5HGBA

Hla*a2402 complexed with hiv nef138 8mer epitope
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 70
structure length 274
sequence length 274
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hgbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hgbA01
3RRQA 1G0DA 1KLUA 4IMLA 4ELKA 4OCXH 3ULUF 5IOPA 1NLDL 4BZ2H 1S7TB 2CLRB 2ZOLA 3JTSB 5F3HA 1DZBA 1TJHH 2CDFA 2DKMA 3BMWA 4GBXC 1FIGL 1VESA 2FB4L 2GK2A 4K2UL 1NCNA 3GJFH 2ZPKL 4XP9L 5FKPB 5SWSB 1WBZA 1G7LA 5IK3B 3CDGA 1YEEL 3D48R 5ID0A 4HIHB 1FO0A 1AGFB 2OX5A 4LQFH 4F9PA 3P0VL 1BF2A 3BIAX 4HUNB 5IVNA 4D3CH 3HRZA 3I6KA 3MRCB 4HS6A 1Y18A 1MJUL 1UEMA 4BELD 3SBWC 2JELL 3GMNA 1D9KC 5DUPL 4JG1H 3AY4C 1P9MA 3EDDA 3T0EA 4YK4B 2I5YL 2XWBA 5EFIB 4F37K 2B20A 4PUBH 2BJML 2H6PA 1G7IA 3MYJB 5ADOL 4OSUL 1BECA 4N1HB 4CBPA 1OSPH 3V5KB 5F89B 1VEPA 1OGAA 4EUPH 1BQHG 4QRUA 1KCSH 4TSCL 4NNXA 1J8HB 1LO2H 2NYYC 3AS3A 4O9HH 4HPYL 3QXTA 3KPSA 4Y19E 3GMMA 4I4WA 5C09E 1I9JL 2AGJL 4QHNA 5IB1B 1A2YA 4WV1C 4RISH 3W39B 2VISB 3CCHB 4MCYB 3ULVE 4P5KB 2HT3D 2ZCKL 3NZ8B 4OZFB 3W82A 3QDMA 4RGMB 3ORJA 3SJVB 2EDBA 4RAUA 1WITA 1QYGH 1INEL 3BJLA 3DARA 4PJ5E 2P1YA 4L9LC 5CKAA 1M6OA 1ROWA 5C9JA 1F90H 4KZDL 2ITCA 2X4OB 1KTLA 4J8RA 5DJZA 4NQCD 3QHZH 3A67H 4XXDB 5ALBL 3HHRB 1I1FA 2Y7QB 3ARXA 1YY8A 4WVRA 1QSFB 2XZCL 5CSBA 4HAFA 5BJTA 3ULUH 3DMMB 1EDQA 4ZTPH 4KMTH 5JPMA 1RZJH 2KUTA 3T4AA 3ZL4H 4WENB 1LO4L 2HG5A 2WBWB 4LP5A 2JCCB 3GSWB 4TYUA 3W11D 1XGRA 5BZDA 1IT9H 3GRWH 3VXQA 3PL6B 5CP3H 1AD9B 2ZZUT 4I5BA 4MXWL 2DQEH 4HJJL 3SOBH 3FB5A 1ZLVK 1KIUA 1G7PB 4BFGA 5C6TH 3SDCA 5FEBA 5CILH 3RL1A 5K59E 3WS6A 5I1GH 2XTJE 3OGCB 1QA9B 5GZNC 5FYLD 3TO2B 3REVA 5HYJB 1RU9L 4QYOA 3LQMA 4TOYH 1QLRB 1NANH 3DTXB 3DX6A 4PB0H 1D6VH 4R4BB 5DHYA 3ZDZF 4NN5C 5JDJA 2RCSL 4LNRA 4M7JL 5KSVB 1OP3H 3QNZA 2IQ9H 4NCC2 1P4IH 1I7RA 3KXFD 2Y36L 1DEDA 1FV1A 1SJHA 1T21A 2PF6A 4P46D 