Z7GA 3ICQB 4FHEA 5LDDC 3JWGA 3M2TA 4KW7A 3Q88A 4B6JA 4F92B 4OBEA 5FLEX 3K9BA 3NWPA 3AI2A 2BLLA 3TAXA 1LDBA 3KJHA 4EGSA 4WXPA 1W4ZA 4J6FA 5FAXA 1JLRA 5TC4A 3MB5A 2AZ4A 4XWTA 2WU0A 4MS3B 3QPBA 4MQEA 4KPUA 3GMDA 3W2FA 2UXDB 3LKVA 1ZI6A 4WLFA 2OV3A 5DLDA 1HDRA 2EBFX 1YS1X 2GCOA 1VL5A 4RVDA 3V2HA 3DUFB 4CEJA 4QXOA 2AZTA 3U7QB 1XHFA 1J8YF 3ER6A 4PLHA 2M6LA 2FRXA 1WCWA 1NBWB 3NHWA 1XEXA 2HEGA 3NBQA 3B8EA 3CEMA 5LA6B 3MPUA 3RQIA 2P3LA 2QMHA 4GYYA 2H18A 3LK7A 4MQBA 3NHAA 4J0EA 5ALZA 1XVUA 1F6DA 2OEPA 4YDRA 4EGCB 1Z62A 2XNJA 1BXGB 1E2GA 2VXOA 4QQFA 4QYSA 4DLXA 4DF3A 4F84A 3DTVA 2WTMA 2O59A 3E3MA 4CN8A 1OZAA 4AJ4A 4QECA 5JCJA 2G9RA 1Z0DA 5AUPB 3H0CA 1KOLA 3UUWA 5K0GA 3A0UA 3MT9A 3I2IA 4GGOA 3C3MA 1ORIA 3AR8A 2CXSA 1D1PA 1A1SA 1PLKA 1QGDA 4RM2A 4DEVA 3IDSA 4I4CA 2BN4A 4BNXA 4HYTA 4ROTA 4L5YA 5G1PA 1W88B 2ZB2A 3DZBA 4KTVE 3FPFA 2W2QA 4D5EA 5GAJA 2CT8A 3E84A 1B3RA 1Y4SA 2QL5A 3QENA 5TF4A 1YF3A 2IFTA 3E6AA 5F12A 1JDVA 3ILVA 4R54A 5LKRA 2BYTA 2JW5A 4G1MB 4V02A 2VNSA 2YNMD 1S1MA 1TUBB 4I66A 3SXUA 1FTWA 3JSAA 3GLFE 3I37X 5JSZA 4O4LA 5HF8A 3VO9A 3QLEA 8AT1A 3UWOA 2GEJA 4AB1A 3D3QA 2FUKA 1O95D 3L7MA 4MA5A 3OTOB 3P2IA 3L4JA 4YDSA 1GNSA 3BKXA 4LF7B 5CGZA 4QTXA 1YVDA 1IZYA 2G36A 3RYTC 3AILA 2IS2A 1JHRA 1U2TA 2QX9A 1C7FA 4DZRA 3WLFA 3TTVA 5CB0A 1DWUA 3F6RA 1IEQA 3DNFA 3PLNA 1P1FA 5D2CA 1TIBA 1G4AE 1QUEA 3MWDA 5EHGA 1BGXT 3SKXA 3FNBA 4D2IA 4DTIA 4F2PA 3ZVLA 1P7CA 5JQGA 1Z88A 4IEEA 2ZATA 2PRYA 5AI5A 2YWRA 1NV9A 4C4XA 1HL3A 3ABQB 2PWBA 2ZSHA 4MPRA 2XYPA 5H81A 4R1SA 1KQOA 2PO5A 3JZAA 3V42A 1OB5A 2O2SA 1DEAA 4FZJA 4MQ4A 1OF1A 3CLUC 2QZ4A 1GTMA 2J45A 4ZMRA 5IG2A 3FYUA 2RBKA 1JQKA 3QI7A 2Q2WA 2G6TA 4O0MA 5B2EA 2RHBA 3WLEA 5CCEA 5MGNA 3NBXX 3ZD6A 1WQ4A 3MQ2A 4QODA 2CJWB 5A0VA 4MAFA 3NP7A 3QV2A 3KKKA 4IW3B 2DB3A 2WB2A 4QO8A 1N9KA 1EGMB 3MC1A 2HDNB 4R5MA 1UT5A 2EQBA 4DV6B 1FFYA 1RP7A 1RE0A 3GDFA 3ABIA 3IQIX 3DE2X 3ND8A 3E1SA 1EFRA 1XRMA 1FQKA 5CA1A 2JH3A 5DGDA 1ZL0A 3IIKA 3KFVA 1SU8A 5IBRA 2Q4BA 3UT6A 2WKQA 4C4SA 1GN8A 2QAJA 1PR3A 3T3HA 1QFJA 1IUNA 2RGEA 2PE5A 5AOVA 1KIAA 3DZJA 3EIXA 3IDQA 4XPZA 3VBEA 4ZVNA 1NVBA 1S3SA 3QU4A 4H6XA 4IOJA 5T4EA 1B8PA 3VR4A 1X2EA 4MVCA 2ATIA 4MNTA 3OTHA 3KZOA 3T4UA 4X6LA 2OP0A 1L1EA 3NRJA 1SKUA 1POWA 3OG9A 2O0JA 5B1DA 3RBXA 5C1PA 1DX4A 1KJQA 1UXIA 5FUQA 1J0XO 3CRZA 4CMJA 1RPNA 1RADA 4D6PA 2P4UA 1YB5A 1MF7A 2OPBA 2POCA 1BCRB 1Z8HA 2YUTA 1WZIA 3CLUD 4HAVA 4JGBA 4LMBA 4OKNA 1DLJA 2VHUA 2VIIA 1XDSA 2D5LA 2HQOA 3R7SA 4FR2A 3GIWA 1KS2A 1M7HA 4A1FA 1YGPA 2ONZA 3MTBA 5IKXA 2V7BA 5A4KA 5JZSA 4GPAA 1J07A 3ZLBA 4XIJA 1Y34E 1RJFA 2H92A 2I54A 2XF2A 4BLWA 1KEUA 3NASA 2O8BA 1MO3A 1N78A 3T9DA 3Q85A 5EE9A 5KYUB 3W5DA 1UIRA 5ES4B 3AEUB 3EXIB 1TYZA 2DFKB 3JQAD 4E0BA 2YIVX 3PB3A 1W36D 4F4DA 4W5NA 2TSYB 3BWBA 2QRHA 3THXB 1OAAA 