5HFJA

Crystal structure of m1.hpyavi-sam complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
201
Chain Sequence
b'MIQIYHADAFEIIKDFYQQNLKVDAIITDPPYNFKLLEWIARYAPLVNPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNIHRRYVQDTEFALWAVKKKAKWVFNKPKNEKYLRPLILKSPVVSGLEKTKHSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQTAKKRLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenine specific DNA methyltransferase (DpnA)
publication title Biochemical and structural characterization of a DNA N6-adenine methyltransferase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori (strain atcc 700392 / 26695)
molecule tags Dna binding protein
total genus 51
structure length 201
sequence length 231
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hfjA00
2ESRA 5EHIA 3VSEA 3JWIA 2Q41A 4R05A 4E32A 1JG4A 1P1CA 3NDJA 4PIPA 4X60A 5EKUA 3OPNA 4FGZA 2EFJA 2PXXA 3KPYA 3AJDA 2AOXA 5GOZA 3BGDA 3QOWA 3E05A 1QAMA 3BWMA 1Z3CA 3KPUA 2QYOA 3DLIA 1SUSA 4RWZA 3I9FA 5E9QA 1ZKDA 5T67A 4DCGA 1WS6A 3GWZA 4M37A 2ORED 2OBFA 4PONA 5LR6A 3ER9A 4ZTBA 3GRVA 1ZGAA 2AOVA 2PVCA 3VYWA 1I4WA 4O29A 3L8DA 2PLWA 1O54A 1EJ0A 2YQZA 4UOEA 3R3HA 2OZVA 7MHTA 3FUUA 1R8XA 4GOND 5EMLA 5DXJA 1XDZA 4MWZA 5F2OA 2ZBRA 5EEHA 3NMUF 2ZVJA 2IP2A 3LKZA 10MHA 2DPMA 2PX4A 2NXEA 4HC4A 3RIEA 4DKJA 4RTQA 4E70A 3DP7A 3DXYA 5P8WA 5FADA 2YVLA 2BM9A 4DCMA 4M7RA 2GS9A 4QPPA 5FULA 5CVJA 4EQZA 2ZSUA 3HCDA 5KVAA 2VDWA 3RODA 4YUYA 1TPYA 5F2NA 3QOXA 3THSA 3KR9A 5HILA 4K6MA 3LPMA 3IHTA 1EAMA 4HTFB 4QPNA 5K0NA 4YMGA 2IBSA 3HVJA 2BM8A 1X1CA 2AZTA 2QE6A 2P40A 3THRA 2AN4A 5EQJB 3FRHA 3ERCA 1RI5A 5DM1A 4YV1A 4CXMA 1D2CA 1KP9A 3SSMA 4C07A 4XUDA 5K03A 3LCUA 5HIKA 3C3YA 3LCCA 4M38A 2GH1A 1KPIA 3OZTA 1FBNA 2G72A 4FSXA 5FTWA 5GINE 3EVCA 3FTEA 3UJAA 5DTMA 5DT2A 4E2WA 1TW2A 5DWQA 4EVIA 2YXEA 4P7GA 3G89A 3CVOA 5JUWA 3UA3A 2R6ZA 1VBFA 3OFKA 4PINA 3LBYA 1PJZA 1QYRA 3HM2A 2BH2A 3M33A 4IV8A 3G8AA 3TLJA 3BKXA 1XDSA 3B3FA 3FPHA 3PS9A 5ICEA 1FP2A 3AXTA 4AZWA 3ELUA 3MAGA 5EMJA 5K05A 4QVKA 3EVEA 3KPVA 3DTNA 2VZ9A 5DM0A 2ZCJA 4C05A 3M6WA 1R8YA 2OO3A 3E23A 4AX8A 5ICGA 5EKXA 4CKCA 3B5IA 4OA8A 3AXSA 2PGXA 2VP3A 3B3JA 2P1DA 3EVGA 3LCVB 4PCLA 5E8JA 1SQFA 2UZ4A 1BKYA 1DL5A 2PXAA 3HVIA 5DX8A 5FCDA 3TKAA 3UJBA 1XXLA 1JG3A 2IDJA 2PBFA 2OPBA 3BKWA 3LDGA 4YUVA 4E31A 4PYOA 5DX1A 2ZWVA 2G8NA 2NYUA 3KKZA 4BP3A 2EX4A 4DQ0A 3UFBA 3G5TA 3EMBA 3KQVA 2QY6A 3MCZA 5MHTA 3ELYA 4EKGA 3IEIA 4GOOD 4IV0A 4B17A 1JR4A 3CKKA 5CVVA 4CTJA 2GB4A 1QAOA 3CBGA 4OBXA 5D1NA 3OZSA 4DA4A 1YFLA 2F8LA 3TOSA 3UJDA 2PWYA 3BWYA 3P8ZA 1KYWA 3CCFA 4GEKA 4A6EA 3SX0A 3MHTA 4AUKA 3AWIA 1AQJA 5LQRA 3FYCA 4CTKA 4YMHA 3IYLW 5ICFA 2I7CA 3RW9A 4E33A 5LQCA 1RJDA 1IM8A 5EG5A 1ORHA 3MCTA 1N2XA 4OQDA 4KIGA 4QTTB 4ISCA 2P3QA 5EVJA 2JH8A 1RJGA 4PYLA 4RTRA 3BGIA 3M6XA 1F38A 3OU6A 2R3SA 3TQSA 2WK1A 3P2IA 4OQEA 2PX8A 1D2HA 3PFHA 5EGSA 5FA5A 3T7SA 4YV0A 2HWKA 5FQOA 4ER5A 3ID6C 1P39A 4NECA 3GRUA 3NDIA 3DR5A 4RTSA 3GO4A 3SR4A 5K0EA 4H0NA 3CJRA 2AOUA 3T7TA 4C4AA 2AN5A 3BZBA 3FTCA 3OE4A 4BY9E 5CCBA 2XYQA 5FWAA 3O31A 3NW9A 5GWXA 4HG2A 2C7PA 1BC5A 5DSTA 2A14A 3KR2A 2ONYA 2CWWA 1FJXA 3JWJA 5T6BA 4LECA 1NE2A 1HNNA 2PJDA 2O06A 3B89A 4XUEA 3HVHA 2GPYA 4ATNA 2BR3A 2JHPA 1RJEA 2P7HA 2ZLBA 3GNLA 4MQ4A 1O9GA 3EGIA 5DTQA 5FUBA 3P9IA 5BP7A 4GOLD 1YUBA 3C6MA 3UA4A 1JG2A 2ZZKA 3ER8A 3QV2A 3GXOA 4P58A 1N7IA 4PYKA 2Y1XA 3G5LA 2FPOA 3LSTA 5GM1A 1AF7A 4BLVA 4QQKA 4GBED 3IV6A 1SKMA 2B25A 3KQSA 2UYHA 4IWNA 3DOUA 5FHQA 3F4KA 3UJ6A 1ORIA 2IH4A 3GJYA 2N47A 5CCXA 1WZNA 2JH9A 3ORHA 3Q7EA 1ZQ9A 2I62A 3FPEA 2VDVE 3P71T 3R0QA 4X41A 1KYZA 3SM3A 3T7RA 4ER6A 4PNEA 5KQRA 3EGEA 4GF5A 5EHGA 1JG1A 3A27A 4RYLA 3BUSA 3E7PA 3SMQA 4GOMD 4ER7A 5CVDA 1YFJA 1NBIA 3EVFA 2FYTA 3DMGA 3S68A 3G2MA 3CGGA 1VL5A 4Y30A 1NKVA 1SVUA 2ZBQA 3KR0A 4V0QA 2P35A 2IBTA 3VC2A 5EC8A 1YZHA 3D2LA 3PX2A 4P7KA 3HEMA 2AOTA 5HZMA 2XVAA 3T0IA 3OE5A 3REOA 2UYOA 4PYMA 3LHDA 2FK8A 4EKIA 2YR0A 4QVGA 3FYDA 4E2XA 2EJTA 4YUXA 1WY7A 4R8RA 1VE3A 2BR4A 4OA5A 2H1RA 4Y2HA 4V0RA 2ERCA 2V7EA 3DULA 3UWPA 2P7IA 3PX3A 2WA2A 3GCZA 4R8SA 3KR1A 1JQ3A 2XVMA 3NTVA 4RX1A 2P3OA 3BWCA 5EEGA 1NW7A 1WXXA 2QRVA 3DXZA 1KXZA 4RTPA 3HA5A 4X63A 2FHPA 3FTFA 4P7FA 4DF3A 8MHTA 1VIDA 3G2QA 4HGZA 1DCTA 1OR8A 2YX1A 3HNRA 4AZSA 4GC5A 1R00A 2G70A 3TKYA 5LSAA 2AR0A 1G8SA 1INLA 3C3PA 3HVKA 3I5UA 5DTRA 3X0DA 4RTJA 4KVZA 4WVLA 3UJ7A 4CKEA 1JSZA 4RSRA 5E2BA 3UZUA 3FPGA 4FT2A 1VLMA 4P7JA 3TM4A 3U81A 1XVAA 3DXXA 4WXHA 2PX5A 5E2AA 3SXJA 5HOQA 5K0FA 1L3CA 2XYVA 2C7QA 3UJ8A 2ZW9A 4RVHA 2OXTA 1KR5A 2ADMA 3HA7A 5EMKA 2NP6A 1I1NA 2AVDA 1VP3A 5GM2A 2CMHA 2PKWA 5GIOE 2JG3A 5FHRA 9MHTA 2YUIA 3EMDA 4MTLA 4GQBA 2NXJA 1JQDA 1TW3A 3Q87B 1SQGA 1EG2A 4M36A 2CL5A 2PXCA 3O4FA 3R6TA 1JTEA 1VPTA 2AS0A 4CKBA 3ANXA 3EEYA 3PVCA 1SG9A 2ZBPA 1H1DA 3B7PA 3ELWA 2NXCA 2GAFA 3CC8A 2ZULA 3MTEA 2OB1A 2YTZA 5K0JA 2IH5A 3LBFA 3NVMB 4KWCA 3VC1A 1F3LA 1YF3A 2JHCA 2GLUA 1M0EA 2LD4A 4LWPA 4FZVA 3G8BA 2FK7A 3EVBA 3EPPA 3A26A 2UYCA 3GU3A 2ZIEA 3NWEA 3I64A 3GRRA 4G56A 5CD1A 3WSTA 1KPHA 3M6UA 4R6WA 4RTNA 1BHJA 3OU2A 4LG1A 2ZZNA 3DH0A 3KQWA 1XCJA 2B3TA 2PSSA 