3QJHA 4P5TD 2DLTA 4P49A 4W4OC 3NCEB 4X4ME 5BV7L 3QPQD 1JNHB 5J89A 1I8LA 3L7FA 4UAOC 1AI1L 1KB9K 3EOTH 4YGVB 4W6XB 5IGXL 5EB9A 3MOBH 1M7XA 4XCFL 5I8KL 3SCMB 3LRHA 4D2NA 2E7HA 1YNLL 5DUML 4X7SL 3O4OC 5I8EA 3BSZH 3MJ9L 4JN2A 5E70A 4KHTH 4PG9A 3SDAC 4FNLH 4WWKA 1KEMH 1I1RA 1XH3B 3FQRA 1LE5A 5EULV 2BY1A 4JFED 4O2CA 3KLHC 1IQWL 2NNAA 2YPLE 5TE6H 3WS3A 4LKXB 3O45A 2R4SH 3HR6A 3TCLA 1IILE 3AMKA 5I1IH 5HI5D 5ESVA 4ZTOH 2FYYA 3O6FB 4F57H 1WAAE 4J3XA 5D7JA 4XTRD 3KJ4B 4PGEA 1KPVA 3QUZD 4Q6YA 4MNQB 2I9TB 1EEUA 3STLB 4PJ8A 4HXAH 3VFPA 4MZ3A 2GI7A 4N0UB 3HAEA 5JTWA 4KKBC 1K9TA 5INCB 3MV7E 1E4XH 5BOPA 4GXUM 4BQ8A 3QWRA 2QQLH 2DF3A 4NJ9L 4GFTB 2VDRL 4G7YL 2R0ZL 5BXFB 1PG7L 3HG1E 3MGOB 4Y2DB 3VDAA 1MWAA 5F9OL 1S7WA 3D3VB 4YUEL 2D9CA 2HLAB 3QCUH 1CXHA 1SHMA 2JB5L 2BY0A 4NQUA 4S10A 4Z7VF 3F6IA 1TZGH 4LK4A 4EIZC 1KENL 3C5SB 4YAQB 4NO0D 4XWOC 5DK3A 1QLEL 1AXSA 4PRHD 2PO6C 3V4VL 5BZWA 2GJJA 3VWJA 5IMOB 2VL5A 3ZSTA 4HLZG 2MOVA 4RFEB 5HGGS 1K4CA 1KYOK 3MMEB 4NFDA 4YO0A 2AQ1A 4B7LA 3L5WA 4LL9A 4PRPB 3NPSB 3D9AL 3L6FB 4ISVA 3C60B 3ARUA 4KRPB 4Z7NE 3LDBC 3C08H 4NUJA 2E6QA 5GS2H 1C8PA 3B3IA 4XBGB 3RL2A 3SE4A 4PJIF 3VXMA 2RAMA 2FECL 5C0BB 1VPOH 4LMQE 5DQ9B 3P30L 1U3HA 3BISA 3WEXB 2NTSP 5BQ7B 3FHAA 3QEHB 2X70B 2G9HB 2QQNL 4QXGL 4WY7H 4PTUA 5J8OA 5INDA 1KBGH 1KB5H 4DGYH 3MJ7A 4JHWL 2H26A 1KXTB 4OI7A 3H7LA 1CVRA 4OB5L 4OZHF 5ECJE 1IGFL 4ODTH 3PWPA 3UTQB 4OT1H 1IJ9A 2V17H 1E27B 2CKBA 3PGDB 1GOHA 2IPKB 1Q72L 4I18B 1RJZA 1KNOB 4KHXL 3CD4A 3HZYB 3I02A 5I17A 3QBTB 4FQJL 3V6BR 5J9PB 3B6SA 2LU4A 1NMCC 1XAUA 1KTRL 3I50H 3GMQB 1M71A 4MAUL 5FYKH 1C1EH 1IQDB 5CD5D 5IMKA 5DMKB 2Q8AL 4OD2A 1I1AC 4FFVD 4NQVB 1EK3A 2R0WL 3FQTB 1JZ8A 3WKNA 3WUWG 1RIUH 2F15A 1N0XL 5FA3A 1A1NB 4P2RE 1UXSA 3TN0A 1TMCA 1DVFA 1U8JA 1SBSH 4FA8A 1LILA 4N8CH 1W72H 3GNML 3AAZB 3O2VL 3OKMB 3BH8A 1FNFA 3SHSA 1VA9A 4K8RH 4H88H 4XNXL 