2SICE 2B8TA 3VNVA 7REQB 5H02A 2ZRGA 4AJ1A 2DQYA 1O94D 3IQXA 1L5SA 2W2LA 4FDLA 3KRTA 4IDHA 3U80A 2NUBA 2ZYWX 4DDVA 2IGBA 3CKKA 1ISPA 5BQFA 3IQGX 5FDFA 3ABZA 3FZYA 3K0AA 1AQLA 1SVNA 5DVZA 3SE0A 4C3VA 2W8BA 4ERNA 3QUTA 4HDOB 1L4LA 4MI1A 1W5EA 5REQA 1MD9A 5C81A 2JB9A 4ZQIA 1KIFA 2BELA 2B6NA 3G1WA 4MJLA 4KQ9A 1KQNA 4BGEA 1BEEA 3KB1A 1D5CA 1EFDN 2CLFB 1F6BA 2R79A 5GGXA 2EWMA 2RGWA 4GC5A 4OAOA 1PFWA 2R4QA 2EJWA 2ZWIA 5KNDA 4GWKA 1W5BA 5I8ZA 4F97A 1IZZA 3C45A 2FR1A 3R5TA 1NSFA 3EC7A 4Y6RA 3KYDB 2EBWA 3PDIB 1U2PA 1K7YA 2V7GA 2ZBQA 1HT3A 5EZ6B 3ZOZA 1DAEA 1RFLA 1JYSA 2VJKA 4L15A 3T41A 1K3UB 1JTFA 2DSNA 3KO8A 2NQ2C 4UTPA 3O83A 1V5EA 3ZDEA 1HDXA 1ZD5A 5KYVA 1G291 2JI6A 1OXMA 1F8XA 4FR0A 2X7XA 2OCAA 4MVJE 4R71A 4CXMA 5EJ6A 1M10A 4GVPA 1G8PA 2H4FA 4U5QA 4BNDB 3D2LA 1DMRA 2XT9A 2PXAA 1KE1A 5HIKA 1GV0A 2IBMA 1T8RA 3HRHA 4FLFA 5KS2A 1Q7GA 1QTNA 3A27A 2EFHB 4JLJA 3F8SA 3C24A 1Z6PA 2C54A 4M0DA 4AG6A 5CXUA 4N1AA 4DG8A 1PQUA 1JHMA 3NOOA 2QX8A 1PL0A 3R7WB 5JWOA 1T9GR 4H0NA 4CDGA 4OXQA 2C7RA 3EMVA 1DU4A 3E3OA 4BVLA 3K5WA 3L6CA 4JSYA 4BE4A 3V5NA 2JBAB 2K7ZA 1N0VC 2O3RA 2Y0EA 3PYXA 4ZO4A 4YXWD 1VB3A 3CWCA 5HE9A 1SBYA 2HMSA 3TDKA 1ONPA 1LD3A 4UTVA 1RRKA 3O8BA 1E1NA 2HWXA 2FP4A 3LCMA 5HJ5A 4R40A 4O4IB 4BASA 4ZCMA 4KK3A 5AI4A 1B6TA 1D1QA 3VR5H 1CXZA 5LP6F 2OHHA 4OP1A 3IT1A 1UXOA 3GXOA 5A03A 5K6AA 4GR4A 2V4ZA 3K6SB 2XVXA 3B6MA 4K6GA 1V6AA 1WW3A 2QPAA 3GF4A 1KMNA 3GVXA 4JA2A 1B41A 4HHEA 4OGGA 1LPAB 5JOQA 3HA3A 1GEGA 4ZIRB 4OP2A 3DZFA 2C98A 4YTEA 1XNJA 2ECQA 5DTMA 4ZCIA 4GL2A 2I6SA 1IZ0A 4C0XA 4QPDA 2ZIAA 3A3PA 4D02A 1H2AS 1JT9A 1T29A 3IXLA 4GRAA 4TLAA 4U7FA 4C5AA 2WT4A 4J43A 1IZ9A 1QYCA 3IB3A 1OHHA 1F60A 2Q4RA 3ETGA 4HNUA 4B4KA 2IXBA 5D84A 3EZ9A 4WNCA 1ZVKA 5C7OO 3CCBA 1MV8A 4R05A 1WABA 1ZJ5A 5DP1A 3L84A 5TQ2B 1CLUA 1VHLA 3OCWA 1WMAA 1NMXA 1IVNA 2F1HA 4HDKB 1PJBA 3PEEA 2R1ZA 1ZMTA 2O05A 3C6QA 3KWMA 3PT9A 4FFNA 1X1DA 2VAWA 4HZIA 2OA0A 1VKZA 1PNVA 3QVLA 1SULA 3WFIA 2BRUC 3BWXA 4KHPB 1U3FA 5BVHB 1EB8A 1FYWA 1J24A 4XLTA 3I12A 3TRDA 4IGKA 1VDZA 4LRXA 1UOEA 3PNVA 4MCHA 1ONBA 5I45A 5KNCD 5JAIA 2FF5A 1NLYA 1NJ2A 2HPAA 3FXAA 3UUEA 3SY8A 1N32B 1BJRE 2CLSA 4ZTBA 2HZBA 3GUZA 2XQIA 1X39A 3JAMA 3H5AA 3P9XA 7ABPA 1Q6ZA 2R8YA 4LEIA 3AVOA 1DTSA 2GD6A 2PX2A 3ZV4A 5ICEA 2C0PA 3H3JA 3IP1A 4WKPA 3FRHA 3TYXA 2O54A 3QNWA 4MV5A 5DX0A 4DLWA 4UJ5A 3GO4A 2IU6A 1G66A 3GT4A 3MUFA 4XZ3A 3WK5A 2G70A 3H0KA 4BGIA 1BKYA 4I55A 2FMKA 2BEUA 2XRMA 2P9HA 2OFFA 5I9LA 1F0PA 4I55F 1A8IA 3NALA 1O0BA 4LRSB 4DV0B 2AFIA 3VQTA 3I3SR 1QWOA 3ZWPA 2J0VA 5JYCA 2YMLA 1R8YA 1BWPA 4B6SA 2Q1XA 1TW3A 3K8ZA 4KO8A 4E3WA 1YRHA 1QC5B 3OQ6A 4B8ZA 1DWQA 3JD4A 4CKBB 4FI3C 4XX1A 5A2QA 3ZYCA 1PGJA 1TI7A 2OXCA 4Y1EA 4KQCA 3JRXA 4W1SA 5KOYA 2BM1A 3AW9A 1T4CA 1FSSA 1NN1A 1TRHA 1M2WA 1Y4DE 3E35A 5ALMA 