5HGBA

Hla*a2402 complexed with hiv nef138 8mer epitope
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 70
structure length 274
sequence length 274
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hgbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hgbA01
1UACH 1PDKA 2FATH 5DQDH 4OBRA 1M71B 1XGPA 3QP3A 4NP4L 4NM8H 4I5BB 1HH9A 1MCSA 5CCKL 2PXYA 3NIGE 2X1XR 2C1OA 2QQKL 4NRZA 4PJAE 3AC0A 3C5SA 4WGWB 2CRZA 5DUBB 4HKXA 1Q38A 4WU5B 3UJTL 5IKCB 4C54A 2E7HA 3MJGX 4MNHA 2XTLA 3UO1L 5IROC 1F3JB 3MBEA 3OR7A 5E00A 3VXUD 5ACZA 3QO0B 3UZQA 3S37H 5IB5A 2EXYD 3FRPA 4WV1A 5DSCB 4I3SH 3MLVH 5ESQA 3TPUA 5JO5A 1JCKA 1LGVA 3VD7A 2XFXB 1QFWL 1YYMH 3QDJB 4XZUB 3GIZH 2GAZA 3CJJA 5B3NA 3MROB 4LSVL 1RUAH 3BAEH 2YZ8A 3T2QA 5FCUH 4J3UA 4M6OL 4P2OB 2HT3D 1A0QH 2RIKA 1ZGLP 1RJZA 4ELMA 5T3ZD 3JBG7 1AJ7L 4OQTA 3FT2B 5E6IB 1I7RB 3EFDL 5IFAL 1YMMD 1OWRM 2V2XB 3CFKA 3REVA 3MX0A 3QZWG 3HE7C 3EIFA 2N4IA 3TJHC 3CPLB 3LCYA 4TNWF 4I0CC 4EXPX 4UT6H 2CJUL 3H8NA 3RDTD 1YEJH 3U9PH 2FHCA 2IGFH 1K6QL 4JPIA 1WAAE 5C0GA 3QQ3A 1INEH 3GO1H 3R06B 4U0RC 1KJ2A 4H5SB 4M1CD 3THML 1P84J 1JF1B 4UDUB 2EDRA 3C5ZB 4PIRF 2R0KH 3OJVC 3EDKA 4LF3A 4P2QB 1DBAH 3VCLB 4OJFH 3O6LL 4V2BA 5F8QC 3HHRB 3VFOB 5B38A 1J7VR 3BH8B 3QEHA 1HK6A 4WNQB 4GS7B 4BQ6A 5EBWB 4RA3A 1FN4A 4P48A 1I9EA 2RCSH 1QLEL 1CI5A 3TBSA 2MTPA 1RPQA 3U1SH 3OQ3B 2MJWA 2CRYA 3ULUH 5JOPE 1ZANL 4KJPC 1K3IA 3HG1E 3TNMB 1A1MA 4RWYH 2MFNA 3L5XH 4DW2H 1K4CB 4NQED 1EZVX 5BXFB 5HJ3A 3RBGA 4JJ5B 4F58L 4CVUA 5FM4A 5EU4B 1N8ZA 2ADGA 4MVBD 1J87A 2WBJD 3U7YH 1EJOH 1F4XL 5IB4B 2PYED 4E41E 3LDBC 3QDMD 5EUKB 3MLXH 4KJWC 3JV5A 4FTVB 3LEVL 4MQXC 3IFPA 3KPSA 4YHOH 4N68A 1KB5L 4KRPB 5CSGA 1W8OA 4K3EH 3FO1B 3TT3H 4P2RD 4M1GL 5FHAL 4HIIA 4WENB 2XZQL 4AEHH 1XIWC 2XWJB 4G42A 5BO1H 2JELH 4BJLA 3TYFB 4TOYL 2LTQB 3RTQB 3WLBB 4LKCB 2J8UF 4NZUL 2KDGA 5MERA 1CFTB 3SO3B 4I77H 3PQYA 3MRRB 1URLA 1FZOB 2OL3H 5F3BA 3MR9B 5F3HA 4JKPL 4E0RA 3MGTA 1MVFA 3FOMB 1N2RB 1GGCL 4TYUA 4DWHA 3D1MC 1JPGA 3PV6A 3I6GB 4IRSC 4L8SB 1A14L 1B0RB 3O4LB 1FNHA 1WWAX 5CINL 2EDDA 1DBJL 4Y4KC 5I8CB 2E7LE 2DQIH 3MRMB 5E4EC 5FO8B 5FYJH 2FIKA 3TA3D 3MV8E 3QEUB 3H0TB 1SBSL 3WFDL 1A02N 1UCBH 5AAMA 1JTOA 4OD3H 3F7VB 5EN2A 1WZMA 1A7PL 3E6FB 4XBPB 3VFGL 2VC2H 3ARGB 1Z9OA 3W81A 4HIEB 2P47B 5I76B 1UT9A 4WEUD 3MYZA 5I1IH 4HZAA 4NC2B 3MODH 2AJSL 2AKRB 1JWMA 2PR4L 5IV2B 2KQNA 4UDUA 4ZFZB 5GS0L 1DFBL 4HUWB 3PV7A 3DVGA 4FQJL 2O93L 2YRLA 4BUGA 3CSPA 1X4XA 3EJYC 4RMSA 5D1XC 4RNRB 5IT2H 4JKWA 1KCGC 1ZT1A 1C08B 2A83A 4G8GE 5D2LF 3PWNA 5B39A 5LWYL 3U2SB 1FYHB 1KJMB 1MY7A 2AEPL 4P23A 2X4UB 1A5FH 1B4JH 1JTPA 1QRKA 4OCYL 1NDGA 3S3SA 1EEZA 4BK5A 2C4FT 4ELMB 1YMMA 4PG9A 4UI2A 3LVEA 4GRWF 1I4FB 1MF2L 5E2TH 3VGHA 3QG6A 3IU3A 1DQQA 1AO7D 1OGTA 1UVQB 4Y19B 4D9LL 2Y72A 4HCRL 4KZDH 4HT1L 4PBVC 1UM6L 4EEEA 3RKDD 2BSED 5DK2A 3A67L 1ZLVK 5DMIH 4CMHB 5DFTA 1NFDA 4OQ1A 5F1NB 3QRFM 3WJJA 1U3HB 5JW5A 4JFXB 2ZUTA 3MLUH 2P5WD 2VZOA 4BM7A 2VLRA 3QNZB 4N0FA 3VMOA 5JMRA 4Y4KA 1BZ9A 25C8L 4F33A 3FT4B 2WWMD 3AS3A 1S7TB 4DGYH 2NNAA 1ZSDA 1S3KH 5DD0H 4ELKB 5EUKA 4RGOL 4J8RB 4EN3B 5E9DB 1EFQA 4NOBA 5IQ7L 1N7ML 1CN4A 1MUJB 1BWWA 1RU9H 3L3HB 5IVXF 4YBQD 4ODUB 1RK1B 5FB8B 4P2RB 3HR6A 3ZSSA 2NZ9D 1MFNA 1MI5B 2Y23A 4FQXB 1VGEH 2DKSA 1X7QB 3UTQB 3GMPA 5JHDD 4FTVE 5CHNB 4U1HA 3F7YB 1CG9A 3P30H 2Z8WC 1YN7B 4HUXA 4LGRB 3FFCB 4JY5H 3MLPA 4CL7A 1TNMA 3ZE2F 1KLGA 4U3XA 5DRZB 4LSSH 1Z5LA 1FZKA 1W0YT 4GRLA 3DBXA 4A6YB 2NX5D 3QEQE 4F9LA 2C1PB 1RFDH 3BUYA 2A1WL 1GJIA 1KNOB 3IKKA 4LHUG 4P3WA 2XXMB 4PRNB 1LEIA 4HMCA 3LHPL 3HRPA 4JZNB 4FXGB 2VIRA 2EH8H 4X9BA 1AQKL 4TVPE 5DYOB 3IFLH 5CBAA 4C83A 1E4JA 3O0RL 2IPTH 4O2EA 1OTTC 2PTTB 2D0HA 3PV6B 1JPGB 1R3KA 5I16A 3T2OA 2AJXH 2DJSA 1P4LB 4OUOA 1BX2B 3RIAK 1A6TA 1ZHNA 3BEVB 1RIVL 3LH2L 2Q1EA 4NQSB 3EBAA 2WY3A 3UTTE 1A4KB 3REWA 5CGMA 3BXNB 3VFUA 2BVOA 4PLOB 5E2WL 3TPKA 4P2QD 4R96A 1QSFA 5D1XB 4Y4KD 3TJHA 1NSNH 4WUUA 2IBZX 2P5WA 1E6JH 4AT6B 1VB9A 4HH9B 4PB9L 1MH5A 1F00I 5T3ZH 1NEUA 4DVBA 4W4OC 3HPJA 3OGOE 5IW3A 4ERSH 1J8KA 3EYUL 4CVXA 4HX1B 4OI7A 2BRRH 2FJGA 2BHYA 5ERWA 5JOPD 1D6EA 1S7WB 4YDJB 4YX2L 3BDYH 5EIIA 1T2QH 1IFHH 1ZGLB 2QL1A 1QYGL 1M7DB 4FFYL 1QYGH 2W0FB 3RHWF 3CH8A 1S9VA 4WV1C 5D7SL 3WIIL 5T1LD 5AZ2L 4JHBA 4IDLA 2B8OT 5IROA 1CXLA 1AE6H 4G9DB 5KS9F 3SO5A 1L7IL 4K3JH 4DGVL 1SEBA 3X12B 4G6ML 4MD5A 1WAAA 3TZVA 4ORGB 1GGUA 1VFAA 2X5PA 1CD9B 4Y2DB 1Y0LB 5TH2B 3T0WA 2QR0B 1DL7H 4PJ5E 3EDDA 5GRXG 1LO4H 5J0BA 2W0LA 4JDZA 4FFZH 43C9B 4JM2C 4K9EC 1KENL 2WZPD 3RVWC 4C55A 4ENEC 1ORQB 5BRZE 4K3JL 4NGHH 1IZKA 1L7IH 2ZPKL 1ZT4A 1AKJB 2BVOB 2IQ9H 1JPST 4LRIC 4JFFE 1FH5L 5DI8A 5F89B 4WI6A 2Z35B 5E4IA 3BDYL 4N1EA 2F54D 4PJ7A 2JK5A 1QR4A 5HY9B 1BX2A 3N9GL 3O3UN 3NZHL 3WSQH 3QDJA 4XZUA 1VKXB 3W11D 1B2WH 4G9FA 3LHPH 4Y2DD 4PJFE 4P49A 3BXNA 3TJHD 3T0EC 5C2UB 5L2JA 2K7PA 2GFBA 3I6LE 1U93A 3BOVA 3SDXA 2Y5TA 2OM5A 3BP4B 1U8QB 5C9JB 4RIRB 5BS0B 1R3IH 3JTTA 4U1GC 5GZND 3TH2T 2O5ZH 1LD9B 3RWEA 4GMTL 1F11A 4LLYB 5IWLC 1JWUA 2G5RA 1T1WB 4UTBH 3V7AG 4U0RB 2NY6C 2BNRD 1UH3A 3MYJB 