5HFLA

Gp41-targeting hiv-1 fusion inhibitors with helical ile-asp-leu tail
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
69
Chain Sequence
MASGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILGGWEEWDKKIEEYTKKIEELIKKSQNQQIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational improvement of gp41-targeting HIV-1 fusion inhibitors: an innovatively designed Ile-Asp-Leu tail with alternative conformations
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Envelope glycoprotein,gp41 CHR region
total genus 30
structure length 69
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5hflA00
2EZPA 4FIPC 1Y66A 1EBOA 1F23A 5H9CA 4JGSA 2EBOA 1SZTA 1DLBA 5KA5A 3MHSC 3K9AA 2M7WA 2OT5A 5KA6A 3B8MA 1Y4MA 1JPXA 4FK5C 1I5YA 3P30A 1JQ0A 1MOFA 1QBZA 2MK3A 3B8NA 5CMUA 1QCEA 4N21A 5CN0A 3WFVA 4JPRA 5HFMA 2EZOA 3CYOA 1K34A 4FJCC 4N23A 1ENVA 3M99B 1K33A 2LP7A 4G2KA 2X7RB 1DF4A 1I5XA 1QR8A 1MG1A 3GWOA 3MHHC 4JF3A 4E2LA 2P6JA 3B77A 3H01A 3CP1A 1DF5A 1QR9A 5HFLA
chains in the Genus database with same CATH superfamily
2A0LA 4DYLA 4LF4B 4U7OA 1AI4A 4DXWA 2WWWA 3STLC 3BEHA 1KD1W 3BABA 4IHJA 1TUEB 1MZFA 3L72H 5B3SC 3ZRVA 3J80N 4PELA 1SA0A 1IZ3A 4Z1MG 1VQ7V 5KHIA 1SKVA 5C8YB 3K58A 1TUBA 4PDMA 4GX0A 3A0BZ 1JMKC 4ZI7A 2UXDB 1QLEB 3CYOA 1JFFB 1VF7A 5J9PC 3JATA 4UCVA 3FB5C 3SPJA 2CGNA 2ZDIC 1WPXA 5EYPB 3ABLB 2P4KA 3BFRA 2HEPA 1IXMA 1YTFD 3R65A 3VQYA 3L9DA 3AK2A 3RW0A 3ZMSA 4LCUC 2P7TC 4MW8A 5LHGA 1JQ0A 1M90W 1TAEA 4DR3O 5B1AB 3RYHB 1K5QA 3JASA 4DR6O 4H0LB 4YJ3A 4WBNA 1SQVH 5H5NA 1K4CC 5AG2A 5H9CA 3O9OA 5LOVB 1FXVA 2DYSB 2OWOA 2AXTZ 4EFEA 1YJ9V 2UUBB 1JJ2U 3G80A 1R6KA 3JARA 1IBKO 4HZ3A 4EFBA 4O2AA 4X62B 4DV2O 2AHYA 5IYZB 2Q7EA 1UFIA 5CBGA 2EIJB 1Y66A 1VQ4V 2JRIA 4DUYB 1THZA 4IL6Z 1BCCH 4UFZA 3RVZA 4MVQA 1YTFB 4DK1A 4O4HA 5CBFA 3OUFA 4ASUG 4P9OA 4DR5O 3X2QC 5A2QN 2DQ0A 4DR1O 1G1XB 5JQGB 2EJ7A 3HKBA 1XHZA 1N0NA 1XL6A 1OJHA 4TOIA 5LMNO 2AZ0A 4U3FH 2GTAA 3UM7A 4LF5B 1L8DA 5C93A 4BIUA 3JCZA 4DR2O 4DR5B 2XOKG 4WFHA 5JH7B 3CCLV 2B9ZA 3U10A 2F1MA 4X88A 1PD3A 1AILA 4K3AA 4ZHQA 2OCCB 4DUZB 3MHHC 4XDKA 4DV4O 1YIJV 4KUMA 2WLKA 3AG7A 3J81N 4FFBA 5F2VO 4BAYA 5H6QA 4Z2WA 4I4TA 2UXCB 3CJHB 1I08A 2EZOA 2AGAA 3CXHF 4N23A 5FPRA 5IJ0B 1QLEC 1YF2A 1H2GA 1TGOA 4DR4O 4JAAA 1EZJA 3RFRA 4ZIBA 5DN6G 5JJNB 3F5TA 1XBLA 1S0VA 4Q20A 4JAVA 2ZD9A 3FB6C 5LBQA 4JI8O 1NKDA 1EBOA 4QE9A 1D2DA 3ZMTA 3UO3A 1RM1B 1TVKB 4R8CA 2EIMC 1ZSPA 1N0JA 4X1IA 1H38A 3ABMB 3BRCA 3SYCA 1SF9A 1XNQO 3OEHG 2ZDIA 4DV6B 2A9HA 4GT1A 5LGNA 1ZL8B 4J41A 3CRAA 1TA8A 1VQOV 2OIEA 1VQKV 2BSKA 4BW9A 3QF7A 1HNZO 4NYKA 2EX3A 5LYJB 1S72V 2M6YA 2DYRC 1CEZA 1V9PA 1Q90D 4DV6O 4YHHB 3K5NA 5JJEB 4BWAA 4MTXA 3AG2C 3D8CA 2HHHB 2DQ3A 4J9YB 3AK3A 3APOA 4QIWF 5EIBC 3OMIB 1WPBA 4TT3G 5B3SB 3LNNA 3OT7A 1WP8A 3DTUB 5TISZ 3HKBB 1VIBA 1XREA 2JGUA 4MTGA 1IBLO 2UUCB 4GX2A 3CHXA 3CCUV 3OGIB 4CH5A 1LUWA 4DR7O 2XTAA 5LXTA 4B3RB 4DV5B 3RT3C 4FIPC 3D3QA 3JAWB 1DLBA 1G8MA 2UU9B 3M7MX 1B3QA 4DV1B 3BY6A 1FFXB 3ABUA 5EYPA 1EZVH 3K5MA 2ITDC 1H2LA 1BT8A 3KZIZ 1LR1A 3FX7A 3A0RA 5E1AC 1S5JA 5B1AC 3B77A 3JARB 4I9WA 1M57C 2O57A 4KXRA 4UB8Z 2XAHA 5J2UB 5JJJB 5LMUO 1Q43A 3BA9A 3J7AU 1JVMA 4EB6B 3P30A 1GMGA 1FXKA 1FD9A 1BHAA 3N2KA 4DV0O 3VBBA 3UCSC 2B5UA 2LQTA 1TVKA 4NXNB 2CK3G 4BIOA 5GTIZ 2OCHA 3SJAC 2WLLB 1N33B 1DF5A 5E79Z 1VQ8V 2AHZA 5IYCO 1GM8A 1XL4A 4HYOA 4LH6A 5LL6Y 1W0KG 3UQ8A 2HVKC 3H1IH 4O4IA 3RYIA 2ZE8A 1JJOA 3OTOO 4LH7A 2JDIG 1VMGA 3L71H 4LF9O 5IWAB 2ZNIA 2A7WA 2Q0OC 1Q86W 3HKEA 3DSQA 1YHQV 5LGTA 4GYCB 5IYZA 3ETQA 2JIZG 3EVKA 3ZRXA 1AI5A 4LP8A 1NJIW 2WAMA 4L87A 1K92A 5A9GA 2ZR3A 2V1DA 4LWSA 4NB5A 2PYLA 2B1GA 3CX5F 1AR5A 2QTSA 1Q3EA 2EZPA 1IDSA 2FB5A 3SPGA 5JQGA 4JI1O 2OTJV 3CRMA 1VQPV 4CC5A 5JVDA 1MNGA 4LFBB 2VQFO 5B1OA 4UB6Z 2EULA 3OW2U 1Y6XA 1O9GA 1IBLB 2WLMA 3AG4B 3OM3B 2OIGA 4UVAA 4JI5B 4FM1A 4EEQA 1UJWB 1R3JC 4LF6B 3TXQA 4GLXA 3JSLA 5J2UA 4DV1O 2Q7GA 4PJ0Z 3UKMA 4J80A 2KQXA 3CCRV 1AJPA 1IX9A 2W6JG 3TK1A 2CE4A 4YIOA 2Q68A 3ZHTA 3L73H 2CAZC 2IW5A 4JI4B 4ZBMA 3ZEDA 1P7GA 1S5LZ 1BZKA 2UXBO 4GKKO 1GN3A 3C3SA 3DGEA 1XUQA 4JPRA 3CCEV 2Y48A 2Q6AA 3JYCA 4CS2A 2LP7A 2PYJA 3RYFA 3F5WC 3NR7A 2X6CA 3IFXA 4OGQB 3BHPA 3CE2A 2KSDA 4NTYA 1KU9A 1Q6UA 2X0LA 1R6TA 4X65O 3AEIA 3JD0A 2LJ2A 3WB0A 2F93B 1ZL8A 4N21A 2QA4V 5KMGA 3ZHVA 3W7XA 3W7TA 4RO2A 3QO5A 5EZYA 1N33O 2F4VB 2P6JA 3E86A 3AG1B 1R6NA 3U0ZA 3CCJV 4AQYB 1GN6A 2WPDG 3CWBH 3DC5A 4IIJB 1GH6A 2P5OA 3CC7V 1ZWIC 4JI3O 2QGNA 1S76D 2IH3C 2K9PA 3BAAA 1YVWA 2DW4A 4JTAB 2CTQA 1H2MA 5LP6B 2PI5A 4JV5O 1J95A 1W59A 5DEDA 1M1KW 1YSCA 2ARHA 2QTOA 1YZBA 4UV8A 1QR8A 3A2FA 3N2KB 4B3MO 3CB2A 4DR7B 2D2CB 2JS5A 5L3BA 3SYQA 5BR8B 5KUMA 3ZMVA 2UXCO 1OCCB 1M56B 2PF4E 3VQXA 2IJIA 2BE3A 4X1YB 4PI2A 1L0NH 4W4KA 4WCEV 1ZAUA 1E1RG 1SZXA 4O4HB 1SQFA 3D3IA 4DRXB 5GW7A 3CXCU 2RMKB 1VEWA 2H3OA 1J5EB 3B8NA 4JI2B 3QNEA 2Q67A 3ZIAG 1ENVA 1KC8W 2YC0A 1RSOA 2E75B 1YJNV 3TCUA 2LFRA 5K1XA 3K08A 3ZHRA 4I0XB 3QTCA 4B3SO 5FLXN 3G67A 2UUBO 4X1KB 1OCCC 1NI8A 4JI0B 4NTXA 3TXSA 4YY3B 3T1YB 1RPOA 1JCHA 4J42A 4L8JA 4O4IB 5CB4B 1HR0B 1W2BU 2PZSA 1AB3A 1WA8A 4FLTA 1OCZC 1YCIA 3CJHA 1Q8IA 1I0HA 3RYHA 2VWJA 4J7JA 1Q6HA 2XUMA 3SJCC 4CS4A 5KAFZ 3HKEB 5BY1A 2XAGA 3D36A 4JZGA 5KHKA 4QNHB 4XDJA 1HNWB 4JI8B 2Q69A 1EFRG 4LFAO 4G27B 2EINB 2Q9LA 1NR7A 4UCRA 1B06A 3ML0A 4DV3O 2Q0AA 2HLDG 1GTOA 