5HFLA

Gp41-targeting hiv-1 fusion inhibitors with helical ile-asp-leu tail
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
69
Chain Sequence
MASGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILGGWEEWDKKIEEYTKKIEELIKKSQNQQIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational improvement of gp41-targeting HIV-1 fusion inhibitors: an innovatively designed Ile-Asp-Leu tail with alternative conformations
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Envelope glycoprotein,gp41 CHR region
total genus 30
structure length 69
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5hflA00
1DF5A 1SZTA 2MK3A 1JQ0A 5KA5A 4FK5C 1ENVA 1DF4A 3B77A 3M99B 2EBOA 4FIPC 1DLBA 1MG1A 1QR9A 1QR8A 4JF3A 3WFVA 1JPXA 1EBOA 3GWOA 4JPRA 1K33A 3B8NA 1K34A 5CMUA 5H9CA 5CN0A 4E2LA 3P30A 5KA6A 1MOFA 2M7WA 1QBZA 3MHSC 1I5XA 1Y66A 2LP7A 1F23A 2X7RB 4N23A 4JGSA 3K9AA 1I5YA 2EZOA 5HFMA 4G2KA 3H01A 3CYOA 2P6JA 1QCEA 1Y4MA 2EZPA 3B8MA 4FJCC 3CP1A 5HFLA 4N21A 2OT5A 3MHHC
chains in the Genus database with same CATH superfamily
4PD4F 1ZAUA 3AEIA 1Q81W 2NLJC 4YY3O 3ICXA 4PA7A 1I94B 4EB6A 1VQKV 3JASB 1FKAO 2LJ2A 2Q7GA 3P30A 3ZRXA 3DXRA 3TGUH 1GAXA 3B2EE 3JAMN 1FPOA 4TV8B 2D2CB 1ZL8A 1SZXA 3OMNB 3CC4V 2UXBO 2OYQA 1H2GA 3JATB 1ZTEA 1VIBA 2QWNB 5CA0A 2W6IG 3G6EV 2WLJA 1V9PA 3CXCU 2MW2B 2NN4A 2IH1C 5B1AB 2YIBD 3CB2A 3T2MA 1O9GA 1Q5OA 1FXKC 2DMXA 4OPAA 5H6RA 1W0JG 4B3SB 3FYIB 1CXZB 3FB6C 4O4LA 3B09A 2QM4A 2UXXA 3OR6C 1FAFA 2QJ1A 1S5HC 2FMLA 1QR8A 4NTXA 1YDXA 5B1NA 3THOA 1WA8B 5KAIZ 4E2LA 4U3JB 4JI8B 1NS1A 1EZJA 2YI8A 3ZN1A 2P6JA 4Q6GA 4YY3B 4D7SA 4DR7O 3A8TA 3J81N 2RNBA 2GV9A 2FL4A 5J2TB 2XAHA 2VWKA 1SA0A 4YXWG 3L74H 1S0VA 4X1YA 4I55B 5CA1A 2A3QA 3UQ8A 1LNQA 3CC7V 1SERA 2QWPB 4JAAA 3QNEA 2C2AA 3CCEV 4JI0B 4B08A 4QGPA 1IXMA 4G2KA 3CCQV 3CMEV 2Q0OC 1NKDA 4LH6A 4OX9O 3BFRA 2ZM6B 3D8CA 3O9OA 3DC5A 2ODMA 5LMUO 3N2KA 4Z1VA 4X66B 3JAWA 1URFA 3B8NA 2ZM6O 1ZL8B 5LYJA 2X7RB 2A79B 1KMIZ 5GW7A 4ZIBA 2PYLA 4TV9B 4LFBB 1NTMH 4UCSA 4DRXB 4CZZA 5IDJA 5LXTA 1R6TA 2OIEA 1Z5VA 2ZKOA 1N4CA 4X1IB 1YHQV 1VQOV 4P2ZA 3EVKA 1FXVA 2AZ0A 4JV5B 2PF4E 3DTUB 2W0FC 1R73A 1YZBA 3ETEA 4P9PA 4LNUB 2OTLV 3IC9A 5GTIZ 1JA8A 3QG5A 4JF3A 1KP3A 3WU2Z 1PPJH 2WLLA 3SDLA 1QQCA 1K34A 4J10A 4AILC 2LGQA 3RWRD 4N23A 1AR4A 2CK3G 1PNMA 2HG5C 4TT3G 3ETDA 2WLHA 1GKFA 1NZ6A 4X65O 1TVKB 2XUMA 1QVFU 1E1RG 1HW7A 3ZHRA 5LBQA 4MTXA 1E1QG 1M93A 3CRMA 1VQ7V 2ZIMA 2OWOA 4DR5B 2Q5ZA 4UB6Z 2DE0X 4Z1MG 3CRCA 2UUAB 1H38A 4JZ2A 4MW8A 2EULA 3LNMB 4DR1B 4DR6O 1G1XB 5KHKA 2JGUA 5L3FA 4WBNA 2WAMA 3DC6A 1XMOB 3OW2U 3LSQA 1VQMV 3K9AA 1YF2A 1RP3B 1N34B 4DRXA 4J7ZA 4GKJO 2WA4A 1J95A 4DR2B 4HNAA 1QLNA 3GVMA 1PP9H 3K03A 2JS5A 4PA6A 2UUAO 4IYIA 2R72A 1ZX3A 5KX5B 2KG7B 2HKOA 3ASNB 3JCZA 2ZINA 1PM9A 2BE3A 4FZ0A 4B3TB 1UFIA 1XI1A 4DV3B 2DYSC 2LQTA 1YJWV 2ZDIA 2OCCB 4DV0O 3X2QB 3ABKC 1ROPA 3T1HB 2HJDA 4EEQA 3CXHF 3GB7C 2BSKA 1M57C 4JYYA 1YCIA 3JD2A 3AG4C 1VQPV 3FB7C 2M6YA 4LH7A 5BR8O 5IYDO 4DUYO 3D36C 1R1BA 2PUSA 1F7YA 3G6BA 2P7TC 3JAKB 4B3MO 3E86A 2EILB 4KL1A 3X2QC 4IIJB 1H8HG 4W4KA 2EX3A 4Z2WA 3APQA 4K0KO 1S5JA 1HNWB 4W4LA 2GDSA 5IJ9A 1M56C 1GM7A 4ZBMA 3JALB 1AI4A 3EFFK 3L9DA 1NQTA 5JVDA 2W6JG 1AJPA 1US6A 2KQXA 2P4VA 3ZRSA 1FS0G 5EC2C 1AJQA 4JYAO 2CH7B 4BW5A 1M1KW 2BOCC 5J2TA 1RM1C 5B1BC 4P30A 4DUZB 2LGWA 1JFFB 1HNZO 5CBGA 1EZVH 2YEVA 1QNMA 3P3NA 2OIGA 3ZMVA 2JJ2G 4JI5B 1CP9A 1JCHA 1AI7A 4K8XA 1P49A 1AILA 1BMFG 4TQFA 4X64O 3OAAG 3ABMC 1Q43A 2OCCC 1SF9A 4FLVA 5CA3A 3UT5B 4CBCA 1SKVA 2WLLB 1Q86W 1I5XA 4WF9V 3ZMUA 2UU9O 2B9ZA 2UUCB 3FB5C 4ZOLA 2X0LA 3QO7A 1K4CC 3L75H 3HKCA 5LHGA 4H44B 2GUZB 1FXHA 3HKEB 4LFCB 3BAAA 5L3DA 3QO5A 4X89A 4GT1A 4TV9A 4WFGA 3TJTA 3E89A 1JR9A 4KXRA 5K1XA 2Y48A 2XHBA 5KHGA 3BA8A 3HR0A 3O65A 2UUBB 3S3XA 4NTYA 4J42A 1N34O 2LW1A 1P84F 3QO8A 3L73H 5LMNB 1GH6A 5ITZB 4LF4O 1TUBA 3QTCA 4FLTA 1MZFA 2GSMB 3IFXA 4TOIA 4LFAB 2CGNA 3AG3C 1Y74A 3TCUA 3G71V 3VQWA 1JOYA 2Q7EA 5FPOA 2R9IA 1G4YB 4GKKO 2XASA 2K9PA 3E2EA 4DW1A 4UVBA 3K79A 3LNNA 1U96A 1JJOA 2YS8A 3TXSA 5B3SB 1BCCH 2QWOB 1BHBA 2ZE6A 4J7KA 3A2FA 3ABKB 2HVJC 2ARHA 4DV4B 2CUGA 4FFKA 2YIBA 4X1YB 2Q68A 5J2UA 2HR3A 1MSWD 5KX5A 4OGQB 4JI3B 2G38A 2OCHA 3ZN0A 5BXZA 1W0KG 3WB2A 4RQFA 3K5LA 2HVKC 4O2BA 1R3IC 3ZMSA 4FM2A 1Y6XA 1QBZA 1XDCA 4AI8A 5IY5B 3UT5A 3W7XA 2QKSA 2RMKB 5EYPB 2AGAA 5LYJB 4B7KA 4ZOLB 3T4DA 5GTHZ 1AROP 4O4IB 2Y69B 3QVNA 1ZLZA 5FNVB 1IVSA 5KAFZ 3JSNA 4G28B 1BQZA 4CS3A 5H2FZ 4UUJC 3OT7A 1XNRB 3OTFA 1JMKC 2WLNA 4MVMA 2QKCA 1KYOF 2F4VO 2YI9A 1GN6A 1SQPH 3OMAB 4WFHA 1JQ0A 5IJ0B 1VF7A 2LO1A 3CCJV 3OEHG 2PYJA 2O57A 1TUBB 3K5NA 4JYAB 3G67A 4F6RB 1B6QA 1N33B 1Y74B 2LP7A 4R50A 2ZR3A 5JVDB 4JTCB 2RN9A 4DV7O 2VQEB 1WN7A 2FTKA 5JWPA 1SQBH 2UXCO 2A06H 2A9HA 2ETNA 3RYCB 1Z2GA 5LXTB 1YI2V 5H9CA 3U0ZA 3PN1A 1JJ2U 3A0RA 3BA9A 4LNUA 1KECA 4IL6Z 4FLUA 1H2KA 1IDSA 1GTOA 3CCRV 4LF9B 3BY6A 3E8GA 2QSAA 1KU9A 4H13B 2YIDA 3K58A 4YJ3B 4A5UB 1MNGA 1MZEA 2Y4UA 1I94O 1N32O 3SJQC 5LHIA 2F4VB 4Q20A 3EXAA 4B3SO 1RSOA 2EZOA 5B1OA 4QJFB 1COWG 5LMNO 3JARB 5BMVA 3ABUA 4LF7B 1B06A 5KA5A 5EIBC 2K1EA 1XHZA 5CBFA 4KHPO 3CJHB 4HYOA 4JI3O 5JJJB 4AQYO 4JI2O 1EN5A 1Y66A 3A0HZ 4DR4O 4GKJB 2Z3YA 4MT8A 1FFXA 4FPPA 2Q73A 5DM6V 3CCSV 3PJSK 2AHYA 4J7JA 4ASUG 2P90A 3OTOB 3N2GB 2P67A 1ENVA 1CEZA 4CC6A 5KHIA 3ZBHA 1PL0A 2EIMB 2ILMA 2F43G 4I0XB 