3GJFB 5AG9A 4H5SA 4OF3A 2P8PB 3V6OE 1VACA 1U8JA 3ALPA 3HMXH 4YXKH 4ODSL 4NKIL 4PGDB 1K4DA 4PGCA 4TSBH 4F7TB 1YEFH 3QXTA 4WJ5A 3VD4A 4JHWH 4LPCA 2ED7A 4D94A 2B2XH 3TC9A 4G6AC 4OAWA 4QRTA 5FKAB 3JV4A 1NFDF 5SWSE 1U8OA 2BFVL 3MGOB 4HEME 4N5EA 4GKSB 5E6YA 5DJ6A 4Q9RH 1NMBL 1RU9L 2FRGP 4R0LA 5FYKE 1T20B 4EDXB 2GQHA 1DQLL 1MJJB 1T7YA 2CK2A 4KKLD 2UZIL 1BREA 2J88L 4BH7A 3QEHB 4MYWB 4CW1A 3VFMA 3ZL4H 1S7SB 5FYLD 1FORH 1I1FA 3NH7H 3TBVA 3GMOA 3WD5L 5MP6L 1FDLL 5KG9B 4QOKE 2D2OA 5TDOB 1YC8A 4JG0H 3PL6A 4JFED 3HUJA 5FA3B 4QY8A 5I17B 4NKIH 4D9QD 3HCVA 5E1AB 3P9LA 3IDJA 3GK8L 1WWBX 1KYOK 5HPOA 1CTOA 5IEHB 4X6EB 5FYLL 2BDNL 1AGBB 1UXWB 1Y6KR 3MV7D 4N8VB 3TO2B 1WCBB 3PGFL 1OL0A 4KK5C 4XNUH 1CFNA 1KN2L 1S7WA 2VXVH 5EUOA 2QTEA 4FQXD 1ZHLA 4R9HA 5D6DC 1RZJH 4QWWC 1CBVH 4M6NH 4YO0A 3L7FA 4UDTA 4OSUL 1CGWA 1Z6JT 2VE6B 2X4SB 1S7RB 1XF2A 5CLTA 4M43L 1BQSA 4ZXBD 5C6TH 4IMLA 3DI3B 2J8UE 3OJ2C 3QNZA 4L9LB 2QQNH 4N0FB 2AEPH 1QSFE 5LWYH 4UBDD 4XPGL 5DD0L 4RMVA 2OBGA 3IVKB 3O41A 3U30B 1OLZA 1YY9D 5EULV 2Q86A 4R8WH 3MOBL 5D1QD 4P4KC 3IETB 5EZLA 5TE7H 2ZOKB 4UIKH 3H42H 3JWDL 3T0XA 3FB6A 5BV7B 4WHDA 3KPQA 3ULVF 1WLHA 4XVSH 3QG6B 1SEQH 3C8HA 3DYPA 2X9YA 3ARPA 3MUY1 4TUOA 3F7RA 2B1AH 2EZ0C 4HT1H 1SHMA 4E41D 4WUKH 4NZTH 1D3CA 2DLTA 4LIQH 2EIZB 1KPRB 3WEXB 5D6CA 2VR9A 2WP3T 1QFUH 3EO1A 1OLLA 4KKAC 2D7QA 5E2TL 3KYNB 1S5IH 1RHHA 1UB5B 4OFDA 3WNOA 1MWAA 3KR3H 3LRGA 5IM7B 5B21A 1KIQB 3BVNA 4RX4A 1RVFL 1A5FL 1MFDL 2AV1A 2DWEA 3BKML 1GZPB 3FN0L 2EE6A 1I7UA 4PV9A 5GZOC 1T1ZA 3IJHA 4DGVH 1JGDB 5DVOA 1FYTE 5DQJA 1JP5A 3V6FA 5CJXA 5ICXA 3SKMA 2FO4B 4LEXH 3BPOC 5F3HB 5DJDA 1NFKA 1KLGB 1NMCB 3RL1A 1GAFH 1I1FB 2GITB 3WIIH 5I75C 2YBRB 3GI9H 1B90A 4U1LB 3TT3L 1YNTA 4D3CL 1LO2H 5HHXH 1DQDL 2XRAL 1NBYB 4F7PA 3OB8A 3INUH 1S9VB 4X6CB 1R24B 2GCYA 4E41A 4NJAH 3VRLF 2NTSP 2X70B 1A4JB 3EYUH 4MNQE 3CVIH 1T6WA 1NFIA 4HIJB 5F1KC 2CDFB 3RZCB 4JFDD 4KKLC 1EJOL 2HG5B 3ARGC 1MJ7L 3TBVB 2ZG3A 3GJFA 4MQ7B 1X5HA 5F7NC 5JORB 5IHLB 5MEPB 5ITFA 5D9SA 2ZCLH 4F57H 4YHYB 4XMKL 3VWKA 4R0LB 5DEZA 1I1AD 4MQTB 4PJCF 3U4BL 1C7SA 5M95B 3SPVB 3I75B 2FBOJ 5E4EB 4NN5C 5HHMA 1EGJA 2H6PA 3U1SL 1BPVA 4MA1C 3B3IB 1UC6A 2OJEB 2YD3A 4IRSB 4L8SC 1UWEL 32C2A 5CMAB 4QF1B 1WJ3A 4IRSA 1MFAH 2V9TA 4UU9B 3KHOA 4HJGB 3VFVB 1CFBA 2JLLA 2VH5H 4FP8H 4NZRL 2IPKA 1P7QB 3QDGA 1KBGL 5AYQA 1BD2B 5BO1L 4YDIH 4H1LA 4EBQL 3HC3L 5F6HI 2W91A 5DJ2B 1BBDH 1YZZA 1NC2A 4JFHD 1KEML 4R7DB 1WWWX 3B9KA 3L5JA 4TNVK 4JJ5A 3GO1L 1TMCA 5GHWH 2BOCB 3MLWL 1P6AB 2EIEA 2EH8L 3DUSA 2LAAA 1HNFA 1G7IB 3WN5B 1KCSH 1G9NC 2VKWA 2Z93A 4NO0B 4R2GC 1F45A 1AI1L 1PLGH 3KLAB 1T22A 1BEYL 2IH3A 3QULA 3ZE1E 3UTSA 2GI7A 4PJHE 3FQUB 2G5BA 4HIXL 4LSUH 4UIMA 1N4XL 2HH0H 5JQ6H 1MSPA 1U8HB 1IJ9A 2OR9H 1QBLH 3T3PE 5ILTH 4M3KB 2ICEA 2XTJE 1LEGB 2PCPA 4Z7UB 4LSVH 2JJSC 1AR1D 4G8FB 4H25B 2V2XA 2ITCA 3CFKB 4OZGE 5KSBA 3FFDA 5MI0B 3VXOB 3GI8H 5HXMA 5KSBB 2FX7H 5KOVC 3MLVL 5JQHC 1BBJB 4L3ED 4CJ0A 3W5MA 4HUVB 1DBAL 1AIFA 1AGCA 5GISL 4HIEA 1U8NA 2ADFL 2EEAA 5SX5H 4TSCL 2IALA 3QXVA 5LG1A 2E8ZA 2AEQL 2DTML 2XKNA 1BZ7A 4HMEA 5SV3A 1X7QA 4G6FB 2HFGH 1IE5A 1K6QH 4KMQA 4HAFA 2A6DB 4K7FA 4J3WA 5CCKH 3UTZB 2ATKB 2EDJA 1E4WH 4OLYH 1E6OH 2DIAA 1S8DB 2Q87A 2XKSA 4EIZC 4UB0H 4P2OA 4BSVB 2QV2A 4Z7VE 4ORGA 3VGDA 3A6CL 3O11A 5J7CC 1PGRB 3IS1X 3SY0B 5IB1A 3CFJA 3NIFF 4UMGA 2W9EH 3ARXA 3P9MB 1VFBA 1BQHG 3BKCH 4U6VH 4QRSB 3GHEL 2AI0L 3UTTB 1E28B 3TFKC 4Y5VA 4JFZL 1IGFL 2YD8A 3VXUB 2R56L 5F9JB 1JZ2A 1DBBH 4N8CL 2FEEI 2EE9A 1CGSH 4WY7H 3L9RA 5FA4B 1NDMA 1X9QA 1GIGH 5CZXD 3PGCB 5IMLA 4NSKA 5J57B 1P4LA 5E1HB 4GW4A 1JHKH 1T6VN 1YMMB 4P4KB 5FUZH 2DB8A 3CXDH 1DP0A 1C1EL 4IRZH 1S78C 3MRIA 4P2OD 4ZODA 2Z8RA 3ARED 5EC1B 1LEKB 4WW2F 4YE4H 3G5VA 1ZA6B 3LSOB 4L9LC 1RJLB 2DQGL 4BZ1H 2VZTA 2NY0C 4NT6B 3H7BB 5F72S 5IGXH 2VITB 3LKOA 3VG9B 4JFQB 5J1AB 2BHUA 3BSZL 4P5TD 2GSIB 4WWKD 3X11A 5DJAB 4PBXA 4QNPE 3VXOA 3VW3H 4EDXA 5ID1A 1SY6L 5D1ZD 5F96H 1SBSH 3T0EA 4R2GD 3WXWL 4LVEA 4TQEL 4MNQD 1SJEB 4Z95H 3BDBA 1SYVB 4WGVB 1DVFA 5CINH 3LN9A 2B0SH 3SJVB 4JPKL 2WQ8A 3C9NB 1DSFL 2OS7A 5EU6B 4U7KA 4ZFOL 3B9VA 4JRYE 2R56H 1CTNA 3VRLE 3LN5B 1FZJB 4PLJC 1XIWB 4LSTL 2YEZA 4LBEB 1D9KA 4X5XB 4I2XE 5EWIL 3LKRB 4PJXB 4JFOA 3BP7B 1FZKB 3PWLB 3PABA 4PJDF 2HFEA 1FPTL 1FZOA 1I1CA 3QA3A 5HDLA 3K74B 1T3FA 2B39A 1IGJA 2W9EL 1WBZB 2GJ6D 3Q1SL 1QNZL 4Z7NE 3L9RB 5FA4A 3CFDA 3KPRB 5CBEB 3D48R 3MRNB 2KKQA 4HV8B 3QHFH 3ARTA 1ZSDB 1A21A 3STLB 5T1LB 2DQEH 2UZYB 3FTGA 1CICA 3O2WL 3V6ZA 3HRZB 4HZLB 3FB8A 1MFEL 1MHCA 4M7JL 4WDIB 3QUYA 2MSPA 3QYCA 4PYHA 3GBNL 1E4WL 4OLYL 43CAA 5CSZA 4PJ8C 5GGSY 4BKLB 1E28A 1KT2A 1X5GA 5CZVL 1QHPA 4XP5L 3KPSB 1XGYL 3S36X 5A40E 1NGPL 3LQZA 4LDEB 2P43B 3UYOD 5I0DA 3EW3B 1FFPA 3ILQC 4L4TB 4A6YL 1FJ1B 5ALBL 1N64H 2V17L 2YMXH 4FS0A 2QHLA 4NQXA 4PJGF 2ZUUA 4U4BA 4TVSa 5EOCH 4PJBF 4LP5A 3MACL 3NACH 2ESVD 4O00A 3O2VL 2M2DA 2D9CA 4Y5VB 1UQSB 2VLJD 4NRYA 4GSDH 2OR9L 4N5ED 1KJMA 4JFYA 1Q9LA 1MNUH 3ZKMC 4F3FB 1IC4L 1Y0LA 5TFSL 4MJ4A 4ZQKB 4IMKA 1PZ5B 2ZSVB 5IB3B 2R8SH 4CAGA 4OIBA 1ORSB 