2ZIFA 3EVZA 4OBWA 5DSXA 5M5BA 3PLAE 3TPZA 2AOTB 2ZTHA 4HTFA 4LWOA 1XJ5A 4A6DA 5F2KA 4RVGA 2HR1A 3R24A 4PIMA 3LL7A 4QDKA 5E1OA 2HNKA 2I6GA 1X1DA 2VDUE 4YV2A 3ME5A 5HEKA 5LQUA 3TR6A 3EEOA 1O9HA 1UFKA 4C03A 1JSXA 4DM3A 5CIYA 3DUWA 4YUZA 5CVEA 2ZIGA 4FT4A 3SSOA 5ICCA 3JWHA 3PTAA 3LDUA 2NNWB 3P9CA 1B42A 5KS2A 5EIWA 3ELDA 4PYNA 4HH4A 2FCAA 5FWDA 2ONZA 1KHHA 2QRVB 3KQMA 5LQNA 3BXOA 5HIMA 3BGVA 4HGYA 1EQAA 2B2CA 5KYGA 2H11A 3PT9A 4KW7A 1RJFA 5DLYA 1RI4A 2PY6A 4E2ZA 3OU7A 4FP9A 5DRTA 2IDKA 3SVZA 3CJTA 3M4XA 1DUSA 2CKDA 3FUWA 2O0LA 2EJUA 3G7UA 4GUAA 1P91A 4Z2YA 1M6EX 2ZFUA 5CUQA 4E30A 1NV8A 3CJQA 5DM2A 1VP9A 3FZGA 2XYRA 1IY9A 3C0KA 4RV9A 5EOVA 5EIFA 2C7OA 4C06A 5K01A 2AVNA 1MHTA 1FP1D 1R74A 5BW5A 3FPJA 3NWBA 2G71A 2ZZMA 5FQNA 5ERGB 3DMHA 5K8VA 3FUTA 4X61A 5FA8A 3JWGA 4FR0A 3BWBA 1EIZA 1NW6A 3FTDA 3G2OA 3PFGA 3HCAA 4PGGA 1SUIA 4YUWA 1NW5A 3KQTA 3FRIA 4BP1A 2E5WA 3A4TA 1WXWA 3TFWA 2QM3A 3TRKA 3AY0A 1RI3A 5K0GA 3FUVA 5IKMA 3HCCA 1X19A 3SSNA 5KQSA 3BT7A 4R6XA 5GIPE 1MJFA 5K0LA 3EVAA 2IIPA 3HTXA 5HIJA 1PRYA 3KQYA 2V74B 2VS1A 3MGGA 3GIWA 2BR5A 4EMSA 1BOOA 2P3LA 3C6KA 2K4MA 5T64A 1I9GA 3LKDA 3TMAA 4KRGA 2Z6QA 1G60A 4XCXA 1IXKA 1XDUA 3HCFA 4KIFA 4OX9Y 4DZRA 4F84A 1Q0TA 3E8SA 2OB2A 1ZGJA 4QTUB 2NP7A 1T43A 3UJCA 3HCBA 1N7JA 1YZ3A 1G8AA 1KIAA 3LGAA 1Y8CA 2IPXA 1RI2A 5DM4A 5DRYA 5EMMA 1ZG3A 3G2PA 2AOUB 1QAQA 1ZHFA 5EZSA 1RI1A 1KPGA 1R6AA 1XCLA 3I53A 3KQQA 5LQAA 3KPWA 5HFJA 1AQIA 3A7DA 2Y1WA 3MTIA 3P97A 4GC9A 5IH3A 4BLUA 2HMYB 3LDFA 3OZRA 2UYQA 1X1BA 2O05A 5K09A 3GRZA 5E9WA 5E1DA 4POOA 3KQPA 2AN3A 3DLCA 2O57A 1U2ZA 3GRYA 4PWYA 1V39A 1FPQA 3UBTA 5U4XA 2B78A 1D2GA 3TM5A 3LX6A 5LQJA 3HCEA 4RTMA 1JTFA 3K6RA 4KDRA 4MIKA 4PCAA 3FUXA 4QQNA 1XTPA 3UJ9A 1Q0SA 2JHAA 4PYQA 2JJQA 4XUCA 5DXAA 5HIIA 2G1PA 3KQOA 1JQEA 2NXNA 3O7WA 3P9NA 5E9JA 4C08A 4HRAA 4RVFA 3OCJA 3P9KA 2BZGA 5BW4A 1NW8A 1P1BA 3G88A 3PB3A 4L7VA 4RTOA 4QDJA 3MERA 3H2BA 2OYRA 4MHTA 2PWPA 1G6Q1 4PGHA 4HSGA 4ER3A 2IH2A 3R9XB 5K0BA 2OY0A 3V97A 4KDCA 1EJ6A 5BXYA 3GGDA 3FPFA 1R18A 3P2KA 1UWVA 4AZVA 3MQ2A 2EG5A 3K0BA 4JXJA 4C04A 2YXDA 2P8JA 2CMGA 3M70A 4PYJA 3V8VA 5B1SA 3KPJA 1L3BA 2PT9A 5CM2Z 3DMFA 2PT6A 3HA3A 5GP1A 1X1AA 2AOWA 3NVKI 2B9EA 2I9KA 4F86A 2H00A 5DX0A 3EVDA 4DMGA 2WA1A 5C0OE 3HP7A 4RTLA 3KU1A 4PYIA 3EGVA 2C7RA 1QANA 2GA9A 2YXLA 4X1OA 2PX2A 5CVUA 3B3GA 5E1BA 1NT2A 2HTEA 3MB5A 4FSDA 4AZTA 1L3IA 1YB2A 3OFJA 1NW3A 3P2EA 5H02A 5JR3A 2OKCA 1QZZA 4ER0A 5C1IA 2Z6AA 4IKPA 5LQKA 4CWAA 2HV9A 3A25A 3A7EA 4BLWA 2P41A 5K0CA 3GDHA 4E2YA 4F85A 1HMYA 2Z6UA 3KHKA 2XBMA 5E8RA 4RTKA 5D1HA 2KW5A 1G55A 1L1EA 1M6YA 2PV0A 4EK9A 2O07A 5DPMA 5E1MA 5G02A 2IGTA 3I58A 1UIRA 3NJRA 2IFTA 4U7PB 1NV9A 2DULA 2FRXA 3LECA 5EZQA 5EPEA 4RVDA 1VQ1A 2ZWAA 1AV6A 3SGLA 1L9KA 4FS8A 1WG8A 3M6VA 1NBHA 4U7TB 1G38A 5C9ZA
chains in the Genus database with same CATH superfamily
3V4LA 4URXR 2I22A 3HADA 3C3WA 4INAA 1F4PA 4JJEA 3ROKA 3U48A 3VTFA 4BX8A 1H4VB 2JIZD 4HEJA 4JVNA 3S2SA 1BFDA 2FW6A 1LVHA 3KB8A 3P32A 2WWWA 1Q1BA 1MF7A 1RRKA 4TS9A 1B74A 1UAAA 3RI3A 5D8DA 1DQYA 3CW9A 5LA6A 3AZOA 4UAJA 3NT5A 5FEMA 5T67A 4EGSA 3GOQA 4ENTA 1ZZGA 1DQPA 4LNHA 1EU1A 3GNQA 3MUOA 4H6PA 2H9IA 4YJDA 1EKXA 1XZQA 4K9DA 4CLHA 1NN1A 5DYIA 1O54A 1RC0A 2F1HA 4YFVA 4BFZA 1TM3E 3D4IA 4QXOA 4RA9B 2ZYWX 4GOND 2NPOA 4OB7A 4UXHA 5EMLA 1PV1A 5LYJB 5HTKA 1RR6A 2E4AA 4KQEA 1R88A 2NN3C 4K40A 2C98A 4PZAA 1UBCA 1UQTA 4HC4A 5IJ0B 4ND7A 3RIEA 4DKJA 2GSDA 1ZL0A 1TT5A 3BX1A 4LX0A 2FWBA 1ISHA 1SRQA 3DXYA 5P8WA 3DE1X 4WOBA 2BM9A 1QO7A 5JS7A 4M7RA 3GB9A 4LZLA 3DMNA 4REMA 3FYSA 5CVJA 3VYSB 4BP9A 1U1IA 1CERA 2GZ3A 2BHLA 3IUMA 3D3NA 5KVQA 2VOEA 4LVCA 1ICIA 3QYJA 1P2DA 2ASEA 3QOFA 4Q9AA 1W30A 1HRKA 2FW1A 5EXXA 1HX7A 2BEVA 1L5NA 3PQ7A 4J29A 1ETUA 2MINA 1QH1B 3BMOA 4CMEA 4J6EA 1KZYC 3GP5A 4AJ9A 3ADCA 2I6UA 1XZJA 3PENA 4OJKA 1KP9A 2BONA 4I6EA 4Q3LA 3RHTA 1ACLA 4TXLA 1LC3A 3IQDB 621PA 4BDSA 2W6CX 4LFCB 4KXQA 5E6UA 3OIUA 2A86A 4ROSA 5T41A 3PDIA 2QI9F 3UJAA 4BNYA 2X7XA 1KSGA 2O3RA 1GKYA 1X1SA 1MNQA 3E9RA 1OLSA 3CVOA 4HZUA 4R9UC 3GDFA 4WZ6A 1KVRA 2GN9A 4IKEA 3NKVA 1K6MA 3BIWA 3G8AA 1AUPA 3KZVA 1K7XB 3N58A 1U28A 4LXTA 3IV7A 4X71A 2JCGA 3Q2OA 3NHRA 5A05A 1S01A 4OM7A 3VJRA 3WNVA 1A5TA 2DEUA 4WDQA 1QDUA 3KJZA 3TL6A 3L0BA 1T0HB 2R25B 1TUIA 2Y4NA 3B51X 3FWKA 3OHMA 3P0IA 2OO3A 2XYGA 3IMGA 2OBXA 4CKCA 4PO3X 4RD2A 3AOEC 3HXMA 2OOKA 5GTDA 1LS6A 2B20A 4OHWA 3C3XA 2VCYA 2VTBA 2JK1A 5KWVA 3EOBI 4U7WA 1P3DA 2C03A 2NUAA 4V0OA 3STXA 1J97A 1YUNA 2PKEA 5TEVA 1E2MA 3B1JA 4L8GA 3UFBA 5KU1A 5ANRB 1S2DA 4UFPA 1M0SA 3DZHA 2WSIA 3ELYA 1NJ5A 3RQSA 2GZSA 3UQYS 3UT0A 3KU4A 3WGMA 2XUOA 5JYCA 2PXHA 5JANA 2OV2A 3G1WA 4OBXA 1COZA 2O1SA 2F8LA 3TOSA 4BRSA 3OICA 3G2IA 3CNHA 1TT5B 3O2SB 2PUWA 1Y9ZA 2G88A 3P2OA 5CDTA 2DBQA 4BV3A 3O8LA 5LOVA 2Y9PB 3PR3A 3GLSA 4H7KA 2OP1A 3DBHA 4OF4A 3COJA 1A9YA 4B6RA 5DJ5A 1WSDA 2X5NA 4KFRA 4LRTB 3WGZA 2Q6IA 3AONB 4WERA 5EG5A 5ECDA 3RYFA 1R0BA 3ZNQA 2P3QA 2V6MA 2A4MA 1X7ZA 3W6PA 1RYHA 4U2CA 2H85A 4WNYA 1EVZA 3LUKA 1JIJA 4RXTA 1NMYA 3Q4GA 2PPVA 3A3OA 3VI4B 2MINB 2QZ4A 1W94A 1AS0A 2NZVG 3OZAA 1IFXA 2HU7A 3T7SA 3S2IA 1BGXT 1TYZA 5MN6A 