5HFLA

Gp41-targeting hiv-1 fusion inhibitors with helical ile-asp-leu tail
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
69
Chain Sequence
MASGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILGGWEEWDKKIEEYTKKIEELIKKSQNQQIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein,gp41 CHR region
publication title Rational improvement of gp41-targeting HIV-1 fusion inhibitors: an innovatively designed Ile-Asp-Leu tail with alternative conformations
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 30
structure length 69
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5hflA00
5KA6A 4FIPC 1Y66A 1QR8A 2EZPA 3K9AA 3MHSC 3M99B 1EBOA 5HFMA 1Y4MA 2M7WA 4JGSA 1MOFA 2MK3A 2P6JA 3B8NA 5CMUA 4E2LA 4FJCC 1DLBA 1MG1A 2LP7A 5H9CA 2EBOA 1SZTA 3WFVA 1QBZA 2EZOA 5CN0A 1I5XA 1K34A 3GWOA 3B8MA 3P30A 4FK5C 2X7RB 1JPXA 2OT5A 4JPRA 1I5YA 4N21A 1ENVA 3H01A 4N23A 3MHHC 4G2KA 3CP1A 5HFLA 1K33A 1JQ0A 5KA5A 1DF4A 4JF3A 1QR9A 1DF5A 1F23A 1QCEA 3B77A 3CYOA
chains in the Genus database with same CATH superfamily
2ZT9B 4Q6GA 3ZIAG 4DV4B 4FLZA 2YXLA 3CRQA 1AR5A 2FL4A 4RO2A 3AG3C 4U3JA 5JVDA 5EZYB 4UCRA 5GONB 3HKCA 2ITCC 1PP9H 3CC7V 4LF4O 1R6KA 4NR1A 4A5UB 3B77A 2JVDA 3RW0A 4GX1A 1VQPV 1RM1B 5DEDA 2F66C 1H38A 4JYAB 1NTKH 1VF6C 5KHKA 1AP6A 2DOSA 1EM1A 2YIBA 5BXZA 4DV6B 3IFXA 1BS3A 3CCVV 1Q3EA 5KX5A 4QPKA 4UFZA 2CGNA 2WA4A 1WNSA 5IYZB 5LMUO 5FPRA 4X62O 1OCRB 4RQEA 2Y69B 1K8AW 4DK0A 1N34O 3CHXA 1H2NA 2A79B 4WFFA 2UXNA 2KQXA 3G6BA 4CC6A 4TUYB 2YEVB 1MZFA 1S5JA 3PJSK 1XBLA 1SZXA 2QWPB 3FYEB 4DV4O 4GT1A 2HJFC 4FFBA 3CC4V 1EBOA 2EINC 3CWBH 5LL6Y 2FTKA 2QM7A 2EIMB 3UT5A 3A8TA 4ZOLB 4I0XB 2ZDIA 3WU2Z 4RAIA 3JD1A 4UB6Z 2W0XA 4NTYA 1VARA 2XNDG 4JZGA 1X59A 3AK3A 1DF5A 1XOUA 4MTFA 3LSUA 3KG2A 1JX9A 4PJ0Z 3SJCC 3B8NA 4K3AA 2CDYA 1D2DA 4R6ZA 4DR3B 2BSKB 4KXRA 1ZX3A 2VWJA 1N36B 3H1KH 3DXRA 4YJ3A 4GYCB 3B4SA 4MVQA 2BCCH 1TA8A 4JI0O 1S5LZ 4CC5A 4FMTA 5LXTA 1B06A 5LBQA 1XMQO 2UU9O 1R3LC 4CH3A 4FLYA 4DUYO 1R73A 2IU3A 2QWRB 1J5EO 3O9OA 4OPAA 2Q8VA 2XTAA 3B8MA 2GBOA 3E8BA 2DMXA 1HNXO 4YJ2A 1ROPA 1NQTA 1CP9A 2R9AA 4DV3B 1FXKA 2HG5C 3JATA 4GKJB 2EIJC 2P6JA 5B66Z 1SZTA 1HNZO 1N0NA 3CCMV 3STLC 4DV0B 3RYCB 4GKKO 1HW7A 2DYSB 1MA1A 2RJZA 3C3SA 1ORQC 2EIKC 2L35A 2QTSA 5K1PA 1QU7A 2VQFB 3P3PA 4LBEC 2GSMB 2LO1A 3K3WA 1NTZH 1OCOC 2FB5A 5IJ0A 1GKFA 4I4TA 3ZRXA 4LNUA 4I9QA 5H2FZ 5EYPA 3VQWA 4JTAB 2OTJV 4U7OA 3CCJV 3FD9A 1HNWO 1GAXA 1YSCA 2VQEO 2OWOA 3SYPA 4LF6B 1VQ4V 5CA0A 1N8RW 1NI8A 3W7WA 2ILMA 2JGDA 3RYIA 3RVZA 1D5AA 3ZMZA 4ZHQB 3I56V 2HHHO 3FB6C 1P7BA 4UV8A 1U96A 1RPRA 5LHGA 5JQGA 3OW2U 1R3IC 1IXBA 2YXYA 3WB1A 4YY3B 4U7NA 2DWEC 5EK0A 2Q0AA 1UJWB 3M7MX 3L70H 1I5YA 2RCVA 3RVYA 3LDDA 4DV3O 1FXHA 3TXQA 1RSOB 3CYOA 1JOYA 1LUWA 1W59A 1M9NA 1Y66A 3EFFK 2K1EA 4BR6A 1JR9A 1NH2B 1AR4A 3JALA 4DV0O 2UXBO 2YIBD 3DTUB 2Q7EA 1FYJA 2DW4A 3ASOC 2GHYA 5IWAB 3ABUA 4YIOA 2VQFO 5JJEB 3IGAC 3K57A 3A2FA 3CMEV 5CBHA 3AG1C 1KKDA 5J9PC 4O4LA 1IBKB 4H0LB 3F7VC 4JI7B 2D2CB 1FD9A 4B3SO 1BT8A 4DR2O 2DQ3A 3JSLA 4I5SA 4J9YB 3E8HA 3OEHG 5EBMC 4LF8O 3OGIB 3L72H 2ZXWB 2CH7A 3TXSA 2QR4A 4TV9B 1SQQH 4JZ2A 1L8DA 3JYCA 2V7QG 4HNAA 1WA8B 3T1YB 4QE7A 2W0FC 4PA6A 1FFTB 1TVKA 3K04A 4EFEA 5CA1A 4JI2B 1IXMA 4I50A 1TGOA 5KHJA 3HKCB 1H2KA 4TOIA 3K5MA 3JD3A 3B40A 5KUKA 5E79Z 2E5LO 2VS0A 1P84F 3ZHSA 3RGBA 4B3TO 4O2AB 3U11A 1P49A 4IIJA 4RWUA 4CH5A 1Q7YW 4E2LA 3W7UA 1XNRO 2BOCC 1GN6A 1WB8A 1NBMG 1YDXA 5LGTA 1XUQA 1AI6A 1KYOF 2BTOA 1PD3A 5LA6A 4JYBA 1FS0G 5KX5B 1DF4A 2OCCB 4C7UA 5CBGA 1QR8A 3AG2B 4DR4O 1I94B 2JEXA 1JA8A 5CN0A 1PL0A 3FKSG 1K73W 1BMFG 2P22C 5D5QA 4PD4F 3MD0A 4X20A 3RN4A 4MVMA 2LGWA 1H2MA 1W0JG 4FFBB 5JWPA 3LSQA 1IBMB 4X1IB 4B7EA 1VEWA 2JJ2G 4Z1VA 2UXDO 4B3RO 3APQA 3UT5B 5B3SC 4FJCC 3LNNA 1QBZA 2P4VA 4DR1B 1FFXB 4DV2O 2CGOA 4J9ZB 4P30A 4PDRA 2ZE6A 1VQ8V 3UKMA 2WAMA 1ZL8A 4WFGA 2D3OW 3X2QC 4WFHA 4NYKA 3FYIB 1R3JC 3DXRB 2IH3C 5LXTB 1K3EA 3P32A 1X4TA 3E83A 1VF6A 3CPWU 1JQ0A 4JAUA 3TGUH 3GVMA 1VP7A 2F23A 4LF5O 5L3FA 2NNUA 1XMOB 4QPJA 1S3JA 3SJBC 5IY5B 3ZN0A 4DUZO 5LHHA 4YJ2B 4AQYO 1HWYA 5TISZ 3ZMSA 4KL1A 1FXKB 4JI8B 5KA5A 4LCUC 2QTOA 3ABKC 5EC2C 2P5OA 4YHHB 4X66B 2QKCA 1GO3F 5KHIA 5IYDO 4DR1O 2QJ1A 3ZMTA 3K5LA 1Y67A 3ETDA 4F6EA 4YXWG 1ZWIC 3LSSA 2YICA 1KB9F 1LR1A 4R8CA 4GX2A 2JS5A 5H6QA 4I4TB 1F23A 3FFQA 5H9CA 2YUAA 4LNUB 5EYPB 2PY5A 5HFMA 2QWNB 3JARB 1XILA 1GM9A 1YJNV 1DGSA 5KLVH 2M6YA 3J81N 5CA0B 5KAIZ 2B1GA 4YIPA 3MDSA 5D5PA 5JJJB 2JGDB 4UCSA 3RYIB 3CCUV 2Y48A 4P9OA 1KBHA 1CPYA 2B5UA 1RM1C 2IBZH 3OMIB 3QF7A 5JQGB 3N2GA 1AILA 1R6NA 4O4IB 4PA7A 1XNQB 2WLIA 3AG4C 3WFVA 4B3MB 1AVMA 3LDEA 4O4JA 3ABTA 5A9GA 2VWKA 4QIWF 1I08A 3JASB 1JPXA 4PI0A 3F5WC 2BE3A 4J7JA 3H01A 4LFBB 1FXVA 1EFRG 1PNMA 1AI4A 4X66O 4OX9B 5ITZB 1OCRC 3QNEA 3M99B 4JGSA 1Q6HA 1L1FA 2QKSA 4DR6O 3H1LH 2PI4A 1K34A 4FM1A 2CTQA 4JI6O 4XDLA 2QSAA 4O4LB 1U97A 3CX5F 5BY1A 1VMGA 4PELA 4P2ZA 4FLXA 1T5EA 4DV5B 1MZEA 4FLTA 5CMUA 2F93B 3UO3A 3K0GA 1OV9A 4LFAB 1F4MA 2DN9A 1NKDA 2HKOA 4K8ZA 3DC6A 4GCZA 1IBLO 4HNAB 2Q5ZA 5IYCO 1WB7A 4MVOA 2ATKC 1VQKV 1ZSPA 4JTDB 1BSMA 1SA0A 1GRJA 2BOBC 1EZVH 2O57A 1EN4A 5CA1B 4I50B 3ZX6A 2NLJC 2ETNA 4JI1O 3JAKA 4KUMA 4LC1A 2RNBA 2PZSA 2GDSA 1BE3H 2AXTZ 4LFBO 2IJJA 4UCVA 2KSDA 3WB2A 5FPOA 1M1KW 4O2BA 5B1BB 2F4VB 4JV5O 4IIJB 2ZQMA 3D36C 4DRXA 1SETA 2DYRC 5KMGA 4TWKA 2RQ6A 