5D1ZA 4YUEL 3WFZA 5CZXC 1IC1A 1PLGL 4YFLF 2P49B 3AS2A 3ECBA 4P5TB 3B9KD 3W9DA 3GEWB 1U2CA 1KJVB 3OKLB 2ED8A 4CN4A 3BMWA 4APQD 3EO0A 4N0CD 4KKBD 5DJZA 4J2XA 3L3OA 4YHZH 4P2OC 1RJYA 5KN5A 3RX5A 1WTGT 2DQEL 2OK0H 1DN0A 3DV6B 4JGJA 5IEKB 1MNUL 1I8LA 3DV6A 3DOSA 1JNNL 4OCXH 3P77B 4QRQA 4JM2B 4NPYA 3VGBA 3HC4L 1S9YA 1RZKC 4M7ZC 4XAKD 4DTGH 2D31A 2OJZH 1IQDA 3O2VH 2P1YA 4C4KT 3NACL 4G9FD 2CLVB 2ITDA 2DQUL 1E4KC 4I3SL 3V0WH 1W72A 3VA2C 1F3RB 1VGKA 2OQJB 3IXAA 4GAYB 2OSLB 5ELIA 5JMOC 2AGJH 15C8H 4YDLB 4YEEA 3BP5A 3W0WB 4BSWB 5I8OH 2QSQA 1JK8A 2Y5TB 1NGPH 5D70H 3OR7B 5E00B 3CSGA 3T0VA 4NO5A 5DLMH 4TNVF 4JE4B 3CVIL 3VG9C 5DTFA 1FLTX 3DX7B 5E95B 3WN5A 3GBNH 4U1NB 5CMAA 1P84K 2F5BH 4L3EE 3GSXB 3QI9C 4IEFB 1FIGL 4NWUH 3LPGA 1ZLVH 2W1NA 1LO3H 5HY9A 1LO2L 1R5IB 5HHXL 5ADPH 1QKZL 3TVMC 1Z2KA 1JRHH 4PD4K 4PB0H 5I66B 1E4XI 2YSSA 4XAKE 4CVZB 1QSZA 1T1XB 4UNUA 1PQZB 3MCLL 3BQUB 43CAB 2UY6A 3G04B 5CEYA 2F8VA 5I75B 1VDGA 4B7IA 3O6KH 1U3HD 2V7HB 1RIHH 4HPYH 4MB4A 3LKSA 1TXKA 1CDHA 3ZTNH 4Y8AA 4Y5YA 3LS5H 5J8OA 2VLKD 3HE6D 4WEMB 2DL9A 2VTFA 3EDEA 5T1LA 5J12B 5TQ2L 3KYAA 2ENYA 4KK6D 5IR1B 1YNTB 1QLRA 3O3DB 3HPLA 4WY7L 1NCBH 3MUGB 4LCIH 2OMBA 2FB4H 5JDJA 4I3GA 2DQCL 4QNPF 3G5ZA 4BH7B 4HGWA 3FFCA 3ZKND 5ICZA 3SQBA 5CIPA 3SDAC 4I9WE 3O6KL 1KPVA 5SWSB 1G7MA 4HKJB 1KTKE 4I9WD 2NXYD 4PJ9C 3MUJA 5DZOA 2UV3A 2IG2L 2EYSA 3K80A 5I1EH 3ILPB 2OYPA 5HGBA 5JIPA 5BS0E 4F7TA 3IRZA 3NMEA 4LCWD 1NGQH 4IS6B 1R3LA 1DUZB 2GEEA 3A6CH 1O7SA 3D6GA 3Q48A 5C0AE 1FIGH 1EK3A 4G80B 1ES0B 3CXDL 4CVXB 5C6TL 3ARFD 3HPJB 2APWA 1AR2A 3BW9B 3JWOL 1GIGL 3OKOB 3TYGL 2I5YH 5JA9A 2DTMH 5I8OL 3SN6N 1BD2D 3OR6A 4XMPL 1Q9LB 3B9DA 3ZDYE 3NN8A 3WBDA 3MJ7B 3NN8B 5ENWB 3VDCA 3PGFH 5FOBA 3KJ6H 1UFUA 4PRPE 5TQ0L 2QQLH 3ZTJG 5KS9E 1G7IA 1YNKH 3QJFB 1NANI 4F7EB 2P5EE 3B9EA 1J0KA 2BK8A 2WM0A 1T04B 2VXQH 4C4KO 3KS0J 3G5YA 3PABB 5EB9A 2R2EB 4FXKB 1EPFA 4PRIB 5TDNA 3X3FH 3NCMA 1OD7A 1L9MA 4OZFB 4PJXA 4OCXL 4IRJA 2EEBA 5TDPA 2ZOKA 1M05A 2JJWA 4ZS6D 2IBBA 3P0GB 1NLDL 2JIXD 3L7EA 2OCFD 5HI5C 1G9ML 5HYJD 3IVKA 1AO7A 1MQKL 2VUOA 1FNGA 4WFFD 1CDIA 1TNNA 5E03A 3RPIA 4OM1H 4IOIA 3UC0L 1QBMH 2A9MH 3FB8B 3QQ4A 1KIRB 1T83C 4Q9BA 1KCVL 2EYRA 3WLWC 1JZ7A 2VE6A 1XF2B 1L7TL 1FL3A 3T8XA 4M62L 3TVMD 3QT2A 4HS6B 1OTSD 3TCLB 2I9LA 4DKDC 4YDIL 2CXGA 1RY7B 3CDYA 4O2CA 4G59A 1SJXA 3NCCB 5T5NG 4NN5B 4FP8L 4NZRH 3QIBA 1PG7W 3D0VB 3CVHA 4KMLB 4OZGA 4P9ML 2CXKA 2FIKB 4N90D 2Z9TA 3TWCL 4PP2A 1RQ5A 5ILTL 4G9FE 4Q6IC 5J9PB 2N1KA 3HKFA 4ZSOB 1CZ8H 3QNXB 4P2QE 4MXWH 4B41A 5HTSA 2MPAL 3BQUA 4LVHC 1BEYH 4HUWA 5IW1B 1EXUB 3JZ7A 2FO4A 4GBXD 3QPXH 4UTAH 4Z7VB 3D39B 4MA7L 4MAYC 3FOLB 1T0NB 4ZTOL 4NN7C 1T1WA 1FL5B 1PVHA 5FF6A 3N9GH 3W0WD 5DRWA 3INUL 1KEMH 4HG4K 2DLFH 4ONHB 4QTIH 1BBDL 5DVMA 2BERA 4BFGA 3FRUB 3GSNB 1HXMB 4WJ5B 5EPMA 1KXQE 3VXNA 4MS8A 3D69A 3LKQA 4PR5A 5T1KD 1KBGH 5CP3A 1UZ6E 3GMRA 5ITBL 5ACLA 4LEXL 1K9TA 1SYSA 1XF5B 1ZHNB 1HEZA 3BEVA 3SOBL 5CKGA 1CT8A 4BA8A 3AS0A 4XP4H 3SBWC 1MY5A 4JAMB 1GPOL 3MBXL 4RSVA 4FQ1L 4KI5C 1EMTL 3VRIB 5E6ZA 1P1ZA 1KTRL 1Y18B 1MLCA 1NL0H 2NY7L 3EUUA 3I02B 5EZIH 3WNNA 2VISB 3BDXA 4FG6D 3I02A 1IKNA 4NHUB 4XXCC 1RVFH 3TGXA 3D3VA 2W9DL 3CUPA 2DQDL 2R0ZL 1L0XA 4MXQD 4PTUA 5IWLA 5HI4D 5I73C 2VLMD 4U2YA 4K2UL 4TQEH 1D9KD 1AXSB 2V7NA 3IDYB 4BSWA 4EI5A 1AHWC 2VZUA 5CILH 1CE6A 1FL6A 3K3QA 5F96L 4WNQA 1ZT1B 4H0IA 4NQEA 1NAKL 4XAWH 1PKQE 2CIIB 2IFFL 4AL8H 1UJ3A 2ARJA 4XWOD 3EOAB 3Q6GL 1Z9MA 2E27H 4JFEA 1DQDH 4XVSL 3U30C 1MCBA 1QFWI 2C1PA 3EO0B 2X4SA 2QQQA 1PY4A 5C8JB 5DC0A 1A7NH 1P2CA 3U9UA 5JNYA 1GAFL 4O9HL 4GH7B 5FYKL 1OAUL 3DVIA 2VL4A 2P5WE 2BRRL 4L8BB 5EO9B 1O5DT 4PG2A 4QRQB 2BSRA 1KPUB 3ARFC 1VCAA 1C1EH 3FN0H 2NZ9C 4D2NA 2QQNL 4HWBA 1KCLA 4K9EL 3AMLA 5DJZB 1F6AB 3HNVH 1VSCA 1I1RA 5T5FL 5CWSA 3FONA 3UP1A 3EYQD 4ZXBA 4V1DD 4MXVE 3DROA 1REIA 1OT2A 4OFKA 3DUSB 2AXFA 5KW9H 1OTSC 1R3JB 5MEQB 3LH2H 1KTLA 2X6MA 3D5OF 4NQUA 1EFXB 3TBWB 3U0PB 2J2ZA 4AEFA 4PTTA 1FL3B 3T8XB 4ONFL 4U31A 3E3QA 3T09A 1VHPA 3QWQB 4PY8I 3L3GA 4ZUTA 1FYTD 4XNQA 2H9GB 3BKCL 5T1DH 2EO9A 3O2DL 1MCIA 4NKDA 4WU5A 5IKCA 4OUUA 4W6XB 1II4E 1JNHA 2Q76A 2X1QA 3HE7B 2PW1A 2GY7B 1H8SA 3K8MA 1KYOJ 1LO0L 1WFOA 4DVRH 1YMHB 4ZPVA 3DUUA 1XT5A 4YC2B 4YHIA 4I0PB 4X4ME 2BVYA 4RFOH 3ZE1F 2J8HA 3WE6A 3QHTC 3SJVD 3QA3B 2BFVH 3UPRA 1NH6A 3PWPA 1P4IH 5F7HA 3GMLB 1CL7I 4OLUH 5DUPH 4ZFGH 4YAQA 2EDWA 4XPTL 4M6NL 3C6SB 1JGUH 2F8OA 2X4QA 1XZ0B 4HWEL 1PYWB 4X5WB 1WUNT 5LBSH 3T65A 1KN2H 4YIQA 4QWWD 5FGBA 1V5JA 5JZ7D 1OGAD 5F6IC 1FG9C 3WKML 5H37H 5FGRA 4BFIB 1UA6H 4J12A 3CIQA 1L0YA 5F9WC 3WL9A 3GIVB 2CMRH 4AK1A 3T0EB 4EDWL 2FYYA 4WO4A 1VGEL 4PJFA 4ZFGL 2PTTA 1V3LA 3RVVC 4NKMB 1CT8B 1FO0A 2QJDA 1JNLL 1GCFA 2B4CL 4ZO8A 3WD5H 2OLDA 4FFWC 2B7DT 3LKOB 5J3HD 1S9YB 2Y06H 4XWGL 1FVDB 4TRPL 2VQ1B 4LCYA 2APFA 4EJ1C 4LDOB 2LVCA 3UTPD 1RJLA 1NMBH 2VLRD 4JM2F 4Z9KB 5IVOA 2EXYC 3I50H 5INDB 4PDCE 2FJHA 1WAAF 1D5BA 1IGTA 1A2YB 2R0LH 3MRIB 2E9BA 3PDGA 4YDVA 4LVOB 3MLTB 3HZMB 2EDXA 4U3CA 3SE3C 3NGBC 4EBQH 2ZCKH 1DLHB 5FDWA 1DEEB 3ZYOA 5C71A 5F88A 2VITA 