4FFBB 1WB7A 5DEDA 4LF5O 5EBWC 4PV1B 2DYRC 3J80N 1S5LZ 4DR5O 3CP1A 3CHXA 3E83A 4AQYB 2YSUB 2IW5A 2XAQA 4CH6A 4J80A 2Q7HA 1SA0B 5C93A 1QLEC 4JYCA 4MTFA 2Q6AA 4BIZA 5IYBO 1K5QA 4IIJA 3HKDA 1VQ5V 4UCRA 2GHYA 3ABLC 1KKDA 3ETGA 1Y4MA 3SPJA 3OE7G 1N8RW 3AK3A 4TSFG 5IWAB 5IE9A 3P32A 3HKBA 3SYAA 1EN6A 1BQ0A 4U3JA 2ATKC 4GX0A 1S3JA 1PD3A 2M7WA 4IYHA 1WNSA 1Q3EA 4K3AA 3RYHB 1YJNV 1X4TA 2BSKB 1NH2D 2CE4A 1EN4A 2FB5A 2QGNA 1D5NA 3QF7A 5HFLA 2EIKC 3CD6V 4O2AA 1H2SB 2JVDA 5CBHA 1YIJV 2HJFC 1DGSA 3E35A 5B1AC 4O4JB 4QNHB 4GUNA 2JEXA 2NNUA 2V1DA 3OGCC 1R3JC 2E3CA 2IJIA 1YTFD 4B3MB 2AW9A 2GBOA 4CH5A 3JSLA 4NB5A 5KA6A 2RQ6A 2Z0AA 3R66A 4PDLA 1V54B 5IYZB 1BS3A 4PHZA 4WCEV 2Q9LA 4KUMA 4O2BB 2LFSA 3SPHA 1K9MW 4O4HA 1O9HA 5KHJA 1HDJA 1SS3A 1SQQH 2B1GA 3N2GA 2PZSA 2ZD9A 4B7EA 1I0HA 5EYPA 1L0LH 1K5SA 4DV0B 3LDDA 4YIOA 1OZ0A 5LHHA 1HNXO 4JI6O 4B3TO 4FVMA 3SJBC 2DYRB 3ASOB 1VQ6V 2OT5A 4DV1O 2DN9A 4H33A 3W7WA 1W59A 5FNVA 2QR4A 1YTFB 3TETA 3ASNC 4JPRA 4IHJA 3ZIAG 1QVGU 1PL4A 1WP8A 3KZIZ 1MOFA 2Q8VA 3AG2C 5E1AC 2V7QG 3CMAV 4MVOA 2Q69A 2CGOA 1QU7A 5LL6Y 5IJ0A 1R6KA 2EILC 3CRRA 4LF9O 4LR3A 4BR6A 4WBNB 1RFYA 4I4TB 2DJVA 1IBMO 2ZNIA 2Y0IA 4CC5A 1K33A 2ADQB 3OMIB 3FFQA 2DWDC 4JTDB 4NR1A 5BY1A 1FYJA 1BGYH 3RVZA 3RN4A 3CCMV 2ZCEA 1BHAA 4UCUA 2HHHB 4YJ2B 3AG2B 4GLXA 5DECA 4L8JA 4FLYA 3UO3A 5H6QA 2A7WA 3SYCA 1PNKA 3K06A 2QM7A 1RM1B 4DV7B 1K92A 2JDIG 3BPZA 5B3SC 3RVYA 3ZMTA 3D36A 1WLEA 2QE7G 3ZS8C 2WLMA 4X20B 2HHHO 3JD3A 1XOUA 2JGDA 3H1JH 1UJWB 1OHHG 3ZHTA 2L6LA 4LWSA 1XUQA 2CAZC 2F66C 1KB9F 2DQ3A 3JAWB 2EJ7A 1XNRO 1RPOA 5LOVA 3AG1C 3F7VC 1H8EG 4MVQA 3TK1A 2JJ1G 3IGAC 4B3RO 4JV5O 4WFBV 3M99B 1MG1A 3RYIB 4FLZA 1VEWA 3CSXA 3SYQA 4DR4B 1F51A 1J5EO 5LGNA 4JI4O 1BSMA 3C3SA 4PDRA 4FJCC 2N74A 4RUEA 2E74B 1IBLB 4DR2O 3L71H 4DV6B 4WFEA 2HEPA 4I5SA 4UB8Z 1LR1A 3WG7C 4I0XA 5JCOA 1MSDA 1PV0A 3WG7B 5E79Z 1J5EB 3E22B 1KD1W 1NH2B 1G8MA 4LFAO 1N36O 4NKGB 1I08A 4WFFA 3AG7A 1VQ9V 1S76D 1FFTB 2N04A 3IC7A 5A2QN 1MABG 2Q0AA 2RCVA 1ZSPA 3UKMA 4DV5O 4LF6O 3WFVA 1ZWIC 3HPLC 3ZJZA 2PI5A 3WB1A 3FB8C 3ZX6A 3SJAC 2D3OW 1CPYA 3RT3C 2RDCA 4X8AA 1OCCC 4LF8B 2R9AA 4JASA 4PDVA 4I50B 2EINB 2PGGA 3ZRWA 3WB0A 3G80A 2QA4V 4UVCA 4U7NA 2P4KA 1JPXA 2CTPA 3K04A 2E75B 5CN0A 1OCOC 3HKCB 5LP6B 4BW9A 5CB4A 4JGSA 4YHHB 3RW0A 3E22A 4O4JA 3I56V 4J11A 4NXNO 3RYCA 4MW3A 4X65B 1JFFA 5KLVH 2IJHA 3KCYA 3SYOA 4DK1A 2Z5UA 3BEHA 1IBKB 1VQ8V 4PELA 3EHBB 2VQEO 2YDEA 4PA9A 4R7CA 1Q6HA 2Y0PA 2QTSA 3JCUZ 1Q6UA 2B5UA 4GZRB 3GWKC 3AK1A 3AG1B 2H8PC 2ZDIC 3BRCA 4BIUA 4WFAV 3ZRWB 1T5EA 1D5AA 5EIBD 1N32B 1RPRA 1XNQO 1H2LA 4DV6O 4JI8O 2IU3A 3T4ZA 4P9OA 2GUZA 1S77D 3DGEA 3ZHQA 1PNLA 2Y69C 1KKCA 1YVWA 4OX9B 1AJNA 1U97A 1GO3F 4TQDA 1Q90D 1NTKH 5L3BA 4F6EA 1DF4A 3CJHA 4K0KB 3OD4A 2YXLA 3R65A 5CMUA 4DR7B 3ZCCA 4X1IA 1XBLA 5DN6G 2NR5A 4R6ZA 1OCCB 4LC1A 3CX5F 2F93B 1WB8A 5KHHA 2QWQB 3N2KB 3FAVB 2H3OA 3H9VA 1H2MA 3LDCA 3NR7A 5JJEB 3CWBH 1GN4A 1EBOA 1JVMA 4KP4A 3M8AA 5C8YA 4EKWA 4EFEA 2N05A 4JTAB 4E4EA 1V55C 4TUYA 1WP7A 2CH7A 1W2BU 2QEXV 4ZHQA 2P22C 1NT2B 5LP6A 2EZPA 3W7UA 2XAJA 1MA1A 3BABA 3L70H 3RGBA 1R6NA 2DW4A 1GN3A 1OCRB 3W7TA 3LUTB 5IY5C 2DQ0A 1IBKO 3RYFB 1KQSU 3SYPA 4MSWC 2PTMA 1IURA 3U11A 4DUYB 2WPDG 4RWUA 1V54C 2XNDG 4N21A 2WA3A 4FLWA 1ZUQA 5IWAO 1IBMB 1XILA 5B5EZ 4R8CA 3DXRB 4DR3B 5FLXN 4F4LA 1GN2A 1S72V 4MVUA 1SQXH 1BT8A 1BE3H 2GTSA 3K9SA 5JCOC 1GRJA 3TXQA 4IGGA 4QE7A 3MHHC 4X1KB 4DYLA 4JI4B 3ETQA 2Q67A 3U10A 3E8FA 4NTWA 1VF6C 4HAMA 3CC2V 1IX9A 2W0XA 4LBEC 1NVPD 4JI7O 2ITCC 4RQEA 3RYFA 3VQXA 3RYIA 2X6CA 2KG7A 4MS2A 2UU9B 4O4HB 1JX9A 4CS4A 3SPCA 4DR1O 3H1LH 4K8ZA 1OV9A 4YIPA 2EIJC 5GONB 1NR1A 4DXWA 3OTOO 4FIPC 3ABTA 4QPKA 5EZYB 1WA8A 2XOKG 1VMGA 4DK0A 4HZ3A 3ML0A 4FM1A 4YJ3A 2E5LB 4XDKA 2JRIA 4GX1A 4NXMO 1Q82W 3AK2A 4DV2O 3ZMZA 1V55B 2KSDA 4ZKIA 3N27A 1HR0O 2EJRA 2L35A 3VBBA 4HNAB 3E8HA 1THZA 1NTZH 3SPIA 1K3EA 4CH3A 3UCSC 5IT9N 3K3WA 4LF8O 2YICA 2QTOA 2LFRA 2ZXWC 4UVAA 3STLC 3VOUA 2UXBB 1FXKB 2IBZH 4DV5B 4LF6B 4GKKB 2VWJA 4K35A 1FJGO 1SQVH 1XMQO 4FK5C 3J7AU 2UUCO 2BOBC 1Y76B 1IXBA 3JD4A 1AP6A 4LWSB 4LF4B 1F23A 5L3EA 5BMVB 3CPWU 3OFNG 4X64B 4U3FH 2XT9A 1Y67A 3BVOA 5BZBA 1L8DA 1TUEB 2XAFA 1HR0B 4JI5O 4DO2A 4PDMA 3STZC 4JI0O 1DTOA 3SPGA 1SQGA 4DV2B 4MVSA 4JYBA 3S3WA 5H5NA 2P06A 3AG3B 1XEQA 3IAYA 3Q4HA 5A9GA 1XL6A 1KC8W 2PI4A 1Q7YW 3K0DA 4I9QA 4LF5B 3CE2A 3JALA 2ITDC 2ZQMA 1YEWA 3CRAA 5EBLC 4IT5A 1H2NA 2CTQA 4EB6B 5L3GA 1OCZB 2EBOA 1R3KC 3ZHVA 4TWKA 3LDEA 3K0GA 1LUVA 5LOVB 5L3CA 4X88A 3F7YC 4AHCA 5EC1C 3JASA 2F95B 3RFRA 4DR3O 1L1FA 4O4IA 1OJHA 3CYOA 1B04A 2WLIB 5D5QA 3ZHSA 1XREA 3MD0A 1Q6IA 3AG4B 1XHXA 3BHPA 4B3RB 3K57A 2CTRA 1HNZB 1YXBA 1GM8A 5LA6A 1MMMA 2XAGA 3GWOA 2HP8A 4JI1O 2F1MA 4X20A 2HFEC 3ABLB 3OGIB 3SJCC 5AG2A 5FPRA 1IZ3A 4BAYA 4X9QA 5HFMA 1M4UA 4U7OA 2CDYA 2ZXWB 2OTJV 4NYKA 4YHHO 4MVZA 2IU0A 1WJZA 3ZEDA 3T1YB 1R3LC 2KKWA 4D7TA 2QWRB 1Y76A 4O4LB 1Q8IA 3KG2A 3CRQA 4TUYB 4UV9A 1RSOB 5IYCO 4PJ0Z 2X6AA 4J9YB 4OXSA 3HKEA 2YIAA 3K59A 5CA0B 4DV3O 1TAEA 2WSSG 3A0BZ 4RAIA 4GX2A 4ABMA 5CA1B 1K7DA 2YUAA 5IYZA 2EIMC 4HBNA 4UXNA 5JJNB 2UUBO 1AB3A 1EFRG 3LSSA 5LA6B 2X6BA 1KBHA 4RO2A 2RJZA 4CS2A 1VF5B 1HP8A 1N36B 1WAZA 1NBMG 4GYCB 1AI6A 2ZE5A 3UM7A 4MTGA 1NU1H 1XMOO 1QR9A 1FJGB 5EZYA 3C3TA 1HNXB 1M5IA 2E5LO 3T1YO 3ASOC 3CCVV 3D3QA 2JK5C 4X66O 2FKXA 3H1IH 3F5TA 4PA4A 1K4DC 4IHJB 1VQ4V 