3WGQA 4NS4A 4D9MA 1SAYA 1MH9A 1T2CA 2QB5A 1V6SA 5J40A 4JT2A 3U5TA 4JB8A 3T15A 1XD2A 1JG7A 1N6PA 3OU2A 4O2BA 4NLLA 4BMNA 2PKEA 4NK4A 1YJXA 1ZD4A 1KKMA 3DMYA 4HNRA 4Y2HA 4F4CA 1VG1A 3ENQA 1T6NA 4KP7A 1X38A 1AKVA 1NYLA 1G9SA 1Q5PA 3QXSA 3ZZTA 4NCHA 3IERA 4XYBA 5T8KA 5J43A 3A58B 1J8VA 4S12A 1AQYA 2NZUG 4C4PA 3WFJA 1SK8A 1PBNA 1L9KA 3KCQA 1CRZA 3WLKX 1SHJA 2AKAB 3LY9A 4JI0B 2PGAA 4KGDA 4MUMA 4KI7A 3ZR4B 5ISMA 1Y8AA 1Y1LA 2WF5A 3G5AA 3SJAA 4XGIA 2PN1A 1RLJA 4R4JA 1WG8A 5JD4A 1RZRA 4Z53A 1FZQA 1FSPA 1T10A 4Q7EA 4EEKA 2K5UA 1AUXA 4CMIA 3TGWA 2J3HA 4TOIA 5ALGA 1NQWA 4ILKA 1KA9H 3CH5A 1AS0A 3K31A 4DXAA 1GA4A 1L5MA 2V0CA 3KXLA 4H27A 4Y1GA 3QTBA 1P3Y1 3PVSA 2HXGA 4AUEA 3NHPA 4C05A 1NVGA 1AB6A 1U8AA 2XR1A 1XTBA 2NT3A 1QQTA 3KKLA 1GTG1 3PA6A 2BFPA 4MRNA 1OI2A 1UPTA 1P9OA 2TECE 5J4VA 4ASUD 2IW1A 4WEQA 4R2XA 4DUGA 2YYZA 5SZJA 5J2TB 3FMGA 1P5FA 4NAUA 4ALLA 3PG5A 1U1IA 2PKRA 4TSFD 4RTRA 1V1JA 2OZEA 2RHJA 2QUBA 2PU7A 2Q5QA 4H0CA 4YQYA 3RYFB 2FG7C 4BMSA 4PBTA 1J8FA 1MGOA 2X4DA 4JVSB 4M3NA 3Q2OA 4B5KA 1WMFA 4G0UA 2BFFA 3B7PA 1QANA 1GPDG 5AW3A 4ZYVA 3FWZA 4IBOA 3OA0A 5WRFA 4TMVA 1SXJA 1XXHB 1MAHA 2IDZA 2X5XA 4TRNA 2J46A 4ENRA 5C4MA 4WXRA 4GGMX 1Z2DA 4HRYA 3H7IA 4LJYA 2OAGA 3EYAA 4XDHA 1NU8A 1JR2A 3LA8A 4X91A 4BRUA 3PC7A 1LBTA 4TZ0A 4G86A 4GPEA 3ON5A 2R6HA 1PSWA 1IN5A 2W2KA 4EENA 4EJFA 4EUEA 1RMYA 3HN7A 4C7VA 3K9FC 1Y5MA 5F64A 5TPZA 3M5CA 4M8IA 5JCOC 5HUJA 1MAAA 1HXHA 4GOKA 3TBHA 1KVQA 4BBPA 3OICA 1U5BA 1GTJ1 3NV7A 3QX8A 2AOUA 3D6TB 1L8AA 3LD9A 4D3FA 5KJ6A 1RZUA 4ALIA 2HSWA 1EWQA 1YWGO 3COZA 3LHDA 1MPXA 3NX4A 2C20A 2VJOA 4NZMA 2V9CA 1SU7A 1A9QA 1LA2A 2WVJA 3LQKA 1U3WA 3OTIA 3PFWO 2I6TA 3TZKA 3VV3A 4DM7A 2F62A 2H9AA 1SHZA 5EIAA 1YB1A 2JD0A 4HTFA 1QGYA 2PGLA 1ESCA 4A26A 2C3PA 2FF7A 3ODGA 1UOOA 2HMYB 1JRLA 4UHJA 2QM3A 1MGPA 2AI3A 2IELA 4E1VA 1IUKA 3GP3A 4XVUA 2NP6A 3D6JA 2HCTA 4NCKA 1CIPA 3HJHA 4M4SA 5B37A 1H65A 4QXRA 5ALFA 2CLDX 3MD9A 4KQIA 4WK0B 2LD4A 3V97A 1CZHA 5CXSA 1NY6A 1G2IA 1DRVA 1F3LA 1C1DB 5TS2A 2PCLA 4R31A 1T0BA 3B6KA 3R0ZA 5TARA 1HC7A 4K7JA 4S35A 4X95A 1W9HA 4B76A 4DSAA 3KPWA 5BW6B 5JISA 4B82A 1ONSA 2WJPA 4KVFA 4B3HA 4JU9A 1A3CA 4YRGA 1NPDA 3VKGA 3L0CA 2FW8A 4KIGA 4ZO9A 4Z7JA 4REOA 2DXIA 1HA3A 1SPBS 2R96A 3O92A 1RYZA 4DMUB 1FDVA 4R8MA 2J3LA 4EM6A 3AVUA 1QF6A 5BSRA 3STXA 4RENA 2DBZA 2QBYB 1E6CA 1QNFA 1WMDA 2OCIA 2C0QA 2H0AA 4JJFA 4CR6A 4XLZA 4QBHA 3O9ZA 3VO8A 3ZCSA 1H0RA 2FHSA 1QGUA 3CVOA 3L4BC 4NJOA 4PFQA 1B8OA 1F6WA 2C8LA 4PLZA 3KWJA 4GI5A 5FUXA 4R2HA 3ZHCA 3I4FA 2AK2A 2FB9A 5KWEA 1X8LA 1NZJA 4ML3A 1Y33E 4E6EA 1VCNA 1H2HA 3EGOA 4CIWA 3F8TA 3HVUA 3QE0A 5D85A 4DNXA 5I9BA 2HA6A 2PMBA 4LJ8A 3PJGA 2QRLA 4MR9A 1ISGA 3BXOA 4PO3X 1V3TA 3CZ9A 1OXBB 4XRRA 1J4AA 2NO0A 3I9NA 4TMTA 4ZVQA 3RSQA 1I1QB 3UBTA 3BZWA 2E5WA 2FN9A 