5K9JH 4YZFE 2I07B 3MRKA 4ZNEA 3V52L 4LSPH 1OSPL 4NGHL 4J8RA 3O4OB 4TVPD 3PQYD 1GOGA 4PRPA 4MB5A 1WEJH 2E6PA 1YNLL 1UB6A 2UWEF 4Z78B 3WFHA 5FKPB 3BT2L 3GSRA 5ABDE 1PAMA 2Y7QA 5IF0B 1UB5A 3S4SB 1P4BH 1JPFA 3S5LG 1KULA 1OSZB 3U46A 1XF1A 3MMEA 3W9EA 1U92B 3RGHA 2HKFH 4OIIH 4HD9A 1Y6MR 1MCQA 1MCPH 3GBMH 4NJAL 4O02H 3MRBA 3MRLA 5H37G 3NIGF 1NEZG 1S7VB 3P73B 3OF6A 5C0RL 1KIRA 1YEDA 3VWKD 3HZKA 3G6AA 3IFOB 2IH1B 1LP9F 4OGAD 2N7BA 2XA3A 3MODL 4V1DA 2P5EB 3RKDC 4G6JH 3ULVL 1IFHL 2XPGA 2GFBB 2YA2A 1IARB 3NFPB 1MHCB 4EZMA 3RWIB 2PO6B 2NY2B 4Z7WE 3W11C 2G2RA 3KYKH 1UCBL 1AGFB 3DMMB 3QDGD 5TPWH 4FA8A 5J06A 1QLFA 2NLJA 4OZHB 3MJ9L 2I25N 2WBJC 4DUVA 1X5LA 2X4NB 3VXPA 5D5ME 3VFWA 1TTFA 3D9AH 1RD6A 3WO4C 4AJ0A 3N06B 1ZT7A 2W9DH 4ZPVB 5IJVB 1BFOA 3I6LD 2DD8H 1ETZA 4PRHE 5DJXA 2PKDA 1I3UA 1EHNA 1IMHC 4WW2C 4YHLH 1CFSA 4G43A 1NCUA 3BH9A 1VEMA 2OTPA 2ZKHL 4KTEH 2W59A 2JE8A 5GGQL 1BVLA 3RVTD 2GUOA 3SE4C 2D7TL 3MLRL 2B1AL 4JQIL 4F7MB 4MZ3A 5ETUB 5AUMB 3GNMH 2BJML 2FH6A 4LPVA 1JI2A 4KRMB 3RTQC 1ZTXH 2YD7A 5FV2A 4X80H 3JVGA 1T2QL 4YX2H 1XF4B 1ORSA 4RFNB 3MOBH 4PJAB 4R97B 3TIEA 4LOUD 3MROA 3LAFA 4PGZA 1UG9A 2L0DA 1P5VA 4LASH 4LLAA 1G1CA 3O8XD 4BFIA 4DGIH 1T7ZA 3MRCA 1CDGA 4MA7H 1HKFA 2Y5EA 5E9DE 1MVUA 1TVHB 1ZA6A 4QXUH 5T3ZL 1JZ3A 3P11L 2IANE 3LN4A 4Y0GA 2EDQA 3OKKA 2HT2D 5T1KA 3DETD 4MXWL 3WUWG 1LK2B 3L5XL 3UAJC 2KH2B 2B1HH 4FQXA 4OSUH 3FO1A 1F6LL 3QO1B 5JW4Q 3VWJC 3TO4B 5D7KE 3VDAA 5DQ9A 3TWCH 1RK0A 2DM4A 1AY1H 3I84A 4MJIE 4KJYA 1D5IL 4FTVA 4AG4H 4XNUL 1E4XH 4RDQG 4N0CC 1IEBB 5HYIA 1A3LH 5H35B 2BDNH 2NXYB 4FQXC 3ULUF 1I9JL 4FMKA 2IAMB 4MDIA 1IM9A 5IB4A 3E6HB 3VGAB 3GK8H 3C8KA 1C5DB 3DMMD 3QDGB 2ARJB 1I8MA 4G5ZH 3RY6C 1N5YH 5HJ3B 1B0WA 3V5DA 3ARRA 1G7PA 3BWUC 2IPTL 3CH1B 4OCNC 3U4EA 4NQDE 5CD5D 5HHNA 4NO5B 3AAZA 4NHUE 4U05A 2WINA 3WO3B 4TTDD 2FR4A 1WBYB 4LVOC 3D18B 3VFTA 2CJUH 1H5BB 1IC5H 1W0WB 3BIAX 5KSAA 3X14A 3UMTA 1DQLH 2OSLA 2R1YB 3BWAB 4WWID 4XBGB 1VFAB 1G9MH 2ZUVA 1MHEB 2OR8A 2ZG1A 3UX9B 5INCB 3TFKD 2CQVA 5DHYB 5IFAH 3EFDH 3PWPD 4ODWA 4HF5L 3SE4A 3MLUL 2Z35A 2E7LC 4Z5RA 2DQJH 4X6CA 4X83A 4TSBL 2AV1B 2DWEB 2EZ0D 1N5YL 3O2DH 1ZLWH 2GTZA 4H0GA 3LD8B 1A3QA 3VI3F 2VIRB 3FZUC 5L2KE 4JY5L 1UM6H 3IRPX 3HAEB 3GMMA 2XXCB 2XWTB 5ECJE 5EO0B 3P30L 2XY1A 4PRAA 3SDDC 3KNBB 2OQJA 1E4XL 4XHQA 5EORH 1U8NB 5L88L 3RIFK 2ZCHH 1DCLA 4HUVA 3KLSA 4HWEH 5EU3A 3IDUA 1JGDA 1X44A 4KI5D 5HVWA 2DICA 1I7ZA 4NZDA 2L7UA 4JCLA 3AREC 4D9QE 4TUOB 4LAQL 4U1SA 3NAAH 3ZE0E 2J4WL 4H1LG 2XIDA 2DQTH 4UV4L 4PV8A 4W70A 3VA6A 3MV9B 4NKQB 3U82B 3CFCH 3X12A 3RNQA 4RGOH 3P4MA 4X4MA 5BZWA 1S3KL 3RVUC 3DV4B 4OZIE 4DGYL 3QEUA 4CVWA 1IEAA 3U6RB 1MFBH 1BIHA 5L2KA 1VENA 1BJMA 1IVLA 3B2VH 1ETZB 3WFCL 1OAUH 3H6JA 5KZCD 5EFIB 4LCWA 1A7NL 4JFHE 1FV1B 1KIUA 4NYLB 3PWVA 4Y1AA 2DMBA 2XQYG 3OHXA 3K4DA 3IKCB 3NIDF 4YXHH 4LSQH 3V0AC 5T1DL 3IJSA 1LE9B 5C86A 2E27L 1NANH 1NUNB 2OI9A 3JWOC 1QQDB 3O4LE 5ESVA 4AL8L 3FN9A 2VC2L 2XA8L 1PEWA 3NPSC 3RZWA 1EHAA 5GIRB 4MJ2A 4YHIB 4D9LH 1EZVY 3TM6A 4YHMH 4JM4L 1FFOB 1CLCA 4XNYL 3OKDA 5DFVD 4ONGH 3OGCA 4QHKI 1JYVA 4Z7UF 1HOCA 1LO5A 1K2DB 4Y88A 2HT4C 4JFDE 5DMGC 4PJHF 2DD8L 3BX7C 3UPCA 5JW5B 4ZUSB 5BV7H 1YPZE 3DETC 3MRDA 1YECL 3NCFB 5HHOE 3RU8H 4RGNC 2YWYA 2YPVL 3OKOA 3OL2A 5A1AA 4K9EH 4NQXB 1C5BL 1U58A 2H6PB 4JKPH 4LL9A 4ZFFB 3TIDB 2NY7H 5EZIL 4GKNA 2CKBB 3DGCR 1PSKL 2DM3A 3SE3A 4I77L 5CD5C 4M1CC 3MV8D 2HJLB 4X4YA 1KF9B 1U3YA 3MMEB 4G6KH 1GVIA 5EUOB 1EHLL 4FZEH 3VFNA 1DFBH 2XWBB 4JB9H 3A6BL 1JRHL 2VABA 2ZSWA 5EFIA 1NBQA 5FHAH 2EDHA 3BZEB 2R29L 1EBPA 3RGVD 5FOBB 1A1MB 1LO3L 3ROOA 3HRZA 3C6LB 4NWUL 1OP3K 1YEIL 1FG2A 2VOTA 3O45B 3VFGH 4NN6C 5B8CC 2YN5A 1FYTB 1MCPL 3GBML 5T5NF 5TF1H 3KPSD 1ND0B 5DLML 1SJEA 3IGAA 5EBMA 3QPXL 4N0UB 1NGWA 2HT2C 4UTAL 1KB9K 4CBPA 2Y36H 1DUYB 3MA7A 4AY0A 4HS6A 3TCLA 1E6JL 15C8L 4NKMA 4KJQC 3RUGE 3IDYC 5EU3B 3BT2H 5J1TC 4M6AA 2CLZA 4NQCB 2X4TA 4XI5D 2D7OA 2VDML 5FGBC 2OL3L 3JV4B 4AENB 4FZ8L 3ULUD 3BVNB 4P9MH 2IPUG 5ANMA 2AQ1A 3ARUA 1RIVH 4ALAL 1OSPH 4EVNB 1CG9B 1HCVA 1CXKA 5ITBH 1MCFA 2H32H 4DUWA 1Q9KA 2LVEA 3STZB 2P8PA 2P24B 4XTRC 5L2JB 2VN4A 5D7LB 4NJ9H 4P57B 1M7IB 2DLIA 2APVA 1OAKL 3TJEH 5DO2D 4APQC 3MCKA 5C1MB 4NC1C 2R2BB 1FVCB 4J4PD 3O0RH 4YHZL 3FAWA 5IJKC 3LEVH 2LU3A 4JREB 4LKXA 1WC7A 3QFJE 5E8DL 4E5XB 2IGFL 1AGDB 5I1CH 3IDNB 4KVNL 4IIQA 1NBZB 1A6WL 3G5VB 1NBVH 2ZNWA 1G1YA 3DX9B 1D5MA 3LKQB 5CJQH 3RVXC 3LQAC 4LLQA 4LOUC 3N1PC 2EIBA 3H9SB 4LVHB 1KG0B 4DN3L 4YR6A 3C60D 4N9GA 4NQCD 4WO4D 2FEEL 4I0PA 2XICA 4NQCE 4OF5A 4OKVA 3AREB 1N6QL 5C0BD 4OD2A 5EOCL 3BO8B 2AJYL 3QEGH 1CFVL 1AFVH 1IAKB 2V17H 5LBSL 5E5MA 1FC1A 1R6VA 2V6HA 3UO1H 2H1PH 5GS1C 2P48B 3WYRA 4JO3L 5T1KB 5CWSB 3HZYA 3ARFA 2NY5H 2XTJD 1INEL 1J88A 4EUPG 4PJIF 3OV6A 1YEJL 1IZJA 3C6LD 4CJ1A 4NO3A 1RZGA 1A9BB 1JPSH 3EYFB 3C09B 1J1OH 3R8QA 3Q5TA 5CJBA 1QA9A 3P0YL 2V2TA 5I9QC 4WI8A 4KC3B 5E24E 3D0LB 3I6KB 3OJDA 1FC2D 1IAIL 4V2CB 2NY4C 2JJTC 4UT9L 5HDBF 1D5XA 1D5ZB 1IEHA 1T7XA 4XCFH 3E2HB 2ZJSH 5D7JB 1EAPB 3S36H 2QADD 4K71C 5ICYA 4WFGD 4WI7A 3RRQA 