5DECA 2LGQA 3A8TA 1UPGA 5KHJA 3MDSA 5LOVA 4JYAB 4LF8B 4GCZA 1AI7A 1KMIZ 1K3EA 2PUSA 2ZCEA 5IJ0A 4DR6B 3ABKB 3B40A 4CC6A 1QLNA 4D7SA 2ZE5A 4UXNA 5J2TB 1S3JA 2YS8A 1AR1B 1Y4MA 2QR4A 2AZ2A 2UXNA 3SPCA 4FPPA 2QM4A 2HVJC 2EIMB 4MVMA 2F23A 2WLIB 4ABMA 4O4LB 4WFEA 4DV7B 4PA4A 4MVZA 4ZKIA 1AR4A 2EILC 1JOYA 5EZYB 1Z5VA 4FM0A 1YI2V 3CRCA 2QKCA 4YIPA 1OZ0A 4F6EA 2X6BA 3C90A 3E8FA 4AI8A 5B1BC 2DN9A 4FLXA 3QG5A 4GKKB 2HR3A 4IT5A 4BIZA 4DW1A 3B09A 5EBMC 1N32B 3K04A 3HKCB 5LP6C 1GK9A 2ZM6O 2OTLV 4NR1A 4R50A 3BVOA 1H8EG 4FFBB 2JJ1G 1I94B 1I5XA 3S3WA 4XBFA 1RM1C 5FPOA 1XILA 3WU2Z 2P4VA 1F7YA 2LW1A 3OE7G 3F7YC 4WFGA 3F7VC 2UUAB 1ZLZA 4PDRA 1R3LC 4X62O 3H9VA 4PV1B 2PY5A 2HP8A 4B3TB 2W0XA 1FAFA 1K7DA 2ZKOA 1BGYH 3K57A 5EC2C 5LP6A 4LFCB 5B1BB 2FYUH 4K8ZA 4JI0O 2XAJA 5LYJA 3LDCA 4O4JB 3OAAG 2ILMA 2H8PC 1L1FA 1K4DC 1BS3A 2E5LB 3RYCA 1ZX3A 3Q4HA 1B04A 5J2TA 2W6IG 2E74B 4BR6A 2FL4A 2ZNJA 4YJ2B 4GZRB 3I5DA 5H2FZ 2DMXA 2N04A 2Y69C 4F6RB 2CTPA 1Y74B 4F4LA 3HB3B 2R9IA 4B3RO 3K0DA 3ASOB 1WA8B 2Q7HA 2CDYA 1XMOB 5C8YA 3TJTA 3FD9A 3MD0A 4TUYA 3AG4C 5IY5C 3SPHA 1WB7A 1R1BA 2P67A 3SYPA 4HBNA 3ZX6A 3FB8C 5L3GA 4DR1B 2WLJA 1WP7A 3JASB 4TQFA 4D6TH 1WB8A 2JS3A 3ZN0A 4B3TO 2EINC 3HKCA 1E79G 4TV8B 5CA1B 2Q73A 1AVMA 3OMNB 4FLZA 2CGOA 4CH4A 1SC5B 2F95B 1F23A 4WF9V 3E2EA 3FFQA 1IBKB 2JJ2G 1QU7A 1SESA 2QWOB 4FLWA 4X20A 2NNUA 1EN6A 4LC1A 3U11A 5KHHA 4B3MB 1FJGO 3M8AA 4E2LA 2R9RB 4I55A 4OX9B 2BTQA 1QR9A 1I94O 1H2NA 2QE7G 4MTOA 4TV9B 3N2GB 4X65B 3H1HH 2GBOA 4O4LA 4DV4B 2GSMB 5JWPA 3ZRWA 4C7UA 4PA9A 1K33A 3ZHSA 4ZI7B 3G71V 3GVMA 3OR6C 1N8RW 4PD4F 4U3JB 4P2ZA 1P4RA 4WFFA 4XDLA 4Q6GA 5JH7A 2IJHA 3H1LH 3HKDB 5JCOA 3SJBC 1MABG 2G38A 3B8MA 5CB4A 2HG5C 4JI6B 1ZTEA 2DWEC 4MVUA 1VQLV 4QPKA 4LWSB 1SA0B 4MSWC 4DO2A 1V54B 4WBNB 2Y0IA 4QGPA 2QWNB 4LF4O 1BQZA 3UT5B 3OTOB 1GN4A 4I4TB 4LF7B 3ZHQA 4RUEA 2QDOA 4JGSA 2Y69B 4IGGA 3CCQV 3JD3A 4OPAA 3CC2V 1YEWA 2DJVA 1KP3A 2CTRA 4E4EA 1YXBA 1BMFG 4K0KB 4JASA 3K5LA 1S5HC 3T1CA 2X7RB 1K9MW 3P3PA 3EHBB 2YSUB 4OX9O 3DXRA 4JYBA 4LNUB 3E89A 5LMUB 4O2AB 1NT2B 2YICA 2YUAA 1XDCA 4X1YA 3ABKC 4UV9A 4KP4A 2C2AA 4FMTA 4JTCB 4MS2A 1I5YA 1P49A 1Y76A 2YIBD 2ZIOA 1PL0A 1XI1A 3GWOA 3OR7C 2DWDC 4JF3A 3AG2B 1U96A 2AW9A 3BCCH 3EXAA 4O2BB 1RPRA 4YJ2A 2EILB 4TSFG 2ZINA 1EN4A 2WA3A 4TV9A 3RVYA 3AK1A 5CN0A 2JEUA 5IWAO 4X66B 1FPOA 2XAQA 1XHXA 3QO8A 4FLVA 3JAMN 4H37A 4R6ZA 5H6RA 2QEXV 2R70A 2YXLA 1HR0O 2N05A 1D5NA 1SERA 3ZHUA 4QE7A 3LSUA 2Q8VA 3BA8A 4JZ2A 1US6A 4CS3A 5IY5B 3IC7A 1XOUA 3ETEA 3SJQC 4QJFB 1XMQO 1VQ6V 3T1HO 2E5LO 3ABTA 3RYCB 1AROP 2LFSA 5EBLC 2ODMA 1I7FA 1WJZA 1W0JG 1SS3A 1VF6C 4FVMA 3CSXA 4RAIA 2DOSA 2KG7B 4JYAO 3AG3B 3C3TA 4X20B 1HNXB 2CH7B 1GRJA 4PA7A 1GM7A 1M57B 2ZR2A 4F6RA 3I55V 3DXRB 2EIKB 3VQWA 2RN9A 4TQDA 3A0HZ 4IYIA 4H33A 4CH3A 1K8AW 1HNZB 1KKCA 2Z0AA 2FTKA 2PTMA 4LF5O 1M5IA 3KG2A 1SETA 3W7SA 5CA3A 2P06A 1KECA 2QWQB 2QM8A 1HP8A 3CPWU 2QWPB 2IJKA 3JAKA 4J7ZA 4I7ZB 2BSKB 2YIBA 3K9SA 4HAMA 5L3CA 3K79A 4K8XA 5LHIA 5KAIZ 4PA6A 1RP3B 2JEXA 1VF5B 3OMAB 1AJNA 2EJRA 3OFNG 1RSOB 4MVRA 1NZ6A 1Q7YW 1JPXA 4JI4O 4UUJC 1G6UA 1M4UA 2BOCC 1S77D 3RGBA 3JAWA 2YXHA 5IYBO 2E76B 3MHSC 2VQEB 3N27A 3RN4A 1HNXO 4LFCO 3W7UA 3OD4A 4MVSA 1PKXA 3CMAV 1PPJH 5L3EA 1PV0A 3ZMUA 3ZCCA 5CMUA 3ZJZA 2GUZB 4GX5A 1VQNV 1QNMA 3OTFA 2BOBC 4PHZA 1AI6A 2A79B 4J7KA 1ROPA 4NXNO 3CP1A 2WSSG 4R7CA 2V4DA 1DGSA 4UCSA 1PP9H 4UVCA 2EBOA 3G6EV 3FB7C 1R73A 1KKDA 4UVBA 2XASA 4JV5B 3ETDA 1VQ9V 2WLNA 4DV2B 5LGUA 1GKFA 2QWRB 1F51A 4B3SB 1MZEA 3K03A 3H01A 1VARA 4KFMA 3ZBHA 4LFAB 3IAYA 2Z3YA 3OGCC 4X1IB 2DE0X 5IT9N 2WA4A 1FXHA 3K0GA 3CCVV 5FL7G 2HKOA 2FMLA 2IH1C 3CRQA 3VQVA 4LF9B 1BHBA 2GDSA 4DV7O 3ICXA 3L74H 4FM2A 3CS5A 2XHBA 1SZTA 3G4SV 4I5SA 3L70H 1M9NA 4LNUA 5DM6V 3LUTB 1MSDA 1BSMA 1NQTA 4OXSA 1FJGB 1M56C 3DC6A 5K1PA 3KCYA 1F4NA 1GN2A 1NTMH 2W0FC 5D5QA 4TWKA 5CA0B 4DR3B 1FXKC 2RDCA 4O2BA 2CH7A 2VQFB 3SGIA 2KKWA 4FLYA 4KHPB 2WLLA 4H44B 1A32A 2A3QA 1F4MA 3CC4V 3ZMZA 4D7TA 4X8AA 2KG7A 3BPZA 3KKYA 1AP5A 4HNAA 1Y67A 3JD1A 2PI4A 4DUZO 4KL1A 1KUQA 2YXYA 2IBZH 1CXZB 3PJSK 4UCTA 5KX5B 1MSWD 1MG1A 3P3NA 5JVDB 3E35A 5KMGB 1KYOF 3B2EE 3TETA 3FKSG 1Z5WA 4FFKA 1V55B 1QHTA 1QBZA 4IIJA 1MA1A 5ITZB 1RFYA 1EM1A 1KB9F 3HPLC 3K5OA 5FNVB 4DR4B 1DTOA 2PGGA 1V54C 5IJ9B 1FXKB 1X59A 1NU1H 3K9AA 1OCRC 5D5PA 2ETNA 4MVOA 2YEVA 1SQQH 2R72A 4FJCC 2QKSA 2P22C 2DYRB 2ZXWC 1HNWO 4LF6O 1GM9A 2ZM6B 3KCXA 3APQA 2Q5ZA 4IYHA 4MTFA 2L6LA 3CCSV 4DV3B 1PNMA 1VF6A 1FFTB 3E22A 2FKXA 1N4CA 2ZE7A 4DRXA 3CCMV 3LNMB 1Q81W 4ZOLA 1AP6A 4YXWG 5B5EZ 2OCCC 3M99B 3SPIA 3H1JH 3G6BA 3K3WA 3CRRA 3R66A 2A06H 4YY3O 3T1YO 2F4VO 5B66Z 1OCZB 4UCOA 1N36O 4J11A 3EFFK 4HNAB 5CBHA 1HWYA 1HW7A 1NS1A 3UT5A 4I0XA 3WB1A 3MAQA 3RBZA 3LSSA 2QKAA 1Y74A 5HFMA 1QCEA 4X1KA 1BL8A 2IU3A 4YJ3B 4LF7O 4GKJO 4JYCA 4B7KA 2BTOA 3D36C 1N36B 4RQFA 3K59A 4I50B 4GX1A 3FAVA 4FZ0A 1XNQB 5KLVH 4NXMB 1PNKA 3WG7C 5ITZA 2UXDO 4U3JA 5BXZA 2D3OW 2H94A 5JCOC 2RNBA 5LA6B 3WFVA 1Q5OA 2NLJC 5L3DA 3ABMC 4G28B 2X6AA 3RWRD 4B08A 1N34B 3LDEA 2RJZA 2L35A 5BZBA 4QPJA 2GUZA 4YHHO 3P32A 4UCUA 1YDXA 2JVDA 2YEVB 2IU0A 2GTSA 2UUAO 1XMOO 3JAKB 3LDDA 4K35A 1GAXA 1D5AA 5IE9A 5BMVA 2Y0PA 3ZN1A 4FZ1A 1VQ5V 3H1KH 4JI7B 1COWG 3SDLA 3OUSA 1OCOC 3ZS8C 3JD4A 5BR8O 1CPYA 3QVNA 2HJDA 2JK5C 2UUCO 1IXBA 4ZOLB 4DW0A 3ZRWB 3HR0A 4LFBO 1U97A 1BE3H 4FK5C 3ASOC 2VRZA 1LUVA 