4EPYA 4P36A 1UBEA 1U9YA 5ITSA 3JTMA 1GXSB 3L6UA 2YL2A 3WRVA 1YK1A 4HGPA 4QUBA 3WL5A 3WQQA 2FSPA 3J81A 3B6JA 3HI4A 4A8JB 2IY8A 2IS4A 4G85A 1JSLA 4PYJA 1XZIA 1AY0A 2QMYA 3FWYA 4J0HA 2IYZA 5EUMA 3F78A 1XZGA 5AHWA 4TMWA 4L28A 4Y0NA 1E60A 2I33A 4YUAA 1JFSA 3MUOA 1H9BA 4ZZIA 3TECE 4J4BA 4NF2A 2CL5A 2V0GA 1GQOA 4UVDA 4BUCA 1GL9B 1DG1G 2IHTA 3FM9A 3LW7A 2OLJA 3OKPA 4RVOA 3OVMA 1Y6ZA 4M7PA 3M4ZA 3UHAA 4BMYA 1WP9A 3L5KA 4KMSA 4HDQB 4F46A 3X1MA 1JAXA 3MXOA 1HF3A 2B5OA 3Q98A 1G1MA 1VZ3A 2AN3A 3FPKA 3ZQUA 4F5DA 4UNRA 3D4BA 4S0XA 4IFTA 1GRRA 1L3IA 3AHEA 1MFZA 1R6VA 2BD0A 4FZ3A 4ZHQA 2M2IA 3PC6A 5JJ5A 1IN7A 2OD7A 4HWOA 4J94A 2PMEA 2QD4A 4NX2A 3DOHA 4B1FA 3L7IA 3IP7A 4DR6B 1VL0A 3CLTD 3I9FA 1H1LB 5CVTA 5JSQA 3KQVA 1NE2A 1WUJS 2JA2A 4NOLA 5T4HA 1C80A 1LPBB 3IHLA 2I2FA 4KZPA 1IATA 4IY1A 3RYCA 4OP3A 4UOEA 2ZI6A 1L7EA 1SUCA 4FILA 3DDWA 1I7LA 2RCNA 2M98A 1O6BA 4CW7A 3OCZA 3KZVA 1P2TA 2WUFA 1MENA 3R5FA 2VEDA 1JKJA 1JE1A 2AQKA 3EHEA 4XSHA 3PJFA 2HKIA 4BXOA 5F21A 4F56A 4PZDA 3T5GA 4RDHA 3TX6A 3UQZA 2IS1A 4KRYA 2NSJA 4IP0A 1IBRA 2Z9DA 5JPCA 3E18A 1OU4A 3G0CA 4IQ8A 4Q66C 4AJEA 3L01A 4RM3A 3T52A 3FY4A 4E46A 2HK6A 1C4KA 3DLAA 4H7IA 3WBKA 4QTTB 2EVWX 2JVJA 2LCFA 1L6IA 3I73A 2WJ6A 3IIIA 1O94C 1H6CA 4PX5A 1I5EA 3S2YA 4ROSA 3USZA 3H8JA 1YULA 4CCAA 3BXFA 4HX2A 1EX6A 2ZVPX 2ZRKA 3BMXA 5CDUA 4WN3A 4WINA 4XD2A 1NNI1 2PZJA 5C1BA 3QITA 4PHTA 1SB9A 4ZJUA 1E89A 3O8RA 1U8UA 1PN3A 5DOVA 16PKA 1SVKA 2QTGA 2ZRCA 5B55A 3R0QA 3DO8A 1PL7A 4YAGA 1J2UA 5CYGA 6NULA 3BDAA 2WABA 3JR7A 3LDAA 1W1IA 4HX9A 2RH9B 4FMCF 4LYYA 4RY2A 1W581 1PVOA 1GV1A 1BW9B 5DE3A 3TQOA 3WISA 1G9TA 3DCJA 2EAUA 1TLLA 5GP1A 5CFPA 3TAHA 4JDPA 2QX7A 2DQZA 2BMEA 3PNQA 3OEHD 3RTAA 4AQYB 1WBDA 5CMLA 2CMHA 1Y0BA 2ENUA 1L1FA 4E33A 3FN4A 3GDGA 4QNMA 4WLNA 4RVFA 1L4YA 2EJBA 4MVWA 1BU8A 4LY0A 3CZMA 3FKJA 4TVSA 3OP1A 1QJ4A 3ERCA 4ENQA 1NRIA 2JJ1A 3ISTA 2YASA 4M9ZA 2E87A 1Q3TA 3KZXA 4K03A 2BEJA 4U6SA 4JITA 1MOZA 3MLAA 1Z6YA 1RJWA 2BR3A 5FX2A 4B5LA 1IBMB 3V7YA 3A2LA 5KVSA 4RNCA 1JQ5A 4H3HB 6ABPA 2R1TB 3PT5A 1EDDA 1CRLA 5KNBH 2X1VA 3P4UA 2F8TA 2RHGB 3KQUA 2BGJA 3BRCA 4LQLA 1UUFA 4W82A 1VPEA 2VFAA 1UBGA 2NG1A 2B37A 1GUZA 4PNPA 1O9GA 1R3DA 4UU8A 5HZKA 2Y1LA 4FOOA 5JNUA 2BSXA 2E5LB 1EUCB 4E32A 2DLNA 2PANA 3HR7A 4YGYA 4JXJA 3GRCA 3DMDA 2FRDA 1M73E 2GUWA 3OOYA 2HEIA 4DSNA 2Q2OA 3L8MA 4RJIA 4URUR 4BQOA 3W34A 1RR6A 5CAEA 1GGNA 3GNSA 3HCDA 2BGNA 3GUHA 2VF4X 3G13A 1VPLA 1J9EA 3A9VA 1FFHA 1GCAA 3ZE7A 1VL1A 3AYXB 1E2UA 1GRVA 2Q4TA 3AEYA 3LBNA 1YFLA 5AHXA 5F76A 4JSTA 1LB1B 5HKKD 3HWX1 4AUMA 1E3WA 1AMNA 1E3LA 1E9EA 1FFDA 3CJRA 5J4HA 1II0A 3O84A 3ES9A 1E2BA 2OHGA 2V8BA 1JHVA 2QGNA 3I9OA 5C4IA 2JANA 3T38A 5IWCA 2GGSA 4HLUC 4MRSA 5DB4A 3I2KA 3IUNA 4I4TF 3DOJA 2D1QA 1QP0A 1T24A 1Z0SA 4WL0A 2XHEA 4CJXA 4QBGB 3AEZA 