2RHJA 3BWDD 1THMA 2A67A 3DAPA 3GYGA 2NAFA 1YBAA 1RXIA 4F45A 1R0CA 2H3EA 3OC0A 2AW5A 3H8SA 2D13A 5E6UB 1ULZA 2OZKA 1UC5B 4CNBA 3C70A 3S8EA 1O95D 3NTXA 1Z17A 2DHQA 1OLSB 3PKJA 4HJRA 3VR2A 1FL9A 3G2JA 2ONYA 4E4RA 1L8LA 1JJBA 5CBPA 1EDDA 4ZCSA 2HJRA 3B85A 3IKLA 3L7AA 4Q1EA 4QC2A 4RU1A 2QGNA 2JFZA 4ATNA 3J80A 3FROA 5JC1A 4R9NA 1C7FA 1K86A 1DIRA 2UVPA 3NJ8A 4RD3A 5A7GA 1T4GA 2FPWA 3L8GA 1TRKA 4Y2JA 4PZ0A 5DOZA 2V5VA 4LJKA 2V4MA 1LX7A 3OUZA 3CLHA 4MP6A 3QELA 1WMAA 4ZC1A 4HN9A 1PS0A 2W6PA 2ZUTA 5JOQA 1U63A 2GESA 2HLPA 1ZJ5A 2D1TA 2PSJA 5CW1A 2BBSA 4KL8S 3AHCA 1J8DA 4MPJA 2VQ3A 1ZWLA 2ZRHA 3GJYA 4Q48A 2IY8A 2JIOA 2VTBB 3AI2A 1OH7A 5DHUA 3PXBA 4AECA 3SM3A 1KO1A 1ONOA 3GLVA 3U3XA 3V7WA 3GUVA 4B84A 1OXXK 2NUAB 2Z8YA 3EGEA 3FJYA 2M6SA 3ZV3A 5AK0A 3M5WA 4PVCA 3LL4A 4GX5A 4N5IX 2F90A 2BKXA 2PH3A 4LPSA 2Z5VA 2DHCA 1SEVA 4Z7OB 1DQSA 4MP8A 4C20A 4NMWA 1T5SA 4ZT4A 5G1OA 3HLYA 4UJ3A 4Z0NA 5REQA 3I23A 4PR0A 2I66A 3H75A 2G9NA 1FP7A 4ZK2A 5LOVB 3K71B 2ZBQA 4C1NA 1SD2A 1O87A 2QJRA 1PHPA 4JP1A 4X00A 5JQWA 3GHYA 2W5UA 3DBHB 5JVDF 5AFSA 4Q4LA 3HEMA 4FYIA 1YE3A 2NV6A 3WISA 2I67A 1PQ4A 2PSDA 1HEYA 2ICAA 3NHJA 3RC9A 3RYFB 1Z4MA 1WZIA 5AVWA 2IOQA 1X7ZB 1UMDB 5FUWA 3SJUA 1JDBC 1U31A 3JTEA 4W1SA 2FWJA 4JYCA 2PZKA 3DW1X 1BS1A 1OVGA 1U2GA 5LMZA 1AA6A 5CLJA 5KYTA 3O4IA 1G4AE 2VP2A 3D0OA 2C4KA 3N2IA 4XM0A 2PKRA 2V6IA 1PVVA 2BMEA 4MGHA 1JLSA 3PFBA 2XMSA 1C4WA 5LMCA 3VPDA 1W44A 1B73A 2IA5A 3PA6A 4JUCA 3L93A 4UBJA 5BSHA 1SHZA 3SE0A 4GC5A 5KNDA 4QSMA 2ZAMA 3M5PA 3R3YA 3TMYA 4WY5A 2VRWA 2PKCA 1I8TA 3CEAA 2XCQA 2ZUVA 3DXXA 3IPCA 2PH5A 5K8JB 1A9XA 5C52B 3VKHA 3M4JA 4X65B 1E7MA 3HFGA 1W73A 4C7OA 3HO6A 2UVPB 2ODBA 2QN7A 4IL5A 4H6WA 2H0QA 3CZ5A 3TBFA 2F8TA 4ZVTA 1GG2A 4EZBA 1M0EA 2AVDA 1FTGA 1ZCAA 1IG0A 5TQVA 3MSCA 4UQOA 2WB4A 3QELB 3KFLA 4JIMA 1IC6A 3IEMA 2XRYA 2XZTA 3EBOA 1C0LA 2CXRA 1JG7A 2Q3CA 1OV4A 1DQNA 1JQDA 1XVUA 2WUVA 3OJOA 3JZFA 2TMDA 4LQCA 1OX6A 3NNNA 1XCOA 3R6TA 4LGYA 4CKBA 5KTRA 4RL4A 1GZDA 3OG9A 1SG9A 2H5EA 3L6OO 1ZJZA 4IYJA 2B6HA 3H0CA 4ZT3A 5IAOA 1AKNA 2WU8A 3V4VB 2H48A 1UFVA 1NP7A 1PWEA 3KKQA 3LZ6A 3N53A 4OJMX 2BI7A 1WUKS 3LBFA 4DKXA 3LAWA 4YFYA 2AZMA 4LXIA 5HBGA 5TGZA 5AVSA 2OCPA 3CZ4A 1T36B 5EXSA 2SICE 3RTDA 1BWQA 5CLLA 5DBFA 3ORQA 1XMVA 4I0WB 5YASA 2DXIA 3F73A 5EUBA 5REQB 2WPNA 5FRDA 4HLUA 4M1WA 1DAMA 4NYMR 2R6GA 3RS8A 3DBIA 1U2DC 3HBJA 4LG1A 5H3CA 1JDZA 4OIFA 1FCJA 3KT8A 1USKA 1M34B 2AL7A 4IIXA 5K3EA 1LF5A 2NAPA 1AHIA 2XCTB 2YJTD 3VV3A 4RY8A 2QLBA 3V2UA 1E2EA 2F1RA 2WEKA 3OFSA 3AB3A 4L5JA 5ITWA 4U1RA 4WXYB 3BCUA 3KZNA 1ZA2A 2AZDA 1UDBA 5A7HA 1M6NA 1I51A 1VL2A 3DUWA 4MYTA 2G76A 1H05A 2ST1A 3F78A 4DCSA 3SJ7A 3GJ4A 5ALKA 2FCAA 4RIFA 4IEFB 1SKYB 4N3CA 4KPEC 1GT6A 2P4HX 3FM9A 1GQYA 1XI2A 4IXTA 4CZ2A 4DMKA 1X9HA 1J2JA 5KYGA 3OETA 3SYNA 1JI3A 4OLHA 2JJ8A 3HJUA 5JDIC 1NMEA 2ZI4A 3B5EA 4ZKDA 1N32B 2VCHA 2VJYA 2D4HA 3AVOA 4X3OA 3FUWA 1WAMA 3JVEA 4X7PA 1XA0A 3G7UA 4GUAA 2QU8A 2Q2QA 3AUUA 3C3DA 1D8AA 1L4LA 1RXUA 4TUYA 1M6EX 2Q27A 1A9XB 3O1JC 1JKJA 4LHXA 3J7AC 4MRAA 1VP9A 2I1LA 3L8HA 1YR8A 1ZH6A 4O2BB 5IULC 4XQEA 4C7OB 1JEDA 2Y1EA 5EOVA 4CMBA 4JVOA 2V1XA 2A9KA 4Q18A 4D3XA 3N0RA 5F1KA 1G5PA 3OLCX 1UXHA 3VGPA 1M67A 1N2ZA 4KR9A 3U0BA 1PWZA 2EKZA 1ONSA 2GRUA 5K8VA 2YZKA 1Y1SA 2BGLA 4FR0A 3OEHA 4FZJA 1RD4A 3Q3GE 4J7UA 4CKBB 4MGYR 1JIIA 3OX1A 1YZLA 2OM6A 2X7HA 4LV8B 1Z8FA 1IZ9A 2C9CA 4H3SA 5ALTA 5JU6A 4DMHA 5BVGA 4MKXA 3TFWA 5C53B 4DPLA 4EG6A 4GM1A 3TRKA 4YRZA 1G8GA 3HCCA 3VYVA 1APBA 3OZVA 5EWMA 2DBRA 3BL6A 3FW1A 3Q6IA 4EUKA 3DJYA 4DR2B 3BT7A 4L8FA 1AC5A 1ETHA 1U0BB 1Z5OA 1Y3CE 4PZEA 4A0FA 3MGAA 1U3CA 1R4NB 2RBEA 3MGGA 1NVVR 3QITA 1QR6A 4RDIA 1KOLA 1C8VB 1HA3A 2C20A 1ZOLA 2AF4C 2C3MA 1G63A 3RJ9A 4M86A 1R0LA 1NZFA 4KIFA 5CR9A 2UXCB 2IHYA 2JAPA 4IIEA 1XQ6A 1IRIA 1XAGA 4KO4S 4CUKA 4X84A 2OFXA 3BQMB 2PYIA 2VF8A 3HCBA 4ZA2A 4UDNA 1XAIA 2GN4A 2NADA 3STUA 4JI2B 3VVBA 3NB0A 1TEZA 5C4IA 1NYTA 5F7JA 3PXCX 4PBRA 1CQZA 4QYWA 3WKAA 3GLHE 3ILXA 3K4QA 2JEYA 4MPRA 3ABZA 1TD9A 3DHVA 1HYGA 5IT9A 4PRYA 2Q5HA 4HWKA 4QBFA 1SCAA 5TPWA 5K09A 1NFFA 3BJRA 2G83A 3DVAA 4HLNA 3M34A 4TM7A 2NSYA 2Y1OA 3DCJA 3L9XA 3TSCA 4DREA 4XVRA 3TBHA 2QV0A 1Z9BA 3NUGA 3VPHA 2H0AA 1P2FA 1QHIA 2XPCA 3AMVA 1LV8A 2C00A 5IJWA 1F06A 3FUXA 3W2TA 1Q0SA 3TR0A 1W36D 3Q9UA 2XOKD 4I1YA 3KQOA 1J0CA 4WGFA 2NXNA 2FVYA 1V4BA 2RC6A 2VI5A 1VSBA 3GUUA 3H1EA 5FP0A 2H29A 1BU5A 5DNUA 1EA5A 1FRVA 1ZD2P 3D8TA 3R7BA 3GMDA 5CFMA 4KBGA 2OYRA 4PIVA 2I4TA 1YA6A 5JDCA 3K1JA 2I8CA 1JQAA 2REQA 2XZPA 4HSGA 5AI9A 4A27A 3V97A 1KIFA 3HA2A 3HVRA 5IJ9A 3RGGA 4ACAA 5LDGA 1CJCA 1LPOA 3F7TA 5JZBA 2NT4A 5JROA 5FTNA 2QW0X 5K3AA 2QK4A 4ZAGA 3QXXA 2ZROA 4G0ZA 4YN3A 1LQUA 3AM4A 4S0ZA 1H8EA 2WVHA 3KK0A 3C7KA 4PCVA 5J23A 4MUEA 5LXTA 1GG8A 1DBWA 2I3GA 3WL3A 2XQIA 3PF8A 3UXEA 3NGMA 1DKQA 2FZEA 1N6IA 4HAXA 4LZWA 5EWMB 5IABA 3DT9A 2C92A 4GDFA 2OAEA 3EA0A 1D5WA 3WWCA 2NQTA 3ABQB 3ZGLA 2PX2A 2RG7A 3QKRB 2Z4SA 4F92B 1AKUA 2GD6A 2QMUA 4FSDA 5FBLB 2GPSA 2AFHA 3GGJA 2BMJA 1UK7A 3EXHB 4B7CA 4CGYA 5L9AA 1M10A 3BTVA 2QD2A 4YJ3B 2LCFA 3OF3A 1QZZA 2MHCA 4NEHB 1H8HA 1XXHE 1PFGA 3IR6A 1SZDA 4MQ5A 5FWXA 