1R3KC 3THOA 2ZT9B 2UXBB 3N2GA 4GKJB 2VQEO 1Y76B 3K06A 2LO1A 3LSQA 4JI2O 1M93A 1IVSA 4PDLA 1SRYA 1MMMA 4AILC 2CTWA 3T1HB 1CP9A 2BCCH 2RQ6A 5CA0A 2YI9A 4WFAV 1KQSU 3FYIB 2NN4A 3WB2A 1H2KA 2GHYA 2QSAA 5LMNB 3IC9A 1NVPB 1QVGU 4LR3A 3TGUH 4OPHA 1NBMG 5IJ9A 2ITCC 2R9AA 1OCOB 1L0LH 1OV9A 1URFA 1JX9A 4MT8A 4DV0B 3FAVB 1NH2D 1FYJA 2RCVA 1H8HG 4W4LA 2F43G 3E8HA 4JI1B 4JI7O 1FFXA 1IBMO 1WNSA 2ZIMA 4LF8O 3JSNA 1WAZA 4BW5A 4J10A 1NR1A 2HHHO 1P7BA 1NVPD 2XNDG 5KX5A 4JI6O 3JALB 2QM7A 2VS0A 2ZXWB 3AG3C 4J9ZB 3T2MA 5KA6A 4X89A 1MOFA 2OYQA 3L75H 1K34A 1JR9A 4NVPA 1ZUQA 2YDEA 5LHHA 3PN1A 1OCRB 3E83A 1SQGA 3CD6V 1EN5A 2NR5A 1DK1A 2Z5UA 2KB1A 4A5UB 2MW2B 3Q4HB 2CUGA 2DYSC 3W7WA 5B1NA 1AJQA 4K0KO 3B4SA 4X64B 2JGDA 5FNVA 2LGWA 3ZRSA 5KA5A 2OT5A 4B7EA 4CZZA 4CBCA 2ZQMA 5L3FA 2F66C 1VQMV 3FYEB 3IJ4A 1PM9A 2VWKA 1XNRB 2LW7A 4GUNA 3ASNC 4PA3A 2ZE6A 4G2KA 1VP7A 3CMEV 3IGAC 4I9QA 1LNQA 1NTZH 3UO2A 2XT9A 1XQ8A 1BQ0A 5GONA 4CH6A 3JATB 3JCUZ 4JAUA 1SQXH 4JI3B 5IYDO 3ABLC 3QO7A 1V55C 3X2QB 1YITV 1PNLA 1E1QG 5EC1C 4FLUA 4JYYA 1B6QA 3STZC 5LA6A 5IDJA 1IBMB 1PL4A 3O65A 1X4TA 3ETGA 3JD2A 1Q6IA 5HFLA 4MW3A 1H2SB 1P84F 1WN7A 5CA1A 4X66O 2E3CA 1R3IC 5LXTB 2Y4UA 3WG7B 2ADPA 2UU9O 1K5SA 3AG1C 4JI5O 1JFFA 2V7QG 5KUKA 4DV5O 1QVFU 2YIDA 3VOUA 4X64O 1SQBH 1SQPH 1K73W 1Z2GA 2QJ1A 4RWUA 3SYOA 1N32O 4DK0A 1FS0G 1N34O 3E22B 4RUFA 1K97A 1QQCA 3SR2C 1YJWV 4AQYO 1NH2B 2B1IA 5GTHZ 1HDJA 2Y4TA 2UXXA 1XEQA 4NTWA 2IJJA 2Q4PA 4U7NA 4P9PA 1KBHA 4H13B 4AHCA 3E8GA 5BMVB 1IURA 3E8BA 1NTKH 4IHJB 3GWKC 5KHGA 3RYIB 3SYAA 5EBWC 2GV9A 4ZHQB 2YIAA 2WLIA 4WFBV 1O9HA 1WLEA 5EK0A 1XMQB 2M7WA 1OHHG 1KP2A 4RQEA 4O4JA 4JTDB 4I50A 1TUBB 3T4ZA 4DUYO 1FKAO 2EIKC 3ASNB 1T5EA 1ORQC 2P90A 2IM9A 3NXSA 1G4YB 4PI0A 4ICGA 2WLHA 3I56V 2HFEC 4NKGB 2MK3A 4X9QA 1JA8A 2N74A 4I55B 2BTQB 1DF4A 2EIJC 2JGDB 4TUYB 5EIBD 3GB7C 1Q82W 3S3XA 4KHPO 2YI8A 4P30A 2HJFC 2ATKC 1J5EO 4NXMO 1GO3F 1XNRO 2XAFA 3RYFB 4LBEC 2K1EA 3T4DA 2ADQB 4Z1VA 4DR2B 3CEIA 5GONB 4EB6A 3JALA 3HKDA 3OEEG 4TV8A 4PDVA 4EKWA
chains in the Genus database with same CATH topology
2A0LA 2QE7G 4MTOA 2Q68A 4MTFA 3CCSV 1PNMA 2IW5A 1FFTB 4ZBMA 4U7OA 1AI4A 4DXWA 2WWWA 3STLC 3BEHA 2GSMB 1KD1W 3CCMV 3DGEA 3LNMB 4JPRA 3ZRWA 3CCEV 1Q81W 1TUEB 2Y48A 4PA9A 4YXWG 2OCCC 2Q6AA 3JYCA 3M99B 5B3SC 3ZRVA 1K33A 2LP7A 3F5WC 4PELA 3G71V 3SPIA 3K3WA 2X6CA 3OR6C 1N8RW 3IFXA 4P2ZA 1P4RA 4Z1MG 1VQ7V 4WFFA 4XDLA 1OCZB 2X0LA 3EFFK 3AEIA 4PDMA 2IJHA 1HWYA 5CBHA 4GX0A 3JD0A 1MABG 3B8MA 3RBZA 2HG5C 2DWEC 3LSSA 4MVUA 1QLEB 5HFMA 1QCEA 4N21A 4QPKA 2QA4V 1VQLV 3CYOA 4MSWC 5J9PC 4DO2A 1BL8A 2IU3A 1V54B 4JYCA 3W7XA 3W7TA 4RO2A 3QO5A 3FB5C 4RQFA 3SPJA 2ZDIC 1WPXA 3ABLB 4GX1A 2P6JA 3E86A 3AG1B 1IXMA 1R6NA 3CCJV 4RUEA 1YTFD 3R65A 1PNKA 2WPDG 3WG7C 4JGSA 2Y69B 3RW0A 3CCQV 3JD3A 3ZMSA 3CC2V 3CC7V 1ZWIC 2D3OW 1S76D 1KP3A 2H94A 2IH3C 2P7TC 4LCUC 4MW8A 5LHGA 1JQ0A 1M90W 2DW4A 4JTAB 3WFVA 5B1AB 1K5QA 2NLJC 1BMFG 5L3DA 3ABMC 4G28B 2PI5A 1J95A 2X6AA 4JASA 1M1KW 3LDEA 1S5HC 1YSCA 3T1CA 2X7RB 1K9MW 5BZBA 2QTOA 4UV8A 3EHBB 2YSUB 4QPJA 1QR8A 4JYBA 3P32A 1K4CC 2YEVB 2IU0A 3E89A 5H9CA 3LDDA 1FXVA 2DYSB 3ABKC 4UV9A 4KP4A 5L3BA 3SYQA 2C2AA 4FMTA 4JTCB 5KUMA 1YJ9V 4MS2A 1I5YA 1VQ5V 3ZN1A 3ZMVA 1JJ2U 1R6KA 1COWG 3OUSA 4HZ3A 1OCOC 1OCCB 1M56B 2IJIA 3JD4A 2AHYA 1PL0A 1CPYA 3GWOA 3OR7C 2DWDC 4JF3A 4WCEV 3AG2B 5CBGA 1E1RG 2EIJB 2JK5C 1Y66A 3D3IA 1VQ4V 5GW7A 3ZRWB 3CXCU 1RPRA 2EILB 4TSFG 1THZA 4FK5C 3ASOC 3RVYA 3B8NA 1R3KC 5CN0A 3RVZA 2JEUA 3QNEA 4MVQA 1YTFB 2Q67A 3ZIAG 1ENVA 1KC8W 5CBFA 3OUFA 4ASUG 4P9OA 3X2QC 3K06A 2XAQA 1YJNV 3TCUA 3QO8A 2LFRA 3LSQA 2DQ0A 3K08A 4H37A 4R6ZA 5H6RA 2QEXV 4PDLA 1SRYA 1SERA 4QE7A 1XL6A 1OCCC 3UM7A 5IY5B 1CP9A 3IC7A 4WFAV 3ETEA 5C93A 4BIUA 3JCZA 1KQSU 3FYIB 3SJQC 4QJFB 2XOKG 1RPOA 4WFHA 2GHYA 3CCLV 1JCHA 1VQ6V 1NVPB 1QVGU 4X88A 3ABTA 1PD3A 1AROP 2LFSA 5EBLC 1W2BU 2OCCB 1NBMG 1OCZC 1W0JG 3MHHC 4XDKA 4RAIA 2ITCC 1YIJV 4KUMA 1OCOB 3AG3B 2WLKA 1JX9A 4PA7A 4MT8A 1GM7A 4BAYA 1M57B 2ZR2A 5H6QA 1NH2D 3I55V 1H8HG 2XAGA 2EIKB 2F43G 3D36A 2EZOA 4QNHB 4N23A 3E8HA 4XDJA 1QLEC 4H33A 1H2GA 2Q69A 1K8AW 1EFRG 1EZJA 5DN6G 4G27B 2EINB 4BW5A 1NR7A 2FTKA 3ML0A 1S0VA 4Q20A 1NR1A 4JAVA 3W7SA 2HLDG 1SETA 2ZD9A 3KG2A 3FB6C 5LBQA 1P7BA 1NVPD 1GTOA 5CA3A 1NKDA 1EBOA 2XNDG 4QE9A 1KECA 3ZMTA 2QM7A 2ZXWB 3AG3C 4J9ZB 2QM8A 3T2MA 5KA6A 1RM1B 4X89A 3CPWU 1MOFA 2EIMC 2IJKA 4R8CA 1K34A 4GCZA 1AI7A 5LHHA 1H38A 3ABMB 1K3EA 1OCRB 3E83A 4HAMA 3SYCA 3CD6V 2Z5UA 2KB1A 5L3CA 3K79A 3OEHG 2ZDIA 5LHIA 2A9HA 4PA6A 4GT1A 2JEXA 2DYSC 3ABKB 5LGNA 3W7WA 1QLNA 3OMAB 1AJNA 1AJQA 2EJRA 5B1NA 4UXNA 3OFNG 1VQOV 1S3JA 4MVRA 3ZRSA 5KA5A 1VQKV 2OT5A 1AR1B 4CZZA 1Q7YW 1Y4MA 1JPXA 2ZQMA 4CBCA 5L3FA 3FYEB 1VQMV 1S72V 4UUJC 2DYRC 2UXNA 1CEZA 3SPCA 4FPPA 4PA3A 3ASNC 2BOCC 2HVJC 4G2KA 1S77D 2EIMB 4MVMA 3CMEV 4MTXA 3AG2C 3IGAC 2WLIB 2DQ3A 1LNQA 4J9YB 4WFEA 5IYBO 3MHSC 4QIWF 4PA4A 4MVZA 3OMIB 4ZKIA 4TT3G 2EILC 4JAUA 5B3SB 1JOYA 3W7UA 4MVSA 1YI2V 1PKXA 3CMAV 5L3EA 1OZ0A 3DTUB 5IYDO 3ZMUA 2X6BA 3ABLC 3ZCCA 3E8FA 5CMUA 3ZJZA 5B1BC 3QO7A 1V55C 4GX5A 3X2QB 1YITV 1PNLA 1VQNV 1E1QG 4MTGA 5EC1C 4GX2A 2BOBC 3CCUV 1B6QA 1AI6A 3STZC 2HR3A 2A79B 5IDJA 4BIZA 1ROPA 3ETGA 3CP1A 2WSSG 3JD2A 4R7CA 5EBMC 4MW3A 5HFLA 3K04A 4FIPC 4UVCA 1GK9A 2EBOA 1DLBA 1G8MA 3G6EV 3FB7C 2OTLV 1R73A 1KKDA 4UVBA 3BY6A 2XASA 4R50A 