4PSUA 1HT0A 1VG8A 1NBMA 4E70A 1O97D 4JEMA 3CC8A 1NF3A 1NF8A 3D8BA 3ZV7A 2PMWB 3ROTA 5E3JA 5E8RA 3WL4A 1YU6A 5CA1B 1U7TA 2HA0A 1QVVA 1EXWA 1TLTA 2Q1UA 2XBLA 4PLYA 5H3LA 4PSAA 5CIQA 4F5EA 4ZQFA 1LDMA 1Q1ZA 1SXPA 4A5SA 2BEKA 5FB3A 3TNDA 4UVIA 2VSFA 1B14A 1YMQA 3NR2A 2JAUA 4TTJA 3MG9A 5KU1A 3VKVA 4S04A 1PL8A 4WERA 2IXDA 2V9PA 3KHSA 3M1AA 3OFKA 3PGVA 1UADA 4YCSA 5BNZA 5KDDA 3T06B 4AM8A 5EPEA 2H1LA 3HDTA 3H19A 2CF6A 2QTAA 3SIPA 2GS9A 2BMAA 1VHQA 1WCYA 1R12A 1YRAA 1T9HA 1W59A 1ZIXA 4Q1FA 3E7DA 3IV7A 3MJDA 4YJ3A 2Y1CA 3DQZA 3FB4A 1QIFA 5ESWA 1GRCA 3T7EA 5J5AA 1G5TA 3OQIA 4UDYX 3S8YA 1O87A 3O74A 1V4BA 3I9V1 5EG5A 2OTCA 1EFAA 1F51E 3FDXA 2PZKA 1L5QA 3EZGA 3K8OE 1SEPA 1GEEA 1K7FB 5DU2A 2HPHA 4DCUA 5TLSA 4ARUA 4EHDA 4UTOA 5CFRA 2OFOA 1X1SA 3C3DA 4MDYA 4ETMA 2CSXA 2XYVA 5KIAA 1WXQA 1V5IA 2XQJA 2AFHA 2NWQA 2BL4A 2REBA 3R5XA 4I1UA 3ZZUA 1QKJA 4C2BA 2GERA 1E6WA 3DMNA 1YQQA 4RACA 3OZBA 2Z6UA 3HYCA 1VKRA 2PUCA 3HGQA 1EP2B 2WF8A 1XQ9A 1KR5A 3DB1A 7REQA 4Z4GA 3AJRA 3C7KA 3HU3A 3KLPX 1E96A 4IUYA 3E9QA 1IXSB 4GQAA 2BEVA 2HGSA 4JJ7A 3V1LA 1SXJC 4R0VA 4XUCA 1BWSA 1OAOA 2IZ7A 3CYFA 3Q0IA 3IIMA 4E14A 1HYEA 1Y89A 2BTQB 1Z37A 3AM5A 4BGUA 3P20A 3AVXA 3G8DA 2JL1A 2AJLI 3ELBA 3MM4A 1X7WB 4Q6WA 4M1OA 1JDTA 1OYYA 2ZWOA 5TMEA 4ZYWA 3KUUA 1JJIA 4AAYA 5IU6A 4OMUA 3D2BA 1JYEA 3LL4A 3OEWA 4LYDA 2B34A 2HNAA 4HC4A 4PTYA 3RU9A 1ISIA 1J2RA 4FKZA 3CLSC 2D13A 2ISCA 3W3AA 4DZZA 1XPJA 2H5IA 5TQJA 1DAKA 3ZBUA 3IQWA 2Q9AA 3I04M 1YBVA 1SXHA 1ACJA 4F3RA 3PHHA 2YICA 4RAQA 1WHTA 5C37A 5MN5A 1EUQA 3K1JA 1RWNA 2GPWA 4GXTA 3RO7A 1SBTA 4B71A 3QIAA 1VE3A 5JALA 1D04A 4EBBA 1D9ZA 3K92A 5BUQA 4EY8A 5T67A 3TG2A 1DKLA 2REXB 4HDRB 2WIKA 3BXPA 4LC0A 4CWAA 1K6EA 3B12A 1UOQA 1KGDA 4IH4A 3S6JA 3U6BA 3NWJA 5GWXA 4M1KA 3WK4A 1LRLA 1NNLA 5TF0A 3HPQA 1TUGA 1LI7A 2AD1A 3I32A 4J4TA 3CRMA 2XH8A 4P0PB 3SDSA 4JJAA 2DP4E 2EG9A 4A2QA 1XMXA 4D9HA 2RE8A 1N3IA 3BN3A 4INZA 4X54A 1ZM2A 3UMVA 6ADHA 2RBGA 3H9JA 3IEPA 1NMSA 4H7KA 1YQGA 2AOTB 2ZXFA 2O2HA 3CUEF 5J5CA 3AFNA 4D8YA 2P2ZA 4BS9A 3SEZA 2WU1A 3EGDB 3MFYA 3KQYA 4XCQA 4KXLA 1T9GS 2CXUA 3UF0A 3JQ8B 3KU4A 4IWXA 2XNHA 4DCGA 5JNRA 5K20A 4G0QA 4UU7A 3AM1A 2Q28A 3M6WA 3PR3A 1CQJB 4I9FA 3D02A 2E37A 1XG5A 3QLVC 4QLBA 5BUCA 1M6NA 1V47A 4DDUA 4HAOA 1PT8A 3VTKA 4E5DA 2E4AA 3WWEA 4D92A 1FMFA 4XWWA 3RRXA 3W2GA 2IPXA 1L4UA 1CZUA 3UKJA 5CBPA 3R5KA 1WSWA 4UZEA 1VYUA 3OIGA 2IYQA 3DBOB 3QLJA 2YMMA 3BMOA 3VR5A 4FOPA 1Y8RA 5G0UA 4RKRA 3A6JA 1TUEA 4Q16A 3A4IA 4FYWA 3IAM6 4LXQA 1G60A 1C50A 3SP1A 5KQRA 5K51A 2F8MA 3VO1A 3KC2A 4L73A 4UNPA 3M7IA 1FFBA 1M76A 2I67A 4R51A 1WXWA 3WLTA 3CNHA 1QHFA 1VCOA 3II6X 1I2MA 3SHQA 4Q48A 2ZBGA 2QZ9A 4F21A 5KNBD 2GVZC 1IAVA 2V7EA 3OOEA 4GX0A 1O2DA 1QLWA 2HH9A 3OT5A 1QMGA 2YVUA 4Y2UA 1Q16A 2C4WA 4M87A 4LXTA 1Q14A 4IL5A 2WT8A 