1DVFD 3LB6D 1H5BC 4HS3A 5I1EL 2ICEB 2UWEB 3PF2A 2OI9C 1HHKB 4MGXA 1J0ZA 1FAIH 4BQ9A 5JIIA 5D72H 5JIKA 4OI8A 1ZGLA 1XCTB 1HSBB 2P8LA 4L8BA 5EO9A 5FV1L 1DSFH 4PJ8D 4AM0B 1T89C 5DHVH 2ZNXA 3AY4C 2HAZA 3PHOA 4WEBH 3OTTA 1FBIH 4ODHL 3E6HA 1QR1B 5A16B 3PJSA 5JHDA 4G6FD 4OZFA 3VGAC 3QQ9D 1OAZH 2Y6SC 4Y4HB 4Z95L 4HWZB 3DO3A 1IT9H 5BMFH 2QQKH 4R4BA 2VB5A 2GJ6A 3JWOH 2SEBA 3SGEH 3WXWH 4ZOAA 2Z4QA 3HUJF 4NP4H 1KIPA 2CIIA 3BE1L 4OLXL 5HHQB 3GSXA 1QLFB 3AMKA 4I48A 5E56A 1WT5C 4YJZL 4L3EB 1W0WA 5KSAB 3V8CA 1LE5A 3ZKXC 1UXSB 1HILA 1E0OB 1KC5L 4MNHB 3BPNB 4Y16C 3RGVC 3RUGA 3QWOA 4O2FB 1XZ0A 5C0CD 5GZNC 4EI6B 4PB0L 4QCIB 5GRVL 2Q7YB 5HYJB 4X8XA 5DURB 4NRZB 1RMFH 3G6JE 3MV9D 1AQDB 5DO2C 5LGHH 3BZ4A 2A6KA 4XCNA 2EXWD 3Q6GH 4JFOB 4PJ7B 4LLWB 5H35A 5IHBA 2K1MA 4NQVB 1DDHA 3QB7C 3B2UC 2DQCH 4Y4FB 3FRPG 4HDIA 1CFNB 1MI5D 1BOGB 4QHUB 5I74B 4OCWL 3WIHA 1O0VA 1JZ5A 4TULH 4F2MB 4GO6B 3QNXA 1MIML 3QSKB 1A14H 4GKZB 5KVDH 2X4OA 1YPZA 5TQ2H 3OF6D 5HHMB 1P5UA 3BUTA 4MXQA 3DRTB 3D3VD 4HWBH 3P4NA 3C60C 1P7QD 1T0NA 3GMNB 3JSSA 2AI0H 5J11B 3ARBD 4U6VL 2H45A 5JORA 2YWZA 3MCLH 1MRDL 3QIUD 3L3DA 4M93C 1OW0A 3RWHB 1EJ6A 3LOWA 2ZWLT 3ARDC 4MD5B 2JELL 2XZQH 4Z7WA 5EDXA 4M1GH 4KPHL 4Y1AE 4LQFH 5JXEC 4X9IA 1JF1A 4N0CA 1U3JA 3DMMC 5IVNA 3AFLA 2AK4D 2YKLH 2DLFL 4QTIL 3OX8A 3UTQA 1KB5H 4X4ZA 5EU7E 1FFRA 3S97C 4ZDHA 2NXZC 2MKWA 3MLXL 3NCJH 5FYJE 4OZIA 1I9RH 2CR6A 4AIZA 2OL3A 2HFGL 4Y4FA 2B5IC 3P0VH 3QI9D 3PIQA 4MA3A 5EH1A 4X6DE 3BRGC 3SHSA 5I66A 2XI9A 3C09C 4XPBH 4Q6YA 1OPGH 4H8WL 5AG8A 2ADFH 1RUKL 3BGAA 2Q3AA 4K8RD 1EX0A 3HTLX 3VXQB 3NABL 3O9WB 2AJYH 4U49A 1BAFH 3CZFA 3QG7H 3FQXB 3UJIL 4F7EA 5GS1B 3PNWB 5KAQF 3DX7A 1S9XA 5DEGA 3QUXC 1U3HA 1U2HA 4N1CA 5KVGL 2VYRE 5D1QC 1EHXA 1OOAA 2E8YA 3OKMA 4LMQI 1FSKC 1LE5B 1JK8B 4KJQD 4OJFL 2ADIB 1G6VK 4JHZA 1NCDH 3O9WD 5TDPB 2YS4A 3MV01 5BOPA 1A1NB 5I18L 1IGJB 4JPWH 3BGMB 2NXZB 1D7FA 3MFFA 1TPXC 1G7HA 2Y4SA 3KPQB 1AI1H 2BOBA 3U9PL 4ZFZA 1A3RH 1K85A 5DJ0A 2R2BA 4GT7A 5I1CL 1PY9A 5C07D 2YEZB 4POZD 4KRLB 3B8YA 4OZHE 1MQKH 2FSEA 4CN1A 3B43A 3BJ91 2YXFA 5IB2B 4S1RL 2Q76B 3U2SA 3R8BB 1ZWIA 4LQFL 1NCDL 4ENED 2IALB 2NW3B 3N85H 4NKDB 3T3ME 4Z0XA 3NCEB 1V7MH 4M48L 3O9WA 2AXGB 5I8CA 5SWSA 1B0GA 1UWEH 3TN0C 2FBJH 1WCQA 2VXTH 5F93C 4G80A 3VFPA 1X5AA 4PJDE 3WIFB 5GGUB 2ZP0T 2YRZA 3KJ6L 3MGTB 5D7IF 3RWHA 3GSWA 4S2SA 4WWKC 4XPHL 4AEEA 3V4VL 1S7SA 4XMKH 4ZXBB 1T5XB 2ZCLL 4NT6A 5HHMD 1OPGL 3HPLB 5JHLH 3S5LA 4OCWH 3KAAA 2O26U 3TYGH 1NEZA 5HI3C 3QDMB 3HR5A 3K7UA 3HC0B 4NUJA 3TBTA 1FFQA 3D87B 1PYWA 5TF1L 2HJFA 5HGDB 4Y4FD 5CIPB 1OAXL 4HXAL 5DJYB 4GKOA 3RGVA 4ZAKC 4I18A 3KWWA 1Z9SA 1W72H 3IDMB 2IC2A 5JLZA 4TNWK 2R29H 1A7BA 3DLQR 4OV6F 1FFPB 5ID0A 2O5YL 3C6LC 5C0CE 5CEZL 4I3RH 1MRDH 1M4KA 1Q1JH 2D03L 4HIHB 1S7QA 4NQEE 1MFCH 4QRTB 3TT1L 1BZ9B 4JFDA 3SGKA 4HWBL 3QIUA 4XH2A 4Y4HC 1QSFB 3SDYH 3CSYB 3ESVF 2VLLB 4Q74A 3S3JA 4OLXH 1BIIA 1HHHB 3NFNB 2BNQD 4KY1H 2HA1A 1T22B 2IH3B 1Z9LA 2YPVH 4L4VE 2X42A 1QFOA 4JPKH 4JLRB 5CBEA 3C6SA 4D8PB 4YGVB 2UYLB 1WBZA 4PJXF 4HBCH 1DE4A 3IXAB 4GAYA 1XMWA 3RDTB 1UVQA 3OKYA 1KTLB 3DXAD 1U8MA 2OI9B 5DQ9B 1LD9A 2Z31A 4Q2ZB 4LIQL 3QO1A 3ARBC 5IK3A 4A2MA 5K9KA 2VWEE 5I1HH 4NM4L 1YUHB 3BD4A 4JFZH 1A7OH 1WK0A 3GHEH 12E8H 4R4FH 3KXFA 1HYRC 3QQ3B 4MAYD 4YXHL 3QUXB 1CFQA 3S36L 5DMYA 4UIKL 4KK9C 4F9PA 1DVFB 4OCSL 2OJEA 1IBGH 1DN0B 1RAMA 3E8UH 1LQVA 2P46B 3RWGB 1U8KB 1KNOA 3RY4A 4XPAL 2OZ4A 5I30L 2CLZB 1JGVL 5HYFA 2GJ6B 2PYEE 4M4PA 1EAPA 4IRZL 4XPGH 4S10A 2BC4A 2AK4A 3KPMB 4LGPB 5J1SC 2BNQE 2F5BL 4P3DA 1TLKA 2O61B 1GC1L 1JHKL 3WLWD 2ZUWA 5GGSA 4G8FA 4YDLC 5DZNA 2J4WH 3CCHB 2XOTA 1XIWD 4NHCH 2DTSA 3OJDB 4RCAA 1IT9L 1INQB 2PW2B 3T4YA 2GAZB 5BMFL 1OAZL 5FUCE 4ZUWB 2HKHH 1JF5A 3GSNH 1LILA 2X1OA 3CNKA 1GHFH 2AERT 2D0GA 1DQJA 1BD2E 4TTDC 4U1IB 4WIQA 2AK4E 4BFEA 2W65A 4HS3B 3ULVD 3O3EA 3QULB 1JHLH 5C0NC 4QYOA 1FGVH 1CD1A 5DJ0B 4HQQH 4XCEB 4Z77A 4D0BB 4RMTA 3VXPB 4RGNE 4YHPA 2R39A 5I8KL 3BEWA 4HWUA 3CLFH 4N8PA 2AV7A 1L6ZA 4FOMA 4X99A 2AABH 4XCFL 3VJ6A 2VLME 1CL7H 2PTVA 3MRQB 4YR6B 3EYOA 4OM0L 1NGXA 2K3TA 1KG0A 2J88H 5J6HA 3P0YH 1H3UA 1TQBC 2V7HA 1U8PA 4H8WC 1G0XA 3RAJH 4PRBA 1CYGA 1X5JA 1LMKA 3MLYH 5D2LE 1IAKA 2FX9L 1RZ8B 1YEDB 1S7XA 4WHYG 2AEQH 4JGMA 5HHVH 3C08H 5TFSH 3CFJB 2FJFB 3U7WH 4MLSA 3SY0A 5L7XH 3BN9D 1QQDA 4YEFA 4MAYB 5IW1A 1A22B 4QRRE 4BSVA 4R3SA 3BHBB 2FX7L 1TPXB 4FABL 3GI8L 1A3LL 3RGVB 4P4RB 4X6EA 5IBUB 1LDPL 4QRPE 1IGYA 2J3SA 4WU7B 5C0DB 5E2JA 4DOHB 3VG0H 2MOVA 2QSCL 3OKKB 2PF6A 4X8JB 3RI5K 5BZDA 5F8RC 3LN4B 1T0MB 4OV5A 5JQ6L 4DZBB 3WNKA 1TVHA 1N64L 1T4KA 4A6YH 3BP5B 4QRRA 1BGXH 1FVDA 5IG7A 4NRXA 3N1FC 4JY4B 2Y07L 4BZ2H 4N0YH 4QXUL 2BNQB 4QGTA 3ARBA 3T77B 5DDHB 4NQCA 4Z0BH 5GJTH 1B2WL 4YFEA 4P3DB 3QQ9C 5F1IA 5ID1B 4QXTA 4PGBA 1FCCA 3LN5A 4GMSH 1JGLH 4NOFA 2I9TA 2ICWB 2X7LA 1JF6A 5I6XC 2EYRB 5GRYA 3O2WH 3FQRB 3H7BA 3FFCE 5KSVB 2JB5H 3QHFL 1EERB 6FABL 3L3IA 4DQOL 3H9HB 5ISZE 5GS3A 1FG2B 2I26N 5IB2A 3C6LA 1HZHH 4NFCA 1MFAL 1YUHA 3F5WA 2Z93B 3N50A 4Q9CA 3UYRH 2YUXA 5DJAA 4HCRA 3QPQC 5KTEL 3UPRB 5DRZA 