1HEZB 2W0FA 3VFRA 5C0CA 1HQRA 4MCZB 3QZWA 1EHLL 5C0AD 5C7XH 4YHNB 5F7UA 3R8BB 3VW3H 3IU4H 1RUAL 3FKUS 3QISA 4YDVB 4LHUD 5D7SH 1Q9WB 4M7LL 2X10A 1S7SB 1DUZA 1V7ML 1FQ9C 3W9EA 4KK6C 4NRYB 4NZUH 1NEZB 5FAAA 5EZLA 1QO3A 2CIIB 4D94A 1N64H 4LPYA 1YPZA 2NY2D 5D1XC 4J3UA 1JGEA 3LQZA 3PNWB 1DL7H 2OLDA 3FT4B 3WNLA 1YNKH 1VFOA 4M9OA 2WW8A 3S6CA 3K46A 4EN3B 4Z0BH 1EHNA 3BQUB 3U9PL 2DD8H 2OSLA 3QXDB 4QHKJ 4OM0H 4AL8H 5IIEB 5FYKU 3KNBA 3LEXA 3O9WD 4G6JH 5JIPA 1RMFH 3UC0L 1AD0B 3MCLH 1Y6MR 3QFJE 1MF2H 3MRIA 3MV9E 4FOMA 4FQXD 5C0DA 1RULL 3ES6B 2X4UB 4X4XB 4UOW0 4JG1L 5FHAH 3MRQB 4HT1L 4ZAKD 1G7HB 5KN5A 5E2WL 1I3UA 1DFBL 1ZA3B 4CVUA 1GPOH 1YY9C 4F33B 1OSPL 1BD2A 4OGYH 2NX5B 4LCCB 5DTFA 5F9DC 5E8NA 4M7ZC 2F74B 2DIAA 3VFSA 1J0IA 2BFVL 2V7HA 2GK0A 2DBJA 3DHMA 5ISZD 2EYRB 1FVDB 2IGFH 3V2AR 4GBXD 2BCKA 4XPAH 3L3GB 4DCQA 3L3IA 1GOFA 4XNZB 4PJHE 4YIQA 4Q9RH 3MLUH 3VH8G 1XR9B 2OL3L 4O00A 4AG4H 1IEAB 1QYGL 2AJZB 1UQSB 1T1ZB 2A83B 1D9KD 5EU6E 3HPLA 3SPVA 4MAYB 4EI5B 1L7TH 2NQCA 3U9UB 3ULUL 4FS0A 5GRUH 1JRHL 5GIRA 2D03L 3WD5L 4Y5VC 4P2YA 5E9DE 5JMRA 4XVJH 1UA6H 3MRHB 3M1BA 2X4TB 5E2TL 2VLJD 3NFPB 2OJZL 4HZAA 4U7MA 1IEBB 4C58B 2NYYD 4HPOL 4M6MH 2LE9A 5DD5L 4G59A 3SOBL 1Y0LB 4JG0H 2JIXB 2QJDA 4KK5C 5I1GL 1XMWA 4DN3L 2VLKE 4BK5A 3QUMH 2WBJC 4C56E 4YHPA 1M7DB 4YC2B 4KU1A 4NQTA 4S1SL 3RHWF 4M3KB 4HEME 2A6KA 1MHEB 3OHXA 3HC3H 3V95A 2X41A 1A3LL 3VXSB 2VR5A 1I7UA 4U1GC 3VU2A 2FCBA 3BDYL 3VD4A 2MHAB 3DVIA 1JPFB 4JKPH 4DUXA 3B5HA 3L3HA 1CD8A 5FO8B 4RZCA 4S11A 1P4IL 2ATKB 4MJ5B 3EYVB 2IG2L 2J5LB 2ATPB 1ND0A 2GJ6E 2PCPA 1SYVA 1CTNA 5LKNA 1JHLH 3N1QC 2AABH 5KSUA 2WLYA 2F53E 2CLVA 2ZUUA 3BP5A 3EO9H 4LSPH 3KPPB 1UCBL 3GZKA 3FZUC 3HI6H 5E4EC 3E6FB 4P4RA 4I48A 2HP4A 4FMFA 2J8OA 3LIZH 4ZS7L 5K93A 1AGCB 3GBMH 2X1XR 5HHMB 4OCRL 5D71H 4MNGB 3TIDA 3VFVA 5GGRY 1HXMB 3ARDA 4FNLL 4RWYH 4NRZB 5GZND 4Y1AB 4LASH 3PWJA 