3ABUA 3ETDA 1R3IC 1VQ9V 2WLNA 1H8EG 2ITDC 3WG7B 2JJ1G 5LGUA 1K5SA 1GKFA 1F51A 3A0RA 3AG1C 1I5XA 5E1AC 2V7QG 4XBFA 5KUKA 1RM1C 5B1AC 3B77A 3K03A 1QVFU 3H01A 4I9WA 4KFMA 1M57C 3OE7G 3F7YC 4WFGA 3VOUA 2XAHA 3F7VC 2Z3YA 1JVMA 3P30A 1R3LC 3OGCC 4PDRA 1GMGA 1K73W 1FXKA 3SYOA 1BHAA 1FXHA 3K0GA 3CCVV 3VBBA 2B5UA 1FS0G 2CK3G 1K7DA 2HKOA 5FL7G 2IH1C 5EC2C 1BHBA 2WLLB 5B1BB 4RUFA 1DF5A 1VQ8V 2XAJA 2AHZA 3LDCA 5IYCO 1GM8A 1K97A 3OAAG 1SZTA 3G4SV 1XL4A 4I5SA 2H8PC 4HYOA 1L1FA 1K4DC 1W0KG 1YJWV 2B1IA 2HVKC 1NH2B 1M9NA 5DM6V 3LUTB 1NQTA 4OXSA 2UXXA 1M56C 2IJJA 4U7NA 4P9PA 2W6IG 2JDIG 3E8GA 1F4NA 2W0FC 4TWKA 1FXKC 3E8BA 1Q86W 2Y69C 3SYAA 1YHQV 4F4LA 3HB3B 5LGTA 2R9IA 5EBWC 3K0DA 3ASOB 2WLIA 4WFBV 1WLEA 2WLLA 2JIZG 5EK0A 2M7WA 3ZRXA 1AI5A 1OHHG 1F4MA 1KP2A 3ZMZA 3CC4V 4RQEA 4X8AA 4LP8A 1NJIW 4JTDB 2WAMA 3MD0A 3AG4C 3JD1A 2PI4A 3T4ZA 4L87A 5IY5C 2EIKC 1K92A 3SPHA 2ZR3A 3ASNB 3PJSK 2V1DA 2P67A 3SYPA 1MSWD 1ORQC 1MG1A 2P90A 3FB8C 3E35A 2B1GA 3NXSA 5L3GA 3TETA 1G4YB 2WLJA 2EZPA 3FKSG 2WLHA 3SPGA 3I56V 3ZN0A 2HFEC 1V55B 2OTJV 1VQPV 1QBZA 2EINC 2MK3A 1E79G 5B1OA 1DF4A 3HPLC 2EIJC 3GB7C 3OW2U 3OMNB 1Q82W 1DTOA 2WLMA 4P30A 2HJFC 1F23A 2ATKC 3AG4B 4WF9V 1V54C 3OM3B 1FXKB 3E2EA 4UVAA 1GO3F 2XAFA 3K9AA 2JJ2G 1R3JC 1UJWB 1OCRC 1SESA 4MVOA 2NNUA 2YEVA 4LBEC 4LC1A 2K1EA 4FJCC 3T4DA 2QKSA 2ZXWC 2DYRB 3UKMA 3CCRV 1AJPA 1GM9A 2W6JG 3TK1A 4E2LA 2R9RB 3OEEG 4PDVA 4EKWA 1QR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZP A;  4FIP C;  1Y66 A;  1EBO A;  1F23 A;  5H9C A;  4JGS A;  2EBO A;  1SZT A;  1DLB A;  5KA5 A;  3MHS C;  3K9A A;  2M7W A;  2OT5 A;  5KA6 A;  3B8M A;  1Y4M A;  1JPX A;  4FK5 C;  1I5Y A;  3P30 A;  1JQ0 A;  1MOF A;  1QBZ A;  2MK3 A;  3B8N A;  5CMU A;  1QCE A;  4N21 A;  5CN0 A;  3WFV A;  4JPR A;  5HFM A;  2EZO A;  3CYO A;  1K34 A;  4FJC C;  4N23 A;  1ENV A;  3M99 B;  1K33 A;  2LP7 A;  4G2K A;  2X7R B;  1DF4 A;  1I5X A;  1QR8 A;  1MG1 A;  3GWO A;  3MHH C;  4JF3 A;  4E2L A;  2P6J A;  3B77 A;  3H01 A;  3CP1 A;  1DF5 A;  1QR9 A;  5HFL A; 
#chains in the Genus database with same CATH topology
 2A0L A;  4DYL A;  4LF4 B;  4U7O A;  1AI4 A;  4DXW A;  2WWW A;  3STL C;  3BEH A;  1KD1 W;  3BAB A;  4IHJ A;  1TUE B;  1MZF A;  3L72 H;  5B3S C;  3ZRV A;  3J80 N;  4PEL A;  1SA0 A;  1IZ3 A;  4Z1M G;  1VQ7 V;  5KHI A;  1SKV A;  5C8Y B;  3K58 A;  1TUB A;  4PDM A;  4GX0 A;  3A0B Z;  1JMK C;  4ZI7 A;  2UXD B;  1QLE B;  3CYO A;  1JFF B;  1VF7 A;  5J9P C;  3JAT A;  4UCV A;  3FB5 C;  3SPJ A;  2CGN A;  2ZDI C;  1WPX A;  5EYP B;  3ABL B;  2P4K A;  3BFR A;  2HEP A;  1IXM A;  1YTF D;  3R65 A;  3VQY A;  3L9D A;  3AK2 A;  3RW0 A;  3ZMS A;  4LCU C;  2P7T C;  4MW8 A;  5LHG A;  1JQ0 A;  1M90 W;  1TAE A;  4DR3 O;  5B1A B;  3RYH B;  1K5Q A;  3JAS A;  4DR6 O;  4H0L B;  4YJ3 A;  4WBN A;  1SQV H;  5H5N A;  1K4C C;  5AG2 A;  5H9C A;  3O9O A;  5LOV B;  1FXV A;  2DYS B;  2OWO A;  2AXT Z;  4EFE A;  1YJ9 V;  2UUB B;  1JJ2 U;  3G80 A;  1R6K A;  3JAR A;  1IBK O;  4HZ3 A;  4EFB A;  4O2A A;  4X62 B;  4DV2 O;  2AHY A;  5IYZ B;  2Q7E A;  1UFI A;  5CBG A;  2EIJ B;  1Y66 A;  1VQ4 V;  2JRI A;  4DUY B;  1THZ A;  4IL6 Z;  1BCC H;  4UFZ A;  3RVZ A;  4MVQ A;  1YTF B;  4DK1 A;  4O4H A;  5CBF A;  3OUF A;  4ASU G;  4P9O A;  4DR5 O;  3X2Q C;  5A2Q N;  2DQ0 A;  4DR1 O;  1G1X B;  5JQG B;  2EJ7 A;  3HKB A;  1XHZ A;  1N0N A;  1XL6 A;  1OJH A;  4TOI A;  5LMN O;  2AZ0 A;  4U3F H;  2GTA A;  3UM7 A;  4LF5 B;  1L8D A;  5C93 A;  4BIU A;  3JCZ A;  4DR2 O;  4DR5 B;  2XOK G;  4WFH A;  5JH7 B;  3CCL V;  2B9Z A;  3U10 A;  2F1M A;  4X88 A;  1PD3 A;  1AIL A;  4K3A A;  4ZHQ A;  2OCC B;  4DUZ B;  3MHH C;  4XDK A;  4DV4 O;  1YIJ V;  4KUM A;  2WLK A;  3AG7 A;  3J81 N;  4FFB A;  5F2V O;  4BAY A;  5H6Q A;  4Z2W A;  4I4T A;  2UXC B;  3CJH B;  1I08 A;  2EZO A;  2AGA A;  3CXH F;  4N23 A;  5FPR A;  5IJ0 B;  1QLE C;  1YF2 A;  1H2G A;  1TGO A;  4DR4 O;  4JAA A;  1EZJ A;  3RFR A;  4ZIB A;  5DN6 G;  5JJN B;  3F5T A;  1XBL A;  1S0V A;  4Q20 A;  4JAV A;  2ZD9 A;  3FB6 C;  5LBQ A;  4JI8 O;  1NKD A;  1EBO A;  4QE9 A;  1D2D A;  3ZMT A;  3UO3 A;  1RM1 B;  1TVK B;  4R8C A;  2EIM C;  1ZSP A;  1N0J A;  4X1I A;  1H38 A;  3ABM B;  3BRC A;  3SYC A;  1SF9 A;  1XNQ O;  3OEH G;  2ZDI A;  4DV6 B;  2A9H A;  4GT1 A;  5LGN A;  1ZL8 B;  4J41 A;  3CRA A;  1TA8 A;  1VQO V;  2OIE A;  1VQK V;  2BSK A;  4BW9 A;  3QF7 A;  1HNZ O;  4NYK A;  2EX3 A;  5LYJ B;  1S72 V;  2M6Y A;  2DYR C;  1CEZ A;  1V9P A;  1Q90 D;  4DV6 O;  4YHH B;  3K5N A;  5JJE B;  4BWA A;  4MTX A;  3AG2 C;  3D8C A;  2HHH B;  2DQ3 A;  4J9Y B;  3AK3 A;  3APO A;  4QIW F;  5EIB C;  3OMI B;  1WPB A;  4TT3 G;  5B3S B;  3LNN A;  3OT7 A;  1WP8 A;  3DTU B;  5TIS Z;  3HKB B;  1VIB A;  1XRE A;  2JGU A;  4MTG A;  1IBL O;  2UUC B;  4GX2 A;  3CHX A;  3CCU V;  3OGI B;  4CH5 A;  1LUW A;  4DR7 O;  2XTA A;  5LXT A;  4B3R B;  4DV5 B;  3RT3 C;  4FIP C;  3D3Q A;  3JAW B;  1DLB A;  1G8M A;  2UU9 B;  3M7M X;  1B3Q A;  4DV1 B;  3BY6 A;  1FFX B;  3ABU A;  5EYP A;  1EZV H;  3K5M A;  2ITD C;  1H2L A;  1BT8 A;  3KZI Z;  1LR1 A;  3FX7 A;  3A0R A;  5E1A C;  1S5J A;  5B1A C;  3B77 A;  3JAR B;  4I9W A;  1M57 C;  2O57 A;  4KXR A;  4UB8 Z;  2XAH A;  5J2U B;  5JJJ B;  5LMU O;  1Q43 A;  3BA9 A;  3J7A U;  1JVM A;  4EB6 B;  3P30 A;  1GMG A;  1FXK A;  1FD9 A;  1BHA A;  3N2K