3UXFA 4QHLB 3L3DB 2VDMH 4XBGA 4WUUD 1LWRA 4N0UA 5JZ7C 3U4BH 3EOTH 3ARDB 3JTTB 4UV7H 2CH8A 4M93B 3MRFA 1DL7L 4O51A 3RU8L 3FQTB 4P46A 5IFHL 4Q7DA 4KUCF 3KR3L 1TITA 3CGTA 4OZFG 3SDXB 3MXWH 4PJ5D 1Q9OB 4MQSB 5C0EB 3KDMB 3G6JF 2PW1B 4I13B 5DD3H 6CGTA 3DECA 4NUGH 4HKXB 3BYYA 4PGDA 5HD8C 3WHE0 4NO0D 3RZCC 5D7SH 4L4VD 2C9AA 4MX7A 4P9HC 3M17A 4ORZC 2E6JA 5IGXL 4LGSB 2GK0A 1M6OA 3GI9L 4C56B 5JHDB 1B4RA 2FWOB 4AZ8A 1P9MA 4MSWB 4G6KL 3IU3B 2C3XA 4YHPB 4MDJA 5BS0A 1NFIB 3UAJD 2NW2A 2HLFC 1I85C 3LMJH 1AP2A 4IOFD 3ALXA 2ADJA 2VJXA 3FAXA 3IDJB 5E9DD 3T1FA 4XNQB 5CJ5A 2NY6D 4JRXD 2PUQT 4RAUA 4LCCC 3O3AA 4GW5B 1K8IA 4PJGA 4OZ4B 1QTYT 3HNTH 1T5XA 5FM5O 4NKOA 2G9HA 5F9AC 4C58B 3RUGF 2I07A 2AK1L 2VKXA 4XNYH 1LE9A 1K8DB 3SKJH 5FDWB 5DQJB 1CXIA 2V2WA 3OHXB 5JW3L 5EORL 5HYSA 1IAOB 1ZOXA 3UZEA 1C16B 5C08B 1NC4D 1ED3A 2ITCB 2R0WH 3S88L 4MD0B 4OGZA 1KJ2B 5C07B 4JPIB 2YPLB 4U6XA 4OLEA 4QLRA 1CIDA 1U8OB 3MGOA 4U33A 3MO1A 2NY4D 3TBYA 1FFNB 5I1LB 4MCZB 1F2XK 5FK9B 5HVFB 3RJDA 1SYVA 4JPVL 5CUSH 4YNYB 3B2VL 4LHQB 1AQKH 1M7XA 2EDYA 1KB5A 2LE9A 4L4TE 5EU6E 1XGUA 4HFUL 4DCQA 1NC4B 4PRHA 3DTXB 3FFDB 4G7YH 3VMPA 3CDCA 1YJDH 2BC4B 4TRPH 1G7JA 4RFEB 1BFTA 4LSDA 5EC2A 5CJOH 2DQTL 4UV4H 1NUGA 2GJZB 4NHUA 1RFDL 3EOAA 5FYLE 3I6KA 4PJBB 4JY4A 3WIHH 1DE4B 5CEZE 4KROD 1UYWL 4D8PA 1QLRB 4PJ9D 5DK0A 3LSOA 2H2PD 5DTFB 4H26A 3O8XB 3VXSB 5I1JH 5DWUL 2A0LC 1MIEL 1MCDA 1VPOL 2XZZA 3LRSA 1CQKA 5GGTA 2GJJA 3RJQB 5D93C 1ZKAA 1JGEA 1ZS8A 3HZKB 5LXGH 1D5IH 4AG4L 3NBNA 3OKEA 3MR9A 1S7VA 1HQRB 3P73A 5GRUL 3QXAA 3MRRA 2O5ZL 5DC4B 4X6CE 1QBLL 3CC5B 3MNZB 1N4XH 2HH0L 4F7CA 3WLBA 3MNZA 1IQDB 3TEUA 3MJ9A 4Z7QF 5F7KC 5BRZD 3NH7L 3ARZA 4PR5B 3ZL4L 3D85D 4LLQB 1HQ4B 3QIUB 4HFUH 3G6JB 3JWDC 3IDGB 5CP7A 3CX5J 5MENA 1MREL 4PJFF 2AJVL 2F54A 1LO0H 1U8IB 1JTTA 2NMSA 2DMCA 4PP2B 1QPXA 5JOFA 2H9GA 1I8IB 4PJHA 3HMWH 4GJTB 4OT1L 3KPRA 3T04D 4P59L 1X5KA 4X80L 2IMNA 2Q3ZA 3VJ6B 1QSVA 4KVCH 1FCGA 3ARDD 1U8LA 5C2BH 1J5OL 3DSNA 4NNYB 5F97E 4RAVA 1XGQB 5HYEA 1FVCA 3V6FB 4UTBL 4D0BA 4WI2A 5JW3H 1CD1B 1R24A 3RX7A 3EYQC 4J4PA 5F7YC 4DEPC 4P46C 4L4JA 5C0BE 4LEOB 3VDBA 2PYEB 1MF2H 3T1FB 5AAWA 4KKCC 4PS4H 4UILL 2VSDA 4Y4HD 2NCMA 2MQCA 4PGCB 3IAPA 3D9AL 3HNVL 2WLZA 2KZWA 4FXLA 1JVKA 3FO0H 4Y5XC 4JZJA 3SKMB 4MSWA 5IMKA 3WS6A 1FO0B 2BCKA 3BO8A 3LMJL 4MD0A 2HJLA 5IT2L 5E9DA 4DGIL 2VMFA 4P5KB 1YN6A 4MJIA 1C16A 3MREA 1AE6L 5AUMA 4YQXL 1UEMA 1MI5E 5CGYD 4JKMA 4JFPA 5FEBA 1RHFA 5FUOH 1NKOA 5D7JD 4ZOCA 3WFEL 2CDGA 4OZ4A 1SJHB 4YPJA 3RWJB 3EZ8A 1CFSB 2A74B 3GNML 2X2YA 2DLEA 2VRAA 1EEQA 1CICB 3HFML 3V6BR 4KTEL 4P4RA 2DYPB 3PNWA 1U91A 2BOBB 5K9KB 4YHLL 4OIIL 5DD3L 4QHMB 3BKMH 3BRDA 1F5WA 4LFHG 4H1LH 1RZ7H 1TZIB 4H20L 3MXWL 1KOAA 4YPGA 1FNEA 1P4BL 4OF6A 4HH8A 4QOKB 1CD0A 4HLZH 3SDCD 3TIDA 4N5UA 3B83A 4Z76A 4L8CA 1U58B 5DFWH 5ACZB 3NIDE 3OAUL 5EU6A 5ADOH 1WEJL 4AQOA 4G6MH 5HGHB 3B5HA 1QFUL 4W4NA 4FQ1H 4UU9A 3BKJL 1HINL 4FXGA 2X1PA 4YK4C 3ARQA 4WUKL 5E7FA 3V52H 3EFFA 5FO9B 3QDJD 1RZIA 4DKEL 2MHAA 3T4AB 3PWUB 1SEQL 5IMOB 4AEHL 3PDDA 1ZGLM 5GJSH 2XTJB 4Z7UE 3CFDB 5EZOL 2J5LB 1OD9A 4KQ3H 3SCMB 3DO7B 2WWKT 1IQWH 4YDKH 1IAII 3I50L 3IJYB 4GMSL 4PRAB 4ZTOH 5GRJL 4E42A 7FABH 3H0TA 3UTZA 3U7YL 2LAGB 2A38A 1PJ9A 1CF8H 4P3CH 4N0YL 3DRTA 2X4PB 1UB6B 2PYEA 5MHSD 4PB9H 5BZDB 4M4RA 4M43H 2GTWA 4ETYA 2VLJB 3S5LB 3UBXI 4ETQB 4K3HA 1MI5A 4JQXC 4UT7L 5D7LD 1RZJL 1XGQA 1U36A 1CBVL 5DZLA 3IF1A 4U1SB 2QSCH 1U8LB 1HYSC 2D3VA 2VXVL 4XX1G 1UA6L 4PGBB 4YFDB 1B0GB 1I7UB 5C0IA 5CEXB 3PHQB 3QCTL 1KXTB 2AJXL 5DRXA 1UJ3B 3AGVA 1RZ8A 4PY8J 2R23A 4UIMB 5E8OA 4AEIH 1U8QA 2E5EA 3QNYA 1GRWA 4ZUSA 1JYWA 2ENSA 4R96B 2GT9B 5DUPL 4YWGL 1FDLH 5E94A 4KI5E 1KFAH 3WXVH 1P7KA 3FO2A 3HAEH 4IHOB 4NQSA 3UC0H 4OM1L 3P9MA 1TVDA 1IGYB 1B6DA 2LU7A 3M8OL 1MJ8L 5ESVB 1JZ6A 1A6UH 1HI6B 2GJZA 4GAJH 4H0HB 1R3KB 4MA8L 1G7JB 4FQ2H 3LKPA 3CU7A 3AM8A 4PREA 1IKFL 4M6OH 4I2XB 1W8NA 2PYFA 4NFBA 5FCUL 2A6DA 4YXKL 2JB6A 2A77H 3VXSA 5I8EA 4GRLD 4JM2A 1X5FA 4NPYB 3HS0B 5IHZB 4QF1A 4FFEX 4ONFH 5SX4I 5TQ0H 5FCSH 3B3IA 5JW4M 2DOCA 4HS8L 3S37L 3KPTA 4L9LA 1NCNA 1CIUA 1EFXD 3ARWA 1RZKL 1ZHBB 4GMTH 4ZUTB 1DBML 4MDIB 2CLVA 1DLFL 1JGUL 2A6IA 4XMLH 4XPTH 1V3MA 2KUTA 3U4AA 1I1YA 5TH2A 5IBTH 3SGEI 4PG2C 4NCDA 4X6FB 2ZZUT 5EU4A 4CNIA 3MV7A 5FO7A 4DAGH 2R69H 2VL5B 2PETA 2DLHA 2ZG2A 4PD4J 1HWGB 1UACL 2FATL 4M61A 4QYOB 4HLZG 1JN6A 3NZHH 3WSQL 3WMSA 3IXTA 4FQJH 3UJJH 4OZGB 3V2AR 3K8LA 4EN3C 5IJVA 1HHGA 3VGGA 1FRGH 2AJSH 2IG2H 1VADA 5IK3B 5H8DA 4YHNA 4TUKH 2NX5B 1KEGH 4ZNCD 1UEYA 1CFTA 3HLAA 2BX5A 4J6RL 1IM9D 3GUTB 4ZS6C 2QKIB 1FIEA 4N90E 3G9AB 4LNRB 1ZHBA 2FB4L 4Y2DC 3DSFH 1F3JA 3MBEB 1U8IA 3RWGA 2E9WA 3VXTA 4F15B 5IM7A 4KI5F 3V5DB 4UUJB 3RVWD 1GGCH 5DJXB 2BSTB 4RISH 1RIHL 4HPYL 4J3OC 1NL0L 3AREA 2F19L 2UVEA 4X7TA 1CR9L 3IFNH 4L3AA 4QXGL 4C56E 5F9WB 3ES6A 3ARSA 1HI6A 5CEZH 1XR9A 4XVTL 4O9HH 4OCRL 3SQOH 4WHTA 3MNVB 4RIRA 4J4PC 5EZJB 1QKZH 4O5LL 3PDOA 1ZVHA 4QTHB 4LPWA 1TETH 3LS4H 4RQQA 2VSCA 1UM4L 1WTLA 3AXLB 4X6DA 3QDMA 4NUJB 2Q8BL 1FNSL 4XAWL 4IIQB 3TA3A 1MAJA 2GSGB 3CU1A 