2HJDA 5LGNA 4KP4A 3CXCU 2IW5A 4WFAV 4IGGA 3ZRSA 1PPJH 4NTXA 3BA8A 2PYLA 3KCYA 5LA6B 1SC5B 3ABLB 2N74A 1OCCC 4NXNO 4PA3A 2WLKA 1Q43A 1B3QA 3E8FA 2DJVA 3LDCA 4KHPB 4MS2A 1K7DA 1B6QA 2EBOA 4FZ1A 2OCHA 5H6RA 4HZ3A 1WP7A 3ZHTA 1EZJA 2JGUA 2ZNJA 4X1KB 1EN5A 2JEUA 2GUZA 2Q69A 1KP3A 3RYFB 1E79G 3G80A 3ZHQA 1FJGB 4LF9B 1QLEB 1N33B 3HR0A 1QQCA 1OCZC 4ZIBA 1US6A 4JYAO 2Q7GA 4E4EA 3DGEA 2Q73A 2XASA 1COWG 4DW0A 3HKBA 4X64B 4DR7B 2AZ2A 1ZL8B 4MVUA 1TUBA 2F4VO 4DV6O 2QGNA 1M57C 4PDLA 1BQZA 2X6AA 4JI3B 2EZPA 4DXWA 2H8PC 5IE9A 5C8YB 3BEHA 3O65A 2X6CA 2P06A 2Q67A 5CB4B 5J2UA 1CXZB 1IZ3A 4X9QA 5A2QN 3SDLA 3SYQA 2P7TC 3CJHA 5LP6C 1Y74A 2WLNA 3SR2C 5BMVA 4J10A 2W6IG 4JI5B 4IT5A 4HBNA 3C3TA 4K0KB 4J42A 5JH7A 4AILC 2ZM6B 1H8HG 4XDJA 3H1IH 4ASUG 4NB5A 4Z1MG 1O9HA 5JCOC 4J11A 2Z5UA 1FJGO 2AHZA 4UCTA 1MMMA 4FFKA 2UUCB 1G8MA 4WBNA 1Q90D 1LNQA 1P7GA 5KHHA 2E3CA 4Q20A 3K08A 3J80N 5BR8B 3EXAA 4DR3O 1N36O 2N04A 3OEEG 4CS3A 2ZINA 3E22A 4FK5C 1CEZA 2XAGA 1ENVA 1PV0A 3BRCA 3MHHC 1P4RA 2G38A 2UXXA 1LUVA 5LOVA 3TJTA 3W7SA 5EIBC 1NVPD 1VQ7V 3ABMB 1G6UA 5LYJA 3CRAA 4ZBMA 3SJQC 2P67A 2NR5A 2EZOA 2IH1C 3K9SA 1Q6UA 2CTWA 4FPPA 4NXMB 3L73H 4J7ZA 4JYCA 4GKJO 3G4SV 3ZCCA 4I7ZB 3MHSC 3Q4HA 1V54B 3BVOA 1YVWA 1DLBA 3I55V 1VF7A 3QG5A 1S0VA 3HKEB 4F6RA 1TAEA 4AI8A 3BCCH 1Y6XA 2UUCO 2OCCC 1JFFB 2ZIMA 5DN6G 2XUMA 2KG7A 2Q9LA 5L3EA 3AG2C 2C2AA 4LF7B 1BQ0A 1Z5WA 3M8AA 1BGYH 1HR0B 4I9WA 3H9VA 3D8CA 2AW9A 1PL4A 4I55A 3ZHRA 3ETGA 1AROP 3ZRVA 4D6TH 2CUGA 2EIJB 1PM9A 3BFRA 3D3IA 1AB3A 4LF6O 4WCEV 1BCCH 4WFEA 2CK3G 4QJFB 1KKCA 4L8JA 3THOA 2EULA 4TSFG 4JAVA 3STZC 3RYHA 1YTFD 1Q8IA 2ADQB 3HKDA 1XL6A 1YZBA 3WG7C 5KUMA 2YSUB 3UM7A 3JCZA 2JK5C 4YY3O 1Q81W 4U3JB 5JVDB 3SYAA 1GTOA 1NZ6A 3S3WA 3CCLV 1IVSA 5EZYA 5AG2A 4BW9A 1L0LH 1Z5VA 3KCXA 4FVMA 1VQ9V 2LGQA 3NXSA 3CCRV 1WPXA 2V1DA 1K97A 1V55C 3UO2A 3S3XA 5B1OA 3T1HB 2FKXA 1WPBA 2AHYA 1MG1A 4EKWA 2JJ1G 2XOKG 3OMAB 2Y4UA 1KU9A 5IWAO 4N21A 3H1HH 3SPHA 3U0ZA 1B04A 1IBKO 4CH4A 1Z2GA 5GTIZ 1QCEA 3JAWA 2HVJC 4JI7O 3ETEA 3LUTB 5FL7G 3CD6V 5BZBA 5IYZA 4OGQB 1WLEA 1NU1H 3CCSV 1FAFA 2ZE5A 4HAMA 1AI5A 4DYLA 3HPLC 2LFSA 2YI8A 4UUJC 1S77D 4NVPA 4EEQA 2UUBB 3ASOB 2N05A 4TUYA 2YEVA 3T1YO 2JRIA 5B1AC 5L3GA 3BY6A 1D5NA 2EILC 4JI2O 4QE9A 2A0LA 3J7AU 3E89A 1YEWA 5EBWC 2B1IA 4EB6A 1YCIA 1K5QA 4GLXA 1VF5B 2E76B 3SYCA 3NR7A 1QR9A 1KD1W 2R9RB 3BAAA 4FIPC 5JJNB 4WFBV 2UUAB 4FM0A 3HKBB 3ETQA 2X0LA 4YJ3B 4LFCB 2Z3YA 4BW5A 1Q6IA 4AHCA 2BSKA 4GZRB 4X65B 3ASNB 4GUNA 5GTHZ 4TV8A 1H2GA 4JI4B 1UPGA 2RN9A 4UXNA 3OTOB 1I94O 1AI7A 5J2UB 2M7WA 4LWSA 1K9MW 3D36A 1DTOA 4DK1A 2LP7A 1F4NA 4X89A 3CXHF 3P30A 4XDKA 2HFEC 3CJHB 1SQGA 2IM9A 5HFLA 4RQFA 3W7TA 3BHPA 1IBMO 2Y4TA 2YXHA 5JH7B 3JATB 4JAAA 1YI2V 3P3NA 4NKGB 4U3FH 3CS5A 3OFNG 1N0JA 3CCQV 1S76D 1R1BA 4DV1B 4J41A 5IT9N 1VQ5V 1GN4A 3JSNA 4K35A 2WLHA 1M5IA 3OAAG 2NN4A 5GW7A 4JF3A 2VRZA 5IJ0B 3ICXA 1IDSA 1XQ8A 1BL8A 1XHZA 4P9PA 3ZMUA 1M56B 4MW8A 3E22B 4DR5B 1SQXH 2ZCEA 5B3SB 1R3KC 1SESA 1XDCA 3GWOA 2X7RB 2OIGA 1H2SB 3MAQA 4UVCA 5DECA 3QTCA 5FNVA 4MVZA 2YS8A 4G2KA 3OR6C 2EJ7A 3G67A 4KFMA 4MT8A 4IYHA 3OUSA 3VBBA 1XMOO 5K1XA 4CS2A 3CRRA 1Q5OA 5LYJB 2PF4E 2QKAA 3X2QB 3D3QA 1Y76A 3K5OA 4JYYA 4B08A 1S5HC 1MSWD 1YHQV 2WLLA 5EC1C 3KZIZ 1KP2A 3PN1A 2Q6AA 2OIEA 1WAZA 3G71V 1FKAO 4JI8O 1YIJV 3ZHUA 3FB8C 4LF4B 3QO5A 3Q4HB 4YHHO 1RSOA 4FLWA 2Y69C 5LP6A 1O9GA 1J95A 2HP8A 3JALB 3HB3B 1VQMV 1URFA 3FX7A 3FB5C 4MVRA 2KG7B 4BIOA 5LHIA 2X6BA 3A0RA 5JCOA 3DC5A 2LW7A 3W7XA 4I55B 2W6JG 3B2EE 5E1AC 1HDJA 2WLMA 3C90A 3ABKB 4EFBA 2EIMC 3ZN1A 2IJKA 2R9IA 5LMUB 4X62B 2CH7B 4H37A 2Q68A 1N34B 1NT2B 1QLEC 3QO8A 4RUEA 4DW1A 2GV9A 2GTSA 1H8EG 2E74B 1RFYA 3HKDB 2YIDA 4F4LA 2JS3A 4RUFA 4MTGA 1K4CC 1WA8A 4ZI7A 2CTRA 1TVKB 1XNQO 4B3MO 2YDEA 3OR7C 3JAMN 3JD0A 4OXSA 1GK9A 1YXBA 3N27A 4OX9O 3CRMA 4O2AA 3SGIA 4H13B 4G28B 2A06H 4QGPA 1R6TA 5L3DA 3ZBHA 3QVNA 2CTPA 3OGCC 2EJRA 3TETA 3AG4B 3CB2A 1KMIZ 4JI0B 3GWKC 1VQ6V 3JAWB 1G4YB 2Y0PA 1XMQB 2UU9B 2E75B 1JCHA 3CE2A 4DV5O 4O4HA 4DUYB 4X1YA 2QE7G 4PA9A 3DSQA 3ZJZA 3KKYA 3N2KA 4JTCB 2PUSA 1Q86W 2Q7HA 3FAVA 1J5EB 1A32A 2DYSC 3L75H 4LFAO 1I5XA 2ZR3A 4X20B 3VQVA 2F95B 1W2BU 4HYOA 4PDVA 2MW2B 3SPJA 4UCOA 4D7TA 4JASA 1HNXB 2HVKC 4TQFA 1EN6A 2PYJA 1E1QG 3FB7C 2F43G 2H3OA 4XBFA 4LH7A 4X1IA 4BIUA 1G1XB 2XAFA 5J2TA 1YJ9V 2YIAA 1QNMA 1BZKA 3L71H 5IYBO 4EB6B 3F7YC 1HNZB 4UVBA 1FFXA 4GKKB 2ZD9A 3K79A 4PDMA 3AG3B 3E8GA 3CP1A 3R66A 3ABMC 4J80A 1JJOA 2KB1A 3ML0A 2LW1A 4J7KA 2ZE7A 2B9ZA 1HNWB 1MNGA 4G27B 1UFIA 2PTMA 4IHJA 4W4LA 2VQEB 4TV8B 3LNMB 1SERA 3E35A 2UXCB 4IYIA 3AK2A 2JIZG 5KAFZ 5KHGA 1QLNA 1NS1A 1ZUQA 1V54C 1GM8A 4LWSB 1Q82W 4WF9V 4KHPO 2DYRB 4H33A 2HHHB 2WPDG 1MOFA 2Q0OC 4H44B 4OPHA 1NR7A 4GX5A 1THZA 3ZHVA 4JPRA 3APOA 2H94A 1E1RG 4LF9O 4UB8Z 1N33O 2QDOA 1OCCB 1NTMH 2L6LA 1VIBA 4B7KA 1JMKC 1KECA 2IJIA 1NH2D 2ZXWC 1GMGA 1DK1A 4X64O 2IU0A 3OE7G 2EINB 5H5NA 4FLVA 4DR7O 2UXBB 1WN7A 1MSDA 1XL4A 2Y0IA 4JI3O 3TCUA 3I5DA 3WB0A 3ZS8C 1NR1A 1KQSU 4B3SB 3JD4A 4DR2B 4K8XA 3B09A 3ZRWA 3JARA 1OCZB 5FNVB 4UCUA 5IJ9A 4LF8B 2QM4A 2UXCO 1TUEB 4DO2A 2HLDG 2XAJA 1VQOV 1RP3B 4PA4A 4CZZA 1I7FA 1K33A 5CBFA 2ARHA 4JI5O 1WP8A 3N2GB 1IX9A 4PI2A 4K0KO 1M57B 4DV7B 2V4DA 2ZM6O 1Y76B 1SQBH 3H1JH 4IL6Z 2PI5A 2WLIB 1Y4MA 2QEXV 1AJPA 3CSXA 2WLLB 4O4JB 4O4IA 5EIBD 2IJHA 3RWRD 3UQ8A 1OZ0A 4CBCA 3JASA 3VOUA 