2E4UA 1A1VA 1DPFA 4BLWA 3ZXXA 4J94A 2H2DA 2ORVA 3WKBA 1TYAE 1AO3A 4S2EA 1FTSA 3WHIA 2ZGVA 3AEXA 5AJXA 4GE3A 2PK3A 4RVUA 2QWXA 2H2HA 3I58A 4I5EA 3V2IA 1Z56C 3HU1A 1XQXA 2AEEA 3DNPA 5L95A 3Q72A 1YO6A 5DNAA 2PZLA 3D3EA 2DHDA 2PKXA 5EPEA 2XAUA 3UFXA 2YWCA 3WGTA 1UWLA 3I0MA 4QNNA 4CLRA 1RYYA 1V16A 3CF6R 3I1IA 4LF8B 2NUBA 1EVEA 1EFPB 3DVAB 5FOUA 4AKGA 4R05A 1T5IA 2FQYA 4IVQA 1KVTA 1TMKA 2EF0A 1FMJA 1S5PA 2XUDA 1QSGA 5F1PA 3ANTA 1X7DA 2Y05A 3EGDA 5BYJA 1NQAO 4NMLA 3V1UA 5AHOA 2QJTA 2HJVA 2NO9A 2Q6VA 3RADC 1DTSA 5BSUA 5BSGA 3ZIAA 5F4ZA 2IHBA 2OBFA 4Q9LA 5EZ6B 3H3JA 5DWVA 3F97A 1SRRA 2VPPA 4YEDA 4C0JA 4EVQA 2PVCA 3VYWA 5CB4A 1OA0A 1F8FA 1VPEA 4PLPA 1VSUA 1EJ0A 1FXWA 3EEFA 4B75A 4F56A 2UXDB 4GMDA 4M0EA 3KELA 5DULA 3UXMA 4DG8A 1XXHA 5JXJA 3VR0A 5I9TA 3LCJA 1XTBA 1FZQA 3KJHA 2HRCA 3PFCA 2PKQO 4IDNA 4EO7A 1LKZA 3EAFA 4WZBE 5HCUA 4YVFA 4XD7D 3L82B 1UDXA 4HDQB 3TGWA 3FY4A 1MQSA 1P2UA 4EPTA 4RTQA 1MJNA 1G0NA 3I1YA 1KRWA 3NIBA 5EP4A 2VDMB 4NU0A 5F5LA 5LXTB 3EJ6A 2IXGA 3LYHA 2XGOA 4IDFA 5EE9A 4DA9A 2WI8A 4ZCLA 3IVRA 1M5RA 4QVIA 4R2KA 3SQMA 4HYQA 1T2VA 4BBJA 5DP2A 1ISSA 4RELA 3WBJA 4WBNA 1UC4B 4QUDA 5K0NA 1GTL1 5CDFE 5KNBD 2PR7A 5LL6P 1V8BA 1ZOOA 4KGZA 3HZHA 1XOIA 3N3AC 3U44B 4NJOA 1UKCA 3W5DA 3PFIA 4M1ZA 2ZBUA 4FZ5A 5CX1A 5FWXB 1R6BX 1CVIA 1PFVA 1D2CA 2I33A 4QDZA 1EZ4A 1FMFA 1E2PA 4F9GA 3AEKA 4IXMA 3KYIB 1A9ZA 5AKZA 2GKSA 1PK8A 2AG5A 1YL7A 4OHBA 4NYIQ 4RZXA 4L02A 2H4YA 4CQLA 4UXJA 4DS3A 3MC1A 2I2XB 2HSZA 3R3JA 4NICA 1J9GA 1SQ6A 4LCJA 1EZZA 2EAUA 4QE3A 3QLEA 3EBPA 4CKYA 1KWGA 3NHPA 3OFKA 1XELA 1JS1X 2P6OA 2F48A 4IXWA 4JBIA 1HL3A 5E6SA 3RVNA 3UFXB 4TLCA 1IBKB 4CLRB 1P1RA 1I7NA 1V16B 1WU8A 2OCKA 4QYMA 4TSFD 4GP9A 5K1ZA 1ODTC 1FDOA 2BYTA 3Q98A 2D1YA 2GBLA 3PS9A 4A1OA 5MN4A 2YY6A 5HCNA 1GM5A 2B8NA 2QU7A 1NPTO 4EQ6A 2Z08A 1UXGA 5EQFA 5LKRA 4QDUA 3DZKA 3BTUA 5DM0A 3K9QO 1NN5A 3IJEB 5C5DA 1QGAA 5FBZA 4DNFA 4FR5A 3IPYA 1E1MA 1JU4A 1Y6ZA 3A6KA 2O14A 3AXSA 4DLPA 3EAQA 2NTJA 3HV2A 4R71A 2XHEA 1S8AA 3SD7A 1YJ8A 5DX8A 2F3QA 4GGOA 4W8OA 3UEOA 4PLWA 5BOSB 2YJ4A 1DXQA 1JG3A 4RK0A 4OI0A 4KQKA 3VNSA 1GQRA 3A9TA 5AW6A 1VLHA 2GN0A 3ICVA 3QJGA 4IHKA 4AIRA 2VHWA 3O1LA 3MCZA 5ALQA 3IIJA 3BCSA 3HEBA 4UHFA 5CVVA 3SJAA 2XNDD 1WSBA 1YZGA 3WMRA 3ESCA 2VQFB 1CRWG 1MP0A 3BWYA 2VHYA 5BYAA 1Z37A 3C8ZA 4A6EA 3DJFA 3AWIA 3PLNA 2QD1A 5BRNA 3W2EA 3OMXA 1DAHA 1VBNA 3IYLW 4AN0A 2PH1A 4J3FA 4NBKA 4B4OA 1XEAA 3Q40A 1JH8A 1YB5A 3FFBA 2HLDD 3WWZA 4OQDA 4ETMA 3MZ0A 1C81A 4LK2A 1V4VA 1RJGA 3IXQA 4ZOAA 4E13A 3M7IA 1T0PA 1Y4AE 4N03A 2PUCA 4BNGA 2II6A 3BGWA 3FBTA 4YMTA 2AN9A 1O0CA 3UK7A 1D2HA 2HMVA 4WK4B 5CLGA 5CX1B 4BVKA 1V96A 2SKEA 2RB5A 3LT1A 4KR6A 1J1IA 3HJBA 3MELA 2XQVA 4MQEB 1CUDA 2HW8A 3NCHA 4HNQA 4CIVA 3AEKB 1KFCB 1QRUA 2XLBA 2EVWX 4FX2A 4IDQA 2G08A 2BFEA 3CJRA 3WLRA 4CQLB 4R2MA 3HBNA 1Z2AA 5H9VA 1JPJA 1BC5A 4JQZA 4D25A 4OQMA 5JNWA 3IVCA 3WY9A 4H3VA 1SCBA 3GPDG 5E6SB 1ESZA 2VBGA 1UPUA 2WM9B 4W8HA 4ZODA 1T4DA 3DLAA 3UF0A 4O08A 1GR1A 1CUEA 1SKAA 4TVKA 3HVHA 1OY1A 3R7DA 4TGLA 1RWXA 5EPOA 5HJ5A 3GVCA 1FX1A 3LP6A 4RV4A 1E3SA 4WDRA 3U6BA 2DHEA 4DQXA 5KNBH 2C2WA 2NYAA 1C0EA 1GDHA 3C6MA 1K8YB 3EYAA 1U1GA 1Q50A 4Z0PA 1NXTA 3P9ZA 4O2RA 3ETLA 3LUJA 4DR7B 1FFSA 3OKFA 4EKNB 5ALHA 2A9PA 4FGKA 1BDHA 1YL5A 3TEJA 4EUHA 1AM4D 4H7EA 4KXUA 1U9IC 1KJ8A 5K8TA 4X41A 2DUUA 3FPEA 1Z0SA 1IHYA 5KQRA 2NUTA 2YWXA 3GNSA 4D9NA 1L7DA 1BVRA 1FDRA 1RAFA 1DJQA 3E7PA 4OU5A 5KSZA 4LSZA 1YIOA 1CTQA 2RGNC 4ER7A 1CSEE 2YFQA 1IWOA 3FPLA 3W1WA 3PEWA 1U04A 2JB9A 1RM3A 4N49A 1M33A 2VH1A 1M75A 3IDOA 3K6KA 1J23A 3AFOA 3K1YA 4I2VA 1ECBA 3KBBA 2AI3A 3L8EA 4LE1A 1PJLA 1WXQA 1J0DA 3PRKE 3TZ6A 1SVUA 1G59A 4GP7A 3DVLA 3JQBA 2HO4A 1PGQA 4KHPB 1M9NA 3VC2A 2EW2A 5EC8A 3IQEA 1BH2A 4Q3KA 5GONA 2EDCA 5EIOA 4P5DA 2ZRPA 2FR0A 3M9LA 4K9KA 3HL4A 1R66A 3KDSE 2GZAA 4P32A 3OX2A 4P93A 5H16A 2Y66A 3MGCA 4QYTA 4G5QA 1WF3A 1MRNA 2WQZA 3LY5A 3DQPA 2HQRA 4COKA 3H4VA 3LJKA 4MSUA 4Y6OA 3V8BA 1KORA 1WPGA 2WA2A 3GCZA 4ILKA 5KHAA 4HAYA 3B2NA 3WZLA 1RKVA 2BGGA 2NQ2C 4GHWA 2UV8A 4QEDA 5H59A 4AD8A 2CB0A 1N5LA 3JQEA 1O6ZA 1OU4A 4XM2A 3R6DA 1H2WA 5FXMA 2IS6A 1OLOA 4O4IA 3GGPA 2BFEB 5DNVA 5CDFA 2WYHA 3WRVA 3DLBA 4AWBA 3PNPA 3VZDA 1AGRA 1C4OA 1W5SA 1INLA 2BLNA 3G1TA 1N7HA 5DTRA 1ORWA 1FX0B 1ZM4A 2LRHA 2WZCA 4XUGB 1P1IA 2KE5A 2H7VA 1IDOA 4PY2A 5E2BA 1RZUA 4N82A 1CJSA 3U81A 3UZUA 3R8FA 1Q6YA 4FB5A 1NQXA 3DYBA 3L7LA 1L3CA 2QPLA 4MCAA 2C7QA 1RKBA 2J9YB 3F47A 3MJHA 3COYA 4F46A 1IHOA 3AL3A 3BG5A 3ONVA 4OJYA 4XOUA 5C37A 1JXMA 5KJEA 4JU9A 5JPCA 2X4DA 1M2NA 3BZWA 3C48A 3WHLA 1E0KA 2W8BA 4DOMA 1T0BA 4EKDA 1T4BA 2PL5A 4B09A 4JU8A 1ELOA 1SN7A 1KMNA 3NM6B 4K6HA 5IUNC 3TLAA 4V38A 1LX6A 2AFIA 3R0IA 3SC2B 4B6EA 4IQ8A 3SS8A 3ANXA 8AT1A 3IEVA 3GUZA 3WLKX 2GAFA 3KHTA 3PDUA 3U7QA 1A96A 4K6FA 5HR5A 2O23A 3NPMA 2FW9A 1VHWA 4CM9D 2G4VA 4MRNA 3D8RA 1P60A 1D2NA 2FKNA 1U94A 1T4CA 3SNKA 4E46A 3B6ZA 3OEED 2ZREA 1CNEA 3HFSA 4GI2A 1KP2A 4KI7A 3HFJA 3G0CA 3OJLA 5KO2A 3KE8A 5DSXA 2QQ0A 3NAMA 1Q1ZA 1VIAA 3NBFA 4OSOA 4MI3A 4DT1A 2IOFA 3HM9A 1JZQA 3RM3A 2PMWB 1N5KA 1Q77A 1J24A 4KX5A 4TYPA 2VSYA 1PE0A 3GFFA 1D2EA 3W5BA 2I6GA 4L4ZA 