2UV8A 2A67A 2X3FA 4OFBA 4RD6A 1RM3A 3HB0A 1T5DX 2YFQA 4GD3Q 5BVHA 3L8ZA 1A2KC 4MVYA 5JYBA 2AMVA 1NG1A 2X0NA 3O21A 3PC3A 3HJFA 4GAEA 5IDQA 1Z0ZA 4UD2A 4QEKA 3ELUA 4DYHA 2GCPA 5BOVA 1TIPA 3HP4A 1WSDA 3LRXA 1ZK1A 2IYOA 4FYPA 2QDXA 4OL9A 3ZU4A 5C8VA 2H59A 4HP8A 2AA3A 1N7JA 4NATA 3DW3X 3MB8A 1Q0QA 4B17A 2MSDB 1R8XA 2X23A 1YR1A 2VRCD 3KEMA 4OI4A 4E1AA 4YCLA 1BQEA 4JUDX 2OHVA 4AJNA 2DR3A 1XDGA 4JOSA 1XP8A 2BFWA 2H4JA 4YN3A 3RG2A 2Z6QA 2V98A 1E1RD 5IAEA 3AY6A 5LUAA 4JI6B 5JR3A 2CL6X 3FTNA 4N5DA 4EW1A 3EGVA 1RQ7A 5EOVA 2YV3A 1SQSA 3PK0A 2JHGA 2YNMC 4KN8A 4MW6A 3T4PA 3SK0A 3UMJA 4C04A 1C3XA 4N8SA 4M60A 4M99A 3UXHA 4OHWA 3GLHB 3JQRA 2VNHA 3EBPA 4R6WA 1KZ6A 3PHBE 5IUNC 4UM9D 5J2UB 4G65A 5AJYA 1KAEA 3ZIDA 1A50B 3LFUA 2WIDA 4CKBA 3THOA 3HCFA 4DRZA 3CNQS 5J4KA 1I3KA 1U4NA 1T5IA 2O2IA 2XUGA 4N0MA 1T6BY 4EY4A 5BRAA 2WZQA 5IN5A 2YYYA 4BNIA 1KZYC 3ZCUA 1WVGA 3GUCA 4FUTA 3LDHA 2AIRA 1W6UA 5EE0A 2JZCA 1C30B 3CB4A 5JVDA 3QKSB 3SLRA 5U4XA 3IEIA 5B57C 5L3VA 4BRZA 3WYCA 1Z16A 2V45A 3CVWA 1I2ZA 5NLLA 2ZTMA 3ROQA 5EHQA 5A6SA 4IFIA 2JFBA 5KMGA 2VUUA 2ZI9A 5JFTA 1ST2A 3OT1B 2A9KA 4P2GA 4BMZA 4XJSA 4LC1A 4X85A 4IHJF 1U31A 3G0BA 3MGKA 5F3RA 5G53C 4TV8F 4C30A 1VCIA 3RC2A 1XHLA 3DO6A 3KVYA 3L1KA 4N0EA 4YX9A 1Z4QA 4IEFB 1RC1A 4J2TA 3SOPA 1EDOA 1O94A 4MINA 3IILA 3X1KA 1CF9A 2A88A 5ICGA 2WD8A 4PQGA 3UENA 4B48A 3JPWA 3O90A 2B7LA 5KPJA 2P6RA 2ZIVB 3OPYI 1PZFA 1AKEA 1RXIA 1Z74A 2PBFA 3V55A 1FFCA 2H07A 2HT1A 3I0MA 4KN9S 1WEKA 2GJSA 4Y6PA 3VHXA 3SX0A 3G9UA 4LF8B 3B3AA 2J0SA 3K0CA 1CY6A 5EKXA 1LXCA 4AT1A 1K86A 3LHFA 4RSRA 1SU6A 4GMDA 1KSJA 5EIFA 4K8RB 4FHZA 4D45A 3PNPA 3HNPA 4UHCA 3SNKA 1F20A 2ZI5A 5DYNA 1IM8A 5A9TA 1IY8A 4M22A 4WVFA 1NFFA 1P3JA 2AHRA 3Q1KA 4JR0A 2NU7A 2IKQA 3CN7A 4TMFA 5KSWB 1JF8A 1WU7A 4EY7A 1SH7A 2DH6A 2IEZA 3A6ZA 2YXNA 4Z7NB 4KI0A 8MHTA 2ADOA 4QYWA 3MWGA 1Z6TA 3G82C 1KJZA 1IY1A 1NP3A 3QUCA 2I6XA 4ID9A 4MP6A 4J03A 3WMFA 2FJ0A 3ACCA 3QF7A 1NXTA 3NHJA 5ALLA 2CDNA 4JLPA 1GSOA 2A57A 5ALRA 3D4IA 2ZBDA 2QGFA 4XGKA 2WUVA 2JRLA 4Q9IA 1CP2A 1SKAA 1Z17A 2YN0A 4V24A 3TPZA 3FDIA 5CH3A 3VR1A 2X5JO 2DPHA 3MAJA 1L5KA 4IV0A 4AP5A 3IRUA 3MGGA 4A8HA 2XT6A 2CBXA 2MHCA 2ZJ5A 2Y99A 2Z6AA 4F38A 3KQTA 3F5MA 3AR3A 3R41A 5EAIA 3Q40A 2E1PA 3U3MA 4F2HA 2CK3D 4JOQA 2AZDA 3QSYA 3KSAC 1FVOA 3FB1A 3N7TA 1C41A 1R6AA 1CQWA 1XJWA 1HE8B 2OD9A 2R84A 3PC8A 3C7TA 3O2JA 3WSWA 2JAHA 3RS8A 3DBIA 2VPPA 1TF2A 3H0EA 3G1UA 4NHEA 4GX1A 2N1BA 3WIDA 3AJDA 4FJ0A 3L18A 1NBIA 5DPMA 5IH3A 2OZVA 1KI6B 3PPYA 4YRNA 4I6GA 3T5CA 1BHO1 1K7SN 1XDWA 3RU7A 4KUEA 4ZC8A 1L5NA 5K6TA 1ADYA 1VSTA 1DEHA 2IHUA 1UEJA 1FMCA 3D8SA 4EJMA 2A8YA 4JZKA 3N6XA 1F12A 3LQRA 3IVXA 5TIIA 2GILA 1LBSA 2XWBF 1OIVA 4BIIA 5C80A 2QPLA 4V0NA 4CIDA 2GO1A 4RTMA 1CETA 1NXXA 4CI0B 1PR5A 1UFKA 1RHJA 2BFAA 4MQLA 