2WLIA 3P3PA 4FZ1A 5B1BB 4DV1B 4XBFA 1M56B 2YC0A 3HKDB 1AVMA 1AP5A 4J41A 4ZI7B 2EIKB 4BIOA 1QCEA 1SESA 1P4RA 2QM8A 3OUFA 3JD0A 1DF5A 1FXKA 3VQYA 2IM9A 2JEUA 2VQFB 1FD9A 1VQNV 2ZE8A 5GONA 4DR6B 5CB4B 1SQFA 4LP8A 4G27B 2DOSA 1XMQB 4I7ZB 3H01A 2CTWA 4UCVA 1NJIW 4H0LB 5LP6C 3H1KH 3OR7C 1EM1A 4DUZO 1PKXA 1K73W 3KCXA 1GM9A 2QKAA 4QPJA 5TISZ 2YEVB 4UV8A 4I9WA 2P5OA 5F2VO 2AHZA 2ZE7A 1F4MA 1OCRC 3C90A 3SGIA 5KMGB 3LSUA 1YITV 2JGDB 4BWAA 1M90W 2UXCB 3UO2A 1E79G 3M7MX 2UXNA 4UFZA 2B1IA 2YXYA 4KFMA 2ZR2A 2WWWA 1TGOA 2YXHA 5B66Z 3D3IA 1OCOB 5JH7A 3KKYA 2Q4PA 3JYCA 1WPXA 4CH4A 1SETA 1I5YA 1YSCA 4NVPA 1QLEB 3CEIA 4LCUC 5J9PC 2MK3A 4JAUA 1ORQC 4JAVA 4MVRA 2BCCH 3K5MA 1DLBA 2EIJB 4X62B 3CCUV 1VQLV 2Y4TA 3VQVA 1M9NA 1BL8A 1GK9A 2AZ2A 4JI2B 3MAQA 2UXDO 1AR5A 2JS3A 3FAVA 3BCCH 3Q4HB 1KUQA 1FFXB 4JI6B 3K08A 1K97A 4I4TA 4I50A 3FX7A 5FL7G 1N33O 3L72H 4LF7O 1P7BA 5IJ9B 5LGUA 4GCZA 1QHTA 2XTAA 4XDLA 1VF6A 2ZIOA 3SR2C 4JI1B 3JD1A 1XNQB 4X62O 1YJ9V 2IJJA 3H1HH 1B3QA 1NI8A 4C7UA 2WLKA 3NXSA 3B77A 4I55A 4KHPB 4X1KA 3FKSG 3IJ4A 4QE9A 5J2UB 2GTAA 1A32A 3JAKA 4UCTA 2ZT9B 5BR8B 3APOA 5KUKA 2EINC 2V4DA 5EBMC 3ABMB 4H37A 5D5PA 1LUWA 2DWEC 2E76B 2VS0A 4JZGA 1F4NA 3T1HO 5JH7B 5KUMA 1M57B 2R70A 4FFBA 1L0NH 3DSQA 3HB3B 3G4SV 4TV8A 2IH3C 2PY5A 4EFBA 5JQGB 1HNWO 2LW7A 1KP2A 4YJ2A 1D2DA 1DK1A 4UCOA 1P7GA 4XDJA 1TA8A 4PA3A 3RBZA 2DYSB 1TVKA 2IJKA 4FLXA 1AR1B 1SZTA 3I5DA 1X59A 3E8BA 2VRZA 3F5WC 1GMGA 1NVPB 3JATA 4O2AB 2BTQA 4DV4O 3I55V 4L87A 4RUFA 2R9RB 4J9ZB 3CS5A 4NXNB 1NR7A 2F23A 2BTOA 1K8AW 5EK0A 3FD9A 5K1PA 3MDSA 4GX5A 2HLDG 4LFCO 2VQFO 4FMTA 1I7FA 1G6UA 3HKBB 2KB1A 1Z5WA 2ZNJA 3T1CA 1N0JA 1AI5A 4F6RA 3OM3B 4DW0A 4PI2A 4ICGA 3OUSA 3W7SA 1XL4A 2A0LA 2FYUH 4QIWF 1OCZC 1VARA 1N0NA 3CCLV 1WPBA 2JIZG 1VP7A 3B4SA 1HWYA 5C8YB 2H94A 5JQGA 3ZHUA 3ZRVA 2QDOA 3RYHA 3OEEG 3FYEB 4ZHQB 1SRYA 3JARA 1IBLO 4LFBO 4D6TH 2AXTZ 2BTQB 1SC5B 4ZI7A 2ADPA 2UXDB 3B40A 4NXMB 3MHSC 4JI7B 1BZKA 1UPGA 4PI0A 3K5OA 1XQ8A 5LGTA 4MTOA 5ITZA 5KMGA 3B8MA 5LMUB 4OPHA 4FM0A
chains in the Genus database with same CATH topology
2ITDC 2ZQMA 1UJWB 3AEIA 2GSMB 5EBLC 3IFXA 1Q81W 2NLJC 5L3GA 1OCZB 2EBOA 1OHHG 1R3KC 3AG3C 4PA7A 4TWKA 3TCUA 3G71V 1VQKV 3LDEA 3K0GA 3P30A 3ZRXA 1JOYA 5L3CA 2DQ3A 2R9IA 4X88A 3F7YC 5EC1C 1RPOA 1L1FA 1G4YB 2XASA 3OMNB 3E2EA 3AG1C 3F7VC 3CYOA 3CC4V 4UVBA 3K79A 1H2GA 1H8EG 4MVQA 3TK1A 2JJ1G 2WLIB 3G6EV 2W6IG 3MD0A 2WLJA 3AG4B 3IGAC 4WFBV 3M99B 3CXCU 5B3SB 1BHBA 1MG1A 1GM8A 2IH1C 2XAGA 3GWOA 5B1AB 3ABKB 3SYQA 2HVJC 3T2MA 2HFEC 1F51A 2Q68A 3ABLB 1FXKC 2HR3A 5LGNA 1MSWD 4BAYA 5HFMA 4U7OA 5H6RA 2ZXWB 2OTJV 4PDRA 1W0JG 4FJCC 3ZN0A 3FYIB 4MVZA 1W0KG 4RQFA 4RUEA 3FB6C 2IU0A 2HVKC 1R3LC 4WFEA 2UXXA 3OR6C 4I5SA 3WG7C 1R3IC 1S5HC 3ZMSA 1QR8A 3KG2A 5B1NA 3WG7B 4UV9A 4E2LA 1QBZA 5IYCO 1KD1W 5IY5B 1EZJA 2X6AA 2QKSA 4J9YB 3W7XA 1NH2B 1G8MA 4OXSA 3ZN1A 2P6JA 4WFFA 3T4DA 1VQ9V 1AROP 1S76D 2Y69B 1FFTB 3IC7A 2WSSG 1MABG 4RAIA 4GX2A 1K7DA 2XAHA 4YXWG 3UKMA 3WFVA 1S0VA 1ZWIC 2EIMC 3HPLC 4G28B 3ZJZA 4UXNA 1LNQA 1EFRG 3CC7V 4UUJC 2PI5A 3FB8C 2D3OW 3LSSA 1CPYA 2X6BA 1SERA 4X8AA 1OCCC 2WLNA 2C2AA 3QNEA 4MVMA 4RO2A 3CCEV 1IXMA 4G2KA 4JASA 3CMEV 3CCQV 4PDVA 4WFHA 1NKDA 2EINB 1NBMG 3OMAB 3ZRWA 1AI6A 1JQ0A 3CCJV 3OEHG 4MTGA 3UM7A 2QA4V 4UVCA 4U7NA 1QR9A 1JPXA 3B8NA 1B6QA 3K04A 5CN0A 1OCOC 2LP7A 4R50A 2X7RB 2ZR3A 3ASOC 4JGSA 2A79B 3CCVV 4JTCB 5GW7A 3RW0A 2JK5C 3I56V 2FTKA 4MW3A 4CZZA 4PA4A 5IDJA 1K4DC 2IJHA 1VQ4V 2WLIA 2A9HA 3SYOA 1YHQV 5B1BB 2Z5UA 3BEHA 4XBFA 1VQOV 1YI2V 4PELA 3EHBB 1VQ8V 4P2ZA 5H9CA 1FXVA 1M56B 4PA9A 1JJ2U 3A0RA 3DTUB 4R7CA 1KECA 2W0FC 1R73A 2EIKB 1QCEA 1GTOA 3ETEA 1SESA 4P9PA 1P4RA 2OTLV 2QM8A 2B5UA 3JD0A 3OUFA 3CCRV 1DF5A 3BY6A 1FXKA 3E8GA 3AG1B 2H8PC 2ZDIC 4BIUA 4WFAV 3ZRWB 2JEUA 4JF3A 1KP3A 2WLLA 1VQNV 1RPRA 1K34A 3SJQC 5LHIA 2IU3A 4Q20A 3T4ZA 4LP8A 4P9OA 1S77D 4G27B 4N23A 3DGEA 2CK3G 2EZOA 1PNLA 1PNMA 2HG5C 2Y69C 1COWG 3H01A 5B1OA 4QJFB 1NJIW 4TT3G 3ETDA 3ABUA 1AJNA 2WLHA 1GO3F 3OR7C 1GKFA 5L3BA 5KA5A 1PKXA 1K73W 1DF4A 1GM9A 2K1EA 1QVFU 5CBFA 1E1RG 4QPJA 5LBQA 2YEVB 4UV8A 4I9WA 4MTXA 4HYOA 2AHZA 1E1QG 3R65A 5CMUA 1F4MA 1OCRC 3ZCCA 5DN6G 1VQ7V 1Y66A 1YITV 2Z3YA 4R6ZA 1M90W 4MT8A 4FPPA 1OCCB 5DM6V 1E79G 4LC1A 4Z1MG 3CCSV 3PJSK 2UXNA 1H38A 2AHYA 4ASUG 2P90A 2B1IA 2P67A 1ENVA 4KFMA 2ZR2A 3LNMB 4MW8A 1CEZA 2WWWA 3LDCA 3D3IA 1EBOA 1JVMA 1OCOB 4KP4A 5L3FA 2WAMA 1PL0A 2EIMB 4EKWA 2F43G 4JTAB 3JYCA 1V55C 1WPXA 1SETA 3OW2U 3LSQA 5EBWC 1VQMV 1W2BU 2QEXV 3K9AA 1I5YA 1YSCA 2DYRC 1QLEB 2EZPA 3W7UA 3CP1A 2XAJA 1J95A 4LCUC 5J9PC 1QLNA 2MK3A 3E83A 4JAUA 3K03A 1ORQC 2YSUB 4JAVA 1R6NA 2IW5A 2DW4A 4PA6A 1OCRB 3W7TA 4MVRA 3LUTB 5IY5C 1DLBA 2DQ0A 2EIJB 1VQLV 3CCUV 2XAQA 1M9NA 1KQSU 3SYPA 1BL8A 2HKOA 3ASNB 5C93A 1GK9A 4MSWC 3JCZA 1QLEC 4JYCA 4MTFA 2Q6AA 4BIZA 5IYBO 1K5QA 2WPDG 1VQ5V 3ABLC 2GHYA 1KKDA 3ETGA 1Y4MA 1V54C 2XNDG 4N21A 3SPJA 2DYSC 3OE7G 1N8RW 4TSFG 3K08A 1K97A 1YJWV 2ZDIA 2OCCB 3P32A 5FL7G 3X2QB 3ABKC 3SYAA 4R8CA 1P7BA 2ATKC 1ROPA 5LGUA 4GX0A 4GCZA 1S3JA 3GB7C 4F4LA 1PD3A 2M7WA 4XDLA 1S72V 1M57C 4MVUA 1YJNV 3JD1A 3JD2A 1NH2D 3AG4C 1VQPV 3FB7C 5HFLA 1YJ9V 2EIKC 2IJJA 3CD6V 4QE7A 3MHHC 2WLKA 3NXSA 5CBHA 1YIJV 2HJFC 5B1AC 3E35A 2Q67A 5IYDO 3B77A 3E8FA 4QNHB 2JEXA 2NNUA 2V1DA 3FKSG 1R3JC 3OGCC 2IJIA 4HAMA 2P7TC 1YTFD 3CC2V 3E86A 2EILB 4LBEC 4QE9A 