1Y1KE 1XDDA 3LX4A 3FGZA 4B80A 2FR8A 1QX4A 4BV2A 4R40A 5KIAA 5ADWA 2Q0XA 5DGHA 4ERXA 1SC4A 1JLHA 2NNLD 3CNLA 3TLZA 2X0NA 1G8FA 2ZPAA 4FDVA 5KSYA 4GL2A 1SH7A 1V35A 5B1EA 2Z56A 2ZWIA 3AW9A 1Q22A 2H11A 3KXLA 4AJ4A 4XSHA 4O3MA 1GUYA 2APJA 2EWVA 3PHJA 4KPYA 1G4UR 3H2SA 4BIMA 3HXOA 1VI6A 4RCZA 5DRTA 3DFUA 3ZS9A 2ETVA 2ENWA 3LWDA 1KI2A 4N3BA 4Q37A 3OOSA 4DRZA 2CKDA 1RFGE 4KRFA 4OEHA 2EJUA 3NNDA 1QYWA 3N0TA 2FGJA 2HF7A 3LLCA 1EGVB 1IUKA 1RXEA 4UJ5A 2GERA 1GEEA 1WLSA 2C5LA 2Q1TA 3T5TA 1E2UA 3IIEA 4R8MA 4D7AA 2C7OA 1BEUB 5EIFA 4FFPA 4Q9HA 4ZOLF 3LY7A 4QGFA 3VR6H 2Y3IA 1QH9A 1RWWA 4E4TA 1PUIA 2W8BB 3R9XA 4UNSA 3QX8A 2OGZA 4KXVA 5LWHA 1BJTA 1GZSA 4F9FA 3WGOA 5FO0A 3A58B 3WYFA 1I14A 5IEJA 5H8WA 4DLRA 1K63A 2WUGA 2V4ZA 4GR9A 1COWA 1TAQA 4QNMA 3CW2A 4BP1A 1WXWA 4L22A 5TF4A 2Z5GA 3U7QB 2BCGY 4K28A 4HB4A 3ETNA 3DL7A 1QGYA 2ZSIA 4R6XA 3RU2A 3HI4A 3RVRA 3KHUA 4G2NA 3RWOA 3Q8WA 4CFYA 3GJ8A 5CK4A 1T4CB 2CDBA 3M49A 1JHXA 2LP4Y 4XIFA 4N47A 4A4DA 4REOA 4INPA 3PTZA 5IAGA 2R5NA 2AD5A 2VYCA 5I7OA 3IESA 5TGTA 3L4EA 4A8PA 4UHCA 2LIPA 1YA8A 2GT1A 3WVNA 7REQB 5K05A 5T4BA 2JIBA 2Q21A 3INYA 1IXKA 4DT1B 3N76A 4MW1A 5EERA 5HKKD 1WDMA 4FS3A 4LGCA 4A23A 2PBLA 3M83A 4QTUB 1GV1A 2DFLA 3Q9NA 1DJPA 2Y0CA 4XIGS 3TXXA 1BQ3A 5JWHA 3X1XA 2ID7A 1UJ6A 2EBWA 3LGAA 4OHFA 5A6VA 5DRYA 2X5XA 5E38A 2HF8A 1RI1A 1NBMD 2ID9A 2E1RA 2YVKA 3G9TA 1WWKA 4GR5A 5ICMA 5J5CA 1HM5A 1R37A 2O2DA 2R62A 4JT2A 1U98A 4PBTA 4QIHA 3WGUA 5CXXA 3CUEF 4A8JC 3OZRA 2BFFA 4BNNA 4ZAWA 4FOLA 4XRGA 4K0KB 5E9WA 4LXUA 3TH5A 2I6QA 2N75A 2Q5EA 1G20E 4BQFA 1KMMA 2IV2X 2CMFA 2R6DA 3L1HA 2XMRA 3BB1A 1RWQA 3WYGA 4BPBA 1DO0A 1TUEA 1E8MA 2QE7A 3AHIA 1BS9A 1C3XA 1X70A 3ZY3A 3A05A 5DN6D 1D0SA 2VATA 4O2AF 4PG4A 4RVCA 5HIIA 4HD8A 2JAWA 5EP3A 2MDTA 3AY7A 3W3ZB 1PJCA 2XE4A 1XFDA 1K88A 2M6RA 3CA8A 1L4FA 1ZJWA 1OFUA 3PB3A 4YXWA 3UKJA 2NVUA 3WGKA 3FI9A 4YMWA 4B5LA 4TWBA 3AI7A 3M6IA 3USCS 3A8TA 1NJFA 5LQSA 5KC8A 1YR7A 1KI4A 3LXRA 3R9XB 3JS5A 4W5QA 4BE4A 4IJMA 4F06A 1W35A 2BTQA 2IUUA 2YV5A 4GI1A 1PNVA 4UUAA 5G4LA 3DD5A 3E2IA 2D0IA 2OENG 5CEJA 1CUGA 2EG5A 4C04A 5BWMA 3PSHA 1UC9A 1MT0A 4F5WA 2J4DA 4ZQHA 3ZJ5A 4OPMA 2UZ0A 4IIJA 4PWZA 3VTAA 3K9LA 1CUXA 4KYTA 1KEWA 1J20A 1E9CA 2B0JA 2QPAA 1A8UA 3EVDA 2IXFA 2XWQA 3LQYA 5AK4A 4DMGA 1PGJA 4S0XA 4X1KB 5DK4A 3G17A 2GTIA 3I09A 1TUGA 3H42B 1RAAA 1XROA 3I6ZA 1IZYA 4BFVA 2D1QA 2HTEA 2Q29A 4AY4A 3GGOA 3TL3A 1UFQA 5C81A 1A8PA 3K0CC 1L5HA 3FCOA 1IL0A 1VYTA 3STHA 3WK8A 2VJPA 4I4TF 1GPWB 1U8FO 3MJ4A 4NV3A 1SC9A 2PKYX 3QY0A 1H1TA 2H6EA 3ITEA 2IXAA 4OQ4A 4Q05A 2P41A 2ROQA 2V0CA 3PXXA 5EE1A 1T6XA 5B3AA 1HQDA 3ILHA 4RK7A 1WPXA 1CX9B 3THYB 4EK9A 1T9ZA 5CPFA 1E2KA 3VH4A 2PVPA 3NJRA 4HT3B 1DKPA 4UARA 3RANA 2WYIA 3ZHXA 4RH0A 2TYSB 5AVTA 3RLFA 4UU7A 1GPAA 1UBHS 1IVNA 1VL6A 2HMAA 4PRZA 5B5SA 2BFFB 1WG8A 4RMJA 1JLRA 2RGAA 1ZVVA 3EW9A 4KEAA 4F6RA 2Q46A 5CJ2A 4B6PA 2J9RA 5KYWA 1NJ6A 2WWGA 3MMPA 2OQVA 4CR7A 4YIHA 5LD2B 3ZJUA 4PIPA 1X8KA 3P1JA 3GFTA 4LDQA 5DCLA 3OESA 2DPHA 2PXXA 3KE9A 4XGIA 1F20A 2GF0A 2EW1A 5JSZA 1P0CA 2RHDA 2FTKE 3BSFA 3EGXA 3U4IA 4XWYA 3BIJA 2IYFA 5E9QA 4EYOA 4GXNA 1HPLA 3V1NA 2ORED 3N0WA 1O9BA 4AAYA 3TECE 1YI8A 1Z8HA 2EGUA 3S4YA 3TRHA 4TSRA 3JQGA 4DSOA 4LSGA 5K8IA 2VP6A 5LBUA 3NALA 5JFGA 1SUDA 4WK2B 4ZVPA 3WRYA 4ZCQA 2EFCB 1DB3A 4BX0A 3R3HA 5TLSA 3F2IA 2OGTA 3HSKA 3L0PA 4AQ7A 4OMUA 4O33A 1L5LA 1ZITA 1XK7A 2P8SA 2HCBA 3D7NA 4HDRA 2J9FB 2PX4A 4EHJA 1VMDA 2MU1A 1BWSA 1S4QA 1Q6ZA 2PAAA 4LXQA 5DGCA 1Q0UA 2JLXA 1UBNA 4Z9YA 2OVBA 4U0KA 3W8RA 1N6NA 1JFSA 4IIJB 2P1RA 5LU8A 3PGXA 3NXKA 1L4NA 5A0VA 1GPNA 2IELA 2O2CA 1X1TA 1TVMA 2OMEA 4QODA 3ASYA 3A2MA 4ES6A 1M2VA 2I91A 4RHXA 3WSVA 4V39A 1NYQA 1JHQA 2Q9BA 5FPYA 3VKWA 1NONA 3ZV5A 4CM8A 1Z4KA 4K6MA 4EHLA 4HTFB 3AHFA 3OE7D 4RF5A 3V4SA 4Y2SA 2E2WA 2QZJA 2VEOA 3FR8A 5GVRA 1Z36A 3WNBA 1MAHA 2J3IA 1N2CE 3A4NA 3A1EA 3C41J 3EZLA 3QWFA 3RVPA 3W4IA 1L5HB 2ZQZA 3MAJA 4NFSA 2LCQA 3H4TA 4JX9A 3H3FA 2P65A 2X6TA 2ZI7A 4IG9A 1D1TA 1NJ1A 1VIVA 3C16C 4C30A 2JEOA 3FGOA 3LLVA 1HI9A 3RYTC 2JGLA 2FWIA 2O0KA 5TEWA 2GD0A 4ZT2A 4XYMA 5LB2A 1RRCA 2O52A 5BV8A 3AHEA 2QG6A 3DSRA 4GNKA 4IJUA 3QPBA 4FONA 4HL6A 4ZO8A 5B1IA 3ZX4A 4RGVA 3I39X 4HDNB 2R6ZA 2HHAA 3QPAA 4KYUA 1RRGA 3V7FA 3OI7A 3M33A 1JE1A 3D7RA 3CCBA 1LBHA 1VGQA 5BRJA 1FDVA 3SQDA 1SHTX 2ZDHA 4QPDA 3ORYA 4C5CA 2FQQA 3PC8A 5ICEA 4Y6LA 1VBKA 5JEDA 5KYWB 3ESZA 2OSBA 3U5TA 3NPAA 4ID3A 4GOKA 2G3YA 3QGMA 1E3EA 1WB6A 3ZV6A 3IPLA 2D1FA 4C05A 4AP5A 2WWIA 5ITVA 3EGXB 1DZIA 2PMCA 2WJAA 1Z47A 2QAGC 4HH3C 4JC0A 1JBQA 1J5EB 4Q82A 3ZHVA 5A1TA 3T1YB 1AHNA 1NY6A 3OPMA 5D2CA 2G5PA 2E82A 3EZYA 3JQGB 3EF1A 1XF9A 2O2ZA 2P0YA 3SWWA 1YQEA 3CZAA 4YCMA 3SDZA 1P62B 2I4MA 1Z7BA 3V34A 3FH0A 1FFBA 1I3LA 1N3YA 1ULHA 1L7EA 2B2XA 2X9LA 3ANSA 3EMBA 4U6QA 4BQSA 1XTVA 4P08A 4AY3A 1JR2A 4HDRB 1EBUA 2PH7A 3GK3A 3ZU5A 1KGSA 1BVUA 4UC0A 4MCIA 1UP7A 5JALA 3QP9A 1KK3A 2JFOA 2Q5OA 3PRYA 1EBFA 3UJDA 3V4RA 2GVDC 4HEHA 4ON9A 3NXSA 4ZMBA 1AQJA 2OG1A 5FUYA 3HDYA 3MT9A 4QUEA 3H17A 1VA5A 1JHMA 4HGOA 3ZLTA 1YJXA 3DDWA 3EIHA 3FYCA 2FY8A 3EW7A 3KALA 3IUEA 3LVFO 1M2VB 3P9YA 1E2IA 1K8ZB 1RAGA 1CUIA 1EEXB 3KRTA 