4BAYA 2WSSG 3IJ4A 2E5LB 3T4DA 2A7WA 5F2VO 4B3TB 1SS3A 5LP6B 3IAYA 1YF2A 3A0HZ 3RBZA 5ITZA 5BR8O 1XNRB 3IC7A 4MW3A 1PNKA 2ZIOA 4X8AA 3K58A 1GM7A 4FZ0A 5KA6A 2EIKB 1M93A 2AZ0A 2BTQA 3QO7A 1I0HA 2ZDIC 1OCOB 2AGAA 1ZTEA 3AG7A 4DR4B 3CRCA 1NVPB 3IC9A 2QA4V 4FM2A 4MTXA 3T4ZA 2LFRA 5L3CA 3BA9A 1GN3A 5GONA 4NXMO 1RPOA 5B1NA 1SA0B 4DV7O 2DQ0A 4ZI7B 2R72A 3TK1A 3L74H 4B3RB 2UXDB 3SPGA 4CS4A 1MABG 3JAKB 4QNHB 3F5TA 2XHBA 2QWOB 3CMAV 3ASNC 2R70A 2DWDC 1GH6A 4BIZA 1YITV 4DV2B 4O2BB 2LJ2A 4N23A 1FPOA 4LF7O 4DRXB 3K0DA 1KUQA 5KMGB 4ABMA 1V9PA 1HR0O 3OTFA 5IY5C 2A3QA 1QHTA 2XAHA 4Z2WA 3SYOA 4LR3A 2OYQA 5EBLC 1FXKC 2A9HA 2ZKOA 1W0KG 5DM6V 4MTOA 3T1CA 3JCUZ 2RDCA 4O4HB 2EX3A 4X1YB 1YTFB 3VQXA 1OHHG 3AG1B 4LP8A 4LF5B 2ZNIA 2P4KA 3N2KB 1VQLV 3FAVB 2WLJA 1SKVA 3BABA 2GUZB 4BWAA 3OM3B 5B5EZ 3K03A 4DUZB 3SPIA 1IURA 4GX0A 4X1KA 1AR1B 4AQYB 2OTLV 4LH6A 4ZOLA 4I0XA 3RYFA 3E86A 1M56C 1XREA 2DE0X 3GB7C 3T1HO 5J2TB 4TT3G 5FLXN 3ZMVA 1SRYA 1AJNA 2XAQA 4CH6A 3WG7B 4L87A 4MVSA 2Q4PA 2F1MA 1N32B 3ZEDA 1AJQA 1TUBB 3SJAC 1N4CA 1SQVH 1GN2A 1BHBA 1VQNV 1HP8A 1V55B 4IHJB 5C8YA 2Z0AA 3U10A 5CB4A 2RMKB 1JVMA 2UUBO 5LMNB 1XHXA 1Y74B 1S72V 5BMVB 3OMNB 1AP5A 2ITDC 1XEQA 3EVKA 1H2LA 4R50A 3CCEV 3CEIA 3RT3C 2GTAA 3R65A 2QWQB 4WBNB 3RYCA 2JDIG 3AK1A 3G6EV 5C93A 2ZE8A 4MSWC 2UUAO 2HR3A 5B1AB 2MK3A 4PHZA 1N32O 1SF9A 3BPZA 4LFCO 3EHBB 2CAZC 5IDJA 5CA3A 2EILB 4DR6B 1ZAUA 4X65O 1M90W 2WA3A 2OT5A 3AEIA 1KC8W 2YI9A 4JI6B 3L9DA 4UV9A 4JI4O 4ZKIA 5L3BA 3K59A 1NJIW 5LOVB 3VQYA 2FMLA 4PV1B 3OTOO 2K9PA 4NTWA 3UCSC 3ZRWB 1F51A 3K5NA 4ZHQA 2P90A 5IJ9B 3K06A 4FLUA 2KKWA 2QM8A 5LMNO 4ICGA 5B1BC 2LQTA 3OT7A 1K92A 1WJZA 1QVFU 2CE4A 3A0BZ 1IBLB 1SQFA 2ZR2A 1BHAA 3JD2A 2ODMA 4DV1O 4F6RB 3ABLC 4JI1B 4D7SA 1L0NH 3T2MA 3HKEA 1K5SA 1YJWV 4UVAA 2WWWA 2FYUH 1JFFA 4TQDA 1F7YA 2HEPA 4JV5B 1ZLZA 4R7CA 1SQPH 3K9AA 3OUFA 2ADPA 4DR5O 1K4DC 2XT9A 1OJHA 4X88A 3SPCA 3RFRA 1PNLA 3CC2V 1JJ2U 3E2EA 2YC0A 1PKXA 4W4KA 3RYHB 4NXNB 4TV9A 2PGGA 1QVGU 3OD4A 1M4UA 2BTQB 1XI1A 5LGUA
chains in the Genus database with same CATH topology
1GM8A 1Q82W 1XL6A 5L3FA 3WG7C 3ZIAG 4WF9V 2NNUA 5KUMA 2YSUB 2DYRB 4H33A 4QPJA 2WPDG 3UM7A 1MOFA 3JCZA 1S3JA 2JK5C 5IY5B 4RO2A 1Q81W 3SYAA 3ZN0A 1GTOA 1NR7A 3AG3C 4GX5A 5LHHA 1THZA 3CCLV 4JPRA 2ITCC 1HWYA 2H94A 1E1RG 3CC7V 3ZMSA 1R6KA 1FXKB 1VQ9V 3NXSA 5KA5A 3CCRV 1WPXA 1OCCB 1K97A 1V55C 2V1DA 4LCUC 2QTOA 3ABKC 3B77A 5EC2C 3RW0A 4GX1A 1VQPV 1RM1B 1KECA 5B1OA 2IJIA 1NH2D 1GO3F 2AHYA 5IYDO 2ZXWC 1H38A 1MG1A 4EKWA 2JJ1G 1GMGA 2XOKG 3OMAB 3ZMTA 2IU0A 3OE7G 2EINB 3ETDA 4YXWG 1ZWIC 3LSSA 4N21A 1XL4A 3SPHA 3IFXA 4R8CA 4GX2A 5H6QA 1F23A 1QCEA 5H9CA 3TCUA 2HVJC 3ETEA 3CCVV 1NR1A 3LUTB 4QPKA 5FL7G 1KQSU 5HFMA 3CD6V 5BZBA 3JD4A 1GM9A 1OCRB 1YJNV 3ZRWA 2Y69B 4RQEA 1K8AW 1WLEA 1OCZB 3CCSV 4HAMA 1AI5A 2A79B 2B1GA 4WFFA 1TUEB 3HPLC 2LFSA 2HLDG 4DO2A 2UXNA 2XAJA 1VQOV 4PA4A 3CCUV 4UUJC 1S77D 2Y48A 4P9OA 4CZZA 2YEVB 1CPYA 3ASOB 3PJSK 1K33A 2B5UA 5CBFA 1RM1C 2YEVA 3FYEB 4GT1A 1M57B 2HJFC 3OMIB 5B1AC 5L3GA 3BY6A 1R6NA 3CC4V 1EBOA 2PI5A 2WLIB 1Y4MA 2QEXV 1AJPA 4PA7A 2EINC 2EILC 2WLLB 4QE9A 2WLIA 2FTKA 2IJHA 2QM7A 2EIMB 3AG4C 3WFVA 2A0LA 3LDEA 3E89A 3ABTA 4QIWF 5EBWC 2B1IA 1JPXA 2ZDIA 1OZ0A 3F5WC 4RAIA 3JD1A 4CBCA 3H01A 3VOUA 4BAYA 2WSSG 1FXVA 2XNDG 1K5QA 1EFRG 3T4DA 3SYCA 1PNMA 1QR9A 1DF5A 1AI4A 2R9RB 1KD1W 4FIPC 4MTFA 1OCRC 3KG2A 1JX9A 3QNEA 3M99B 3RBZA 4JGSA 4WFBV 3B8NA 1L1FA 2QKSA 4R6ZA 3IC7A 2X0LA 4MW3A 2PI4A 2Z3YA 4BW5A 1PNKA 1K34A 4MVQA 4X8AA 4FMTA 4XDLA 3ASNB 5LBQA 1H2GA 1GM7A 1R3LC 4UXNA 5KA6A 2EIKB 4PELA 4P2ZA 1AI7A 3QO7A 1R73A 2M7WA 2ZDIC 1OCOB 1K9MW 3D36A 2IU3A 5CMUA 1DTOA 3K0GA 2LP7A 1NVPB 2QA4V 1F4NA 4MTXA 3T4ZA 2LFRA 4X89A 3B8MA 3P30A 4XDKA 2HFEC 1F4MA 5L3CA 1NKDA 2HKOA 3E8BA 4GCZA 5IYCO 5HFLA 1ROPA 4RQFA 1NQTA 1RPOA 3W7TA 4MVOA 5B1NA 2ATKC 1VQKV 1CP9A 2DQ0A 4JTDB 3TK1A 1FXKA 1YI2V 2BOBC 2HG5C 2EIJC 3SPGA 3OFNG 2NLJC 1MABG 4QNHB 2P6JA 3CCQV 1S76D 4KUMA 1SZTA 3CMAV 3ASNC 4LC1A 3CCMV 3STLC 2DWDC 4BIZA 1YITV 1VQ5V 2IJJA 2DYSB 2WLHA 4N23A 1M1KW 3OAAG 1ORQC 2EIKC 5B1BB 3K0DA 4LBEC 2ZQMA 2GSMB 4JF3A 5GW7A 3K3WA 1SETA 2DYRC 1OCOC 1BL8A 4P9PA 4TWKA 1GKFA 5IY5C 3ZMUA 3ZRXA 5LGNA 4KP4A 3CXCU 1M56B 2IW5A 4WFAV 3ZRSA 4JTAB 4MW8A 2OTJV 2XAHA 3SYOA 4U7OA 3CCJV 5B3SB 1YSCA 1R3KC 1SESA 3SYPA 3GWOA 1VQ4V 2X7RB 5EBLC 3ABLB 1FXKC 2A9HA 4UVCA 4MVZA 1W0KG 5DM6V 1OCCC 1N8RW 4MTOA 4PA3A 3W7WA 4G2KA 2WLKA 3OR6C 3T1CA 3RVZA 3E8FA 4KFMA 4MT8A 3OUSA 3VBBA 3ZMZA 3I56V 3FB6C 1P7BA 1YTFB 1OHHG 3AG1B 4LP8A 4UV8A 1VQLV 3LDCA 3X2QB 1RPRA 5LHGA 3OW2U 4MS2A 1K7DA 2WLJA 1R3IC 1B6QA 1S5HC 2EBOA 5H6RA 1MSWD 4U7NA 2DWEC 1YHQV 5EK0A 2WLLA 5EC1C 4HZ3A 1EZJA 3OM3B 3K03A 2JEUA 1UJWB 3SPIA 2Q69A 1KP3A 4GX0A 1E79G 1I5YA 1KP2A 1AR1B 2Q6AA 3G71V 2OTLV 3RVYA 1YIJV 3LDDA 1QLEB 3FB8C 3E86A 1FXHA 3QO5A 1M56C 3CYOA 1JOYA 3GB7C 1M9NA 1Y66A 3EFFK 4TT3G 2Y69C 3ZMVA 1OCZC 2K1EA 1J95A 1SRYA 1AJNA 2XAQA 3HB3B 3WG7B 4L87A 4MVSA 3DGEA 1NH2B 1VQMV 2XASA 1AJQA 3DTUB 1COWG 3FB5C 2DW4A 4MVRA 3ASOC 2GHYA 4MVUA 3ABUA 5LHIA 3IGAC 2X6BA 3A0RA 3CMEV 1M57C 5CBHA 3AG1C 1KKDA 5J9PC 3W7XA 4PDLA 1BHBA 2W6JG 1VQNV 5E1AC 2X6AA 3F7VC 2WLMA 2EZPA 1V55B 4DXWA 2H8PC 3ABKB 2EIMC 3BEHA 3ZN1A 2X6CA 2DQ3A 4I5SA 2IJKA 2R9IA 3E8HA 2Q67A 3OEHG 4J9YB 5EBMC 4H37A 2Q68A 2ZXWB 1QLEC 3QO8A 4RUEA 1JVMA 3SYQA 1H8EG 1S72V 2P7TC 