1NVPD 2ITCC 4RQEA 5KA6A 3X2QC 4PDLA 1V54B 1H8HG 2X6CA 5KUKA 4MS2A 2EINC 4WCEV 5EBMC 4KUMA 3ABMB 4H37A 1JX9A 2LFSA 2DWEC 3SPCA 3SPHA 1K9MW 1F4NA 1M56C 1GM7A 2EIJC 4ZBMA 1NR1A 4DXWA 4FIPC 3ABTA 4QPKA 1AI4A 5KUMA 2B1GA 3EFFK 1M57B 2ZD9A 3G4SV 3HB3B 2XOKG 1NQTA 2IH3C 2W6JG 1AJPA 4HZ3A 3ML0A 1K5SA 4XDKA 3ZRSA 1KP2A 4GX1A 1FS0G 3LDDA 1OZ0A 5EC2C 5LHHA 1AJQA 1Q82W 4XDJA 3ZMZA 1V55B 4PA3A 3RBZA 2DYSB 2DYRB 3ASOB 1VQ6V 2OT5A 2IJKA 4BW5A 4ZKIA 1M1KW 1AR1B 2BOCC 1SZTA 4H33A 3E8BA 3F5WC 2EJRA 3W7WA 1GMGA 4P30A 5B1BC 1RM1C 3VBBA 1NVPB 3I55V 1YTFB 3E8HA 1THZA 4L87A 4RUFA 3TETA 2R9RB 4J9ZB 3SPIA 1K3EA 3ASNC 4JPRA 5CBGA 2YEVA 3ZIAG 3ZMVA 1QVGU 3K3WA 1MOFA 1NR7A 3AG2C 5E1AC 2V7QG 2JJ2G 2QTOA 2LFRA 1CP9A 2ZXWC 4UVAA 1JCHA 1AI7A 2Q69A 4MVOA 3STLC 3CMAV 1K8AW 5EK0A 1BMFG 3VOUA 4GX5A 1FXKB 2HLDG 4FMTA 1R6KA 2KB1A 3OAAG 2EILC 3ABMC 3T1CA 4FK5C 1AI5A 3OM3B 2BOBC 2OCCC 5CA3A 1K33A 3OUSA 3W7SA 1XL4A 2A0LA 3JD4A 1OCZC 3OMIB 4QIWF 4CBCA 2DWDC 4JTDB 2WLLB 3CCLV 1I5XA 4WF9V 3ZMUA 1Q86W 1F23A 2JIZG 5L3EA 3FB5C 2X0LA 3QO7A 3RVZA 1HWYA 2H94A 3CPWU 1K4CC 3OFNG 3CCMV 3ZRVA 1BHAA 5LHGA 3AG2B 3OEEG 3FYEB 1FXHA 5BZBA 1SRYA 5L3DA 1TUEB 2XAFA 3QO5A 4X89A 5H6QA 3SYCA 1PNKA 4GT1A 4WFGA 4DO2A 3E89A 4PDMA 3STZC 3K06A 2QM7A 1RM1B 1DTOA 3SPGA 1K92A 2Y48A 2JDIG 4MVSA 4JYBA 5B3SC 3RVYA 3D36A 3ZMTA 3AG3B 1WLEA 3MHSC 2QE7G 1XL6A 1KC8W 5LGTA 2WLMA 2PI4A 4MTOA 1Q7YW 3K0DA 3B8MA 3QO8A 3JD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF5 A;  1SZT A;  2MK3 A;  1JQ0 A;  5KA5 A;  4FK5 C;  1ENV A;  1DF4 A;  3B77 A;  3M99 B;  2EBO A;  4FIP C;  1DLB A;  1MG1 A;  1QR9 A;  1QR8 A;  4JF3 A;  3WFV A;  1JPX A;  1EBO A;  3GWO A;  4JPR A;  1K33 A;  3B8N A;  1K34 A;  5CMU A;  5H9C A;  5CN0 A;  4E2L A;  3P30 A;  5KA6 A;  1MOF A;  2M7W A;  1QBZ A;  3MHS C;  1I5X A;  1Y66 A;  2LP7 A;  1F23 A;  2X7R B;  4N23 A;  4JGS A;  3K9A A;  1I5Y A;  2EZO A;  5HFM A;  4G2K A;  3H01 A;  3CYO A;  2P6J A;  1QCE A;  1Y4M A;  2EZP A;  3B8M A;  4FJC C;  3CP1 A;  5HFL A;  4N21 A;  2OT5 A;  3MHH C; 
#chains in the Genus database with same CATH topology
 4PD4 F;  1ZAU A;  3AEI A;  1Q81 W;  2NLJ C;  4YY3 O;  3ICX A;  4PA7 A;  1I94 B;  4EB6 A;  1VQK V;  3JAS B;  1FKA O;  2LJ2 A;  2Q7G A;  3P30 A;  3ZRX A;  3DXR A;  3TGU H;  1GAX A;  3B2E E;  3JAM N;  1FPO A;  4TV8 B;  2D2C B;  1ZL8 A;  1SZX A;  3OMN B;  3CC4 V;  2UXB O;  2OYQ A;  1H2G A;  3JAT B;  1ZTE A;  1VIB A;  2QWN B;  5CA0 A;  2W6I G;  3G6E V;  2WLJ A;  1V9P A;  3CXC U;  2MW2 B;  2NN4 A;  2IH1 C;  5B1A B;  2YIB D;  3CB2 A;  3T2M A;  1O9G A;  1Q5O A;  1FXK C;  2DMX A;  4OPA A;  5H6R A;  1W0J G;  4B3S B;  3FYI B;  1CXZ B;  3FB6 C;  4O4L A;  3B09 A;  2QM4 A;  2UXX A;  3OR6 C;  1FAF A;  2QJ1 A;  1S5H C;  2FML A;  1QR8 A;  4NTX A;  1YDX A;  5B1N A;  3THO A;  1WA8 B;  5KAI Z;  4E2L A;  4U3J B;  4JI8 B;  1NS1 A;  1EZJ A;  2YI8 A;  3ZN1 A;  2P6J A;  4Q6G A;  4YY3 B;  4D7S A;  4DR7 O;  3A8T A;  3J81 N;  2RNB A;  2GV9 A;  2FL4 A;  5J2T B;  2XAH A;  2VWK A;  1SA0 A;  4YXW G;  3L74 H;  1S0V A;  4X1Y A;  4I55 B;  5CA1 A;  2A3Q A;  3UQ8 A;  1LNQ A;  3CC7 V;  1SER A;  2QWP B;  4JAA A;  3QNE A;  2C2A A;  3CCE V;  4JI0 B;  4B08 A;  4QGP A;  1IXM A;  4G2K A;  3CCQ V;  3CME V;  2Q0O C;  1NKD A;  4LH6 A;  4OX9 O;  3BFR A;  2ZM6 B;  3D8C A;  3O9O A;  3DC5 A;  2ODM A;  5LMU O;  3N2K A;  4Z1V A;  4X66 B;  3JAW A;  1URF A;  3B8N A;  2ZM6 O;  1ZL8 B;  5LYJ A;  2X7R B;  2A79 B;  1KMI Z;  5GW7 A;  4ZIB A;  2PYL A;  4TV9 B;  4LFB B;  1NTM H;  4UCS A;  4DRX B;  4CZZ A;  5IDJ A;  5LXT A;  1R6T A;  2OIE A;  1Z5V A;  2ZKO A;  1N4C A;  4X1I B;  1YHQ V;  1VQO V;  4P2Z A;  3EVK A;  1FXV A;  2AZ0 A;  4JV5 B;  2PF4 E;  3DTU B;  2W0F C;  1R73 A;  1YZB A;  3ETE A;  4P9P A;  4LNU B;  2OTL V;  3IC9 A;  5GTI Z;  1JA8 A;  3QG5 A;  4JF3 A;  1KP3 A;  3WU2 Z;  1PPJ H;  2WLL A;  3SDL A;  1QQC A;  1K34 A;  4J10 A;  4AIL C;  2LGQ A;  3RWR D;  4N23 A;  1AR4 A;  2CK3 G;  1PNM A;  2HG5 C;  4TT3 G;  3ETD A;  2WLH A;  1GKF A;  1NZ6 A;  4X65 O;  1TVK B;  2XUM A;  1QVF U;  1E1R G;  1HW7 A;  3ZHR A;  5LBQ A;  4MTX A;  1E1Q G;  1M93 A;  3CRM A;  1VQ7 V;  2ZIM A;  2OWO A;  4DR5 B;  2Q5Z A;  4UB6 Z;  2DE0 X;  4Z1M G;  3CRC A;  2UUA B;  1H38 A;  4JZ2 A;  4MW8 A;  2EUL A;  3LNM B;  4DR1 B;  4DR6 O;  1G1X B;  5KHK A;  2JGU A;  5L3F A;  4WBN A;  2WAM A;  3DC6 A;  1XMO B;  3OW2 U;  3LSQ A;  1VQM V;  3K9A A;  1YF2 A;  1RP3 B;  1N34 B;  4DRX A;  4J7Z A;  4GKJ O;  2WA4 A;  1J95 A;  4DR2 B;  4HNA A;  1QLN A;  3GVM A;  1PP9 H;  3K03 A;  2JS5 A;  4PA6 A;  2UUA O;  4IYI A;  2R72 A;  1ZX3 A;  5KX5 B;  2KG7 B;  2HKO A;  3ASN B;  3JCZ A;  2ZIN A;  1PM9 A;  2BE3 A;  4FZ0 A;  4B3T B;  1UFI A;  1XI1 A;  4DV3 B;  2DYS C;  2LQT A;  1YJW V;  2ZDI A;  2OCC B;  4DV0 O;  3X2Q B;  3ABK C;  1ROP A;  3T1H B;  2HJD A;  4EEQ A;  3CXH F;  3GB7 C;  2BSK A;  1M57 C;  4JYY A;  1YCI A;  3JD2 A;  3AG4 C;  1VQP V;  3FB7 C;  2M6Y A;  4LH7 A;  5BR8 O;  5IYD O;  4DUY O;  3D36 C;  1R1B A;  2PUS A;  1F7Y A;  3G6B A;  2P7T C;  3JAK B;  4B3M O;  3E86 A;  2EIL B;  4KL1 A;  3X2Q C;  4IIJ B;  1H8H G;  4W4K A;  2EX3 A;  4Z2W A;  3APQ A;  4K0K O;  1S5J A;  1HNW B;  4W4L A;  2GDS A;  5IJ9 A;  1M56 C;  1GM7 A;  4ZBM A;  3JAL B;  1AI4 A;  3EFF K;  3L9D A;  1NQT A;  5JVD A;  2W6J G;  1AJP A;  1US6 A;  2KQX