1W6RA 4RACA 2Y1CA 4O4HB 1S8OA 3VDNB 1RSZA 2A6PA 1U7XA 4CM8B 2YYYA 3N87A 4QTZA 4UATA 3RB8A 1TD1A 4C87A 3RBXA 2OE2A 2WK1A 2QP9X 1T2AA 4CLDA 4LNUB 4WASA 2Z3VA 3B9QA 2FHSA 2PUBA 3I0ZA 1Z7GA 4L2IA 2X86A 4EF4A 4IAOA 2RGBA 4JYZA 4C22A 2JBHA 1NN3A 2V3VA 3BJMA 4K9RA 4UAGA 1IN4A 1N0IA 4LHVA 1O97D 4L51A 5AR1A 2NU8A 1DIBA 3E3OA 3ZEIA 4UPDA 4AT1A 4C4AA 5FX2A 3AIMA 1ZBQA 3VAZA 4GXTA 5FWAA 4C4SA 1W5TA 2F43A 1EFUA 4ETWA 1GD1O 3WAGA 3PNSA 2JLVA 1IOZA 5IYZB 3BVPA 4FW8A 4KLCA 3S28A 2LR0A 1BXKA 1GGKA 1KXJA 2NVWA 3R8CA 3ZDDA 1QG2A 1PYOA 4OOEA 4Q1AA 4IQFA 3QYPA 2ZTLA 2BI4A 3U9SA 2A1TS 1F8XA 2YN4A 5DTQA 4BMVA 1TE2A 5SY9A 1PW7A 4D92A 3A3YA 5JS2A 1BG6A 2ZYVX 1P74A 1LS1A 3BD8A 2B4QA 3O47A 1DT3A 5KHLB 4B7AA 2WFZA 4BRWA 4IJWA 3DZIA 1CP2A 2HPHA 3M8KA 2V6BA 1NF9A 1U2SA 3MJVA 1RWBA 4I5FA 5TARA 1JG6A 4XFDA 2CW5A 1CT9A 1U2EA 1G8YA 4QBGB 1KDYA 1VG9B 2CYCA 3E8MA 1FU7A 4UEJA 4L0MA 1G8HA 2Z6VA 4RY0A 2EF1A 2P3SA 4BVEA 3OQPA 3O93A 4R2WA 3EC1A 4BFCA 5L45A 5EHGA 3ROQA 3TSAA 3U4DA 3VU3A 1DWPA 4FGJA 4EG3A 4W99A 4BVLA 1PVOA 5TY0A 1ES9A 3A9VA 3VU8A 4Z9BA 1U8TA 3VM6A 2PUHA 5ENDA 4B2PA 2FYTA 3PUWA 3NS7A 3A6ZA 4B6SA 4B8WA 4EJ0A 1C3VA 2V7PA 3EXIA 2XWSA 2JVJA 1A82A 4J7CA 2OORC 3OLYA 4NQZA 4X20A 4O0MA 3TPFA 3ZCPA 4GMHA 1OH8A 2BGJA 2P69A 2WUFA 3PHHA 5IF3A 4Q9KA 3B1WA 4C1BA 1U65A 4A2QA 2WE7A 3EODA 3IMFA 3OE5A 1XDBA 1HOXA 1XG5A 1G8KA 2H1VA 3QNWA 5KNDH 3HO1A 4ZYWA 2OLEA 1RJWA 4RY9A 3W7AA 1EFRD 3DKIA 2QM7A 1O2DA 4R3WA 3W05A 1M54A 4FU0A 2ZSAA 1QC5A 2ERCA 1NKTA 3DHEA 3SFVA 1NOKA 1JR3D 1ZU5A 2ADFA 4RD1A 4U3JB 4L2IB 1C50A 4L8VA 1MOSA 4HEA6 3WQBA 3LTNC 4BKQA 5TMDA 2FHPA 1J90A 1ESDA 1SCUB 8MHTA 1IPEA 5IVHA 1EUQA 1ODLA 5IJXA 2NZYA 1LSUA 5A5DA 2DLNA 4Q4DA 4LWZA 1PJ4A 3M1IA 4JXZA 3KZOA 3T3OA 2FKAA 2AR0A 2F43B 3E15A 5CA0F 3ABIA 1KI7A 2DM6A 2HLNA 3C8MA 5JMWA 3SCZA 3QEKA 2JVKA 2EW8A 4J0DA 4CKEA 2WWVD 1VKHA 3PQ5A 3TSYA 3ZU4A 5AVUA 3ZE1B 2FQXA 3KSRA 4ROTA 5BSEA 2ZG6A 3OOYA 2PR2A 1RCFA 3JARA 1T6ZA 2ZBDA 4ZAXA 5KMGA 1VECA 5B2FA 4R8LA 4FQ5A 3AJ8A 2OILA 4A2WA 2FDXA 1EVIA 4PPQA 4B81A 3DMTC 3KSAC 1G6KA 2YWGA 2DCUA 5JSZB 3CQ9A 1C8KA 1X7HA 3EMDA 3PD1A 2C31A 3C1AA 3FLEA 2NTEA 3MMNA 2VDKB 4G07A 4BJ1A 2AS0A 1VPTA 4DILA 7MDHA 4DJFC 1T0UA 1UBJS 4HRXA 1N8NA 2VAMA 2ZBPA 1PDWA 4MR8A 4WHMA 4ZTUB 1N36B 1B43A 3TDNA 1K0UA 2ZULA 5ESXA 4B5KA 1Z0AA 3VPBA 4FHCA 4IZIA 1P0IA 2C8KA 3IAXA 3KNZA 4QULA 4ZU1X 3P0RA 4IDCA 2AZXA 1MXFA 3EPPA 5DHAA 1VG8A 4HKTA 1B6TA 2O7NA 2QROA 1NNI1 1UEIA 3HDVA 3KTAA 4IUBS 3G13A 3EXIB 3O3NB 3ZY4A 2I8AA 1LK0A 2OFFA 3WSTA 1H85A 1KDPA 2EG9A 4FMCF 5ALFA 1U3FA 3G8DA 3OU2A 3W6ZA 2VQEB 1W52X 2L69A 4PSVA 1QFZA 1TT7A 3D3QA 1JL3A 5K4HA 3UO8B 2JGAA 3BWVA 1RS0A 2R6R1 4DY4A 2C9BA 5F2KA 4H18A 4IUDS 5JVDA 3EDMA 1D4AA 4G1MB 4J0EA 5C8XA 4W9RA 3LC2O 1O9HA 1V9CA 4KXWA 5IM4F 2YS7A 4TZTA 4DIMA 3GLKA 4UM9B 1L9XA 4YT4A 3N6RA 1PZGA 4BWYA 5JXGA 4L5CA 1Y5IA 2YXNA 2W8ZA 3DBLA 4URWR 4JBXA 4AKTA 4EF6A 4YUZA 3D6VA 2HBYA 1ABFA 1GPYA 3UV3A 3MRSA 2PZJA 5DM60 4PG6A 2O2XA 3ONWA 4LRSB 4KKVA 1Z16A 1Q7BA 5ULLA 3RSLA 2WV7A 4FYXA 2C99A 1FJGB 4Y1EA 3TMKA 2WJ3A 2YFHA 1RIIA 4AYTA 4D82A 1MB0A 3ZDYB 1JZSA 1W88A 3NWJA 1QQ7A 2C4WA 3HRHA 3OU7A 3TVYA 1PJQA 2FN8A 2GASA 2X2OA 3U60B 1JHUA 1IBRA 1EE1A 2WSSA 4CKEB 1MZPA 1G291 1K8QA 3RSQA 1IU9A 4F91B 3R7NA 4EYGA 2QRQA 4WFQA 2R5WA 4O8CA 2VN8A 3CY6A 4B31A 4BNIA 4FFDA 4I50A 4EY7A 2OZEA 4CN8A 4AIIA 2BFMA 4ALKA 4F2GA 2A9RA 2C8LA 5JV5A 4P34A 4YJ3A 2CXXA 5KMGB 1FNMA 1G17A 1NYRA 2P2DA 4C06A 1MHTA 3QWBA 3PNYA 4ZXFA 2ZT8A 3DPUA 3QFTA 1GPDG 5FL3A 3E18A 3T95A 3L6EA 5D6OA 1J9ZA 1MH1A 1UJ2A 4BNUA 1YQWA 1OJLA 3IE2A 3IEXA 3SHTA 3LW7A 2JFPA 1OA1A 5KAMA 4MYHA 4AJKA 1SAYA 4QDTA 3TZBA 5B3LA 5CB8A 4ECEA 2QTHA 5HUJA 2XGGA 3X44A 1NW5A 2AQKA 1NF2A 4MR8B 5C4GB 2C7BA 2XTAA 4LA4A 3UMVA 4DJEC 1ZAKA 5K0GA 1OE0A 5IBQA 5EVCA 4BGIA 2PANA 4DUGD 2O50A 3QFFA 4MVJD 4OQFA 4AJ2A 3PNMA 2BJVA 2DZDA 1RZRD 3H9BA 2P2GA 3PU6A 3PCXA 3O75A 3UMGA 2OVFA 2PPLA 1ICEA 1BO6A 3FKJA 1WHSA 2BR5A 2X14A 3C6KA 2X0KA 3PUZA 4UTZA 3PGJA 4W1QA 3PGA1 3PC3A 5CK5A 4ML3A 4DV2B 4RD0A 3KL2A 4ZYTA 3OWXA 4Z1OA 4GL4A 3PX7A 2JW5A 1L5WA 3WYDA 1SG0A 3CINA 3EYWA 2O7RA 2QPOA 2XDQA 5JLAA 2ETXA 1AGXA 4YRPA 3HY3A 1TM4E 3QKIA 3G2NA 5ALUA 3ZV7A 2D7JA 2INGX 5JVDB 2HDHA 3JCZA 4FEAA 3R3SA 4LV6A 4MMXB 4B83A 4KQWA 1L5ZA 4BGUA 5I51A 3KKOA 1ZHFA 3PICA 1KYVA 3DBLB 3EF3A 1OGJA 2PL9A 3ASZA 2PZEA 3D43A 1RPTA 4KLZA 3W8NA 3ER6A 2BUAA 2R44A 5HF6A 3LDFA 4HGQA 2VK2A 4DEVA 5AUOB 5KEIA 1QKIA 4OK5A 2QA5A 5IVPA 1RZRA 4OREX 1BH6A 3BS4A 2PLNA 4YV1A 5K4AA 1PZXA 3UBTA 4NFLA 3LFUA 2PAFA 1I2AA 1W88B 5EFZA 1CY4A 1FP6A 3L41A 2W6ID 4PX5A 5G0UA 3B8EA 2Z8YM 3AR3A 1CQXA 4INJA 3FCAA 4PZ9A 1BGWA 1N2JA 1PDOA 4MRPA 4R2HA 1TC1A 3QPVA 2F67A 5DW0A 1RLTA 2C8JA 1E9RA 4AP6A 2B5OA 2QTZA 3OCJA 1CDEA 3IB6A 5G1PA 1F3OA 1UPFA 2PMBA 2IYLD 3L8YA 1O96A 2VFAA 1JIUA 3Q5DA 1DAKA 2ZETA 3H2BA 1C7JA 4L7VA 2CJXA 1PFUA 1AGYA 1V5IA 1WM1A 1C3OA 4NHEA 4XVUA 2WWXA 3QVWA 1L7OA 5FFFA 1PR4A 1BMDA 4ZEXA 3WJAA 3CNOA 4GO1A 2QMZA 3ZGOA 5AKJA 1JIVA 4FQ7A 3OCYA 3RDPA 4S1OA 2ZRKA 3RK1A 1HSOA 1T1JA 2PT6A 4D3SA 3P2JA 5AM0A 4Y2RA 1K08A 2YRFA 2BMFA 1RYZA 2JIZA 3BH7A 4IOLA 4F5DA 