A;  4DV0 O;  3VBB A;  3UCS C;  2B5U A;  2LQT A;  1TVK A;  4NXN B;  2CK3 G;  4BIO A;  5GTI Z;  2OCH A;  3SJA C;  2WLL B;  1N33 B;  1DF5 A;  5E79 Z;  1VQ8 V;  2AHZ A;  5IYC O;  1GM8 A;  1XL4 A;  4HYO A;  4LH6 A;  5LL6 Y;  1W0K G;  3UQ8 A;  2HVK C;  3H1I H;  4O4I A;  3RYI A;  2ZE8 A;  1JJO A;  3OTO O;  4LH7 A;  2JDI G;  1VMG A;  3L71 H;  4LF9 O;  5IWA B;  2ZNI A;  2A7W A;  2Q0O C;  1Q86 W;  3HKE A;  3DSQ A;  1YHQ V;  5LGT A;  4GYC B;  5IYZ A;  3ETQ A;  2JIZ G;  3EVK A;  3ZRX A;  1AI5 A;  4LP8 A;  1NJI W;  2WAM A;  4L87 A;  1K92 A;  5A9G A;  2ZR3 A;  2V1D A;  4LWS A;  4NB5 A;  2PYL A;  2B1G A;  3CX5 F;  1AR5 A;  2QTS A;  1Q3E A;  2EZP A;  1IDS A;  2FB5 A;  3SPG A;  5JQG A;  4JI1 O;  2OTJ V;  3CRM A;  1VQP V;  4CC5 A;  5JVD A;  1MNG A;  4LFB B;  2VQF O;  5B1O A;  4UB6 Z;  2EUL A;  3OW2 U;  1Y6X A;  1O9G A;  1IBL B;  2WLM A;  3AG4 B;  3OM3 B;  2OIG A;  4UVA A;  4JI5 B;  4FM1 A;  4EEQ A;  1UJW B;  1R3J C;  4LF6 B;  3TXQ A;  4GLX A;  3JSL A;  5J2U A;  4DV1 O;  2Q7G A;  4PJ0 Z;  3UKM A;  4J80 A;  2KQX A;  3CCR V;  1AJP A;  1IX9 A;  2W6J G;  3TK1 A;  2CE4 A;  4YIO A;  2Q68 A;  3ZHT A;  3L73 H;  2CAZ C;  2IW5 A;  4JI4 B;  4ZBM A;  3ZED A;  1P7G A;  1S5L Z;  1BZK A;  2UXB O;  4GKK O;  1GN3 A;  3C3S A;  3DGE A;  1XUQ A;  4JPR A;  3CCE V;  2Y48 A;  2Q6A A;  3JYC A;  4CS2 A;  2LP7 A;  2PYJ A;  3RYF A;  3F5W C;  3NR7 A;  2X6C A;  3IFX A;  4OGQ B;  3BHP A;  3CE2 A;  2KSD A;  4NTY A;  1KU9 A;  1Q6U A;  2X0L A;  1R6T A;  4X65 O;  3AEI A;  3JD0 A;  2LJ2 A;  3WB0 A;  2F93 B;  1ZL8 A;  4N21 A;  2QA4 V;  5KMG A;  3ZHV A;  3W7X A;  3W7T A;  4RO2 A;  3QO5 A;  5EZY A;  1N33 O;  2F4V B;  2P6J A;  3E86 A;  3AG1 B;  1R6N A;  3U0Z A;  3CCJ V;  4AQY B;  1GN6 A;  2WPD G;  3CWB H;  3DC5 A;  4IIJ B;  1GH6 A;  2P5O A;  3CC7 V;  1ZWI C;  4JI3 O;  2QGN A;  1S76 D;  2IH3 C;  2K9P A;  3BAA A;  1YVW A;  2DW4 A;  4JTA B;  2CTQ A;  1H2M A;  5LP6 B;  2PI5 A;  4JV5 O;  1J95 A;  1W59 A;  5DED A;  1M1K W;  1YSC A;  2ARH A;  2QTO A;  1YZB A;  4UV8 A;  1QR8 A;  3A2F A;  3N2K B;  4B3M O;  3CB2 A;  4DR7 B;  2D2C B;  2JS5 A;  5L3B A;  3SYQ A;  5BR8 B;  5KUM A;  3ZMV A;  2UXC O;  1OCC B;  1M56 B;  2PF4 E;  3VQX A;  2IJI A;  2BE3 A;  4X1Y B;  4PI2 A;  1L0N H;  4W4K A;  4WCE V;  1ZAU A;  1E1R G;  1SZX A;  4O4H B;  1SQF A;  3D3I A;  4DRX B;  5GW7 A;  3CXC U;  2RMK B;  1VEW A;  2H3O A;  1J5E B;  3B8N A;  4JI2 B;  3QNE A;  2Q67 A;  3ZIA G;  1ENV A;  1KC8 W;  2YC0 A;  1RSO A;  2E75 B;  1YJN V;  3TCU A;  2LFR A;  5K1X A;  3K08 A;  3ZHR A;  4I0X B;  3QTC A;  4B3S O;  5FLX N;  3G67 A;  2UUB O;  4X1K B;  1OCC C;  1NI8 A;  4JI0 B;  4NTX A;  3TXS A;  4YY3 B;  3T1Y B;  1RPO A;  1JCH A;  4J42 A;  4L8J A;  4O4I B;  5CB4 B;  1HR0 B;  1W2B U;  2PZS A;  1AB3 A;  1WA8 A;  4FLT A;  1OCZ C;  1YCI A;  3CJH A;  1Q8I A;  1I0H A;  3RYH A;  2VWJ A;  4J7J A;  1Q6H A;  2XUM A;  3SJC C;  4CS4 A;  5KAF Z;  3HKE B;  5BY1 A;  2XAG A;  3D36 A;  4JZG A;  5KHK A;  4QNH B;  4XDJ A;  1HNW B;  4JI8 B;  2Q69 A;  1EFR G;  4LFA O;  4G27 B;  2EIN B;  2Q9L A;  1NR7 A;  4UCR A;  1B06 A;  3ML0 A;  4DV3 O;  2Q0A A;  2HLD G;  1GTO A;  5DEC A;  2LGQ A;  3A8T A;  1UPG A;  5KHJ A;  3MDS A;  5LOV A;  4JYA B;  4LF8 B;  4GCZ A;  1AI7 A;  1KMI Z;  1K3E A;  2PUS A;  2ZCE A;  5IJ0 A;  4DR6 B;  3ABK B;  3B40 A;  4CC6 A;  1QLN A;  4D7S A;  2ZE5 A;  4UXN A;  5J2T B;  1S3J A;  2YS8 A;  1AR1 B;  1Y4M A;  2QR4 A;  2AZ2 A;  2UXN A;  3SPC A;  4FPP A;  2QM4 A;  2HVJ C;  2EIM B;  4MVM A;  2F23 A;  2WLI B;  4ABM A;  4O4L B;  4WFE A;  4DV7 B;  4PA4 A;  4MVZ A;  4ZKI A;  1AR4 A;  2EIL C;  1JOY A;  5EZY B;  1Z5V A;  4FM0 A;  1YI2 V;  3CRC A;  2QKC A;  4YIP A;  1OZ0 A;  4F6E A;  2X6B A;  3C90 A;  3E8F A;  4AI8 A;  5B1B C;  2DN9 A;  4FLX A;  3QG5 A;  4GKK B;  2HR3 A;  4IT5 A;  4BIZ A;  4DW1 A;  3B09 A;  5EBM C;  1N32 B;  3K04 A;  3HKC B;  5LP6 C;  1GK9 A;  2ZM6 O;  2OTL V;  4NR1 A;  4R50 A;  3BVO A;  1H8E G;  4FFB B;  2JJ1 G;  1I94 B;  1I5X A;  3S3W A;  4XBF A;  1RM1 C;  5FPO A;  1XIL A;  3WU2 Z;  2P4V A;  1F7Y A;  2LW1 A;  3OE7 G;  3F7Y C;  4WFG A;  3F7V C;  2UUA B;  1ZLZ A;  4PDR A;  1R3L C;  4X62 O;  3H9V A;  4PV1 B;  2PY5 A;  2HP8 A;  4B3T B;  2W0X A;  1FAF A;  1K7D A;  2ZKO A;  1BGY H;  3K57 A;  5EC2 C;  5LP6 A;  4LFC B;  5B1B B;  2FYU H;  4K8Z A;  4JI0 O;  2XAJ A;  5LYJ A;  3LDC A;  4O4J B;  3OAA G;  2ILM A;  2H8P C;  1L1F A;  1K4D C;  1BS3 A;  2E5L B;  3RYC A;  1ZX3 A;  3Q4H A;  1B04 A;  5J2T A;  2W6I G;  2E74 B;  4BR6 A;  2FL4 A;  2ZNJ A;  4YJ2 B;  4GZR B;  3I5D A;  5H2F Z;  2DMX A;  2N04 A;  2Y69 C;  4F6R B;  2CTP A;  1Y74 B;  4F4L A;  3HB3 B;  2R9I A;  4B3R O;  3K0D A;  3ASO B;  1WA8 B;  2Q7H A;  2CDY A;  1XMO B;  5C8Y A;  3TJT A;  3FD9 A;  3MD0 A;  4TUY A;  3AG4 C;  5IY5 C;  3SPH A;  1WB7 A;  1R1B A;  2P67 A;  3SYP A;  4HBN A;  3ZX6 A;  3FB8 C;  5L3G A;  4DR1 B;  2WLJ A;  1WP7 A;  3JAS B;  4TQF A;  4D6T H;  1WB8 A;  2JS3 A;  3ZN0 A;  4B3T O;  2EIN C;  3HKC A;  1E79 G;  4TV8 B;  5CA1 B;  2Q73 A;  1AVM A;  3OMN B;  4FLZ A;  2CGO A;  4CH4 A;  1SC5 B;  2F95 B;  1F23 A;  4WF9 V;  3E2E A;  3FFQ A;  1IBK B;  2JJ2 G;  1QU7 A;  1SES A;  2QWO B;  4FLW A;  4X20 A;  2NNU A;  1EN6 A;  4LC1 A;  3U11 A;  5KHH A;  4B3M B;  1FJG O;  3M8A A;  4E2L A;  2R9R B;  4I55 A;  4OX9 B;  2BTQ A;  1QR9 A;  