3JYCA 3OMNB 2WLNA 2ITDC 2V7QG 4F4LA 4RUFA 2W6IG 4MTGA 4QE7A 1K4CC 2W0FC 4PA6A 4R50A 3CCEV 1FFTB 1H8HG 3K04A 4XDJA 3OR7C 1IXMA 4ASUG 4Z1MG 3R65A 3JD0A 4OXSA 2Z5UA 3JD3A 1GK9A 5KUKA 2AHZA 2JDIG 3G6EV 1G8MA 5C93A 1LNQA 4G28B 4Q20A 4MSWC 3K08A 2HR3A 1Q7YW 5B1AB 2MK3A 4E2LA 3W7UA 2BOCC 5L3DA 3EHBB 5IDJA 5CA3A 1NBMG 2EILB 3OEEG 5LGTA 3OGCC 2EJRA 3TETA 4FK5C 1CEZA 3AG4B 1M90W 1AI6A 2XAGA 2OT5A 3AEIA 1KC8W 1ENVA 1PD3A 1VQ6V 4UV9A 3MHHC 4ZKIA 4JYBA 1G4YB 1P4RA 5L3BA 1FS0G 1DF4A 2OCCB 1NJIW 5CBGA 2UXXA 1JCHA 1QR8A 3AG2B 3W7SA 3ZRWB 1F51A 1NVPD 2JEXA 2QE7G 1VQ7V 2P90A 3ABMB 4PA9A 3ZJZA 3K06A 4ZBMA 3SJQC 2P67A 4JTCB 1Q86W 2EZOA 2DYSC 5CN0A 1I5XA 1PL0A 2QM8A 2ZR3A 3FKSG 1K73W 1W2BU 4HYOA 1BMFG 2IH1C 4PDVA 5B1BC 3MD0A 1K92A 3SPJA 1QVFU 4MVMA 4JASA 1W0JG 2HVKC 4FPPA 3LSQA 1E1QG 4JYCA 3FB7C 2ZR2A 3G4SV 2F43G 2JJ2G 3ZCCA 4XBFA 3MHSC 1BHAA 4BIUA 1V54B 2XAFA 3JD2A 5B3SC 1YJ9V 4FJCC 1DLBA 3I55V 1S0VA 3ABLC 5IYBO 1QBZA 3F7YC 4UVBA 4J9ZB 3T2MA 1K5SA 2OCCC 4P30A 5DN6G 2ZD9A 1YJWV 4PDRA 1VQ8V 3K79A 4PDMA 3UKMA 2WAMA 2WWWA 3AG3B 4UVAA 3E8GA 4WFGA 3CP1A 5L3EA 3AG2C 2C2AA 2D3OW 4R7CA 3ABMC 3X2QC 4I9WA 3K9AA 4WFHA 2KB1A 3ML0A 3ETGA 3OUFA 1AROP 3ZRVA 3FYIB 1R3JC 2EIJB 1K4DC 3D3IA 4WCEV 4X88A 4G27B 2IH3C 3SPCA 4WFEA 1K3EA 3LNMB 1PNLA 3P32A 2CK3G 3CC2V 1JJ2U 4QJFB 1SERA 3E2EA 3E35A 3E83A 1PKXA 4TSFG 2JIZG 3CPWU 4JAVA 1JQ0A 3STZC 1QVGU 4JAUA 1QLNA 1V54C 1YTFD 5LGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KA6 A;  4FIP C;  1Y66 A;  1QR8 A;  2EZP A;  3K9A A;  3MHS C;  3M99 B;  1EBO A;  5HFM A;  1Y4M A;  2M7W A;  4JGS A;  1MOF A;  2MK3 A;  2P6J A;  3B8N A;  5CMU A;  4E2L A;  4FJC C;  1DLB A;  1MG1 A;  2LP7 A;  5H9C A;  2EBO A;  1SZT A;  3WFV A;  1QBZ A;  2EZO A;  5CN0 A;  1I5X A;  1K34 A;  3GWO A;  3B8M A;  3P30 A;  4FK5 C;  2X7R B;  1JPX A;  2OT5 A;  4JPR A;  1I5Y A;  4N21 A;  1ENV A;  3H01 A;  4N23 A;  3MHH C;  4G2K A;  3CP1 A;  5HFL A;  1K33 A;  1JQ0 A;  5KA5 A;  1DF4 A;  4JF3 A;  1QR9 A;  1DF5 A;  1F23 A;  1QCE A;  3B77 A;  3CYO A; 
#chains in the Genus database with same CATH topology
 2ZT9 B;  4Q6G A;  3ZIA G;  4DV4 B;  4FLZ A;  2YXL A;  3CRQ A;  1AR5 A;  2FL4 A;  4RO2 A;  3AG3 C;  4U3J A;  5JVD A;  5EZY B;  4UCR A;  5GON B;  3HKC A;  2ITC C;  1PP9 H;  3CC7 V;  4LF4 O;  1R6K A;  4NR1 A;  4A5U B;  3B77 A;  2JVD A;  3RW0 A;  4GX1 A;  1VQP V;  1RM1 B;  5DED A;  2F66 C;  1H38 A;  4JYA B;  1NTK H;  1VF6 C;  5KHK A;  1AP6 A;  2DOS A;  1EM1 A;  2YIB A;  5BXZ A;  4DV6 B;  3IFX A;  1BS3 A;  3CCV V;  1Q3E A;  5KX5 A;  4QPK A;  4UFZ A;  2CGN A;  2WA4 A;  1WNS A;  5IYZ B;  5LMU O;  5FPR A;  4X62 O;  1OCR B;  4RQE A;  2Y69 B;  1K8A W;  4DK0 A;  1N34 O;  3CHX A;  1H2N A;  2A79 B;  4WFF A;  2UXN A;  2KQX A;  3G6B A;  4CC6 A;  4TUY B;  2YEV B;  1MZF A;  1S5J A;  3PJS K;  1XBL A;  1SZX A;  2QWP B;  3FYE B;  4DV4 O;  4GT1 A;  2HJF C;  4FFB A;  3CC4 V;  1EBO A;  2EIN C;  3CWB H;  5LL6 Y;  2FTK A;  2QM7 A;  2EIM B;  3UT5 A;  3A8T A;  4ZOL B;  4I0X B;  2ZDI A;  3WU2 Z;  4RAI A;  3JD1 A;  4UB6 Z;  2W0X A;  4NTY A;  1VAR A;  2XND G;  4JZG A;  1X59 A;  3AK3 A;  1DF5 A;  1XOU A;  4MTF A;  3LSU A;  3KG2 A;  1JX9 A;  4PJ0 Z;  3SJC C;  3B8N A;  4K3A A;  2CDY A;  1D2D A;  4R6Z A;  4DR3 B;  2BSK B;  4KXR A;  1ZX3 A;  2VWJ A;  1N36 B;  3H1K H;  3DXR A;  4YJ3 A;  4GYC B;  3B4S A;  4MVQ A;  2BCC H;  1TA8 A;  4JI0 O;  1S5L Z;  4CC5 A;  4FMT A;  5LXT A;  1B06 A;  5LBQ A;  1XMQ O;  2UU9 O;  1R3L C;  4CH3 A;  4FLY A;  4DUY O;  1R73 A;  2IU3 A;  2QWR B;  1J5E O;  3O9O A;  4OPA A;  2Q8V A;  2XTA A;  3B8M A;  2GBO A;  3E8B A;  2DMX A;  1HNX O;  4YJ2 A;  1ROP A;  1NQT A;  1CP9 A;  2R9A A;  4DV3 B;  1FXK A;  2HG5 C;  3JAT A;  4GKJ B;  2EIJ C;  2P6J A;  5B66 Z;  1SZT A;  1HNZ O;  1N0N A;  3CCM V;  3STL C;  4DV0 B;  3RYC B;  4GKK O;  1HW7 A;  2DYS B;  1MA1 A;  2RJZ A;  3C3S A;  1ORQ C;  2EIK C;  2L35 A;  2QTS A;  5K1P A;  1QU7 A;  2VQF B;  3P3P A;  4LBE C;  2GSM B;  2LO1 A;  3K3W A;  1NTZ H;  1OCO C;  2FB5 A;  5IJ0 A;  1GKF A;  4I4T A;  3ZRX A;  4LNU A;  4I9Q A;  5H2F Z;  5EYP A;  3VQW A;  4JTA B;  2OTJ V;  4U7O A;  3CCJ V;  3FD9 A;  1HNW O;  1GAX A;  1YSC A;  2VQE O;  2OWO A;  3SYP A;  4LF6 B;  1VQ4 V;  5CA0 A;  1N8R W;  1NI8 A;  3W7W A;  2ILM A;  2JGD A;  3RYI A;  3RVZ A;  1D5A A;  3ZMZ A;  4ZHQ B;  3I56 V;  2HHH O;  3FB6 C;  1P7B A;  4UV8 A;  1U96 A;  1RPR A;  5LHG A;  5JQG A;  3OW2 U;  1R3I C;  1IXB A;  2YXY A;  3WB1 A;  4YY3 B;  4U7N A;  2DWE C;  5EK0 A;  2Q0A A;  1UJW B;  3M7M X;  3L70 H;  1I5Y A;  2RCV A;  3RVY A;  3LDD A;  4DV3 O;  1FXH A;  3TXQ A;  1RSO B;  3CYO A;  1JOY A;  1LUW A;  1W59 A;  1M9N A;  1Y66 A;  3EFF K;  2K1E A;  4BR6 A;  1JR9 A;  1NH2 B;  1AR4 A;  3JAL A;  4DV0 O;  2UXB O;  2YIB D;  3DTU B;  2Q7E A;  1FYJ A;  2DW4 A;  3ASO C;  2GHY A;  5IWA B;  3ABU A;  4YIO A;  2VQF O;  5JJE B;  3IGA C;  3K57 A;  3A2F A;  3CME V;  5CBH A;  3AG1 C;  1KKD A;  5J9P C;  4O4L A;  1IBK B;  4H0L B;  3F7V C;  4JI7 B;  2D2C B;  1FD9 A;  4B3S O;  1BT8 A;  4DR2 O;  2DQ3 A;  3JSL A;  4I5S A;  4J9Y B;  3E8H A;  3OEH G;  5EBM C;  4LF8 O;  3OGI B;  3L72 H;  2ZXW B;  2CH7 A;  3TXS A;  2QR4 A;  4TV9 B;  1SQQ H;  4JZ2 A;  1L8D A;  3JYC A;  2V7Q G;  4HNA A;  1WA8 B;  3T1Y B;  4QE7 A;  2W0F C;  4PA6 A;  1FFT B;  1TVK A;  3K04 A;  4EFE A;  5CA1 A;  4JI2 B;  1IXM A;  4I50 A;  1TGO A;  5KHJ A;  3HKC B;  1H2K A;  4TOI A;  3K5M A;  3JD3 A;  3B40 A;  5KUK A;  5E79 Z;  2E5L O;  2VS0 A;  1P84 F;  3ZHS A;  3RGB A;  4B3T O;  4O2A B;  3U11 A;  1P49 A;  4IIJ A;  4RWU A;  4CH5 A;  1Q7Y W;  4E2L A;  3W7U A;  1XNR O;  2BOC C;  1GN6 A;  1WB8 A;  1NBM G;  1YDX A;  5LGT A;  1XUQ A;  1AI6 A;  1KYO F;  2BTO A;  1PD3 A;  5LA6 A;  4JYB A;  1FS0 G;  5KX5 B;  1DF4 A;  2OCC B;  4C7U A;  5CBG A;  1QR8 A;  3AG2 B;  4DR4 O;  1I94 B;  2JEX A;  1JA8 A;  5CN0 A;  1PL0 A;  3FKS G;  1K73 W;  1BMF G;  2P22 C;  5D5Q A;  4PD4 F;  3MD0 A;  4X20 A;  3RN4 A;  4MVM A;  2LGW A;  1H2M A;  1W0J G;  4FFB B;  5JWP A;  3LSQ A;  1IBM B;  4X1I B;  4B7E A;  1VEW A;  2JJ2 G;  4Z1V A;  2UXD O;  4B3R O;  3APQ A;  3UT5 B;  5B3S C;  4FJC C;  3LNN A;  1QBZ A;  2P4V A;  4DR1 B;  1FFX B;  4DV2 O;  2CGO A;  4J9Z B;  4P30 A;  4PDR A;  2ZE6 A;  1VQ8 V;  3UKM A;  2WAM A;  1ZL8 A;  4WFG A;  2D3O W;  3X2Q C;  4WFH A;  4NYK A;  3FYI B;  1R3J C;  3DXR B;  2IH3 C;  5LXT B;  1K3E A;  3P32 A;  1X4T A;  3E83 A;  1VF6 A;  3CPW U;  1JQ0 A;  4JAU A;  3TGU H;  3GVM A;  1VP7 A;  2F23 A;  4LF5 O;  5L3F A;  2NNU A;  1XMO B;  4QPJ A;  1S3J A;  3SJB C;  5IY5 B;  3ZN0 A;  4DUZ O;  5LHH A;  4YJ2 B;  4AQY O;  1HWY A;  5TIS Z;  3ZMS A;  4KL1 A;  1FXK B;  4JI8 B;  5KA5 A;  4LCU C;  2QTO A;  3ABK C;  5EC2 C;  2P5O A;  4YHH B;  4X66 B;  2QKC A;  1GO3 F;  5KHI A;  5IYD O;  4DR1 O;  2QJ1 A;  3ZMT A;  3K5L A;  1Y67 A;  3ETD A;  4F6E A;  4YXW G;  1ZWI C;  3LSS A;  2YIC A;  1KB9 F;  1LR1 A;  4R8C A;  4GX2 A;  2JS5 A;  5H6Q A;  4I4T B;  1F23 A;  3FFQ A;  5H9C A;  2YUA A;  4LNU B;  5EYP B;  2PY5 A;  5HFM A;  2QWN B;  3JAR B;  1XIL A;  1GM9 A;  1YJN V;  1DGS A;  5KLV H;  2M6Y A;  3J81 N;  5CA0 B;  5KAI Z;  2B1G A;  4YIP A;  3MDS A;  5D5P A;  5JJJ B;  2JGD B;  4UCS A;  3RYI B;  3CCU V;  2Y48 A;  4P9O A;  1KBH A;  1CPY A;  2B5U A;  1RM1 C;  2IBZ H;  3OMI B;  3QF7 A;  5JQG B;  3N2G A;  1AIL A;  1R6N A;  4O4I B;  4PA7 A;  1XNQ B;  2WLI A;  3AG4 C;  3WFV A;  4B3M B;  1AVM A;  3LDE A;  4O4J A;  3ABT A;  5A9G A;  2VWK A;  4QIW F;  1I08 A;  3JAS B;  1JPX A;  4PI0 A;  3F5W C;  2BE3 A;  4J7J A;  3H01 A;  4LFB B;  1FXV A;  1EFR G;  1PNM A;  1AI4 A;  4X66 O;  4OX9 B;  5ITZ B;  1OCR C;  3QNE A;  3M99 B;  4JGS A;  1Q6H A;  1L1F A;  2QKS A;  4DR6 O;  3H1L H;  2PI4 A;  1K34 A;  4FM1 A;  2CTQ A;  4JI6 O;  4XDL A;  2QSA A;  4O4L B;  1U97 A;  3CX5 F;  5BY1 A;  1VMG A;  4PEL A;  4P2Z A;  4FLX A;  1T5E A;  4DV5 B;  1MZE A;  4FLT A;  5CMU A;  2F93 B;  3UO3 A;  3K0G A;  1OV9 A;  4LFA B;  1F4M A;  2DN9 A;  1NKD A;  2HKO A;  4K8Z A;  3DC6 A;  4GCZ A;  1IBL O;  4HNA B;  2Q5Z A;  5IYC O;  1WB7 A;  4MVO A;  2ATK C;  1VQK V;  1ZSP A;  4JTD B;  1BSM A;  1SA0 A;  1GRJ A;  2BOB C;  1EZV H;  2O57 A;  1EN4 A;  5CA1 B;  4I50 B;  3ZX6 A;  2NLJ C;  2ETN A;  4JI1 O;  3JAK A;  4KUM A;  4LC1 A;  2RNB A;  2PZS A;  2GDS A;  1BE3 H;  2AXT Z;  4LFB O;  2IJJ A;  4UCV A;  2KSD A;  3WB2 A;  5FPO A;  1M1K W;  4O2B A;  5B1B B;  2F4V B;  4JV5 O;  4IIJ B;  2ZQM A;  3D36 C;  4DRX A;  1SET A;  2DYR C;  5KMG A;  4TWK A;  2RQ6 A;  2HJD A;  5LGN A;  4KP4 A;  3CXC U;  2IW5 A;  4WFA V;  4IGG A;  3ZRS A;  1PPJ H;  4NTX A;  3BA8 A;  2PYL A;  3KCY A;  5LA6 B;  1SC5 B;  3ABL B;  2N74 A;  1OCC C;  4NXN O;  4PA3 A;  2WLK A;  1Q43 A;  1B3Q A;  3E8F A;  2DJV A;  3LDC A;  4KHP B;  4MS2 A;  1K7D A;  1B6Q A;  2EBO A;  4FZ1 A;  2OCH A;  5H6R A;  4HZ3 A;  1WP7 A;  3ZHT A;  1EZJ A;  2JGU A;  2ZNJ A;  4X1K B;  1EN5 A;  2JEU A;  2GUZ A;  2Q69 A;  1KP3 A;  3RYF B;  1E79 G;  3G80 A;  3ZHQ A;  1FJG B;  4LF9 B;  1QLE B;  1N33 B;  3HR0 A;  1QQC A;  1OCZ C;  4ZIB A;  1US6 A;  4JYA O;  2Q7G A;  4E4E A;  3DGE A;  2Q73 A;  2XAS A;  1COW G;  4DW0 A;  3HKB A;  4X64 B;  4DR7 B;  2AZ2 A;  1ZL8 B;  4MVU A;  1TUB A;  2F4V O;  4DV6 O;  2QGN A;  1M57 C;  4PDL A;  1BQZ A;  2X6A A;  4JI3 B;  2EZP A;  4DXW A;  2H8P C;  5IE9 A;  5C8Y B;  3BEH A;  3O65 A;  2X6C A;  2P06 A;  2Q67 A;  5CB4 B;  5J2U A;  1CXZ B;  1IZ3 A;  4X9Q A;  5A2Q N;  3SDL A;  3SYQ A;  2P7T C;  3CJH A;  5LP6 C;  1Y74 A;  2WLN A;  3SR2 C;  5BMV A;  4J10 A;  2W6I G;  4JI5 B;  4IT5 A;  4HBN A;  3C3T A;  4K0K B;  4J42 A;  5JH7 A;  4AIL C;  2ZM6 B;  1H8H G;  4XDJ A;  3H1I H;  4ASU G;  4NB5 A;  4Z1M G;  1O9H A;  5JCO C;  4J11 A;  2Z5U A;  1FJG O;  2AHZ A;  4UCT A;  1MMM A;  4FFK A;  2UUC B;  1G8M A;  4WBN A;  1Q90 D;  1LNQ A;  1P7G A;  5KHH A;  2E3C A;  4Q20 A;  3K08 A;  3J80 N;  5BR8 B;  3EXA A;  4DR3 O;  1N36 O;  2N04 A;  3OEE G;  4CS3 A;  2ZIN A;  3E22 A;  4FK5 C;  1CEZ A;  2XAG A;  1ENV A;  1PV0 A;  3BRC A;  3MHH C;  1P4R A;  2G38 A;  2UXX A;  1LUV A;  5LOV A;  3TJT A;  3W7S A;  5EIB C;  1NVP D;  1VQ7 V;  3ABM B;  1G6U A;  5LYJ A;  3CRA A;  4ZBM A;  3SJQ C;  2P67 A;  2NR5 A;  2EZO A;  2IH1 C;  3K9S A;  1Q6U A;  2CTW A;  4FPP A;  4NXM B;  3L73 H;  4J7Z A;  4JYC A;  4GKJ O;  3G4S V;  3ZCC A;  4I7Z B;  3MHS C;  3Q4H A;  1V54 B;  3BVO A;  1YVW A;  1DLB A;  3I55 V;  1VF7 A;  3QG5 A;  1S0V A;  3HKE B;  4F6R A;  1TAE A;  4AI8 A;  3BCC H;  1Y6X A;  2UUC O;  2OCC C;  1JFF B;  2ZIM A;  5DN6 G;  2XUM A;  2KG7 A;  2Q9L A;  5L3E A;  3AG2 C;  2C2A A;  4LF7 B;  1BQ0 A;  1Z5W A;  3M8A A;  1BGY H;  1HR0 B;  4I9W A;  3H9V A;  3D8C A;  2AW9 