4QU0A 1HORA 1QYCA 5C0OE 1PJAA 3JVDA 5BWLA 5KQPA 5KKNB 1Y7HA 3OQIA 2N3ZA 1ULTA 1VLQA 1OFHA 4WJKB 3WS7A 2RI1A 3WKCA 1B26A 5AVJA 4OH7A 5E1BA 2P30A 2WSMA 1L3IA 1WHSB 2DP4E 3OFJA 3ZZMA 3KXIA 3C7AA 3CUVA 4ZOQI 1OFIA 5JR3A 3RASA 2O7VA 1AZSC 2R97A 4Q00A 4TT8A 3HU2A 3FTQA 1P5RA 4EI2A 3WWOA 1A98A 4QAQA 2V55B 2BBTA 4XGNA 5IF9A 4XYBA 2XDQB 2O3QA 3LF1A 2XUIA 5IH7A 4KWHA 1E1LA 3DCIA 1HRDA 4K9PA 3PQ6A 4RTKA 1TAGA 4PPYA 1ZL2A 4DC9A 4TYNA 1QNLA 2HYIC 2V7WA 3LIPA 4IWXA 3R0JA 4M76B 2GBCA 5E1MA 5G02A 3WB0A 1L4MA 1Q19A 1OZAA 1PR3A 2GZ1A 3RAJA 1AX9A 2XJ9A 4D0NA 3OP4A 1E8NA 1A4RA 4EMBA 4ZYLA 2WAOA 3K09C 2NSDA 2J5KA 3IDSA 5C8YA 1M8KA 3KYCA 2WZQA 3DV2A 2WIAA 2YXPX 4D98A 4IIUA 3ZWWA 2GKOA 1QFJA 1P1CA 3ZWYA 4YT8A 4L6IA 1QK5A 2J5QA 4Z8YA 3OPNA 5GADl 2BSAA 1AKTA 5LWQA 4FGSA 1RC8A 4E32A 4E5NA 4OGFA 1DQZA 3RUAA 4AP9A 1XPUA 3EEIA 2PDAA 3NRBA 5CNKA 4W6ZA 3ER9A 4YH1A 4ZTBA 1ZGAA 4QBKA 4WCFC 1XC7A 3TK1A 2WWFA 1BFUA 2V5AA 4DIOA 4H1HA 3RBZA 4E6EA 1I2MA 5F9MA 4HXEB 5BSRA 1H93A 2AXEA 4ESEA 3T8YA 4Z3OA 1DAFA 2RARA 4EPXA 4O6VA 4D56A 1KO7A 2ZSJA 1TKAA 4UASA 3UAGA 2FOIA 1XNGA 4DBLE 3DCNA 1IK6A 2NXEA 3UT5A 5CFNA 5JFOA 2CJWA 1FFCA 3R2JA 4RORA 3FVQA 1CEEA 3LUGA 1OWPA 4R0VA 1J70A 2ZIVB 3NO4A 4O5AA 4I55F 1KARA 1VCNA 1I7SB 1ZXBA 4A0GA 4G5RA 1L8AA 3L84A 4YHBA 5D3MB 5F2NA 3HNOA 2HQBA 2P5UA 4HEQA 4YJ2A 1EWTA 2F17A 3MWKA 3F4LA 4Z4QA 2AD1A 3O26A 3THRA 4EVRA 4GZ5A 1GFZA 2B4RO 4NE7A 1UJ5A 1FMTA 1T3LA 4X8LA 3T12A 4YQFA 1GZ5A 3PEVA 3BIFA 1MEJA 4WLUA 1KI6B 2UYYA 1IVSA 2W6ZA 1TQ8A 1QGZA 3RBVA 1JFFB 3LVRE 3NHWA 4UQPA 1X6VA 1Y9JA 3OPVA 4ZT7A 5HS6A 1V8ZA 1E66A 2DWUA 3EVCA 3HDHA 3KJNA 4X1IA 2AV6A 4XGRA 2VYFA 1FU8A 1OZFA 4YJFA 2HZ7A 1TW2A 1WPQA 2GHIA 4BMOB 2C82A 2QP4A 3AEYA 5L6MB 3HB4X 2YASA 1M66A 3KT3A 1SC3A 2XH8A 1H23A 1JA9A 5AHRA 1XKTA 4S05A 1S2OA 2GXSA 2QRMA 3W2IA 1JYFA 5HZGA 5I3ZA 5BSFA 3VR5D 3MAGA 1BA2A 1N1EA 1C9KA 1V3QE 4GLOA 4DLYA 1J33A 4RDXA 1D6JA 2VH5R 4E11A 1YKGA 5HRCA 2IEBA 4ZT5A 4WLOA 1YB7A 3W06A 1QYIA 3QLJA 3W5HA 4TV9A 4ILEA 3WNZA 5B37A 2E4WA 3T4XA 3WOHA 1XLUA 4OA8A 1M3SA 1BMTA 5D86A 3BE6A 1YTLA 1YVEI 4XDYA 5H4HA 4PGMA 1WQ3A 5LB4A 2WILA 5IT0A 2GARA 3OQ1A 2R79A 1XXLA 1P6XA 3I9MA 2NXWA 1D6NA 2FZ4A 4MNTA 3EH2A 1A9SA 4LI0A 3EISA 4N3AA 4TWZA 5L3QA 2H8GA 3B82A 3QQPA 5ILGA 4CLOA 2AG1A 4C4OA 5KAPA 5K6RA 2ZYTX 2WWHA 1FFDA 2P2SA 2JFQA 3CTMA 2R7KA 1E1YA 1OT5A 1U4NA 2RHBA 3OSUA 5G3YA 4QHTA 1O8CA 3RFTA 2CJWB 2P6PA 4R16A 3UT5B 3KKMA 3DV9A 4GEKA 4RW0A 2CVPA 4TRJA 1SBYA 2E4ZA 2WJWA 4JC4A 1PFKA 3S7TA 1EQ2A 1SXJD 3BPSA 5DISB 5FOSA 4DQLA 5AM2A 1UXOA 1LPNA 3D2AA 4ZZ3A 4E5KA 4BNDB 2YWFA 1VE9A 1Y4DE 1SVSA 3SHWA 3ZVRA 4YRKA 4CF4A 4NC9A 1SBZA 1J2EA 4UD2A 4ZMSA 3AF4A 4YJ2B 2H1OA 4DBVO 4BVGA 1TO6A 3ZJVA 1RAIA 5I9NA 1UOOA 1QO9A 4DR3B 2WPDD 2Z1NA 3A1NA 4EGJA 1P4RA 2CHGA 4P54A 1JFRA 1JSLA 5JCPA 4NNPA 4UTRA 4FCVA 5B53A 3MWJA 3HR7A 3UW1A 5BVHA 4H7IA 1T9DA 4YJFB 1UMCA 3IE1A 2RH5A 2BJHA 2WHXA 3W7VA 1AG9A 2BRUA 4B3TB 3CLSD 4FMPA 4KDFA 4HG2A 5I4CA 2C7PA 2WYWA 1DKRA 1I1OA 3OCWA 2OCGA 4N41A 3ENVA 3OSZA 4JI3B 5TC4A 2O06A 1GEGA 3T1QA 4ARZA 2RIRA 3GV0A 3U7HB 4MV8A 1EDOA 2X5OA 4DNQA 4G84A 1YZYA 4AJHA 4HNSA 1TAHA 5BPFA 1QRTA 4MQ6A 2EIXA 1P0MA 2FG6C 1N5OX 3RS9A 1R12A 2FPOA 4FYPA 4TV9B 1AF7A 4B3BA 1LPAB 1M8PA 2R7AA 4QQKA 3EPKA 2QX8A 3JR7A 2XGMA 4IWNA 1DAEA 2XEXA 3BK2A 1QIDA 2XVZA 4ESVA 4NG5A 1BVYF 2Q8NA 3INNA 3JQFA 1EFDN 1L4HA 1V45E 4L57A 2QDKA 2HWYA 5EUQB 4ER6A 2XXBA 5L3QB 2QTLA 5HJEA 1PJ8A 5IG2A 2XB2A 4EFDA 2XF2A 5MN5A 2B1GA 1UZMA 3DMGA 4JXXA 4XLTA 4CMCA 2P75A 2J0UA 3CGGA 4EFKA 3CO5A 5JYDA 5EE3A 4RHTA 2V0NA 3CBQA 3IRVA 1L5VA 3GGGA 2Y93A 2A9OA 2GZRA 2QRKA 2QUBA 3ZWDA 5T3UA 4ND6A 4RPLA 2LPMA 4I7EA 1HH4A 4PR3A 3ELBA 3PQCA 3MLAA 4P1ZA 3LWBA 4V0RA 3BMXA 2UZ1A 1JEYB 3UWPA 1GTVA 1LPPA 3GFOA 4R8SA 2QRGA 1JQ3A 2ZYAA 1LPSA 1WL8A 1DXOA 3NTVA 4PGFA 4OJTA 4YRGA 2XRZA 3R9WA 4KIUA 9LDTA 1ZI9A 1AH2A 5BVHB 1V2HE 2OV6A 4M2LA 3G2QA 4HGZA 1MV8A 1KJQA 3UUFA 1Y1TA 1Q0QA 2PV7A 4PTZA 1E2NA 4ALIA 1SXHA 4AROA 4J7XA 4LKRA 1NVEA 2WM8A 1ZD1A 5FI0B 4HFRA 4P6VF 5I5EA 5J9FA 3WDMA 2EEZA 1SCKA 1JR6A 1JU3A 2H5JA 2OGUA 5KJ6A 2C9YA 5AVQA 3GA5A 2OXCA 3K6JA 5FBHA 2GD1O 2J1LA 2WJJA 3UTCA 5K8LA 1HY3A 3DONA 4Z4EA 5E7MA 3TAHA 2Q0QA 2EQ5A 2UZIR 3HB5X 3HA7A 4OTZA 5EMKA 1N6HA 2JKVA 4W5RA 3ONFA 1EUYA 1JA1A 1H0KA 4G86A 2IUEA 4H7DA 4JQSA 3QFHA 5ALWA 3SMVA 4NYJR 2GBGA 1A5BB 2Z2JA 4X24A 2PFGA 4G4SP 3JAMA 4D4HA 1SHJA 1YC2A 1Q3KA 2ZTUA 4GQBA 5FFMA 1E1QD 2C2ZA 3RPEA 1T4MA 3V8EA 1SQGA 4C0BA 5JSHA 1R8SA 2PXCA 3GAMA 3UMJA 3TLYA 4F4JA 2O7QA 2WTEA 2BV3A 4N7JA 3B7PA 4OQZA 1YFKA 4D8XA 5KYXB 1DFIA 2FMHA 3QXJA 2Z58A 3HQ4O 1F3LA 4DABA 2H63A 2Z5LA 4XJTA 2Y6VA 5CXUA 4HPWA 4KG7A 3G02A 5FYDA 3HJRA 3R8XA 3ZXIA 5A4AA 5E0OA 2C4NA 4MEBA 2J0UB 3PGLA 2HA0A 1YS6A 3E5RA 1VI2A 5GMOA 2P6MA 2HN9A 1MB9A 1UJBA 2J09A 4F12A 4BFYA 4EUEA 2P27A 4ENQA 1G5FA 3GMIA 2DERA 4I4IA 2HR1A 2JD0A 3WB1A 3KVYA 1M6HA 4MAFA 4TMVA 1JFVA 2R8XA 4AM8A 3B52X 3UANA 3M3PA 4Q6WA 1KL7A 4XWAA 5C32A 4XWTA 1CUYA 1H2AS 1VYHA 1ZESA 2ZSFA 2WZBA 4BX3A 4CIYA 2UZ1B 3FE2A 4ETIA 3V4PB 3KKLA 3EDCA 3PI6A 1Z25A 2BL4A 5DTJA 3ZCUA 4EWLA 2G80A 2DSTA 3HE3A 3UGKA 3CSSA 5HIMA 