1I94 O;  1H2N A;  2QE7 G;  4MTO A;  4TV9 B;  3N2G B;  4X65 B;  3H1H H;  2GBO A;  4O4L A;  4DV4 B;  2GSM B;  5JWP A;  3ZRW A;  4C7U A;  4PA9 A;  1K33 A;  3ZHS A;  4ZI7 B;  3G71 V;  3GVM A;  3OR6 C;  1N8R W;  4PD4 F;  4U3J B;  4P2Z A;  1P4R A;  4WFF A;  4XDL A;  4Q6G A;  5JH7 A;  2IJH A;  3H1L H;  3HKD B;  5JCO A;  3SJB C;  1MAB G;  2G38 A;  3B8M A;  5CB4 A;  2HG5 C;  4JI6 B;  1ZTE A;  2DWE C;  4MVU A;  1VQL V;  4QPK A;  4LWS B;  1SA0 B;  4MSW C;  4DO2 A;  1V54 B;  4WBN B;  2Y0I A;  4QGP A;  2QWN B;  4LF4 O;  1BQZ A;  3UT5 B;  3OTO B;  1GN4 A;  4I4T B;  4LF7 B;  3ZHQ A;  4RUE A;  2QDO A;  4JGS A;  2Y69 B;  4IGG A;  3CCQ V;  3JD3 A;  4OPA A;  3CC2 V;  1YEW A;  2DJV A;  1KP3 A;  2CTR A;  4E4E A;  1YXB A;  1BMF G;  4K0K B;  4JAS A;  3K5L A;  1S5H C;  3T1C A;  2X7R B;  1K9M W;  3P3P A;  3EHB B;  2YSU B;  4OX9 O;  3DXR A;  4JYB A;  4LNU B;  3E89 A;  5LMU B;  4O2A B;  1NT2 B;  2YIC A;  2YUA A;  1XDC A;  4X1Y A;  3ABK C;  4UV9 A;  4KP4 A;  2C2A A;  4FMT A;  4JTC B;  4MS2 A;  1I5Y A;  1P49 A;  1Y76 A;  2YIB D;  2ZIO A;  1PL0 A;  1XI1 A;  3GWO A;  3OR7 C;  2DWD C;  4JF3 A;  3AG2 B;  1U96 A;  2AW9 A;  3BCC H;  3EXA A;  4O2B B;  1RPR A;  4YJ2 A;  2EIL B;  4TSF G;  2ZIN A;  1EN4 A;  2WA3 A;  4TV9 A;  3RVY A;  3AK1 A;  5CN0 A;  2JEU A;  5IWA O;  4X66 B;  1FPO A;  2XAQ A;  1XHX A;  3QO8 A;  4FLV A;  3JAM N;  4H37 A;  4R6Z A;  5H6R A;  2QEX V;  2R70 A;  2YXL A;  1HR0 O;  2N05 A;  1D5N A;  1SER A;  3ZHU A;  4QE7 A;  3LSU A;  2Q8V A;  3BA8 A;  4JZ2 A;  1US6 A;  4CS3 A;  5IY5 B;  3IC7 A;  1XOU A;  3ETE A;  3SJQ C;  4QJF B;  1XMQ O;  1VQ6 V;  3T1H O;  2E5L O;  3ABT A;  3RYC B;  1ARO P;  2LFS A;  5EBL C;  2ODM A;  1I7F A;  1WJZ A;  1W0J G;  1SS3 A;  1VF6 C;  4FVM A;  3CSX A;  4RAI A;  2DOS A;  2KG7 B;  4JYA O;  3AG3 B;  3C3T A;  4X20 B;  1HNX B;  2CH7 B;  1GRJ A;  4PA7 A;  1GM7 A;  1M57 B;  2ZR2 A;  4F6R A;  3I55 V;  3DXR B;  2EIK B;  3VQW A;  2RN9 A;  4TQD A;  3A0H Z;  4IYI A;  4H33 A;  4CH3 A;  1K8A W;  1HNZ B;  1KKC A;  2Z0A A;  2FTK A;  2PTM A;  4LF5 O;  1M5I A;  3KG2 A;  1SET A;  3W7S A;  5CA3 A;  2P06 A;  1KEC A;  2QWQ B;  2QM8 A;  1HP8 A;  3CPW U;  2QWP B;  2IJK A;  3JAK A;  4J7Z A;  4I7Z B;  2BSK B;  2YIB A;  3K9S A;  4HAM A;  5L3C A;  3K79 A;  4K8X A;  5LHI A;  5KAI Z;  4PA6 A;  1RP3 B;  2JEX A;  1VF5 B;  3OMA B;  1AJN A;  2EJR A;  3OFN G;  1RSO B;  4MVR A;  1NZ6 A;  1Q7Y W;  1JPX A;  4JI4 O;  4UUJ C;  1G6U A;  1M4U A;  2BOC C;  1S77 D;  3RGB A;  3JAW A;  2YXH A;  5IYB O;  2E76 B;  3MHS C;  2VQE B;  3N27 A;  3RN4 A;  1HNX O;  4LFC O;  3W7U A;  3OD4 A;  4MVS A;  1PKX A;  3CMA V;  1PPJ H;  5L3E A;  1PV0 A;  3ZMU A;  3ZCC A;  5CMU A;  3ZJZ A;  2GUZ B;  4GX5 A;  1VQN V;  1QNM A;  3OTF A;  2BOB C;  4PHZ A;  1AI6 A;  2A79 B;  4J7K A;  1ROP A;  4NXN O;  3CP1 A;  2WSS G;  4R7C A;  2V4D A;  1DGS A;  4UCS A;  1PP9 H;  4UVC A;  2EBO A;  3G6E V;  3FB7 C;  1R73 A;  1KKD A;  4UVB A;  2XAS A;  4JV5 B;  3ETD A;  1VQ9 V;  2WLN A;  4DV2 B;  5LGU A;  1GKF A;  2QWR B;  1F51 A;  4B3S B;  1MZE A;  3K03 A;  3H01 A;  1VAR A;  4KFM A;  3ZBH A;  4LFA B;  3IAY A;  2Z3Y A;  3OGC C;  4X1I B;  2DE0 X;  5IT9 N;  2WA4 A;  1FXH A;  3K0G A;  3CCV V;  5FL7 G;  2HKO A;  2FML A;  2IH1 C;  3CRQ A;  3VQV A;  4LF9 B;  1BHB A;  2GDS A;  4DV7 O;  3ICX A;  3L74 H;  4FM2 A;  3CS5 A;  2XHB A;  1SZT A;  3G4S V;  4I5S A;  3L70 H;  1M9N A;  4LNU A;  5DM6 V;  3LUT B;  1MSD A;  1BSM A;  1NQT A;  4OXS A;  1FJG B;  1M56 C;  3DC6 A;  5K1P A;  3KCY A;  1F4N A;  1GN2 A;  1NTM H;  2W0F C;  5D5Q A;  4TWK A;  5CA0 B;  4DR3 B;  1FXK C;  2RDC A;  4O2B A;  2CH7 A;  2VQF B;  3SGI A;  2KKW A;  4FLY A;  4KHP B;  2WLL A;  4H44 B;  1A32 A;  2A3Q A;  1F4M A;  3CC4 V;  3ZMZ A;  4D7T A;  4X8A A;  2KG7 A;  3BPZ A;  3KKY A;  1AP5 A;  4HNA A;  1Y67 A;  3JD1 A;  2PI4 A;  4DUZ O;  4KL1 A;  1KUQ A;  2YXY A;  2IBZ H;  1CXZ B;  3PJS K;  4UCT A;  5KX5 B;  1MSW D;  1MG1 A;  3P3N A;  5JVD B;  3E35 A;  5KMG B;  1KYO F;  3B2E E;  3TET A;  3FKS G;  1Z5W A;  4FFK A;  1V55 B;  1QHT A;  1QBZ A;  4IIJ A;  1MA1 A;  5ITZ B;  1RFY A;  1EM1 A;  1KB9 F;  3HPL C;  3K5O A;  5FNV B;  4DR4 B;  1DTO A;  2PGG A;  1V54 C;  5IJ9 B;  1FXK B;  1X59 A;  1NU1 H;  3K9A A;  1OCR C;  5D5P A;  2ETN A;  4MVO A;  2YEV A;  1SQQ H;  2R72 A;  4FJC C;  2QKS A;  2P22 C;  2DYR B;  2ZXW C;  1HNW O;  4LF6 O;  1GM9 A;  2ZM6 B;  3KCX A;  3APQ A;  2Q5Z A;  4IYH A;  4MTF A;  2L6L A;  3CCS V;  4DV3 B;  1PNM A;  1VF6 A;  1FFT B;  3E22 A;  2FKX A;  1N4C A;  2ZE7 A;  4DRX A;  3CCM V;  3LNM B;  1Q81 W;  4ZOL A;  1AP6 A;  4YXW G;  5B5E Z;  2OCC C;  3M99 B;  3SPI A;  3H1J H;  3G6B A;  3K3W A;  3CRR A;  3R66 A;  2A06 H;  4YY3 O;  3T1Y O;  2F4V O;  5B66 Z;  1OCZ B;  4UCO A;  1N36 O;  4J11 A;  3EFF K;  4HNA B;  5CBH A;  1HWY A;  1HW7 A;  1NS1 A;  3UT5 A;  4I0X A;  3WB1 A;  3MAQ A;  3RBZ A;  3LSS A;  2QKA A;  1Y74 A;  5HFM A;  1QCE A;  4X1K A;  1BL8 A;  2IU3 A;  4YJ3 B;  4LF7 O;  4GKJ O;  4JYC A;  4B7K A;  2BTO A;  3D36 C;  1N36 B;  4RQF A;  3K59 A;  4I50 B;  4GX1 A;  3FAV A;  4FZ0 A;  1XNQ B;  5KLV H;  4NXM B;  1PNK A;  3WG7 C;  5ITZ A;  2UXD O;  4U3J A;  5BXZ A;  2D3O W;  2H94 A;  5JCO C;  2RNB A;  5LA6 B;  3WFV A;  1Q5O A;  2NLJ C;  5L3D A;  3ABM C;  4G28 B;  2X6A A;  3RWR D;  4B08 A;  1N34 B;  3LDE A;  2RJZ A;  2L35 A;  5BZB A;  4QPJ A;  2GUZ A;  4YHH O;  3P32 A;  4UCU A;  1YDX A;  2JVD A;  2YEV B;  2IU0 A;  2GTS A;  2UUA O;  1XMO O;  3JAK B;  3LDD A;  4K35 A;  1GAX A;  1D5A A;  5IE9 A;  5BMV A;  2Y0P A;  3ZN1 A;  4FZ1 A;  1VQ5 V;  3H1K H;  4JI7 B;  1COW G;  3SDL A;  3OUS A;  1OCO C;  3ZS8 C;  3JD4 A;  5BR8 O;  1CPY A;  3QVN A;  2HJD A;  2JK5 C;  2UUC O;  1IXB A;  4ZOL B;  4DW0 A;  3ZRW B;  3HR0 A;  4LFB O;  1U97 A;  1BE3 H;  4FK5 C;  3ASO C;  2VRZ A;  1LUV A;  1R3K C;  3THO A;  2ZT9 B;  2UXB B;  3N2G A;  4GKJ B;  2VQE O;  1Y76 B;  3K06 A;  2LO1 A;  3LSQ A;  4JI2 O;  1M93 A;  1IVS A;  4PDL A;  1SRY A;  1MMM A;  4AIL C;  2CTW A;  3T1H B;  1CP9 A;  2BCC H;  2RQ6 A;  5CA0 A;  2YI9 A;  4WFA V;  1KQS U;  3FYI B;  2NN4 A;  3WB2 A;  1H2K A;  2GHY A;  2QSA A;  5LMN B;  3IC9 A;  1NVP B;  1QVG U;  4LR3 A;  3TGU H;  4OPH A;  1NBM G;  5IJ9 A;  2ITC C;  2R9A A;  1OCO B;  1L0L H;  1OV9 A;  1URF A;  1JX9 A;  4MT8 A;  4DV0 B;  3FAV B;  1NH2 D;  1FYJ A;  2RCV A;  1H8H G;  4W4L A;  2F43 G;  3E8H A;  4JI1 B;  4JI7 O;  1FFX A;  1IBM O;  1WNS A;  2ZIM A;  4LF8 O;  3JSN A;  1WAZ A;  4BW5 A;  4J10 A;  1NR1 A;  2HHH O;  1P7B A;  1NVP D;  2XND G;  5KX5 A;  4JI6 O;  3JAL B;  2QM7 A;  2VS0 A;  2ZXW B;  3AG3 C;  4J9Z B;  3T2M A;  5KA6 A;  4X89 A;  1MOF A;  2OYQ A;  3L75 H;  1K34 A;  1JR9 A;  4NVP A;  1ZUQ A;  2YDE A;  5LHH A;  3PN1 A;  1OCR B;  3E83 A;  1SQG A;  3CD6 V;  1EN5 A;  2NR5 A;  1DK1 A;  2Z5U A;  2KB1 A;  4A5U B;  2MW2 B;  3Q4H B;  2CUG A;  2DYS C;  3W7W A;  5B1N A;  1AJQ A;  4K0K O;  3B4S A;  4X64 B;  2JGD A;  5FNV A;  2LGW A;  3ZRS A;  5KA5 A;  2OT5 A;  4B7E A;  4CZZ A;  4CBC A;  2ZQM A;  5L3F A;  2F66 C;  1VQM V;  3FYE B;  3IJ4 A;  1PM9 A;  2VWK A;  1XNR B;  2LW7 A;  4GUN A;  3ASN C;  4PA3 A;  2ZE6 A;  4G2K A;  1VP7 A;  3CME V;  3IGA C;  4I9Q A;  1LNQ A;  1NTZ H;  3UO2 A;  2XT9 A;  1XQ8 A;  1BQ0 A;  5GON A;  4CH6 A;  3JAT B;  3JCU Z;  4JAU A;  1SQX H;  4JI3 B;  5IYD O;  3ABL C;  3QO7 A;  1V55 C;  3X2Q B;  1YIT V;  1PNL A;  1E1Q G;  5EC1 C;  4FLU A;  4JYY A;  1B6Q A;  3STZ C;  5LA6 A;  5IDJ A;  1IBM B;  1PL4 A;  3O65 A;  1X4T A;  3ETG A;  3JD2 A;  1Q6I A;  5HFL A;  4MW3 A;  1H2S B;  1P84 F;  1WN7 A;  5CA1 A;  4X66 O;  2E3C A;  1R3I C;  5LXT B;  2Y4U A;  3WG7 B;  2ADP A;  2UU9 O;  1K5S A;  3AG1 C;  4JI5 O;  1JFF A;  2V7Q G;  5KUK A;  4DV5 O;  1QVF U;  2YID A;  3VOU A;  4X64 O;  1SQB H;  1SQP H;  1K73 W;  1Z2G A;  2QJ1 A;  4RWU A;  3SYO A;  1N32 O;  4DK0 A;  1FS0 G;  1N34 O;  3E22 B;  4RUF A;  1K97 A;  1QQC A;  3SR2 C;  1YJW V;  4AQY O;  1NH2 B;  2B1I A;  5GTH Z;  1HDJ A;  2Y4T A;  2UXX A;  1XEQ A;  4NTW A;  2IJJ A;  2Q4P A;  4U7N A;  4P9P A;  1KBH A;  4H13 B;  4AHC A;  3E8G A;  5BMV B;  1IUR A;  3E8B A;  1NTK H;  4IHJ B;  3GWK C;  5KHG A;  3RYI B;  3SYA A;  5EBW C;  2GV9 A;  4ZHQ B;  2YIA A;  2WLI A;  4WFB V;  1O9H A;  1WLE A;  5EK0 A;  1XMQ B;  2M7W A;  1OHH G;  1KP2 A;  4RQE A;  4O4J A;  4JTD B;  4I50 A;  1TUB B;  3T4Z A;  4DUY O;  1FKA O;  2EIK C;  3ASN B;  1T5E A;  1ORQ C;  2P90 A;  2IM9 A;  3NXS A;  1G4Y B;  4PI0 A;  4ICG A;  2WLH A;  3I56 V;  2HFE C;  4NKG B;  2MK3 A;  4X9Q A;  1JA8 A;  2N74 A;  4I55 B;  2BTQ B;  1DF4 A;  2EIJ C;  2JGD B;  4TUY B;  5EIB D;  3GB7 C;  1Q82 W;  3S3X A;  4KHP O;  2YI8 A;  4P30 A;  2HJF C;  2ATK C;  1J5E O;  4NXM O;  1GO3 F;  1XNR O;  2XAF A;  3RYF B;  4LBE C;  2K1E A;  3T4D A;  2ADQ B;  4Z1V A;  4DR2 B;  3CEI A;  5GON B;  4EB6 A;  3JAL A;  3HKD A;  3OEE G;  4TV8 A;  4PDV A;  4EKW A; 
#chains in the Genus database with same CATH homology
 2A0L A;  2QE7 G;  4MTO A;  2Q68 A;  4MTF A;  3CCS V;  1PNM A;  2IW5 A;  1FFT B;  4ZBM A;  4U7O A;  1AI4 A;  4DXW A;  2WWW A;  3STL C;  3BEH A;  2GSM B;  1KD1 W;  3CCM V;  3DGE A;  3LNM B;  4JPR A;  3ZRW A;  3CCE V;  1Q81 W;  1TUE B;  2Y48 A;  4PA9 A;  4YXW G;  2OCC C;  2Q6A A;  3JYC A;  3M99 B;  5B3S C;  3ZRV A;  1K33 A;  2LP7 A;  3F5W C;  4PEL A;  3G71 V;  3SPI A;  3K3W A;  2X6C A;  3OR6 C;  1N8R W;  3IFX A;  4P2Z A;  1P4R A;  4Z1M G;  1VQ7 V;  4WFF A;  4XDL A;  1OCZ B;  2X0L A;  3EFF K;  3AEI A;  4PDM A;  2IJH A;  1HWY A;  5CBH A;  4GX0 A;  3JD0 A;  1MAB G;  3B8M A;  3RBZ A;  2HG5 C;  2DWE C;  3LSS A;  4MVU A;  1QLE B;  5HFM A;  1QCE A;  4N21 A;  4QPK A;  2QA4 V;  1VQL V;  3CYO A;  4MSW C;  5J9P C;  4DO2 A;  1BL8 A;  2IU3 A;  1V54 B;  4JYC A;  3W7X A;  3W7T A;  4RO2 A;  3QO5 A;  3FB5 C;  4RQF A;  3SPJ A;  2ZDI C;  1WPX A;  3ABL B;  4GX1 A;  2P6J A;  3E86 A;  3AG1 B;  1IXM A;  1R6N A;  3CCJ V;  4RUE A;  1YTF D;  3R65 A;  1PNK A;  2WPD G;  3WG7 C;  4JGS A;  2Y69 B;  3RW0 A;  3CCQ V;  3JD3 A;  3ZMS A;  3CC2 V;  3CC7 V;  1ZWI C;  2D3O W;  1S76 D;  1KP3 A;  2H94 A;  2IH3 C;  2P7T C;  4LCU C;  4MW8 A;  5LHG A;  1JQ0 A;  1M90 W;  2DW4 A;  4JTA B;  3WFV A;  5B1A B;  1K5Q A;  2NLJ C;  1BMF G;  5L3D A;  3ABM C;  4G28 B;  2PI5 A;  1J95 A;  2X6A A;  4JAS A;  1M1K W;  3LDE A;  1S5H C;  1YSC A;  3T1C A;  2X7R B;  1K9M W;  5BZB A;  2QTO A;  4UV8 A;  3EHB B;  2YSU B;  4QPJ A;  1QR8 A;  4JYB A;  3P32 A;  1K4C C;  2YEV B;  2IU0 A;  3E89 A;  5H9C A;  3LDD A;  1FXV A;  2DYS B;  3ABK C;  4UV9 A;  4KP4 A;  5L3B A;  3SYQ A;  2C2A A;  4FMT A;  4JTC B;  5KUM A;  1YJ9 V;  4MS2 A;  1I5Y A;  1VQ5 V;  3ZN1 A;  3ZMV A;  1JJ2 U;  1R6K A;  1COW G;  