3KVQA 3TVMB 3WFDH 4PP8C 4K7PH 4M5YL 4U6HB 3GFUA 5SWQA 4P5MA 4LDLB 1XFPA 2RAMA 2P42B 2YC1A 4YC2C 5BQ7A 4EQ3A 2ITDB 5M7QA 1GC1C 2R0ZH 3L7FB 1LP9E 1M7IA 2FL5B 3FZUD 3BISA 1QRND 1ZHLB 3HI6H 2RQ8A 5IMKB 2A2QT 4LVNC 4MJ5A 4R4NC 2FLBT 2I60L 5DJCA 2DQUH 3D69B 2XN9D 1QOKA 5IUSA 1BFVL 5I1DA 3MBXH 1GPOH 3V4UH 2UY7A 3NA9L 3KLDA 3SKUD 4MVBA 4U1HB 1MRCH 1V7ML 4M48H 1RJYB 4PRPB 3HUJB 3HC4H 4DZ8B 4XBEL 4K23H 5IBLD 3PL6B 5TE4L 4WU7A 5C0DA 5AZEL 5D7JA 2W0PA 2YUVA 4K3EL 3MRKB 1F58H 4PJ5A 5AYUH 3RDTC 4FNLH 3LIZL 1JFQL 4NRXB 1NCWH 1MRCL 2DLGA 1JFMA 2FX8H 3OAYK 1T03L 1HCFX 4QRPD 4HUXB 4OD1L 4UT6L 4K07A 4ELKA 3NA9H 4DZBA 4YUEH 1F4WH 2C3WA 3QJHB 4G6AD 2R4SH 4PJEF 4R7NB 2AEIT 3BPLB 3EFFB 5FO9A 1TZGL 4OFYD 3ARFB 1UH2A 3RVUD 4PJXE 4GG6A 1X5YA 5A2KH 4MVBC 2FH8A 1JMXA 5HSFA 4GSDL 5HGHA 3FQXA 5I71B 4JN1L 3TNNA 5F7FA 5JUEL 1MRFL 2VXQL 3CAFA 4O2CB 1Q0XL 1QPPA 1T1XA 2DQFA 2V9RA 4HSQA 1OB1B 3BAEL 3VGEA 5DFVC 2VZVA 1YNKL 2AQ2A 1MCNA 4LLWA 1QFWH 1YYML 4HX1A 5DMKB 3IS0X 5EO1B 4U6YB 2QQLL 2CKBA 3UJIH 4C57C 5H2BA 5IW6A 2WUCH 5EG6C 4G8EA 3ALWA 4HBQA 1ZLSL 2OZ4L 3RZCD 4CU6A 3BP4A 2Y9RT 4O2FA 2WIIA 1HIML 5D1XA 1JMZA 4TSAH 1KCVH 1KUMA 4WHYH 1XGYH 4HZLA 4MJID 4OCLC 2W65B 4MQXD 4KRPD 3C5ZC 1V05A 3H9ZA 4PTTB 2N56A 1A6TB 3G5XA 3MRPA 5IQ7H 1SY6A 1RIUH 2M1KA 4OGXL 4ZOBA 1WIUA 4BH8A 1AGCB 4XP6L 5DHXB 5KJRH 1G7LA 2WBJA 1ZXQA 2A73A 5I16B 4LCWB 4WCYL 1S7UA 1EUUA 2PXYD 1S9WA 1JWMB 2V5YA 1N5AB 4RMUA 2ATKA 4WW1A 4O2EB 4HJ0D 2EYTA 1CK0L 4JZJB 2DI8A 1P9MC 3BP6B 4DUXA 1NMAL 2GUOB 3H3KA 3V5KA 5E6IC 3PWNB 2FGWH 2X4OB 1TDQA 4J6RH 4JHAL 5EUOF 3DVFA 1R5WA 1MCLA 2VQ1A 4LCYB 4NC1E 1A8JH 4UQ2B 2Z8SA 4FQLL 4TUKL 2QADB 5F9DC 3TA3C 5IV2A 1QRNB 2X4RB 1FRGL 5C8JA 4M3JA 1VEPA 1A7RL 4U7MA 5HYSB 5KOMC 4PGEA 1ONQA 2HTKD 5TE6H 4KWUA 2Q8AL 2Z31B 3KYMA 4JR9H 1Z3GL 1DUZA 3LEYH 5J1AA 3LS5L 4ZPTB 1NLBH 2G9HB 5FECA 4U6HA 3BIBX 3G5XB 3EYFA 1F2QA 1QFPA 4U1MA 3HS0A 3TVMA 5IHZA 4RAUB 3WNLA 1YN7A 3A0OA 5D1QB 4OZIF 3Q3GB 1N0XL 1UWXK 1BD2A 2FNBA 4HC1L 3HG1D 5D7IE 3UBXB 5BVJB 2VAAA 5IVXA 1WWCA 1OP5H 4U6TA 4HLJA 1YEGH 2V5SA 1FZMA 3BZEA 4GAGH 4L29A 3QR2A 3LZFH 5I1IL 5ADPL 2VDRL 1KXVC 3CLEL 3T3MF 4ODUA 1MLCB 2NY0B 4JM2D 5DVNA 3FN3A 2L4OA 3KPLA 1LDSA 4JFFA 5FUZL 3Q5OA 2D7MA 2P7TB 5MEND 2NNAB 4MQ7A 3STBA 1BECA 4HPOL 3LQZB 3D25B 3QFJA 1KGCE 4P2YA 2YZ1A 4OZHF 2HG5A 4LPUA 3H9SD 1DANT 1H8OA 1ZVYA 2HN7A 2P8LB 2WP3O 4AH2B 4DFIA 4OUUB 4ODHH 5GGVH 3ZDYF 3QEQB 4WDIA 1DBBL 1JJUA 3LV3A 2HVKB 1BVKB 1QRNE 1YYLL 1OTUD 3DVNA 3SPVA 1NAMB 3EOYG 5LVEA 1IM9B 5JR1H 5DK0B 1MJ8H 3M8OH 1D6VL 2Y25A 4OF7A 1AGDA 4JN2A 1OGAB 5HI3D 2R15A 5I1GL 3GB7B 2OJZL 5HHQA 2C7UA 1JI1A 4QHLA 3O11B 3I3DA 4TN9A 4KROC 4X9HA 4YHKL 4KUCD 1J12A 4P57A 1FZMB 4NNXB 3QZWB 4L4VA 4MNGE 4JDTH 3CFEB 1BQLH 5DEFB 4TUJB 4ODVH 1A64A 1I7TB 5GS0D 1NCAH 4GQ9L 4OLZL 3SGJA 1N0LA 4ZD3L 1J1OL 1JPTL 3AB0B 3DYOA 3EAKA 2A83B 4S1SL 3RNQB 3VFOA 3U0TB 4G43B 3TCXA 1CXEA 3ZE2E 2I27N 5ICXB 2R8SL 5ERWB 1XCQB 3GJEA 4WW1B 5LCVH 3T0DA 3H2WA 5BQ7B 4DW2L 1BMGA 5KANI 4GS7C 1LEGA 2PCPB 2AXGA 4PJCE 5E8EA 3S98A 8FABA 3MQIA 4ZQKA 4N0RA 5FK9A 2V2TB 3DX8A 4ZUUB 2XWTA 2AJ3A 2GSGA 4GOSA 5IESH 2X9XA 2AAVA 3IB4A 5C0BA 4LARL 5E2UL 4DKFH 3OWEA 4I0PD 1LEKA 4DN3H 3OXRB 5HYSG 1A4KA 2IWGA 5CGTA 5F7DB 1WZ1L 4FFVD 5IVXE 3SDAB 3REVB 4ZNEE 2MMXA 4PJ8A 3KPOA 1QSED 2BY2A 3RWDA 5D7LE 2WANA 5EIIB 3SDAD 3OAZK 3L3JB 2OR7A 2XN9E 5F71A 3FL7A 1MJUH 4KK9D 4MAUL 4XP1L 4KVNH 1S7RA 5DT1H 5K59F 3DX6A 4JN2B 3P2TA 3S7GA 4JFYB 3K1DA 3U7AA 5GRWA 4X9FA 5I2IA 4M9OA 4MX7B 4HWNA 3V0VA 1NCCL 2A74A 5C9KA 3SJVE 2CGRH 1SJHA 3GZKA 3VXNB 3HC3H 1W0VB 4RZCA 3GRWH 3M45A 4X6CF 5D96C 2FZ3B 5BJTA 3Q2CA 1UKTA 4GLRH 5FIEA 2WBWB 2FD6L 5E1AA 1MHHA 5D4QA 3VXQA 4L8CB 1PKQB 1VFBB 1FPTH 1RUML 5FA3A 1J8HE 2VXSH 5GIRA 3GIZL 1UWGH 1FNEB 1NQBA 2J8OA 1YEHL 2EXWC 2J8UA 4WFFE 5CJ8A 4U3HA 3VI4F 5ALBH 1A1OA 2KL6A 4LLMB 3CMOL 1OQXA 2GY5A 2VLJA 3O3EB 1MJ7H 1T66D 3V6ZB 1AC6A 2J6EL 5CD3A 1HHJA 2VZSA 3STLA 5INDA 1R0AL 4NM8L 3ROOB 1BHGA 2HFFA 3F8UB 1MLBB 2C4FU 4QRPA 4NDMB 4DFHA 1MFEH 4M7JH 1YEIH 3FQRA 4M8VA 4RAVB 3FO0L 5BW7A 3GKWL 2NX5E 2WQRA 3QEQD 4X6DF 4JY6A 2G75B 4XI5C 3OB0K 2FHBA 1V3KA 3O3DA 2FL5A 5EOTB 3A6BH 1R5VA 4HUMB 1Q9WA 3WV0A 1ZVSA 3VE0A 1ADQA 4HHAA 1PKQA 5BVPH 3QXDB 4CADA 5MENB 2F58L 5EN2B 5IQ9A 5DR5L 2YXMA 1PSKH 5L6YL 4D0DA 2NY0D 1MFDH 4O4YL 4W81A 1I9IL 7CGTA 1HILB 3V9FA 1A6ZA 4XVJL 1MWAH 2HRPH 3EO1B 1YECH 3JUZA 3SDCB 3U36A 4P5TC 4I8DA 2WNGA 1BF8A 4B7LA 3MNVA 2QSVA 3PWPB 1S5IL 4OT1H 1UKSA 4IM8A 4XGZA 4XXDB 4XWOC 2JK5B 3O3BA 4JM4H 3UBXG 4POYA 1G6RH 2ZOLB 3OKNA 3VW3L 3BD3A 1XF3B 1IGFH 3VXME 5HDQH 3BSZH 1HHIA 5F6HJ 5EIQA 4ZYKB 1P7QA 5JDSA 1KGCD 2BP3A 5E94B 1S7XB 4BELD 4WWKA 5KVFH 5J12C 3NFPA 1N59B 1PKOA 3IU4L 2NY3C 1I75A 2DQGH 1MPAH 4B0MM 5TE7L 1OAQH 1MAKA 2F8XC 4H88H 5J6HB 3BHBA 4YE4L 1J8HB 5K9OA 5GRUH 1OT1A 4DK3A 5DK2B 5C0IB 3TLRA 5CEXA 1ACYL 3MREB 4X7FC 1IEBA 4MZ2A 3DX6B 4ZS7H 4Y19A 2YD5A 5LKNA 1VPOH 5TGBA 4AM0A 4MA3B 3L3JA 1EVTC 1LQSR 1F90H 4YH6A 5A2FA 3RWDB 4NYLA 3KXFD 2OP4L 4HEPG 5F21B 4TSCH 4PRID 1U41A 3HR5B 3TBTB 