A;  2P4V A;  3ZRS A;  1FS0 G;  5EC2 C;  1AJQ A;  4JYA O;  2CH7 B;  4BW5 A;  1M1K W;  2BOC C;  5J2T A;  1RM1 C;  5B1B C;  4P30 A;  4DUZ B;  2LGW A;  1JFF B;  1HNZ O;  5CBG A;  1EZV H;  2YEV A;  1QNM A;  3P3N A;  2OIG A;  3ZMV A;  2JJ2 G;  4JI5 B;  1CP9 A;  1JCH A;  1AI7 A;  4K8X A;  1P49 A;  1AIL A;  1BMF G;  4TQF A;  4X64 O;  3OAA G;  3ABM C;  1Q43 A;  2OCC C;  1SF9 A;  4FLV A;  5CA3 A;  3UT5 B;  4CBC A;  1SKV A;  2WLL B;  1Q86 W;  1I5X A;  4WF9 V;  3ZMU A;  2UU9 O;  2B9Z A;  2UUC B;  3FB5 C;  4ZOL A;  2X0L A;  3QO7 A;  1K4C C;  3L75 H;  3HKC A;  5LHG A;  4H44 B;  2GUZ B;  1FXH A;  3HKE B;  4LFC B;  3BAA A;  5L3D A;  3QO5 A;  4X89 A;  4GT1 A;  4TV9 A;  4WFG A;  3TJT A;  3E89 A;  1JR9 A;  4KXR A;  5K1X A;  2Y48 A;  2XHB A;  5KHG A;  3BA8 A;  3HR0 A;  3O65 A;  2UUB B;  3S3X A;  4NTY A;  4J42 A;  1N34 O;  2LW1 A;  1P84 F;  3QO8 A;  3L73 H;  5LMN B;  1GH6 A;  5ITZ B;  4LF4 O;  1TUB A;  3QTC A;  4FLT A;  1MZF A;  2GSM B;  3IFX A;  4TOI A;  4LFA B;  2CGN A;  3AG3 C;  1Y74 A;  3TCU A;  3G71 V;  3VQW A;  1JOY A;  2Q7E A;  5FPO A;  2R9I A;  1G4Y B;  4GKK O;  2XAS A;  2K9P A;  3E2E A;  4DW1 A;  4UVB A;  3K79 A;  3LNN A;  1U96 A;  1JJO A;  2YS8 A;  3TXS A;  5B3S B;  1BCC H;  2QWO B;  1BHB A;  2ZE6 A;  4J7K A;  3A2F A;  3ABK B;  2HVJ C;  2ARH A;  4DV4 B;  2CUG A;  4FFK A;  2YIB A;  4X1Y B;  2Q68 A;  5J2U A;  2HR3 A;  1MSW D;  5KX5 A;  4OGQ B;  4JI3 B;  2G38 A;  2OCH A;  3ZN0 A;  5BXZ A;  1W0K G;  3WB2 A;  4RQF A;  3K5L A;  2HVK C;  4O2B A;  1R3I C;  3ZMS A;  4FM2 A;  1Y6X A;  1QBZ A;  1XDC A;  4AI8 A;  5IY5 B;  3UT5 A;  3W7X A;  2QKS A;  2RMK B;  5EYP B;  2AGA A;  5LYJ B;  4B7K A;  4ZOL B;  3T4D A;  5GTH Z;  1ARO P;  4O4I B;  2Y69 B;  3QVN A;  1ZLZ A;  5FNV B;  1IVS A;  5KAF Z;  3JSN A;  4G28 B;  1BQZ A;  4CS3 A;  5H2F Z;  4UUJ C;  3OT7 A;  1XNR B;  3OTF A;  1JMK C;  2WLN A;  4MVM A;  2QKC A;  1KYO F;  2F4V O;  2YI9 A;  1GN6 A;  1SQP H;  3OMA B;  4WFH A;  1JQ0 A;  5IJ0 B;  1VF7 A;  2LO1 A;  3CCJ V;  3OEH G;  2PYJ A;  2O57 A;  1TUB B;  3K5N A;  4JYA B;  3G67 A;  4F6R B;  1B6Q A;  1N33 B;  1Y74 B;  2LP7 A;  4R50 A;  2ZR3 A;  5JVD B;  4JTC B;  2RN9 A;  4DV7 O;  2VQE B;  1WN7 A;  2FTK A;  5JWP A;  1SQB H;  2UXC O;  2A06 H;  2A9H A;  2ETN A;  3RYC B;  1Z2G A;  5LXT B;  1YI2 V;  5H9C A;  3U0Z A;  3PN1 A;  1JJ2 U;  3A0R A;  3BA9 A;  4LNU A;  1KEC A;  4IL6 Z;  4FLU A;  1H2K A;  1IDS A;  1GTO A;  3CCR V;  4LF9 B;  3BY6 A;  3E8G A;  2QSA A;  1KU9 A;  4H13 B;  2YID A;  3K58 A;  4YJ3 B;  4A5U B;  1MNG A;  1MZE A;  2Y4U A;  1I94 O;  1N32 O;  3SJQ C;  5LHI A;  2F4V B;  4Q20 A;  3EXA A;  4B3S O;  1RSO A;  2EZO A;  5B1O A;  4QJF B;  1COW G;  5LMN O;  3JAR B;  5BMV A;  3ABU A;  4LF7 B;  1B06 A;  5KA5 A;  5EIB C;  2K1E A;  1XHZ A;  5CBF A;  4KHP O;  3CJH B;  4HYO A;  4JI3 O;  5JJJ B;  4AQY O;  4JI2 O;  1EN5 A;  1Y66 A;  3A0H Z;  4DR4 O;  4GKJ B;  2Z3Y A;  4MT8 A;  1FFX A;  4FPP A;  2Q73 A;  5DM6 V;  3CCS V;  3PJS K;  2AHY A;  4J7J A;  4ASU G;  2P90 A;  3OTO B;  3N2G B;  2P67 A;  1ENV A;  1CEZ A;  4CC6 A;  5KHI A;  3ZBH A;  1PL0 A;  2EIM B;  2ILM A;  2F43 G;  4I0X B;  4FFB B;  1WB7 A;  5DED A;  4LF5 O;  5EBW C;  4PV1 B;  2DYR C;  3J80 N;  1S5L Z;  4DR5 O;  3CP1 A;  3CHX A;  3E83 A;  4AQY B;  2YSU B;  2IW5 A;  2XAQ A;  4CH6 A;  4J80 A;  2Q7H A;  1SA0 B;  5C93 A;  1QLE C;  4JYC A;  4MTF A;  2Q6A A;  4BIZ A;  5IYB O;  1K5Q A;  4IIJ A;  3HKD A;  1VQ5 V;  4UCR A;  2GHY A;  3ABL C;  1KKD A;  3ETG A;  1Y4M A;  3SPJ A;  3OE7 G;  1N8R W;  3AK3 A;  4TSF G;  5IWA B;  5IE9 A;  3P32 A;  3HKB A;  3SYA A;  1EN6 A;  1BQ0 A;  4U3J A;  2ATK C;  4GX0 A;  1S3J A;  1PD3 A;  2M7W A;  4IYH A;  1WNS A;  1Q3E A;  4K3A A;  3RYH B;  1YJN V;  1X4T A;  2BSK B;  1NH2 D;  2CE4 A;  1EN4 A;  2FB5 A;  2QGN A;  1D5N A;  3QF7 A;  5HFL A;  2EIK C;  3CD6 V;  4O2A A;  1H2S B;  2JVD A;  5CBH A;  1YIJ V;  2HJF C;  1DGS A;  3E35 A;  5B1A C;  4O4J B;  4QNH B;  4GUN A;  2JEX A;  2NNU A;  2V1D A;  3OGC C;  1R3J C;  2E3C A;  2IJI A;  1YTF D;  4B3M B;  2AW9 A;  2GBO A;  4CH5 A;  3JSL A;  4NB5 A;  5KA6 A;  2RQ6 A;  2Z0A A;  3R66 A;  4PDL A;  1V54 B;  5IYZ B;  1BS3 A;  4PHZ A;  4WCE V;  2Q9L A;  4KUM A;  4O2B B;  2LFS A;  3SPH A;  1K9M W;  4O4H A;  1O9H A;  5KHJ A;  1HDJ A;  1SS3 A;  1SQQ H;  2B1G A;  3N2G A;  2PZS A;  2ZD9 A;  4B7E A;  1I0H A;  5EYP A;  1L0L H;  1K5S A;  4DV0 B;  3LDD A;  4YIO A;  1OZ0 A;  5LHH A;  1HNX O;  4JI6 O;  4B3T O;  4FVM A;  3SJB C;  2DYR B;  3ASO B;  1VQ6 V;  2OT5 A;  4DV1 O;  2DN9 A;  4H33 A;  3W7W A;  1W59 A;  5FNV A;  2QR4 A;  1YTF B;  3TET A;  3ASN C;  4JPR A;  4IHJ A;  3ZIA G;  1QVG U;  1PL4 A;  1WP8 A;  3KZI Z;  1MOF A;  2Q8V A;  3AG2 C;  5E1A C;  2V7Q G;  3CMA V;  4MVO A;  2Q69 A;  2CGO A;  1QU7 A;  5LL6 Y;  5IJ0 A;  1R6K A;  2EIL C;  3CRR A;  4LF9 O;  4LR3 A;  4BR6 A;  4WBN B;  1RFY A;  4I4T B;  2DJV A;  1IBM O;  2ZNI A;  2Y0I A;  4CC5 A;  1K33 A;  2ADQ B;  3OMI B;  3FFQ A;  2DWD C;  4JTD B;  4NR1 A;  5BY1 A;  1FYJ A;  1BGY H;  3RVZ A;  3RN4 A;  3CCM V;  2ZCE A;  1BHA A;  4UCU A;  2HHH B;  4YJ2 B;  3AG2 B;  4GLX A;  5DEC A;  4L8J A;  4FLY A;  3UO3 A;  5H6Q A;  2A7W A;  3SYC A;  1PNK A;  3K06 A;  2QM7 A;  1RM1 B;  4DV7 B;  1K92 A;  2JDI G;  3BPZ A;  5B3S C;  3RVY A;  3ZMT A;  3D36 A;  1WLE A;  2QE7 G;  3ZS8 C;  