3OUS A;  4HZ3 A;  1OCO C;  1OCC B;  1M56 B;  2IJI A;  3JD4 A;  2AHY A;  1PL0 A;  1CPY A;  3GWO A;  3OR7 C;  2DWD C;  4JF3 A;  4WCE V;  3AG2 B;  5CBG A;  1E1R G;  2EIJ B;  2JK5 C;  1Y66 A;  3D3I A;  1VQ4 V;  5GW7 A;  3ZRW B;  3CXC U;  1RPR A;  2EIL B;  4TSF G;  1THZ A;  4FK5 C;  3ASO C;  3RVY A;  3B8N A;  1R3K C;  5CN0 A;  3RVZ A;  2JEU A;  3QNE A;  4MVQ A;  1YTF B;  2Q67 A;  3ZIA G;  1ENV A;  1KC8 W;  5CBF A;  3OUF A;  4ASU G;  4P9O A;  3X2Q C;  3K06 A;  2XAQ A;  1YJN V;  3TCU A;  3QO8 A;  2LFR A;  3LSQ A;  2DQ0 A;  3K08 A;  4H37 A;  4R6Z A;  5H6R A;  2QEX V;  4PDL A;  1SRY A;  1SER A;  4QE7 A;  1XL6 A;  1OCC C;  3UM7 A;  5IY5 B;  1CP9 A;  3IC7 A;  4WFA V;  3ETE A;  5C93 A;  4BIU A;  3JCZ A;  1KQS U;  3FYI B;  3SJQ C;  4QJF B;  2XOK G;  1RPO A;  4WFH A;  2GHY A;  3CCL V;  1JCH A;  1VQ6 V;  1NVP B;  1QVG U;  4X88 A;  3ABT A;  1PD3 A;  1ARO P;  2LFS A;  5EBL C;  1W2B U;  2OCC B;  1NBM G;  1OCZ C;  1W0J G;  3MHH C;  4XDK A;  4RAI A;  2ITC C;  1YIJ V;  4KUM A;  1OCO B;  3AG3 B;  2WLK A;  1JX9 A;  4PA7 A;  4MT8 A;  1GM7 A;  4BAY A;  1M57 B;  2ZR2 A;  5H6Q A;  1NH2 D;  3I55 V;  1H8H G;  2XAG A;  2EIK B;  2F43 G;  3D36 A;  2EZO A;  4QNH B;  4N23 A;  3E8H A;  4XDJ A;  1QLE C;  4H33 A;  1H2G A;  2Q69 A;  1K8A W;  1EFR G;  1EZJ A;  5DN6 G;  4G27 B;  2EIN B;  4BW5 A;  1NR7 A;  2FTK A;  3ML0 A;  1S0V A;  4Q20 A;  1NR1 A;  4JAV A;  3W7S A;  2HLD G;  1SET A;  2ZD9 A;  3KG2 A;  3FB6 C;  5LBQ A;  1P7B A;  1NVP D;  1GTO A;  5CA3 A;  1NKD A;  1EBO A;  2XND G;  4QE9 A;  1KEC A;  3ZMT A;  2QM7 A;  2ZXW B;  3AG3 C;  4J9Z B;  2QM8 A;  3T2M A;  5KA6 A;  1RM1 B;  4X89 A;  3CPW U;  1MOF A;  2EIM C;  2IJK A;  4R8C A;  1K34 A;  4GCZ A;  1AI7 A;  5LHH A;  1H38 A;  3ABM B;  1K3E A;  1OCR B;  3E83 A;  4HAM A;  3SYC A;  3CD6 V;  2Z5U A;  2KB1 A;  5L3C A;  3K79 A;  3OEH G;  2ZDI A;  5LHI A;  2A9H A;  4PA6 A;  4GT1 A;  2JEX A;  2DYS C;  3ABK B;  5LGN A;  3W7W A;  1QLN A;  3OMA B;  1AJN A;  1AJQ A;  2EJR A;  5B1N A;  4UXN A;  3OFN G;  1VQO V;  1S3J A;  4MVR A;  3ZRS A;  5KA5 A;  1VQK V;  2OT5 A;  1AR1 B;  4CZZ A;  1Q7Y W;  1Y4M A;  1JPX A;  2ZQM A;  4CBC A;  5L3F A;  3FYE B;  1VQM V;  1S72 V;  4UUJ C;  2DYR C;  2UXN A;  1CEZ A;  3SPC A;  4FPP A;  4PA3 A;  3ASN C;  2BOC C;  2HVJ C;  4G2K A;  1S77 D;  2EIM B;  4MVM A;  3CME V;  4MTX A;  3AG2 C;  3IGA C;  2WLI B;  2DQ3 A;  1LNQ A;  4J9Y B;  4WFE A;  5IYB O;  3MHS C;  4QIW F;  4PA4 A;  4MVZ A;  3OMI B;  4ZKI A;  4TT3 G;  2EIL C;  4JAU A;  5B3S B;  1JOY A;  3W7U A;  4MVS A;  1YI2 V;  1PKX A;  3CMA V;  5L3E A;  1OZ0 A;  3DTU B;  5IYD O;  3ZMU A;  2X6B A;  3ABL C;  3ZCC A;  3E8F A;  5CMU A;  3ZJZ A;  5B1B C;  3QO7 A;  1V55 C;  4GX5 A;  3X2Q B;  1YIT V;  1PNL A;  1VQN V;  1E1Q G;  4MTG A;  5EC1 C;  4GX2 A;  2BOB C;  3CCU V;  1B6Q A;  1AI6 A;  3STZ C;  2HR3 A;  2A79 B;  5IDJ A;  4BIZ A;  1ROP A;  3ETG A;  3CP1 A;  2WSS G;  3JD2 A;  4R7C A;  5EBM C;  4MW3 A;  5HFL A;  3K04 A;  4FIP C;  4UVC A;  1GK9 A;  2EBO A;  1DLB A;  1G8M A;  3G6E V;  3FB7 C;  2OTL V;  1R73 A;  1KKD A;  4UVB A;  3BY6 A;  2XAS A;  4R50 A;  3ABU A;  3ETD A;  1R3I C;  1VQ9 V;  2WLN A;  1H8E G;  2ITD C;  3WG7 B;  2JJ1 G;  5LGU A;  1K5S A;  1GKF A;  1F51 A;  3A0R A;  3AG1 C;  1I5X A;  5E1A C;  2V7Q G;  4XBF A;  5KUK A;  1RM1 C;  5B1A C;  3B77 A;  3K03 A;  1QVF U;  3H01 A;  4I9W A;  4KFM A;  1M57 C;  3OE7 G;  3F7Y C;  4WFG A;  3VOU A;  2XAH A;  3F7V C;  2Z3Y A;  1JVM A;  3P30 A;  1R3L C;  3OGC C;  4PDR A;  1GMG A;  1K73 W;  1FXK A;  3SYO A;  1BHA A;  1FXH A;  3K0G A;  3CCV V;  3VBB A;  2B5U A;  1FS0 G;  2CK3 G;  1K7D A;  2HKO A;  5FL7 G;  2IH1 C;  5EC2 C;  1BHB A;  2WLL B;  5B1B B;  4RUF A;  1DF5 A;  1VQ8 V;  2XAJ A;  2AHZ A;  3LDC A;  5IYC O;  1GM8 A;  1K97 A;  3OAA G;  1SZT A;  3G4S V;  1XL4 A;  4I5S A;  2H8P C;  4HYO A;  1L1F A;  1K4D C;  1W0K G;  1YJW V;  2B1I A;  2HVK C;  1NH2 B;  1M9N A;  5DM6 V;  3LUT B;  1NQT A;  4OXS A;  2UXX A;  1M56 C;  2IJJ A;  4U7N A;  4P9P A;  2W6I G;  2JDI G;  3E8G A;  1F4N A;  2W0F C;  4TWK A;  1FXK C;  3E8B A;  1Q86 W;  2Y69 C;  3SYA A;  1YHQ V;  4F4L A;  3HB3 B;  5LGT A;  2R9I A;  5EBW C;  3K0D A;  3ASO B;  2WLI A;  4WFB V;  1WLE A;  2WLL A;  2JIZ G;  5EK0 A;  2M7W A;  3ZRX A;  1AI5 A;  1OHH G;  1F4M A;  1KP2 A;  3ZMZ A;  3CC4 V;  4RQE A;  4X8A A;  4LP8 A;  1NJI W;  4JTD B;  2WAM A;  3MD0 A;  3AG4 C;  3JD1 A;  2PI4 A;  3T4Z A;  4L87 A;  5IY5 C;  2EIK C;  1K92 A;  3SPH A;  2ZR3 A;  3ASN B;  3PJS K;  2V1D A;  2P67 A;  3SYP A;  1MSW D;  1ORQ C;  1MG1 A;  2P90 A;  3FB8 C;  3E35 A;  2B1G A;  3NXS A;  5L3G A;  3TET A;  1G4Y B;  2WLJ A;  2EZP A;  3FKS G;  2WLH A;  3SPG A;  3I56 V;  3ZN0 A;  2HFE C;  1V55 B;  2OTJ V;  1VQP V;  1QBZ A;  2EIN C;  2MK3 A;  1E79 G;  5B1O A;  1DF4 A;  3HPL C;  2EIJ C;  3GB7 C;  3OW2 U;  3OMN B;  1Q82 W;  1DTO A;  2WLM A;  4P30 A;  2HJF C;  1F23 A;  2ATK C;  3AG4 B;  4WF9 V;  1V54 C;  3OM3 B;  1FXK B;  3E2E A;  4UVA A;  1GO3 F;  2XAF A;  3K9A A;  2JJ2 G;  1R3J C;  1UJW B;  1OCR C;  1SES A;  4MVO A;  2NNU A;  2YEV A;  4LBE C;  4LC1 A;  2K1E A;  4FJC C;  3T4D A;  2QKS A;  2ZXW C;  2DYR B;  3UKM A;  3CCR V;  1AJP A;  1GM9 A;  2W6J G;  3TK1 A;  4E2L A;  2R9R B;  3OEE G;  4PDV A;  4EKW A;  1QR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...