A;  1PL4 A;  4I55 A;  3ZHR A;  3ETG A;  1ARO P;  3ZRV A;  4D6T H;  2CUG A;  2EIJ B;  1PM9 A;  3BFR A;  3D3I A;  1AB3 A;  4LF6 O;  4WCE V;  1BCC H;  4WFE A;  2CK3 G;  4QJF B;  1KKC A;  4L8J A;  3THO A;  2EUL A;  4TSF G;  4JAV A;  3STZ C;  3RYH A;  1YTF D;  1Q8I A;  2ADQ B;  3HKD A;  1XL6 A;  1YZB A;  3WG7 C;  5KUM A;  2YSU B;  3UM7 A;  3JCZ A;  2JK5 C;  4YY3 O;  1Q81 W;  4U3J B;  5JVD B;  3SYA A;  1GTO A;  1NZ6 A;  3S3W A;  3CCL V;  1IVS A;  5EZY A;  5AG2 A;  4BW9 A;  1L0L H;  1Z5V A;  3KCX A;  4FVM A;  1VQ9 V;  2LGQ A;  3NXS A;  3CCR V;  1WPX A;  2V1D A;  1K97 A;  1V55 C;  3UO2 A;  3S3X A;  5B1O A;  3T1H B;  2FKX A;  1WPB A;  2AHY A;  1MG1 A;  4EKW A;  2JJ1 G;  2XOK G;  3OMA B;  2Y4U A;  1KU9 A;  5IWA O;  4N21 A;  3H1H H;  3SPH A;  3U0Z A;  1B04 A;  1IBK O;  4CH4 A;  1Z2G A;  5GTI Z;  1QCE A;  3JAW A;  2HVJ C;  4JI7 O;  3ETE A;  3LUT B;  5FL7 G;  3CD6 V;  5BZB A;  5IYZ A;  4OGQ B;  1WLE A;  1NU1 H;  3CCS V;  1FAF A;  2ZE5 A;  4HAM A;  1AI5 A;  4DYL A;  3HPL C;  2LFS A;  2YI8 A;  4UUJ C;  1S77 D;  4NVP A;  4EEQ A;  2UUB B;  3ASO B;  2N05 A;  4TUY A;  2YEV A;  3T1Y O;  2JRI A;  5B1A C;  5L3G A;  3BY6 A;  1D5N A;  2EIL C;  4JI2 O;  4QE9 A;  2A0L A;  3J7A U;  3E89 A;  1YEW A;  5EBW C;  2B1I A;  4EB6 A;  1YCI A;  1K5Q A;  4GLX A;  1VF5 B;  2E76 B;  3SYC A;  3NR7 A;  1QR9 A;  1KD1 W;  2R9R B;  3BAA A;  4FIP C;  5JJN B;  4WFB V;  2UUA B;  4FM0 A;  3HKB B;  3ETQ A;  2X0L A;  4YJ3 B;  4LFC B;  2Z3Y A;  4BW5 A;  1Q6I A;  4AHC A;  2BSK A;  4GZR B;  4X65 B;  3ASN B;  4GUN A;  5GTH Z;  4TV8 A;  1H2G A;  4JI4 B;  1UPG A;  2RN9 A;  4UXN A;  3OTO B;  1I94 O;  1AI7 A;  5J2U B;  2M7W A;  4LWS A;  1K9M W;  3D36 A;  1DTO A;  4DK1 A;  2LP7 A;  1F4N A;  4X89 A;  3CXH F;  3P30 A;  4XDK A;  2HFE C;  3CJH B;  1SQG A;  2IM9 A;  5HFL A;  4RQF A;  3W7T A;  3BHP A;  1IBM O;  2Y4T A;  2YXH A;  5JH7 B;  3JAT B;  4JAA A;  1YI2 V;  3P3N A;  4NKG B;  4U3F H;  3CS5 A;  3OFN G;  1N0J A;  3CCQ V;  1S76 D;  1R1B A;  4DV1 B;  4J41 A;  5IT9 N;  1VQ5 V;  1GN4 A;  3JSN A;  4K35 A;  2WLH A;  1M5I A;  3OAA G;  2NN4 A;  5GW7 A;  4JF3 A;  2VRZ A;  5IJ0 B;  3ICX A;  1IDS A;  1XQ8 A;  1BL8 A;  1XHZ A;  4P9P A;  3ZMU A;  1M56 B;  4MW8 A;  3E22 B;  4DR5 B;  1SQX H;  2ZCE A;  5B3S B;  1R3K C;  1SES A;  1XDC A;  3GWO A;  2X7R B;  2OIG A;  1H2S B;  3MAQ A;  4UVC A;  5DEC A;  3QTC A;  5FNV A;  4MVZ A;  2YS8 A;  4G2K A;  3OR6 C;  2EJ7 A;  3G67 A;  4KFM A;  4MT8 A;  4IYH A;  3OUS A;  3VBB A;  1XMO O;  5K1X A;  4CS2 A;  3CRR A;  1Q5O A;  5LYJ B;  2PF4 E;  2QKA A;  3X2Q B;  3D3Q A;  1Y76 A;  3K5O A;  4JYY A;  4B08 A;  1S5H C;  1MSW D;  1YHQ V;  2WLL A;  5EC1 C;  3KZI Z;  1KP2 A;  3PN1 A;  2Q6A A;  2OIE A;  1WAZ A;  3G71 V;  1FKA O;  4JI8 O;  1YIJ V;  3ZHU A;  3FB8 C;  4LF4 B;  3QO5 A;  3Q4H B;  4YHH O;  1RSO A;  4FLW A;  2Y69 C;  5LP6 A;  1O9G A;  1J95 A;  2HP8 A;  3JAL B;  3HB3 B;  1VQM V;  1URF A;  3FX7 A;  3FB5 C;  4MVR A;  2KG7 B;  4BIO A;  5LHI A;  2X6B A;  3A0R A;  5JCO A;  3DC5 A;  2LW7 A;  3W7X A;  4I55 B;  2W6J G;  3B2E E;  5E1A C;  1HDJ A;  2WLM A;  3C90 A;  3ABK B;  4EFB A;  2EIM C;  3ZN1 A;  2IJK A;  2R9I A;  5LMU B;  4X62 B;  2CH7 B;  4H37 A;  2Q68 A;  1N34 B;  1NT2 B;  1QLE C;  3QO8 A;  4RUE A;  4DW1 A;  2GV9 A;  2GTS A;  1H8E G;  2E74 B;  1RFY A;  3HKD B;  2YID A;  4F4L A;  2JS3 A;  4RUF A;  4MTG A;  1K4C C;  1WA8 A;  4ZI7 A;  2CTR A;  1TVK B;  1XNQ O;  4B3M O;  2YDE A;  3OR7 C;  3JAM N;  3JD0 A;  4OXS A;  1GK9 A;  1YXB A;  3N27 A;  4OX9 O;  3CRM A;  4O2A A;  3SGI A;  4H13 B;  4G28 B;  2A06 H;  4QGP A;  1R6T A;  5L3D A;  3ZBH A;  3QVN A;  2CTP A;  3OGC C;  2EJR A;  3TET A;  3AG4 B;  3CB2 A;  1KMI Z;  4JI0 B;  3GWK C;  1VQ6 V;  3JAW B;  1G4Y B;  2Y0P A;  1XMQ B;  2UU9 B;  2E75 B;  1JCH A;  3CE2 A;  4DV5 O;  4O4H A;  4DUY B;  4X1Y A;  2QE7 G;  4PA9 A;  3DSQ A;  3ZJZ A;  3KKY A;  3N2K A;  4JTC B;  2PUS A;  1Q86 W;  2Q7H A;  3FAV A;  1J5E B;  1A32 A;  2DYS C;  3L75 H;  4LFA O;  1I5X A;  2ZR3 A;  4X20 B;  3VQV A;  2F95 B;  1W2B U;  4HYO A;  4PDV A;  2MW2 B;  3SPJ A;  4UCO A;  4D7T A;  4JAS A;  1HNX B;  2HVK C;  4TQF A;  1EN6 A;  2PYJ A;  1E1Q G;  3FB7 C;  2F43 G;  2H3O A;  4XBF A;  4LH7 A;  4X1I A;  4BIU A;  1G1X B;  2XAF A;  5J2T A;  1YJ9 V;  2YIA A;  1QNM A;  1BZK A;  3L71 H;  5IYB O;  4EB6 B;  3F7Y C;  1HNZ B;  4UVB A;  1FFX A;  4GKK B;  2ZD9 A;  3K79 A;  4PDM A;  3AG3 B;  3E8G A;  3CP1 A;  3R66 A;  3ABM C;  4J80 A;  1JJO A;  2KB1 A;  3ML0 A;  2LW1 A;  4J7K A;  2ZE7 A;  2B9Z A;  1HNW B;  1MNG A;  4G27 B;  1UFI A;  2PTM A;  4IHJ A;  4W4L A;  2VQE B;  4TV8 B;  3LNM B;  1SER A;  3E35 A;  2UXC B;  4IYI A;  3AK2 A;  2JIZ G;  5KAF Z;  5KHG A;  1QLN A;  1NS1 A;  1ZUQ A;  1V54 C;  1GM8 A;  4LWS B;  1Q82 W;  4WF9 V;  4KHP O;  2DYR B;  4H33 A;  2HHH B;  2WPD G;  1MOF A;  2Q0O C;  4H44 B;  4OPH A;  1NR7 A;  4GX5 A;  1THZ A;  3ZHV A;  4JPR A;  3APO A;  2H94 A;  1E1R G;  4LF9 O;  4UB8 Z;  1N33 O;  2QDO A;  1OCC B;  1NTM H;  2L6L A;  1VIB A;  4B7K A;  1JMK C;  1KEC A;  2IJI A;  1NH2 D;  2ZXW C;  1GMG A;  1DK1 A;  4X64 O;  2IU0 A;  3OE7 G;  2EIN B;  5H5N A;  4FLV A;  4DR7 O;  2UXB B;  1WN7 A;  1MSD A;  1XL4 A;  2Y0I A;  4JI3 O;  3TCU A;  3I5D A;  3WB0 A;  3ZS8 C;  1NR1 A;  1KQS U;  4B3S B;  3JD4 A;  4DR2 B;  4K8X A;  3B09 A;  