2WLM A;  4X20 B;  2HHH O;  3JD3 A;  1XOU A;  2JGD A;  3H1J H;  1UJW B;  1OHH G;  3ZHT A;  2L6L A;  4LWS A;  1XUQ A;  2CAZ C;  2F66 C;  1KB9 F;  2DQ3 A;  3JAW B;  2EJ7 A;  1XNR O;  1RPO A;  5LOV A;  3AG1 C;  3F7V C;  1H8E G;  4MVQ A;  3TK1 A;  2JJ1 G;  3IGA C;  4B3R O;  4JV5 O;  4WFB V;  3M99 B;  1MG1 A;  3RYI B;  4FLZ A;  1VEW A;  3CSX A;  3SYQ A;  4DR4 B;  1F51 A;  1J5E O;  5LGN A;  4JI4 O;  1BSM A;  3C3S A;  4PDR A;  4FJC C;  2N74 A;  4RUE A;  2E74 B;  1IBL B;  4DR2 O;  3L71 H;  4DV6 B;  4WFE A;  2HEP A;  4I5S A;  4UB8 Z;  1LR1 A;  3WG7 C;  4I0X A;  5JCO A;  1MSD A;  1PV0 A;  3WG7 B;  5E79 Z;  1J5E B;  3E22 B;  1KD1 W;  1NH2 B;  1G8M A;  4LFA O;  1N36 O;  4NKG B;  1I08 A;  4WFF A;  3AG7 A;  1VQ9 V;  1S76 D;  1FFT B;  2N04 A;  3IC7 A;  5A2Q N;  1MAB G;  2Q0A A;  2RCV A;  1ZSP A;  3UKM A;  4DV5 O;  4LF6 O;  3WFV A;  1ZWI C;  3HPL C;  3ZJZ A;  2PI5 A;  3WB1 A;  3FB8 C;  3ZX6 A;  3SJA C;  2D3O W;  1CPY A;  3RT3 C;  2RDC A;  4X8A A;  1OCC C;  4LF8 B;  2R9A A;  4JAS A;  4PDV A;  4I50 B;  2EIN B;  2PGG A;  3ZRW A;  3WB0 A;  3G80 A;  2QA4 V;  4UVC A;  4U7N A;  2P4K A;  1JPX A;  2CTP A;  3K04 A;  2E75 B;  5CN0 A;  1OCO C;  3HKC B;  5LP6 B;  4BW9 A;  5CB4 A;  4JGS A;  4YHH B;  3RW0 A;  3E22 A;  4O4J A;  3I56 V;  4J11 A;  4NXN O;  3RYC A;  4MW3 A;  4X65 B;  1JFF A;  5KLV H;  2IJH A;  3KCY A;  3SYO A;  4DK1 A;  2Z5U A;  3BEH A;  1IBK B;  1VQ8 V;  4PEL A;  3EHB B;  2VQE O;  2YDE A;  4PA9 A;  4R7C A;  1Q6H A;  2Y0P A;  2QTS A;  3JCU Z;  1Q6U A;  2B5U A;  4GZR B;  3GWK C;  3AK1 A;  3AG1 B;  2H8P C;  2ZDI C;  3BRC A;  4BIU A;  4WFA V;  3ZRW B;  1T5E A;  1D5A A;  5EIB D;  1N32 B;  1RPR A;  1XNQ O;  1H2L A;  4DV6 O;  4JI8 O;  2IU3 A;  3T4Z A;  4P9O A;  2GUZ A;  1S77 D;  3DGE A;  3ZHQ A;  1PNL A;  2Y69 C;  1KKC A;  1YVW A;  4OX9 B;  1AJN A;  1U97 A;  1GO3 F;  4TQD A;  1Q90 D;  1NTK H;  5L3B A;  4F6E A;  1DF4 A;  3CJH A;  4K0K B;  3OD4 A;  2YXL A;  3R65 A;  5CMU A;  4DR7 B;  3ZCC A;  4X1I A;  1XBL A;  5DN6 G;  2NR5 A;  4R6Z A;  1OCC B;  4LC1 A;  3CX5 F;  2F93 B;  1WB8 A;  5KHH A;  2QWQ B;  3N2K B;  3FAV B;  2H3O A;  3H9V A;  1H2M A;  3LDC A;  3NR7 A;  5JJE B;  3CWB H;  1GN4 A;  1EBO A;  1JVM A;  4KP4 A;  3M8A A;  5C8Y A;  4EKW A;  4EFE A;  2N05 A;  4JTA B;  4E4E A;  1V55 C;  4TUY A;  1WP7 A;  2CH7 A;  1W2B U;  2QEX V;  4ZHQ A;  2P22 C;  1NT2 B;  5LP6 A;  2EZP A;  3W7U A;  2XAJ A;  1MA1 A;  3BAB A;  3L70 H;  3RGB A;  1R6N A;  2DW4 A;  1GN3 A;  1OCR B;  3W7T A;  3LUT B;  5IY5 C;  2DQ0 A;  1IBK O;  3RYF B;  1KQS U;  3SYP A;  4MSW C;  2PTM A;  1IUR A;  3U11 A;  4DUY B;  2WPD G;  4RWU A;  1V54 C;  2XND G;  4N21 A;  2WA3 A;  4FLW A;  1ZUQ A;  5IWA O;  1IBM B;  1XIL A;  5B5E Z;  4R8C A;  3DXR B;  4DR3 B;  5FLX N;  4F4L A;  1GN2 A;  1S72 V;  4MVU A;  1SQX H;  1BT8 A;  1BE3 H;  2GTS A;  3K9S A;  5JCO C;  1GRJ A;  3TXQ A;  4IGG A;  4QE7 A;  3MHH C;  4X1K B;  4DYL A;  4JI4 B;  3ETQ A;  2Q67 A;  3U10 A;  3E8F A;  4NTW A;  1VF6 C;  4HAM A;  3CC2 V;  1IX9 A;  2W0X A;  4LBE C;  1NVP D;  4JI7 O;  2ITC C;  4RQE A;  3RYF A;  3VQX A;  3RYI A;  2X6C A;  2KG7 A;  4MS2 A;  2UU9 B;  4O4H B;  1JX9 A;  4CS4 A;  3SPC A;  4DR1 O;  3H1L H;  4K8Z A;  1OV9 A;  4YIP A;  2EIJ C;  5GON B;  1NR1 A;  4DXW A;  3OTO O;  4FIP C;  3ABT A;  4QPK A;  5EZY B;  1WA8 A;  2XOK G;  1VMG A;  4DK0 A;  4HZ3 A;  3ML0 A;  4FM1 A;  4YJ3 A;  2E5L B;  4XDK A;  2JRI A;  4GX1 A;  4NXM O;  1Q82 W;  3AK2 A;  4DV2 O;  3ZMZ A;  1V55 B;  2KSD A;  4ZKI A;  3N27 A;  1HR0 O;  2EJR A;  2L35 A;  3VBB A;  4HNA B;  3E8H A;  1THZ A;  1NTZ H;  3SPI A;  1K3E A;  4CH3 A;  3UCS C;  5IT9 N;  3K3W A;  4LF8 O;  2YIC A;  2QTO A;  2LFR A;  2ZXW C;  4UVA A;  3STL C;  3VOU A;  2UXB B;  1FXK B;  2IBZ H;  4DV5 B;  4LF6 B;  4GKK B;  2VWJ A;  4K35 A;  1FJG O;  1SQV H;  1XMQ O;  4FK5 C;  3J7A U;  2UUC O;  2BOB C;  1Y76 B;  1IXB A;  3JD4 A;  1AP6 A;  4LWS B;  4LF4 B;  1F23 A;  5L3E A;  5BMV B;  3CPW U;  3OFN G;  4X64 B;  4U3F H;  2XT9 A;  1Y67 A;  3BVO A;  5BZB A;  1L8D A;  1TUE B;  2XAF A;  1HR0 B;  4JI5 O;  4DO2 A;  4PDM A;  3STZ C;  4JI0 O;  1DTO A;  3SPG A;  1SQG A;  4DV2 B;  4MVS A;  4JYB A;  3S3W A;  5H5N A;  2P06 A;  3AG3 B;  1XEQ A;  3IAY A;  3Q4H A;  5A9G A;  1XL6 A;  1KC8 W;  2PI4 A;  1Q7Y W;  3K0D A;  4I9Q A;  4LF5 B;  3CE2 A;  3JAL A;  2ITD C;  2ZQM A;  1YEW A;  3CRA A;  5EBL C;  4IT5 A;  1H2N A;  2CTQ A;  4EB6 B;  5L3G A;  1OCZ B;  2EBO A;  1R3K C;  3ZHV A;  4TWK A;  3LDE A;  3K0G A;  1LUV A;  5LOV B;  5L3C A;  4X88 A;  3F7Y C;  4AHC A;  5EC1 C;  3JAS A;  2F95 B;  3RFR A;  4DR3 O;  1L1F A;  4O4I A;  1OJH A;  3CYO A;  1B04 A;  2WLI B;  5D5Q A;  3ZHS A;  1XRE A;  3MD0 A;  1Q6I A;  3AG4 B;  1XHX A;  3BHP A;  4B3R B;  3K57 A;  2CTR A;  1HNZ B;  1YXB A;  1GM8 A;  5LA6 A;  1MMM A;  2XAG A;  3GWO A;  2HP8 A;  4JI1 O;  2F1M A;  4X20 A;  2HFE C;  3ABL B;  3OGI B;  3SJC C;  5AG2 A;  5FPR A;  1IZ3 A;  4BAY A;  4X9Q A;  5HFM A;  1M4U A;  4U7O A;  2CDY A;  2ZXW B;  2OTJ V;  4NYK A;  4YHH O;  4MVZ A;  2IU0 A;  1WJZ A;  3ZED A;  3T1Y B;  1R3L C;  2KKW A;  4D7T A;  2QWR B;  1Y76 A;  4O4L B;  1Q8I A;  3KG2 A;  3CRQ A;  4TUY B;  4UV9 A;  1RSO B;  5IYC O;  4PJ0 Z;  2X6A A;  4J9Y B;  4OXS A;  3HKE A;  2YIA A;  3K59 A;  5CA0 B;  4DV3 O;  1TAE A;  2WSS G;  3A0B Z;  4RAI A;  4GX2 