4U1RA 5CVDA 3Q7QA 1HR0B 3EA4A 5FFNA 2Y2UA 2J9RA 1VE7A 2JLXA 4JWKA 1G8KA 2GRUA 4M55A 4HVCA 3BOSA 4QG7A 2XUZA 3CSUA 3ZBPA 3BXZA 4A2PA 3LWZA 3PFHA 4PU0A 5JRZA 2QZJA 1OWMA 1ML4A 2GN1A 2NYVA 3LT5A 5CJJA 4R2JA 2RI6A 3K6JA 3R74A 4DSZA 3LW8A 1KFBB 3BB1A 1GFZA 2DU8A 4RPLA 3FMPB 1H2FA 3VGJA 3RUHA 3J7AC 3TQSA 4C0HA 4QHSA 1KBZA 3P1JA 5JNLA 4UPVA 2JS7A 2NUPA 5I6DA 1RAGA 4JYPA 3GOHA 2BZSA 1USUA 1E1QD 2VDNB 3I6BA 4ZAWA 3WWYA 2O0LA 1GJRA 2WVAA 1R6DA 1ZXLA 2Z2JA 4LXXA 4ESOA 4OTZA 1XU9A 4R3NA 1NBME 3KTDA 1JFFB 5KNCA 3TNJA 4DILA 4JNCA 2P90A 2H17A 2WFMA 1JHQA 4JX8A 4LHSA 4RX1A 2FSHA 2QAGC 2QS9A 1K6MA 1QHSA 1Z38A 1AZSC 2Q3BA 2X0KA 3ROKA 5E6SA 2WIGA 1E6KA 1PV4A 4FYJA 3TR5A 1USKA 2Y1DA 4LBYA 5IHPA 1JNXX 1XLTC 2IHVA 2V3VA 2DT8A 4UMVA 4O25A 3OQOA 3LHSA 3UJ7A 1M34E 2VPXA 3EEOA 4YMUA 3K15A 4PYNA 5HJEA 1E32A 1PJRA 2CFCA 2WUDA 2RIRA 3F4LA 3AESB 3FBGA 5KOHB 3MRXA 2IZ5A 4ZCLA 3LPNA 4MV7A 5JY1A 3ANLA 3P9ZA 4TYPA 3H6GA 1LVGA 3P96A 3PUZA 4KXNA 4PLGA 4XEUA 4J6EA 7YASA 3JZDA 4ZRNA 3R76A 4DCSA 1I7SB 2AHOA 1XZMA 2BCJQ 3FD8A 1OLUA 2NO1A 3JVEA 5HRAA 1KO1A 1FOEB 1AD2A 3TXXA 4RH3A 1HOTA 1ECJA 3U7FB 3FPCA 4JJEA 1DRUA 5KYYA 4A0RA 4LJLA 2Q5EA 5FEMA 3NONA 3HXKA 4NEGA 1JIVA 4UNQA 2I8CA 2GAOA 2QU7A 4YDQA 1DIGA 4ETNA 4RCZA 1WSAA 4LXIA 4CR7A 3X1ZA 1Q15A 4EZEA 4Q9LA 4B4OA 4GKKB 2WLSA 5A7FA 3BD7A 4M1YA 1NW5A 2CKDA 1AS2A 2B4TO 4FEGA 3O7WA 4IDBA 3TK1A 1J6UA 4Z1OA 4H6WA 2BWJA 4PG7A 1VA4A 4JJKA 1T8UA 2FWIA 5BSWA 1EUYA 4G4GA 4DJ5X 2G0NA 1Q3HA 2BZ1A 1CVIA 1QBKC 2AXPA 1KYTA 1CWUA 1V1MB 2UYOA 1HDIA 3C3CA 4RADA 1PT9A 5BN5B 1UBJS 3FA2A 3RJ5A 4DBLC 3AXSA 3SHOA 1RPAA 2QE7A 3USCS 4EA9A 3ANNA 5AUNB 2QJOA 3B1FA 1LTQA 3JV7A 3WJ1A 1ZS9A 3U39A 4LSZA 2MYPA 2FN4A 3DE5X 3DKKA 4EKIA 1RZRD 3QELB 5GIOE 4N6NA 2IS6A 5EESA 3HBJA 3KSMA 1MJ5A 3QVWA 3AFIA 4LMRA 4MJXA 4UFOA 3L0IB 1UBMS 4BXOB 5KINB 2OAP1 3QY0A 3RLFA 2C1EA 2O8CA 4KSCA 4X24A 4X3CA 4BKUA 1OILA 1V16A 4N5HX 1KNXA 3R9KA 1UWVA 4R5HA 2ZSAA 4EG1A 1ZN8A 3C8MA 3ZLVA 1YTUA 2JGEA 1CQIA 1IB0A 2HJVA 3A25A 3JQQA 1Y8ZA 3MMXA 1JEYB 2O2ZA 3DL4A 4K28A 1ECBA 3GEGA 5GIPE 3RAFC 1I94B 1VLVA 4TSFA 1HK7A 4D97A 5BORA 1YA6A 2P78A 3M89A 3U56A 4PZ0A 2HRDA 2XB9A 4S2EA 1R6TA 4LHWA 4IIUA 4NYJR 4RGBA 1JR6A 2OD2A 2E6UX 1NURA 3HQ4O 2H63A 1NR7A 1EEXB 1RQRA 1R5BA 3IXMA 3K2EA 4N9QA 3VR4H 1CEQA 1YZTA 4D9GA 4R1MA 5IDYA 4OA5A 2GMWA 3H1GA 3I9LA 1MZVA 2I7DA 2J09A 4DCJA 3RW9A 1GUAA 1IQUA 2ECKA 2X2FA 1HZZA 3CZ4A 4RWEA 1BW9A 1LBHA 1WQ1R 1ZZGA 1MJFA 2I1QA 4E5NA 1YBHA 3E8XA 3ETCA 3Q0EA 2GHIA 3MMZA 1E6EA 3WJ7A 4CLEA 2X13A 4MWSA 5ENVA 3U13A 3QU2A 1J70A 4E4YA 1WV1A 1GL3A 1LZLA 1U2SA 2RGYA 3A3OA 4RVHA 5JNTA 2CJXA 1XTJA 2D1TA 2OCXA 2ZRNA 3AZPA 3C1UA 3DV9A 1CDDA 1GGKA 1MVLA 4NFSA 3TPCA 3TXYA 4O2BF 5CG1A 4AS3A 2VUTA 3FWNA 3GCZA 4ZVKA 5KJEA 4CMHA 4EHNA 2QGZA 3W1WA 2PLWA 5JS2A 