3ZRW A;  3JAR A;  1OCZ B;  5FNV B;  4UCU A;  5IJ9 A;  4LF8 B;  2QM4 A;  2UXC O;  1TUE B;  4DO2 A;  2HLD G;  2XAJ A;  1VQO V;  1RP3 B;  4PA4 A;  4CZZ A;  1I7F A;  1K33 A;  5CBF A;  2ARH A;  4JI5 O;  1WP8 A;  3N2G B;  1IX9 A;  4PI2 A;  4K0K O;  1M57 B;  4DV7 B;  2V4D A;  2ZM6 O;  1Y76 B;  1SQB H;  3H1J H;  4IL6 Z;  2PI5 A;  2WLI B;  1Y4M A;  2QEX V;  1AJP A;  3CSX A;  2WLL B;  4O4J B;  4O4I A;  5EIB D;  2IJH A;  3RWR D;  3UQ8 A;  1OZ0 A;  4CBC A;  3JAS A;  3VOU A;  4BAY A;  2WSS G;  3IJ4 A;  2E5L B;  3T4D A;  2A7W A;  5F2V O;  4B3T B;  1SS3 A;  5LP6 B;  3IAY A;  1YF2 A;  3A0H Z;  3RBZ A;  5ITZ A;  5BR8 O;  1XNR B;  3IC7 A;  4MW3 A;  1PNK A;  2ZIO A;  4X8A A;  3K58 A;  1GM7 A;  4FZ0 A;  5KA6 A;  2EIK B;  1M93 A;  2AZ0 A;  2BTQ A;  3QO7 A;  1I0H A;  2ZDI C;  1OCO B;  2AGA A;  1ZTE A;  3AG7 A;  4DR4 B;  3CRC A;  1NVP B;  3IC9 A;  2QA4 V;  4FM2 A;  4MTX A;  3T4Z A;  2LFR A;  5L3C A;  3BA9 A;  1GN3 A;  5GON A;  4NXM O;  1RPO A;  5B1N A;  1SA0 B;  4DV7 O;  2DQ0 A;  4ZI7 B;  2R72 A;  3TK1 A;  3L74 H;  4B3R B;  2UXD B;  3SPG A;  4CS4 A;  1MAB G;  3JAK B;  4QNH B;  3F5T A;  2XHB A;  2QWO B;  3CMA V;  3ASN C;  2R70 A;  2DWD C;  1GH6 A;  4BIZ A;  1YIT V;  4DV2 B;  4O2B B;  2LJ2 A;  4N23 A;  1FPO A;  4LF7 O;  4DRX B;  3K0D A;  1KUQ A;  5KMG B;  4ABM A;  1V9P A;  1HR0 O;  3OTF A;  5IY5 C;  2A3Q A;  1QHT A;  2XAH A;  4Z2W A;  3SYO A;  4LR3 A;  2OYQ A;  5EBL C;  1FXK C;  2A9H A;  2ZKO A;  1W0K G;  5DM6 V;  4MTO A;  3T1C A;  3JCU Z;  2RDC A;  4O4H B;  2EX3 A;  4X1Y B;  1YTF B;  3VQX A;  1OHH G;  3AG1 B;  4LP8 A;  4LF5 B;  2ZNI A;  2P4K A;  3N2K B;  1VQL V;  3FAV B;  2WLJ A;  1SKV A;  3BAB A;  2GUZ B;  4BWA A;  3OM3 B;  5B5E Z;  3K03 A;  4DUZ B;  3SPI A;  1IUR A;  4GX0 A;  4X1K A;  1AR1 B;  4AQY B;  2OTL V;  4LH6 A;  4ZOL A;  4I0X A;  3RYF A;  3E86 A;  1M56 C;  1XRE A;  2DE0 X;  3GB7 C;  3T1H O;  5J2T B;  4TT3 G;  5FLX N;  3ZMV A;  1SRY A;  1AJN A;  2XAQ A;  4CH6 A;  3WG7 B;  4L87 A;  4MVS A;  2Q4P A;  2F1M A;  1N32 B;  3ZED A;  1AJQ A;  1TUB B;  3SJA C;  1N4C A;  1SQV H;  1GN2 A;  1BHB A;  1VQN V;  1HP8 A;  1V55 B;  4IHJ B;  5C8Y A;  2Z0A A;  3U10 A;  5CB4 A;  2RMK B;  1JVM A;  2UUB O;  5LMN B;  1XHX A;  1Y74 B;  1S72 V;  5BMV B;  3OMN B;  1AP5 A;  2ITD C;  1XEQ A;  3EVK A;  1H2L A;  4R50 A;  3CCE V;  3CEI A;  3RT3 C;  2GTA A;  3R65 A;  2QWQ B;  4WBN B;  3RYC A;  2JDI G;  3AK1 A;  3G6E V;  5C93 A;  2ZE8 A;  4MSW C;  2UUA O;  2HR3 A;  5B1A B;  2MK3 A;  4PHZ A;  1N32 O;  1SF9 A;  3BPZ A;  4LFC O;  3EHB B;  2CAZ C;  5IDJ A;  5CA3 A;  2EIL B;  4DR6 B;  1ZAU A;  4X65 O;  1M90 W;  2WA3 A;  2OT5 A;  3AEI A;  1KC8 W;  2YI9 A;  4JI6 B;  3L9D A;  4UV9 A;  4JI4 O;  4ZKI A;  5L3B A;  3K59 A;  1NJI W;  5LOV B;  3VQY A;  2FML A;  4PV1 B;  3OTO O;  2K9P A;  4NTW A;  3UCS C;  3ZRW B;  1F51 A;  3K5N A;  4ZHQ A;  2P90 A;  5IJ9 B;  3K06 A;  4FLU A;  2KKW A;  2QM8 A;  5LMN O;  4ICG A;  5B1B C;  2LQT A;  3OT7 A;  1K92 A;  1WJZ A;  1QVF U;  2CE4 A;  3A0B Z;  1IBL B;  1SQF A;  2ZR2 A;  1BHA A;  3JD2 A;  2ODM A;  4DV1 O;  4F6R B;  3ABL C;  4JI1 B;  4D7S A;  1L0N H;  3T2M A;  3HKE A;  1K5S A;  1YJW V;  4UVA A;  2WWW A;  2FYU H;  1JFF A;  4TQD A;  1F7Y A;  2HEP A;  4JV5 B;  1ZLZ A;  4R7C A;  1SQP H;  3K9A A;  3OUF A;  2ADP A;  4DR5 O;  1K4D C;  2XT9 A;  1OJH A;  4X88 A;  3SPC A;  3RFR A;  1PNL A;  3CC2 V;  1JJ2 U;  3E2E A;  2YC0 A;  1PKX A;  4W4K A;  3RYH B;  4NXN B;  4TV9 A;  2PGG A;  1QVG U;  3OD4 A;  1M4U A;  2BTQ B;  1XI1 A;  5LGU A; 
#chains in the Genus database with same CATH homology
 1GM8 A;  1Q82 W;  1XL6 A;  5L3F A;  3WG7 C;  3ZIA G;  4WF9 V;  2NNU A;  5KUM A;  2YSU B;  2DYR B;  4H33 A;  4QPJ A;  2WPD G;  3UM7 A;  1MOF A;  3JCZ A;  1S3J A;  2JK5 C;  5IY5 B;  4RO2 A;  1Q81 W;  3SYA A;  3ZN0 A;  1GTO A;  1NR7 A;  3AG3 C;  4GX5 A;  5LHH A;  1THZ A;  3CCL V;  4JPR A;  2ITC C;  1HWY A;  2H94 A;  1E1R G;  3CC7 V;  3ZMS A;  1R6K A;  1FXK B;  1VQ9 V;  3NXS A;  5KA5 A;  3CCR V;  1WPX A;  1OCC B;  1K97 A;  1V55 C;  2V1D A;  4LCU C;  2QTO A;  3ABK C;  3B77 A;  5EC2 C;  3RW0 A;  4GX1 A;  1VQP V;  1RM1 B;  1KEC A;  5B1O A;  2IJI A;  1NH2 D;  1GO3 F;  2AHY A;  5IYD O;  2ZXW C;  1H38 A;  1MG1 A;  4EKW A;  2JJ1 G;  1GMG A;  2XOK G;  3OMA B;  3ZMT A;  2IU0 A;  3OE7 G;  2EIN B;  3ETD A;  4YXW G;  1ZWI C;  3LSS A;  4N21 A;  1XL4 A;  3SPH A;  3IFX A;  4R8C A;  4GX2 A;  5H6Q A;  1F23 A;  1QCE A;  5H9C A;  3TCU A;  2HVJ C;  3ETE A;  3CCV V;  1NR1 A;  3LUT B;  4QPK A;  5FL7 G;  1KQS U;  5HFM A;  3CD6 V;  5BZB A;  3JD4 A;  1GM9 A;  1OCR B;  1YJN V;  3ZRW A;  2Y69 B;  4RQE A;  1K8A W;  1WLE A;  1OCZ B;  3CCS V;  4HAM A;  1AI5 A;  2A79 B;  2B1G A;  4WFF A;  1TUE B;  3HPL C;  2LFS A;  2HLD G;  4DO2 A;  2UXN A;  2XAJ A;  1VQO V;  4PA4 A;  3CCU V;  4UUJ C;  1S77 D;  2Y48 A;  4P9O A;  4CZZ A;  2YEV B;  1CPY A;  3ASO B;  3PJS K;  1K33 A;  2B5U A;  5CBF A;  1RM1 C;  2YEV A;  3FYE B;  4GT1 A;  1M57 B;  2HJF C;  3OMI B;  5B1A C;  5L3G A;  3BY6 A;  1R6N A;  3CC4 V;  1EBO A;  2PI5 A;  2WLI B;  1Y4M A;  2QEX V;  1AJP A;  4PA7 A;  2EIN C;  2EIL C;  2WLL B;  4QE9 A;  2WLI A;  2FTK A;  2IJH A;  2QM7 A;  2EIM B;  3AG4 C;  3WFV A;  2A0L A;  3LDE A;  3E89 A;  3ABT A;  4QIW F;  5EBW C;  2B1I A;  1JPX A;  2ZDI A;  1OZ0 A;  3F5W C;  4RAI A;  