4LLDA 1IGIL 4H26B 4Y19E 2MQ0A 5C7XH 5IHUH 4ZTPL 3CVHB 2BXZA 1P53A 1I8KB 3EYVB 2R9HC 1EGJL 5FHBH 1RZJC 3L1OH 1W72B 3WJJC 1T1YA 1HH6A 2XZCL 3GHBH 5LJYH 1XF4A 3GMOB 3WCYA 1YEKL 1YDPA 4KXZI 4HF5H 4WI9A 4HUUA 5LQBH 1OAQL 1ROWA 4HIXH 4X98B 5K9QG 3C2AH 5TJWK 1A2YA 3UTSE 2RBLA 4RGNB 3B9KC 4AMKL 2LTQC 3J7HA 4I4WB 5FHBL 1AD9A 2UZIH 3K46A 1E6OL 4J3VA 4ZTPH 1IC5L 2ICES 5DD6A 1KCSL 3B6SB 1AO7E 2BSRB 5JPNA 2VDOH 3D85B 3EYSL 1ERNA 5KN5B 3MLWH 1AIFB 3S3PA 4X7SL 5GHWL 2MQ3A 3KXFB 3D25A 2VR4A 1CLZH 1SQ2N 2Y6SD 4KRPC 4M02A 4WFEE 2XQBH 1ADQL 2FWOA 3FT2A 3HMXA 3I6GA 4L8SA 2CDEA 4KK8C 4ODSH 4Y19D 1CVSC 5DHYA 5GISH 4XX1E 5K9OB 3DURA 2FCBA 3Q5YA 3RDTA 2VR5A 3DWTA 2VH5L 3FB6B 2E9IA 3GB7A 4Q9QH 5SWSD 3DMMA 3L3KB 2F53A 4XNZB 2BVQA 4LKCA 4QO1A 1YY9C 1J8HD 2CKBH 3M1BA 3RUGB 5GZOD 2NY2D 5CAYB 1G9EA 1IAMA 3NA4A 4IRSD 1H3PL 1R3IL 3VXSD 1HHIB 4H88L 5HHNB 2DM7A 2B1HL 3P4LA 3GGWB 1QEWA 4LSUL 3GSQB 3IU4H 1EO8H 2QHRL 3PL6D 4O58L 3AROA 4OQTL 3HNSH 3QXDA 4L5FH 1KTDB 1CE1H 1DQTA 3VE0B 3ES6B 1A7QL 2R1XA 3JVGC 4OLWH 5DRNB 5FM5M 1FL5A 3PE9A 1FZJA 1J0JA 4X7TB 5C09A 1FE8H 5D2LA 3QWRD 1A6ZB 3BQUD 1L6XA 3PWJA 3BZFA 1JV5A 1G9MC 3MA9H 4UQ2A 2O5XH 3VFVA 3RZCA 4M03A 2BVUA 2GT9A 2ESVA 2CUHA 1QSEE 3MXVL 5EPMB 1K4CA 4D3CH 3KYOA 1YJDC 4LCUA 3CMOH 4WW2A 5IFHH 1FH5H 4E41B 4JO1H 3OXSA 2HRPL 4P2CG 3KDMA 3VXUE 3MLRH 2D7TH 4JQIH 1LP9B 5DUML 2WWMC 2D4FA 2ZKHH 5BCAA 4Y16A 2YD2A 3OJMB 4P5TA 1ACZA 1HH6B 3IDMA 3IGAB 4OB5L 1LO4L 3F12B 1SMAA 1T5WA 3TZVB 2E6QA 4HIJA 4LF3B 3H3BC 1FQ9C 1IL1A 3I3EA 1S9KC 1YMME 2JB5L 3GKWH 3I85A 3RTQD 1FVEB 3IDXL 4JRXB 2VNCA 3MJ9H 4LLDB 1KJ3H 1YPZB 3RWCA 3HB3D 2C3VA 4L1DA 2VLRB 4HK3J 4WI5A 1BVLB 1J1PL 3O6MH 4RWHA 1AP2B 2IF7A 4P4KA 5L9DL 4Y2OA 5BW7C 3W39A 1QSEA 4GFTB 5TGBB 1N26A 2Y07H 4I5BA 4BZ2L 3AY4A 1T89A 1DQML 4FFYH 1CGTA 1J86A 4LHUA 3U9UB 4O58H 5JNYB 4MNGB 3F62A 3JWDH 3T0EE 4LP4A 2JCCE 1BM3H 4D9RD 4B53A 3T0ED 3MBED 1OB1A 1T0PB 4W68A 1FNLA 4HFWA 4HKBB 4F33B 3MFFB 4O02L 2XKUA 4IJ3C 2HFTA 4NQEB 2HKFL 4ZFOA 5L8KB 3ZDXE 2J6EA 3H3PH 1NCTA 4Q9QL 1U42A 4Z78A 3GSOA 3OXRA 1YC7A 2ERJC 5I2IB 2FSEB 4KH2A 4P99A 3DX9A 1WFUA 2WLYA 4WO4C 5I19H 3MRQA 4OFVA 5DGQA 4MHHG 2DMKA 1HNGA 3G6DL 3WFBL 3AU1B 1WSST 2WAHA 5IP4A 3PGDB 4KV5F 3MNWA 5EBLA 4HK0B 2IJ0C 5D1ZC 3PL6C 4NZTL 5DA0B 2QEJA 2VDOL 3DTXA 3LKRA 3PQYE 1YMHA 2ADIA 3BJLA 1CWVA 2DQFB 3MC0A 2ZCKL 1CGXA 1QSEB 3O41B 1S5HA 3GM8A 2FJHB 3I2CH 4PJEE 2XN9A 3DV4A 4MA1B 5IEKA 2UUDK 1CL7L 1DN2A 4JG0L 5DA4A 2YD4A 3MTRA 5KSVA 5C08E 4CADB 4PRNA 3RL2A 3EYOB 5J13C 2GTZB 3CLFL 4HHAB 1WIPA 3BUYB 2RHEA 3L1OL 4YHYC 5IESL 1FORL 1Q9WB 3AM8C 1OF2B 3W9DB 4H25A 4ODWB 3F6LA 3DBXB 2X41A 5I76A 1T2XA 4MJ6B 5INCA 2A1WH 2B4CH 3D0LA 4GAFB 4Z18A 1U8HA 3EZJB 9CGTA 3JTCA 2B2XL 4IIQC 4JANB 2OP4H 4AYFA 5HGBB 2VUYA 1T4KB 4OLVH 3WDJA 5DJ6B 4L4TD 3FMGH 4GRWE 3AXLA 5EUOE 5SWZE 2F54B 4FQIH 4RQQB 3RIAF 3PP3H 4U1GB 3DGGA 2FECI 5L2KD 4PYGA 4MD4B 1KN4L 1JIBA 2FGZA 5B39G 3HI1A 1MHEA 2NY3B 2ILLA 4ZXBC 3ROLA 3GSVA 1JYXA 3VMNA 5IMMB 1I1YB 1NDMB 1IBGL 5IOPB 4OLUL 4RMQA 2A6IB 3VXSE 5D5MB 4X6BA 4G3YH 5I1KL 1OP3H 3KPRD 5I15L 3SGJC 1F3DJ 5A3IC 4HC1H 1KJ2L 1Q72H 2A6JA 12E8L 4R4FL 2VLLA 5I1GH 2F74A 3QUZD 3VI3E 2XG4A 4JQXA 5LGKA 1FL6B 3RA7L 3SKOB 5E70A 4Q9RL 2FHFA 1GGIH 2ICWJ 4LRIA 3P3YA 3Q3GA 1UXSA 2W92A 3L6FB 3BPCB 3VH8B 3CSBA 4ONOA 1ZAGA 4JHWL 3PDOB 2HLAA 1M05B 5D9SB 3UTSD 1HKLL 2HLFD 3V4PH 3NGBB 3RHWK 4HPOH 4WI4A 4CKVX 1AGEA 4O4YH 3LQMA 3VRIA 4JRYB 4U1NA 2CDEB 4HCRH 2ESVE 3O6FB 4KGLA 1JWSA 4KZDL 3DGGB 2DYPA 4KDWA 1RURH 2C5DC 1BOYA 1F6AA 3SCMD 1XGTB 3CSYA 1QO3A 4FFZL 1ZT4B 4JANA 2E9JA 4MCZA 5T3XH 2CDGB 3Q0HA 3QUML 3OR6B 3N1MC 2R1WA 1RZFL 4ZPTA 2PW2A 3T4YB 4UINH 4PLKC 3ZYZA 5FO7B 5D7IA 1B88A 4OBSA 4JO2L 1WISA 4HXAH 1XGUB 1TJGL 1UJTA 5D1XD 1VERA 1Z3GH 5ETUA 5FYKH 5AZ2H 3BESR 2X4NA 2MNUA 4TSAL 4QOKD 3DROB 3E6FA 1CDUA 5DK3A 5GSRB 4N1HB 2DQHL 5JIHA 2GTWB 2X40A 4YZFF 1WV7T 2CLRB 2ZPKH 1SMOA 4OD3L 1P6FA 4JHAH 1NAML 3ME0A 1MCOL 1NGYA 4KKNA 5EOQL 1IAOA 2FBJL 2VXTL 1IKNC 1NMAH 2WSKA 3MOAL 3ZKNC 5DJDB 4K3GA 4P9HH 1Q0XH 2PXYB 4MJ6A 3PWPE 3SGKC 2VDPL 4OD2B 5MHSE 4Y5XA 3WS6C 3N85L 5ISZD 3QHZH 2D7NA 2KPNA 2XY2A 1TZHB 3QAZC 3TN0A 2X44D 3V8OA 4JZJC 4L8DB 1ZLWK 1TCMA 1TJIH 3MV11 4Y4KB 1J8HA 1WVZA 3QDGE 5C92A 1I3RA 1QSFD 4XC3H 1U8PB 5CP7B 3DIFA 2AQ3A 2Q7NA 1UM5L 2NYYD 3MJ6A 4XP1H 1NCWL 3MCG1 1I8MB 3REWB 2APBA 3I75A 2EE3A 2JIXB 3FT3A 2OTWB 4PREB 1KACB 4X6BB 5IB1B 1LVEA 3CUPB 2JJSA 2R2EA 4FXKA 4J3SA 4DVBB 1IC7L 5D2NB 5F88B 2IEPA 4XGZB 3MV9E 3B5GA 4KFZC 5I0ZA 2Z8VC 4FFWD 2CDFA 5KBNC 5BXFA 5E2UH 4OI9A 3WHE1 5BV7C 5IFJA 4OKDA 2HJFB 1EEYA 4XRCB 1MRFH 2LU4A 4F58H 3EJZC 3D39E 3NABH 4GBXA 2C3HA 2YA0A 3LDBB 2DBLH 5D1QA 4ZFOB 5CLWA 1NSNL 1BQHA 1CU4L 4K55A 2EDFA 4MNQA 1ZANH 5E2WH 5KSAC 3BH8A 1DEEA 3T2PA 5I71C 1QLEH 3ZT5A 3F7PC 1YN6B 4GQPH 2FX8L 4KK8D 1FAKT 5DVKA 1J1XH 4PLKD 5E7BA 2V5MA 1Z5LB 3LIZH 3EKCA 4KROB 3VXMA 3QQ4B 3B8SA 4HG4J 3VRJB 4FQCL 4PLNC 1JNJA 2UWEE 3DPBA 3P77A 2AS5M 3KYOB 4ZAKD 3FQUA 5E08L 1OM3L 1HHJB 3SQOL 3HCVB 1AO7B 1QZ1A 5GXBB 3MRMA 3GMPB 1ZVSB 3MLZH 4KKBC