1BX0A 1DUVG 1EUDA 1GQOA 1UBUS 2BCEA 4PZDA 4WAUA 2WVAA 1ENYA 4MZDA 5KI6A 3K32A 3FTNA 5J5VA 4WACA 1G5TA 2JI4A 4L8WB 3UATA 4TRRA 1RXVA 1JQKA 1ZWKA 4NQRA 3OZEA 2OV8A 3HDTA 1C41A 2YIJA 4N7MA 4DCOA 2I0FA 4QXMA 3UK6A 5HTOA 3OM8A 2VRCD 1CF9A 5F1YA 4KX3A 3G68A 1GFWA 3QYFA 4RV9A 3Q3HA 5JAQA 4TS3A 1NURA 2YRXA 1ITZA 4M4SA 2X0JA 4LJ8A 4BV8A 5BNTA 1TQ4A 4QL3A 2W2KB 1TKRA 4AF6A 4MICA 4J1SA 4JKOA 5KPJA 4L9RA 3S2FA 3MBOA 2GAAA 3JWGA 3BWBA 2IPAB 3LA8A 2I6TA 2OG2A 3G2OA 3GLHB 4H16A 5IMSA 1IN1A 4RHYA 4A1FA 4AJLA 3GJ5A 3B60A 2AWOA 2EFYA 2MOKA 2E85A 2ZRBA 2QKYA 3FSGD 3AY0A 4B3DA 4F3RA 3KS9A 2KJQA 3QZUA 4N5LA 5DGIA 1RIFA 3AW8A 1K98A 1Q0RA 4HS9A 4X7MA 5GY7A 1QO0D 3B5JA 4MQUA 2JBAB 2HU5A 3NH9A 3ZD7A 1XU4A 3RRBA 4CI0B 1Z6PA 5ESRA 4P38A 2VBFA 2EWWA 2XOKA 2V58A 2FPSA 4EB8A 5BQXA 3OO1A 1I9GA 1Z7YA 2DU8A 2HD4A 3C1UA 3T7CA 3HUEA 1G60A 2B5VA 2R8EA 2XX3A 2RGWA 1G21E 1C0PA 1VKNA 1SNYA 3PRJA 1ZCJA 2X3YA 5JTTA 2QV7A 2W83A 3CRZA 2IYOA 2NP7A 5IM5A 3KTOA 1GL7A 2AHRA 1PKXA 4I4LA 5M2QA 3K6SB 3ESYA 1E62A 2E89A 2H51A 2KLHA 2R4QA 2YOFA 1H2XA 2ZR8A 3A2LA 1Q14A 2P9CA 3JR3A 4NZ9A 5D3QA 1Q16A 3MD9A 2AOUB 1QAQA 5ALYA 3ZK9A 2X0RA 1EG7A 4C7BA 4XH9B 3PFKA 1E79D 5IH3A 3A7DA 3BWXA 4EY8A 1XTIA 4QO8A 3UYKA 1QV6A 2D1SA 1C0IA 2YNMC 3JASA 4R2JA 4PFQA 1E69A 3ZDZB 3EOZA 3GRZA 3O8OA 1PT6A 1RBZA 2LCIA 2O8VA 3F46A 1N8KA 4UCWA 4YQZA 1H65A 3UG6A 2J59A 1FPQA 5C35A 2CL6X 1XQYA 1WCWA 4J1TA 4BYMA 2Y99A 4DV4B 3KM0A 3LX6A 4EY6A 1OZ0A 2Q3MA 4TLMB 4WK0B 4EHFA 3H9JA 5MDHA 3U4QA 4G67A 4QD3A 2WM3A 1ODJA 3GN1A 3M81A 5IX8A 1KI1A 2YBDA 1N5IA 2FI1A 3IBYA 5ARBA 1KQNA 5T8KC 4BLPA 4EA7A 5BW4A 4YAUA 4KMSA 5HRAA 3OZWA 3CLRC 1QBGA 1I94B 2YHAA 4NBVA 4Q7MB 2PWPA 3PD0A 3V33A 3CVYA 4PGHA 3V7NA 1IG3A 1SB9A 2AZ4A 1LBTA 3DE5X 2B9VA 4KOEC 3AUXA 4HVCA 3UJNA 5BXYA 4X62B 1WUTA 4ZOLA 1OTYA 4LOJA 1KQPA 2WAYA 2JFVA 1WV0A 4BZZA 4CHTA 2X77A 3RRZA 1V1RB 2GK4A 2JASA 4YDSA 4EP1A 1L8QA 5BQPA 1MW8X 4HQKA 2CMGA 3C6QA 1U90A 1R9NA 2IPMA 3LGXA 2ZIUB 4FFOA 2ZQ5A 1U9CA 5CM2Z 2ID8A 2QAIA 4D9BA 3RC3A 3F7NA 1H22A 4PG5A 3ASUA 1BWRA 5EJMA 1YIDA 2ZYUX 2D2XA 3Q7RA 3EGVA 5C7IO 2C7RA 3KBOA 4ZEWA 4TQGA 4X1OA 4G1CA 1TECE 1YZFA 2ILVA 3WBKA 3B3GA 5I48A 2CXTA 4NJMA 3CLUD 1YCFA 2QMEA 3I2HA 3MS4A 2ODNA 1UBFA 3D6TB 3BXPA 3P5BA 4TTPA 1B41A 4MDHA 4MR7A 1TVKA 2W6JD 4HMQA 4RL6A 1DIOB 1IZ7A 1V3UA 2XUFA 4JUIA 4GSYA 4Y0VA 1HQKA 3K1AA 4JIGA 1RMQA 4JOSA 3P27A 5KSPA 3S7ZA 2KW5A 3PEYA 1M6YA 3ECSA 2WFAA 2O07A 2QLLA 3M1LA 4XD7A 1F17A 5JXWA 2IIBA 4J7AA 5ALOA 2J3KA 5AJTA 1N9KA 4O59O 3HGTA 4FDUA 5DNWA 4AWXA 1ZW6A 1QCZA 3NUZA 4MQMA 4FS8A 2IE0A 1NF3A 1U3TA 4I8DA 5C7LO 2L19A 4CM3A 3TUZC 1GTRA 1T34A 3VSEA 2OHHA 2Q41A 2VEDA 1QCCA 3NYRA 1ZCZA 1U2DA 3SC6A 3PHBE 3R3WA 4KNVA 4FGZA 5DNYB 1MB3A 1VB5A 4F2PA 5A5FA 2J0EA 3BGDA 3E05A 3V32A 5JECA 2V9ZA 4NRDA 1UBGA 3U4QB 3H87A 2A0XA 1L5OA 1NG9A 1CF4A 1EK5A 4DJDC 1FF9A 1P5ZB 5DO9A 2OBBA 3GRVA 4R7GA 3S3TA 1JDBB 4F1WA 2V4UA 2G1UA 3QU4A 1YACA 3ZCSA 3OCUA 3PQ3A 1QTQA 2VNHA 2YQZA 2H2WA 2ZYGA 1JN0A 2OZVA 4QG3A 1TTPB 2O3UA 3GZTB 1TU4A 3RBAA 2ZBRA 1WO8A 2O1XA 2ZVJA 5CXSA 4ZOLB 4Z54A 4U2FA 2G7MC 5ESDA 4EI9A 2OHVA 3PT5A 1SUCA 4TSFA 4XEHA 2R7LA 4IIDA 2YVLA 5FOXA 3ZZ0A 1NRXA 1QHHB 4LVUA 1U8UA 1MPTA 1KE2A 4DCMA 5BR8B 5BV1A 5ED0A 1A71A 1FS4A 3BD6A 4FNMA 4JBYA 3DMPA 5CLQA 5AIBA 2ZB3A 2LVBA 5THXA 1JAZA 2NGRA 4FHFA 5FD8A 4M87A 4YDRA 4DLLA 3VR2D 2QD5A 3AJ9A 1WDLA 1ZBDA 1UBTS 1UPBA 3FGNA 2AZTA 3OC6A 3RUHA 4ERNA 1OLUA 2D74A 5FFNA 4OUDA 3SG0A 2YWHA 2VP0A 1Y98A 3GJTA 5DWDA 4EI7A 1CRZA 1TVKB 1XTQA 3ZW7A 1FJ2A 3AUTA 2Q9AA 2P2NA 1IQ0A 1E3JA 2JLSA 3LWNA 4I4TA 5EINA 3R7FA 4COOA 4LQLA 4NMMA 5F5NA 2ZM5A 2XNDA 5EKSA 5LYYA 3AKZA 2ZPTX 2PRJA 2FDCA 5JJKA 2P6NA 1YE5A 3ZS8A 4LZNA 3UA3A 1M74A 1QVVA 1EIWA 4ZXPA 3NKLA 3KL4A 2J3MA 3ANMA 2Z8XA 5AK6A 5FIUA 4ZC8A 2XRFA 2EGGA 3U37A 4CTOA 2W2MA 5M34A 5HJ7A 3GA7A 4WZAE 2HLDA 1W0JD 3WGIA 1GU1A 1V9LA 5JG7A 1SB8A 3H5OA 2P9JA 1R6TA 4OO3A 1M1YE 3PGVA 5KTKA 2XXAA 4R2XA 2X6QA 3P9XA 5KYUA 5EKXA 4AG6A 2VUHB 2I71A 2ODWA 3T5PA 4D0GA 1SKUA 2XCUA 3ILSA 4A16A 1BKYA 1GA1A 3HVIA 3I01A 1R6VA 3OJXA 1XD8A 3BKWA 4WGGA 1OIXA 5HKLA 2C5HA 4FOPA 1CZOA 3IILA 1EJ2A 1B4DA 1MHPA 1RPJA 2OBMA 2XODA 3FKSD 3VNAA 3D8UA 4IIBA 2MSNA 2RH4A 1GG5A 4E5YA 1JR4A 1EGMB 1JJAA 4JOCA 3JAKB 1ARZA 4G2TA 4WT7A 2DPGA 1LGYA 2PO7A 3RAFC 4M98A 4F21A 2X58A 4CKWB 1Z75A 5SZHB 1KC1A 4P9NA 1A9QA 3VYRB 3IIMA 4QM7A 3S2ZA 4DWWA 1QHNA 1D1SA 3DDCA 1U7WA 2WG0A 3ACCA 3E1SA 1W5BA 3FDZB 3H97A 3PSAA 3UH0A 3NONA 3T0FA 1R5NA 1WVMA 2EOAA 1ZA1A 2JH8A 3AVYA 1LRLA 1LSSA 2Y67A 1REQA 2VNSA 1DCFA 2G1KA 3OU6A 2ZJ2A 4OUDB 5TSDA 1G3UA 4DE5A 2EWMA 2ZI6A 4MIEA 1TQHA 2Q4RA 1GQSA 1AB5A 1X1RA 3FVRA 4OKNA 4OMCA 2JI9A 2GDJA 3A28A 3TRJA 1KQGA 3W9UA 4I4TB 4NECA 5CURA 3WLIA 3DR5A 4E94A 1OILA 3GT3A 2QOEA 4INZA 3EX7C 2IWHA 5K45A 1O6CA 4DV0B 2RHOA 1Y6QA 3CZRA 2JCYA 4FFMA 3GDGA 3CURA 4Q4AB 3TYXA 4QOIA 3FTCA 2YNMD 3RC8A 3M9XA 2IGBA 1SVLA 2XYQA 4DZZA 5IP5A 2ISQA 3ITDA 3N1UA 1C7IA 2FN7A 5LZ9A 2NV2B 2CWWA 2RGRA 2FPPA 2D7DA 2TMGA 4N8DA 2ACWA 2P6RA 2VTKA 4UEKA 3OEYA 2YICA 2AUNA 4UNQA 3MXTA 1UFRA 1CUBA 5JT1A 5J1TB 4JEIA 2C9DA 2FPIA 5FUBA 3PUXA 4FVTA 1I7LA 1U7UA