3JD1 A;  4CBC A;  3H01 A;  3VOU A;  4BAY A;  2WSS G;  1FXV A;  2XND G;  1K5Q A;  1EFR G;  3T4D A;  3SYC A;  1PNM A;  1QR9 A;  1DF5 A;  1AI4 A;  2R9R B;  1KD1 W;  4FIP C;  4MTF A;  1OCR C;  3KG2 A;  1JX9 A;  3QNE A;  3M99 B;  3RBZ A;  4JGS A;  4WFB V;  3B8N A;  1L1F A;  2QKS A;  4R6Z A;  3IC7 A;  2X0L A;  4MW3 A;  2PI4 A;  2Z3Y A;  4BW5 A;  1PNK A;  1K34 A;  4MVQ A;  4X8A A;  4FMT A;  4XDL A;  3ASN B;  5LBQ A;  1H2G A;  1GM7 A;  1R3L C;  4UXN A;  5KA6 A;  2EIK B;  4PEL A;  4P2Z A;  1AI7 A;  3QO7 A;  1R73 A;  2M7W A;  2ZDI C;  1OCO B;  1K9M W;  3D36 A;  2IU3 A;  5CMU A;  1DTO A;  3K0G A;  2LP7 A;  1NVP B;  2QA4 V;  1F4N A;  4MTX A;  3T4Z A;  2LFR A;  4X89 A;  3B8M A;  3P30 A;  4XDK A;  2HFE C;  1F4M A;  5L3C A;  1NKD A;  2HKO A;  3E8B A;  4GCZ A;  5IYC O;  5HFL A;  1ROP A;  4RQF A;  1NQT A;  1RPO A;  3W7T A;  4MVO A;  5B1N A;  2ATK C;  1VQK V;  1CP9 A;  2DQ0 A;  4JTD B;  3TK1 A;  1FXK A;  1YI2 V;  2BOB C;  2HG5 C;  2EIJ C;  3SPG A;  3OFN G;  2NLJ C;  1MAB G;  4QNH B;  2P6J A;  3CCQ V;  1S76 D;  4KUM A;  1SZT A;  3CMA V;  3ASN C;  4LC1 A;  3CCM V;  3STL C;  2DWD C;  4BIZ A;  1YIT V;  1VQ5 V;  2IJJ A;  2DYS B;  2WLH A;  4N23 A;  1M1K W;  3OAA G;  1ORQ C;  2EIK C;  5B1B B;  3K0D A;  4LBE C;  2ZQM A;  2GSM B;  4JF3 A;  5GW7 A;  3K3W A;  1SET A;  2DYR C;  1OCO C;  1BL8 A;  4P9P A;  4TWK A;  1GKF A;  5IY5 C;  3ZMU A;  3ZRX A;  5LGN A;  4KP4 A;  3CXC U;  1M56 B;  2IW5 A;  4WFA V;  3ZRS A;  4JTA B;  4MW8 A;  2OTJ V;  2XAH A;  3SYO A;  4U7O A;  3CCJ V;  5B3S B;  1YSC A;  1R3K C;  1SES A;  3SYP A;  3GWO A;  1VQ4 V;  2X7R B;  5EBL C;  3ABL B;  1FXK C;  2A9H A;  4UVC A;  4MVZ A;  1W0K G;  5DM6 V;  1OCC C;  1N8R W;  4MTO A;  4PA3 A;  3W7W A;  4G2K A;  2WLK A;  3OR6 C;  3T1C A;  3RVZ A;  3E8F A;  4KFM A;  4MT8 A;  3OUS A;  3VBB A;  3ZMZ A;  3I56 V;  3FB6 C;  1P7B A;  1YTF B;  1OHH G;  3AG1 B;  4LP8 A;  4UV8 A;  1VQL V;  3LDC A;  3X2Q B;  1RPR A;  5LHG A;  3OW2 U;  4MS2 A;  1K7D A;  2WLJ A;  1R3I C;  1B6Q A;  1S5H C;  2EBO A;  5H6R A;  1MSW D;  4U7N A;  2DWE C;  1YHQ V;  5EK0 A;  2WLL A;  5EC1 C;  4HZ3 A;  1EZJ A;  3OM3 B;  3K03 A;  2JEU A;  1UJW B;  3SPI A;  2Q69 A;  1KP3 A;  4GX0 A;  1E79 G;  1I5Y A;  1KP2 A;  1AR1 B;  2Q6A A;  3G71 V;  2OTL V;  3RVY A;  1YIJ V;  3LDD A;  1QLE B;  3FB8 C;  3E86 A;  1FXH A;  3QO5 A;  1M56 C;  3CYO A;  1JOY A;  3GB7 C;  1M9N A;  1Y66 A;  3EFF K;  4TT3 G;  2Y69 C;  3ZMV A;  1OCZ C;  2K1E A;  1J95 A;  1SRY A;  1AJN A;  2XAQ A;  3HB3 B;  3WG7 B;  4L87 A;  4MVS A;  3DGE A;  1NH2 B;  1VQM V;  2XAS A;  1AJQ A;  3DTU B;  1COW G;  3FB5 C;  2DW4 A;  4MVR A;  3ASO C;  2GHY A;  4MVU A;  3ABU A;  5LHI A;  3IGA C;  2X6B A;  3A0R A;  3CME V;  1M57 C;  5CBH A;  3AG1 C;  1KKD A;  5J9P C;  3W7X A;  4PDL A;  1BHB A;  2W6J G;  1VQN V;  5E1A C;  2X6A A;  3F7V C;  2WLM A;  2EZP A;  1V55 B;  4DXW A;  2H8P C;  3ABK B;  2EIM C;  3BEH A;  3ZN1 A;  2X6C A;  2DQ3 A;  4I5S A;  2IJK A;  2R9I A;  3E8H A;  2Q67 A;  3OEH G;  4J9Y B;  5EBM C;  4H37 A;  2Q68 A;  2ZXW B;  1QLE C;  3QO8 A;  4RUE A;  1JVM A;  3SYQ A;  1H8E G;  1S72 V;  2P7T C;  3JYC A;  3OMN B;  2WLN A;  2ITD C;  2V7Q G;  4F4L A;  4RUF A;  2W6I G;  4MTG A;  4QE7 A;  1K4C C;  2W0F C;  4PA6 A;  4R50 A;  3CCE V;  1FFT B;  1H8H G;  3K04 A;  4XDJ A;  3OR7 C;  1IXM A;  4ASU G;  4Z1M G;  3R65 A;  3JD0 A;  4OXS A;  2Z5U A;  3JD3 A;  1GK9 A;  5KUK A;  2AHZ A;  2JDI G;  3G6E V;  1G8M A;  5C93 A;  1LNQ A;  4G28 B;  4Q20 A;  4MSW C;  3K08 A;  2HR3 A;  1Q7Y W;  5B1A B;  2MK3 A;  4E2L A;  3W7U A;  2BOC C;  5L3D A;  3EHB B;  5IDJ A;  5CA3 A;  1NBM G;  2EIL B;  3OEE G;  5LGT A;  3OGC C;  2EJR A;  3TET A;  4FK5 C;  1CEZ A;  3AG4 B;  1M90 W;  1AI6 A;  2XAG A;  2OT5 A;  3AEI A;  1KC8 W;  1ENV A;  1PD3 A;  1VQ6 V;  4UV9 A;  3MHH C;  4ZKI A;  4JYB A;  1G4Y B;  1P4R A;  5L3B A;  1FS0 G;  1DF4 A;  2OCC B;  1NJI W;  5CBG A;  2UXX A;  1JCH A;  1QR8 A;  3AG2 B;  3W7S A;  3ZRW B;  1F51 A;  1NVP D;  2JEX A;  2QE7 G;  1VQ7 V;  2P90 A;  3ABM B;  4PA9 A;  3ZJZ A;  3K06 A;  4ZBM A;  3SJQ C;  2P67 A;  4JTC B;  1Q86 W;  2EZO A;  2DYS C;  5CN0 A;  1I5X A;  1PL0 A;  2QM8 A;  2ZR3 A;  3FKS G;  1K73 W;  1W2B U;  4HYO A;  1BMF G;  2IH1 C;  4PDV A;  5B1B C;  3MD0 A;  1K92 A;  3SPJ A;  1QVF U;  4MVM A;  4JAS A;  1W0J G;  2HVK C;  4FPP A;  3LSQ A;  1E1Q G;  4JYC A;  3FB7 C;  2ZR2 A;  3G4S V;  2F43 G;  2JJ2 G;  3ZCC A;  4XBF A;  3MHS C;  1BHA A;  4BIU A;  1V54 B;  2XAF A;  3JD2 A;  5B3S C;  1YJ9 V;  4FJC C;  1DLB A;  3I55 V;  1S0V A;  3ABL C;  5IYB O;  1QBZ A;  3F7Y C;  4UVB A;  4J9Z B;  3T2M A;  1K5S A;  2OCC C;  4P30 A;  5DN6 G;  2ZD9 A;  1YJW V;  4PDR A;  1VQ8 V;  3K79 A;  4PDM A;  3UKM A;  2WAM A;  2WWW A;  3AG3 B;  4UVA A;  3E8G A;  4WFG A;  3CP1 A;  5L3E A;  3AG2 C;  2C2A A;  2D3O W;  4R7C A;  3ABM C;  3X2Q C;  4I9W A;  3K9A A;  4WFH A;  2KB1 A;  3ML0 A;  3ETG A;  3OUF A;  1ARO P;  3ZRV A;  3FYI B;  1R3J C;  2EIJ B;  1K4D C;  3D3I A;  4WCE V;  4X88 A;  4G27 B;  2IH3 C;  3SPC A;  4WFE A;  1K3E A;  3LNM B;  1PNL A;  3P32 A;  2CK3 G;  3CC2 V;  1JJ2 U;  4QJF B;  1SER A;  3E2E A;  3E35 A;  3E83 A;  1PKX A;  4TSF G;  2JIZ G;  3CPW U;  4JAV A;  1JQ0 A;  3STZ C;  1QVG U;  4JAU A;  1QLN A;  1V54 C;  1YTF D;  5LGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...