A;  4ABM A;  5CA1 B;  1K7D A;  2YUA A;  5IYZ A;  2EIM C;  4HBN A;  4UXN A;  5JJN B;  2UUB O;  1AB3 A;  1EFR G;  3LSS A;  5LA6 B;  2X6B A;  1KBH A;  4RO2 A;  2RJZ A;  4CS2 A;  1VF5 B;  1HP8 A;  1N36 B;  1WAZ A;  1NBM G;  4GYC B;  1AI6 A;  2ZE5 A;  3UM7 A;  4MTG A;  1NU1 H;  1XMO O;  1QR9 A;  1FJG B;  5EZY A;  3C3T A;  1HNX B;  1M5I A;  2E5L O;  3T1Y O;  3ASO C;  3CCV V;  3D3Q A;  2JK5 C;  4X66 O;  2FKX A;  3H1I H;  3F5T A;  4PA4 A;  1K4D C;  4IHJ B;  1VQ4 V;  2WLI A;  3P3P A;  4FZ1 A;  5B1B B;  4DV1 B;  4XBF A;  1M56 B;  2YC0 A;  3HKD B;  1AVM A;  1AP5 A;  4J41 A;  4ZI7 B;  2EIK B;  4BIO A;  1QCE A;  1SES A;  1P4R A;  2QM8 A;  3OUF A;  3JD0 A;  1DF5 A;  1FXK A;  3VQY A;  2IM9 A;  2JEU A;  2VQF B;  1FD9 A;  1VQN V;  2ZE8 A;  5GON A;  4DR6 B;  5CB4 B;  1SQF A;  4LP8 A;  4G27 B;  2DOS A;  1XMQ B;  4I7Z B;  3H01 A;  2CTW A;  4UCV A;  1NJI W;  4H0L B;  5LP6 C;  3H1K H;  3OR7 C;  1EM1 A;  4DUZ O;  1PKX A;  1K73 W;  3KCX A;  1GM9 A;  2QKA A;  4QPJ A;  5TIS Z;  2YEV B;  4UV8 A;  4I9W A;  2P5O A;  5F2V O;  2AHZ A;  2ZE7 A;  1F4M A;  1OCR C;  3C90 A;  3SGI A;  5KMG B;  3LSU A;  1YIT V;  2JGD B;  4BWA A;  1M90 W;  2UXC B;  3UO2 A;  1E79 G;  3M7M X;  2UXN A;  4UFZ A;  2B1I A;  2YXY A;  4KFM A;  2ZR2 A;  2WWW A;  1TGO A;  2YXH A;  5B66 Z;  3D3I A;  1OCO B;  5JH7 A;  3KKY A;  2Q4P A;  3JYC A;  1WPX A;  4CH4 A;  1SET A;  1I5Y A;  1YSC A;  4NVP A;  1QLE B;  3CEI A;  4LCU C;  5J9P C;  2MK3 A;  4JAU A;  1ORQ C;  4JAV A;  4MVR A;  2BCC H;  3K5M A;  1DLB A;  2EIJ B;  4X62 B;  3CCU V;  1VQL V;  2Y4T A;  3VQV A;  1M9N A;  1BL8 A;  1GK9 A;  2AZ2 A;  4JI2 B;  3MAQ A;  2UXD O;  1AR5 A;  2JS3 A;  3FAV A;  3BCC H;  3Q4H B;  1KUQ A;  1FFX B;  4JI6 B;  3K08 A;  1K97 A;  4I4T A;  4I50 A;  3FX7 A;  5FL7 G;  1N33 O;  3L72 H;  4LF7 O;  1P7B A;  5IJ9 B;  5LGU A;  4GCZ A;  1QHT A;  2XTA A;  4XDL A;  1VF6 A;  2ZIO A;  3SR2 C;  4JI1 B;  3JD1 A;  1XNQ B;  4X62 O;  1YJ9 V;  2IJJ A;  3H1H H;  1B3Q A;  1NI8 A;  4C7U A;  2WLK A;  3NXS A;  3B77 A;  4I55 A;  4KHP B;  4X1K A;  3FKS G;  3IJ4 A;  4QE9 A;  5J2U B;  2GTA A;  1A32 A;  3JAK A;  4UCT A;  2ZT9 B;  5BR8 B;  3APO A;  5KUK A;  2EIN C;  2V4D A;  5EBM C;  3ABM B;  4H37 A;  5D5P A;  1LUW A;  2DWE C;  2E76 B;  2VS0 A;  4JZG A;  1F4N A;  3T1H O;  5JH7 B;  5KUM A;  1M57 B;  2R70 A;  4FFB A;  1L0N H;  3DSQ A;  3HB3 B;  3G4S V;  4TV8 A;  2IH3 C;  2PY5 A;  4EFB A;  5JQG B;  1HNW O;  2LW7 A;  1KP2 A;  4YJ2 A;  1D2D A;  1DK1 A;  4UCO A;  1P7G A;  4XDJ A;  1TA8 A;  4PA3 A;  3RBZ A;  2DYS B;  1TVK A;  2IJK A;  4FLX A;  1AR1 B;  1SZT A;  3I5D A;  1X59 A;  3E8B A;  2VRZ A;  3F5W C;  1GMG A;  1NVP B;  3JAT A;  4O2A B;  2BTQ A;  4DV4 O;  3I55 V;  4L87 A;  4RUF A;  2R9R B;  4J9Z B;  3CS5 A;  4NXN B;  1NR7 A;  2F23 A;  2BTO A;  1K8A W;  5EK0 A;  3FD9 A;  5K1P A;  3MDS A;  4GX5 A;  2HLD G;  4LFC O;  2VQF O;  4FMT A;  1I7F A;  1G6U A;  3HKB B;  2KB1 A;  1Z5W A;  2ZNJ A;  3T1C A;  1N0J A;  1AI5 A;  4F6R A;  3OM3 B;  4DW0 A;  4PI2 A;  4ICG A;  3OUS A;  3W7S A;  1XL4 A;  2A0L A;  2FYU H;  4QIW F;  1OCZ C;  1VAR A;  1N0N A;  3CCL V;  1WPB A;  2JIZ G;  1VP7 A;  3B4S A;  1HWY A;  5C8Y B;  2H94 A;  5JQG A;  3ZHU A;  3ZRV A;  2QDO A;  3RYH A;  3OEE G;  3FYE B;  4ZHQ B;  1SRY A;  3JAR A;  1IBL O;  4LFB O;  4D6T H;  2AXT Z;  2BTQ B;  1SC5 B;  4ZI7 A;  2ADP A;  2UXD B;  3B40 A;  4NXM B;  3MHS C;  4JI7 B;  1BZK A;  1UPG A;  4PI0 A;  3K5O A;  1XQ8 A;  5LGT A;  4MTO A;  5ITZ A;  5KMG A;  3B8M A;  5LMU B;  4OPH A;  4FM0 A; 
#chains in the Genus database with same CATH homology
 2ITD C;  2ZQM A;  1UJW B;  3AEI A;  2GSM B;  5EBL C;  3IFX A;  1Q81 W;  2NLJ C;  5L3G A;  1OCZ B;  2EBO A;  1OHH G;  1R3K C;  3AG3 C;  4PA7 A;  4TWK A;  3TCU A;  3G71 V;  1VQK V;  3LDE A;  3K0G A;  3P30 A;  3ZRX A;  1JOY A;  5L3C A;  2DQ3 A;  2R9I A;  4X88 A;  3F7Y C;  5EC1 C;  1RPO A;  1L1F A;  1G4Y B;  2XAS A;  3OMN B;  3E2E A;  3AG1 C;  3F7V C;  3CYO A;  3CC4 V;  4UVB A;  3K79 A;  1H2G A;  1H8E G;  4MVQ A;  3TK1 A;  2JJ1 G;  2WLI B;  3G6E V;  2W6I G;  3MD0 A;  2WLJ A;  3AG4 B;  3IGA C;  4WFB V;  3M99 B;  3CXC U;  5B3S B;  1BHB A;  1MG1 A;  1GM8 A;  2IH1 C;  2XAG A;  3GWO A;  5B1A B;  3ABK B;  3SYQ A;  2HVJ C;  3T2M A;  2HFE C;  1F51 A;  2Q68 A;  3ABL B;  1FXK C;  2HR3 A;  5LGN A;  1MSW D;  4BAY A;  5HFM A;  4U7O A;  5H6R A;  2ZXW B;  2OTJ V;  4PDR A;  1W0J G;  4FJC C;  3ZN0 A;  3FYI B;  4MVZ A;  1W0K G;  4RQF A;  4RUE A;  3FB6 C;  2IU0 A;  2HVK C;  1R3L C;  4WFE A;  2UXX A;  3OR6 C;  4I5S A;  3WG7 C;  1R3I C;  1S5H C;  3ZMS A;  1QR8 A;  3KG2 A;  5B1N A;  3WG7 B;  4UV9 A;  4E2L A;  1QBZ A;  5IYC O;  1KD1 W;  5IY5 B;  1EZJ A;  2X6A A;  2QKS A;  4J9Y B;  3W7X A;  1NH2 B;  1G8M A;  4OXS A;  3ZN1 A;  2P6J A;  4WFF A;  3T4D A;  1VQ9 V;  1ARO P;  1S76 D;  2Y69 B;  1FFT B;  3IC7 A;  2WSS G;  1MAB G;  4RAI A;  4GX2 A;  1K7D A;  2XAH A;  4YXW G;  3UKM A;  3WFV A;  1S0V A;  1ZWI C;  2EIM C;  3HPL C;  4G28 B;  3ZJZ A;  4UXN A;  1LNQ A;  1EFR G;  3CC7 V;  4UUJ C;  2PI5 A;  3FB8 C;  2D3O W;  3LSS A;  1CPY A;  2X6B A;  1SER A;  4X8A A;  1OCC C;  2WLN A;  2C2A A;  3QNE A;  4MVM A;  4RO2 A;  3CCE V;  1IXM A;  4G2K A;  4JAS A;  3CME V;  3CCQ V;  4PDV A;  4WFH A;  1NKD A;  2EIN B;  1NBM G;  3OMA B;  3ZRW A;  1AI6 A;  1JQ0 A;  3CCJ V;  