4QQNA 3RF6A 1V4VA 3BA6A 2M32A 4OHMA 1ODFA 2EOAA 4JVOA 4G01B 1KEKA 4URYR 3NIFB 3LPCA 4RHUA 2GNAA 4G5YA 1H94A 4MYSA 1CUIA 2OK8A 1J7KA 3LGSA 2BM0A 1Q83A 4A0HA 1Q84A 1U4SA 2XXJA 4IINA 2Q6OA 4DQLA 4NTZA 3TO5A 4EB6A 4ZYLA 1NX9A 4N01A 3CKMA 3WTCA 1WBBA 1PR4A 1SQGA 2ARKA 4HAUA 4NBWA 3SX4A 3D8TA 4HGNA 5EL0A 3WB1A 1N5LA 5JHGB 1I7DA 1KBOA 1MC8A 3JYHA 4K40A 1JQEA 5ALUA 4ECEA 1E0AA 3RUAA 3R3HA 5G4LA 4O3FA 5HGXA 5DASA 1EUCA 2OV2A 4G1VA 1WF6A 4L16A 4EZIA 1P1RA 5DBHX 3LIPA 1S02A 2JFNA 4PQRA 5ESXA 2G82A 2LBPA 2HLNA 3CX4A 2IYYA 2EW8A 1ORWA 3R6DA 3JYQA 3R0IA 3U0VA 4F4JA 3WYFA 3U40A 2BGGA 1P2GA 1BCSA 1XYGA 4HZUA 4NV1A 3RAPR 4EX7A 3BCSA 1Z13A 1W2WB 1OTXA 4TWBA 3KR2A 3RRJA 1D6JA 2FLKA 5DNWA 2DULA 3LOPA 3VX3A 1RM4A 1GPBA 1XELA 1ZUD1 2I80A 1P74A 3DF9A 4XFJA 2ZS8A 3EULA 1EWTA 1WWKA 4WOBA 1SK9A 1H9AA 3CR7A 1ELOA 2VDOB 1E9BA 4FGUA 3MRSA 3A6LA 4EW6A 4KL8S 3C39A 4EG0A 3EDRA 2Q5FA 2YBEA 4C88A 2XCIA 2ZIGA 1GPH1 5LXTF 2HRBA 5D8DA 3MGCA 4C0QC 1Z9BA 4NY1A 1L5HB 2B8NA 5ALQA 4IICA 1Q1GA 1VP3A 2XNKA 1FFSA 3GHYA 1HNZB 1JU9A 2DFDA 2ZB4A 3NBMA 1NT4A 2ZPUA 4ND2A 3S1AA 3DVAB 3Q72A 2ZJYA 1SVLA 4KPFC 3A1NA 10MHA 4NCIA 4HB3A 1OWNA 1Z35A 1Z82A 3P45A 1JJAA 3E7PA 4TV9A 4J7XA 1DJOA 1E5VA 4G1UC 4XA8A 3I04A 2G06A 1RLIA 2AJ8A 1JT2A 1PWEA 2A94A 3CZRA 3DF7A 5AM3A 2XD4A 4G09A 1K8YB 3B7WA 2VZLA 3R8XA 1N2CB 1Z75A 3B9QA 2O8EB 2A3NA 4MULA 5CX4A 1IIBA 4DA4A 2QTWB 1ZD1A 3OFSA 4P7GA 1UL1X 1SXQA 3G2LA 3WMXA 2C4MA 1M2NA 1YC5A 1Z22A 4N82A 1TMYA 2W0MA 1XBTA 3IFSA 3RH0A 4NONA 3VU9A 1CCWA 1NXQA 4WXYB 2QMQA 3HVHA 1U3TA 3BT7A 1YQ9A 4UNIA 2CBZA 1BC5A 1MW9X 1UPUA 1KF0A 1LLQA 4M1EA 3ZU2A 4YQFA 2C4KA 1AKNA 5HTOA 4OHUA 1ZR4A 1VE9A 4JI1B 1V4NA 3IPRA 3S0JA 2VL7A 4O0LA 3I64A 4OLAA 1RJGA 3E9YA 3O4VA 4MPDA 5FO1A 5HS6A 3RBZA 3RJ9A 4IZOA 4LHEA 5HXAA 2TMGA 3DV2A 2Z4RA 4H18A 4KO4S 4OQQA 4IXDA 4ZA2A 2VZ0A 4LMAA 5AW6A 4MQMA 1DDOA 3ZLTA 3NEYA 3S8EA 1Z33A 5FL7D 3MK31 2XLCA 2DWUA 5LYYA 1HLPA 1U9JA 2XUJA 3JD0A 5I7EA 2V3CC 2C88A 2VDUE 4JQCA 3W3ZB 3TD9A 3AU9A 4QATA 1DRWA 3DW1X 2NO6A 3KPUA 4PQEA 5FXMA 4CIYA 4RULA 3G8BA 4ENUA 2HOQA 1KEPA 1NX6A 1DQPA 1RPTA 1UK9A 1YR7A 2QRGA 3H6KA 2REQB 3NGLA 2ZLBA 3AHCA 3N8DA 4PLFA 3HCCA 3UICA 3JASB 4BHTA 1TB4A 4J0GA 1AA6A 1JAZA 1NVAA 1NJ1A 3ZK7A 1RLMA 1G6KA 2A0XA 2OVBA 5C8YA 3FFAA 5K8CA 4RHTA 2AQHA 2LWIA 4F72A 5KSZA 4M7RA 3QOWA 4BOYA 5HMLA 4CT0A 2I03A 2XOKA 1KZGB 4HT3B 3DDUA 4AY6A 1HSZA 1IXKA 1HE3A 3LP6A 4K26A 4PVCA 2YINC 3HKBA 3N0TA 2C2WA 1T13A 4L6IA 1ZK0A 2NTYC 3OZDA 2CXRA 5P8WA 4EI9A 4CM9A 4EW3A 1OIWA 3A11A 2YHIB 3RVJA 5JEEA 4IMIB 5DLQC 5CD9A 4BFVA 1DXYA 2XRYA 1W5TA 3AUUA 3CX8A 2LV8A 1Z2NX 4NMHA 1PVVA 1EVJA 1L4KA 4WSOA 3SJBA 3ZV5A 5F2NA 3OQJA 1HRKA 1RWPA 4PWZA 1DUSA 1GPUA 4V03A 4YFYA 5EVCA 3WOHA 1G38A 2QRPA 3SKVA 4V1CB 1KZ4A 2XITA 4BX9A 1Q7BA 4CM7A 3CW2A 3AV3A