3OEH G;  4MTG A;  3UM7 A;  2QA4 V;  4UVC A;  4U7N A;  1QR9 A;  1JPX A;  3B8N A;  1B6Q A;  3K04 A;  5CN0 A;  1OCO C;  2LP7 A;  4R50 A;  2X7R B;  2ZR3 A;  3ASO C;  4JGS A;  2A79 B;  3CCV V;  4JTC B;  5GW7 A;  3RW0 A;  2JK5 C;  3I56 V;  2FTK A;  4MW3 A;  4CZZ A;  4PA4 A;  5IDJ A;  1K4D C;  2IJH A;  1VQ4 V;  2WLI A;  2A9H A;  3SYO A;  1YHQ V;  5B1B B;  2Z5U A;  3BEH A;  4XBF A;  1VQO V;  1YI2 V;  4PEL A;  3EHB B;  1VQ8 V;  4P2Z A;  5H9C A;  1FXV A;  1M56 B;  4PA9 A;  1JJ2 U;  3A0R A;  3DTU B;  4R7C A;  1KEC A;  2W0F C;  1R73 A;  2EIK B;  1QCE A;  1GTO A;  3ETE A;  1SES A;  4P9P A;  1P4R A;  2OTL V;  2QM8 A;  2B5U A;  3JD0 A;  3OUF A;  3CCR V;  1DF5 A;  3BY6 A;  1FXK A;  3E8G A;  3AG1 B;  2H8P C;  2ZDI C;  4BIU A;  4WFA V;  3ZRW B;  2JEU A;  4JF3 A;  1KP3 A;  2WLL A;  1VQN V;  1RPR A;  1K34 A;  3SJQ C;  5LHI A;  2IU3 A;  4Q20 A;  3T4Z A;  4LP8 A;  4P9O A;  1S77 D;  4G27 B;  4N23 A;  3DGE A;  2CK3 G;  2EZO A;  1PNL A;  1PNM A;  2HG5 C;  2Y69 C;  1COW G;  3H01 A;  5B1O A;  4QJF B;  1NJI W;  4TT3 G;  3ETD A;  3ABU A;  1AJN A;  2WLH A;  1GO3 F;  3OR7 C;  1GKF A;  5L3B A;  5KA5 A;  1PKX A;  1K73 W;  1DF4 A;  1GM9 A;  2K1E A;  1QVF U;  5CBF A;  1E1R G;  4QPJ A;  5LBQ A;  2YEV B;  4UV8 A;  4I9W A;  4MTX A;  4HYO A;  2AHZ A;  1E1Q G;  3R65 A;  5CMU A;  1F4M A;  1OCR C;  3ZCC A;  5DN6 G;  1VQ7 V;  1Y66 A;  1YIT V;  2Z3Y A;  4R6Z A;  1M90 W;  4MT8 A;  4FPP A;  1OCC B;  5DM6 V;  1E79 G;  4LC1 A;  4Z1M G;  3CCS V;  3PJS K;  2UXN A;  1H38 A;  2AHY A;  4ASU G;  2P90 A;  2B1I A;  2P67 A;  1ENV A;  4KFM A;  2ZR2 A;  3LNM B;  4MW8 A;  1CEZ A;  2WWW A;  3LDC A;  3D3I A;  1EBO A;  1JVM A;  1OCO B;  4KP4 A;  5L3F A;  2WAM A;  1PL0 A;  2EIM B;  4EKW A;  2F43 G;  4JTA B;  3JYC A;  1V55 C;  1WPX A;  1SET A;  3OW2 U;  3LSQ A;  5EBW C;  1VQM V;  1W2B U;  2QEX V;  3K9A A;  1I5Y A;  1YSC A;  2DYR C;  1QLE B;  2EZP A;  3W7U A;  3CP1 A;  2XAJ A;  1J95 A;  4LCU C;  5J9P C;  1QLN A;  2MK3 A;  3E83 A;  4JAU A;  3K03 A;  1ORQ C;  2YSU B;  4JAV A;  1R6N A;  2IW5 A;  2DW4 A;  4PA6 A;  1OCR B;  3W7T A;  4MVR A;  3LUT B;  5IY5 C;  1DLB A;  2DQ0 A;  2EIJ B;  1VQL V;  3CCU V;  2XAQ A;  1M9N A;  1KQS U;  3SYP A;  1BL8 A;  2HKO A;  3ASN B;  5C93 A;  1GK9 A;  4MSW C;  3JCZ A;  1QLE C;  4JYC A;  4MTF A;  2Q6A A;  4BIZ A;  5IYB O;  1K5Q A;  2WPD G;  1VQ5 V;  3ABL C;  2GHY A;  1KKD A;  3ETG A;  1Y4M A;  1V54 C;  2XND G;  4N21 A;  3SPJ A;  2DYS C;  3OE7 G;  1N8R W;  4TSF G;  3K08 A;  1K97 A;  1YJW V;  2ZDI A;  2OCC B;  3P32 A;  5FL7 G;  3X2Q B;  3ABK C;  3SYA A;  4R8C A;  1P7B A;  2ATK C;  1ROP A;  5LGU A;  4GX0 A;  4GCZ A;  1S3J A;  3GB7 C;  4F4L A;  1PD3 A;  2M7W A;  4XDL A;  1S72 V;  1M57 C;  4MVU A;  1YJN V;  3JD1 A;  3JD2 A;  1NH2 D;  3AG4 C;  1VQP V;  3FB7 C;  5HFL A;  1YJ9 V;  2EIK C;  2IJJ A;  3CD6 V;  4QE7 A;  3MHH C;  2WLK A;  3NXS A;  5CBH A;  1YIJ V;  2HJF C;  5B1A C;  3E35 A;  2Q67 A;  5IYD O;  3B77 A;  3E8F A;  4QNH B;  2JEX A;  2NNU A;  2V1D A;  3FKS G;  1R3J C;  3OGC C;  2IJI A;  4HAM A;  2P7T C;  1YTF D;  3CC2 V;  3E86 A;  2EIL B;  4LBE C;  4QE9 A;  1NVP D;  2ITC C;  4RQE A;  5KA6 A;  3X2Q C;  4PDL A;  1V54 B;  1H8H G;  2X6C A;  5KUK A;  4MS2 A;  2EIN C;  4WCE V;  5EBM C;  4KUM A;  3ABM B;  4H37 A;  1JX9 A;  2LFS A;  2DWE C;  3SPC A;  3SPH A;  1K9M W;  1F4N A;  1M56 C;  1GM7 A;  2EIJ C;  4ZBM A;  1NR1 A;  4DXW A;  4FIP C;  3ABT A;  4QPK A;  1AI4 A;  5KUM A;  2B1G A;  3EFF K;  1M57 B;  2ZD9 A;  3G4S V;  3HB3 B;  2XOK G;  1NQT A;  2IH3 C;  2W6J G;  1AJP A;  4HZ3 A;  3ML0 A;  1K5S A;  4XDK A;  3ZRS A;  1KP2 A;  4GX1 A;  1FS0 G;  3LDD A;  1OZ0 A;  5EC2 C;  5LHH A;  1AJQ A;  1Q82 W;  4XDJ A;  3ZMZ A;  1V55 B;  4PA3 A;  3RBZ A;  2DYS B;  2DYR B;  3ASO B;  1VQ6 V;  2OT5 A;  2IJK A;  4BW5 A;  4ZKI A;  1M1K W;  1AR1 B;  2BOC C;  1SZT A;  4H33 A;  3E8B A;  3F5W C;  2EJR A;  3W7W A;  1GMG A;  4P30 A;  5B1B C;  1RM1 C;  3VBB A;  1NVP B;  3I55 V;  1YTF B;  3E8H A;  1THZ A;  4L87 A;  4RUF A;  3TET A;  2R9R B;  4J9Z B;  3SPI A;  1K3E A;  3ASN C;  4JPR A;  5CBG A;  2YEV A;  3ZIA G;  3ZMV A;  1QVG U;  3K3W A;  1MOF A;  1NR7 A;  3AG2 C;  5E1A C;  2V7Q G;  2JJ2 G;  2QTO A;  2LFR A;  1CP9 A;  2ZXW C;  4UVA A;  1JCH A;  1AI7 A;  2Q69 A;  4MVO A;  3STL C;  3CMA V;  1K8A W;  5EK0 A;  1BMF G;  3VOU A;  4GX5 A;  1FXK B;  2HLD G;  4FMT A;  1R6K A;  2KB1 A;  3OAA G;  2EIL C;  3ABM C;  3T1C A;  4FK5 C;  1AI5 A;  3OM3 B;  2BOB C;  2OCC C;  5CA3 A;  1K33 A;  3OUS A;  3W7S A;  1XL4 A;  2A0L A;  3JD4 A;  1OCZ C;  3OMI B;  4QIW F;  4CBC A;  2DWD C;  4JTD B;  2WLL B;  3CCL V;  1I5X A;  4WF9 V;  3ZMU A;  1Q86 W;  1F23 A;  2JIZ G;  5L3E A;  3FB5 C;  2X0L A;  3QO7 A;  3RVZ A;  1HWY A;  2H94 A;  3CPW U;  1K4C C;  3OFN G;  3CCM V;  3ZRV A;  1BHA A;  5LHG A;  3AG2 B;  3OEE G;  3FYE B;  1FXH A;  5BZB A;  1SRY A;  5L3D A;  1TUE B;  2XAF A;  3QO5 A;  4X89 A;  5H6Q A;  3SYC A;  1PNK A;  4GT1 A;  4WFG A;  4DO2 A;  3E89 A;  4PDM A;  3STZ C;  3K06 A;  2QM7 A;  1RM1 B;  1DTO A;  3SPG A;  1K92 A;  2Y48 A;  2JDI G;  4MVS A;  4JYB A;  5B3S C;  3RVY A;  3D36 A;  3ZMT A;  3AG3 B;  1WLE A;  3MHS C;  2QE7 G;  1XL6 A;  1KC8 W;  5LGT A;  2WLM A;  2PI4 A;  4MTO A;  1Q7Y W;  3K0D A;  3B8M A;  3QO8 A;  3JD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...