4K3JL 4LCWE 3CFIC 2CLRA 1S9YA 3IT8D 1E28A 1PX4A 5DRZB 2CDEB 1I8KB 1CGSL 2R4SL 1UENA 2HRLA 5IK3A 5D6DC 1FIEA 5GGQH 5K9KA 3WHE1 3DX7B 4YFLF 2B5IC 4KDTC 5IVXA 3MRCA 5D9SB 4QNPF 3QFDB 4MZ2A 3U46B 2JTDA 5ERWA 1PYWA 1EAJA 1F6LL 5BS0D 4FG6C 2C4XA 3HZVA 1E4XL 4LKCA 1EEZB 2CGRL 5EIVA 3VGAB 3ZDXF 4U1KA 1QEWB 3VFGH 1GZQB 1CGTA 3B9KA 5DHVB 2XPGB 3B2VH 1WIOA 5DC0A 1YMME 5KOMC 5I8CB 2E6JA 1IGCH 3RBGA 2I25N 1CTOA 2DWDA 3SDAD 1J8HA 3U4BH 3KJ6L 4B41A 3ULUE 2ADIA 5LGHH 5T3XD 2F5AL 4QRPE 1CFNA 1N5AB 4X99A 4XXCC 3KLHD 3X12A 4CVXB 3MLPA 4QRRB 3H9SD 2WIIA 2FZ3A 4R3SB 5F7KC 5E6IC 5C8JB 3CCHA 4NZJA 1KIRB 4R7NB 4P5KA 4U1JA 4DVRH 2APTA 3IJSA 2E27H 1FL6A 4ZSOA 5FUCE 3QT2A 3CUPB 1QQDB 1KCVH 1VPOL 5HHOB 5GJTH 1P84J 3ARGA 4GQ9L 4QRQA 4BSVA 3K4ZA 3LCYA 4KKBD 2PKDA 3LS5H 1BVKA 4OM1H 2I60L 2P45B 3BGMA 1EV2E 4NCDA 4WY7L 3KYMB 2EXWC 2VYRE 4ODWB 4YXLL 5IR1B 1FNHA 4DGYL 4GG6A 1U8IA 2XA8H 5HYSA 1CN4A 2X1PA 4ODHL 1IEHA 2W0KA 4ODTL 5CINH 1MRDH 2DLHA 1VFBB 3MJ8A 4JM2A 1FNSH 1IAII 4OLXL 4HWEL 4E41A 4JFFA 5F97E 4TVPL 2VABB 1FYTB 3U36B 4XWOD 4P2OC 5CLTA 2Y4SA 2NTFA 5EU4A 3M8OH 4LSSL 2NW2B 1QFWL 2JK5B 2PO6D 2FL5A 5CP7A 3W0WA 4CVZA 3WNMA 2EDFA 5CIPA 3OGCA 3O6KL 1ZVYA 1QPPA 2XZQH 3S96B 4U2ZA 4DVBB 1Z0MA 4GAYA 1O7SA 1QLRA 1CL7L 2BDNH 3OR6B 5I8OL 1INDH 2FJFB 3RTQC 4R4BA 1TJIL 1HKFA 5JIIA 3ZYZA 3NCJH 3RU8H 1P6FA 5M7QA 2CH8A 4N8CL 2OZ4L 4G6MH 4RIRA 4H20H 3EYUL 1F4XH 4GQPH 4XP5L 4PP8C 1DN2A 1PQZA 1YEFH 3ARBB 3MJ9A 1JNLL 3CLFL 3RWCB 1A47A 5C7XL 2VKWA 3S98A 5CGTA 4R96B 4MJID 4H25B 3VW3L 4UOJA 6FABH 5D7SL 4RGNE 4Z7UF 4MDIB 2P7TB 1QP1A 5IQ9B 4JGMA 1P7QD 1T03L 3EJZC 4NZUL 3CJJA 2VQ1A 1P4LA 1LO3L 4PG2C 5ESQB 4JO2H 1B2WL 2R2BB 4WU5A 4L3ED 5KS9F 1U8HA 3ZYOA 5E08H 5ACLA 5DRNB 4G6KH 1I1AD 4OUOA 4Z0BL 2DYPB 3X3GL 4AL8L 5DUBB 2HFEB 3CK0L 4LPWA 5DR5H 5FK9A 3S34L 4G6JL 2CR3A 1DE4A 3ZDZE 1ZK9A 4DN4H 2CJUL 4UV4L 1LK3L 5FHAL 1WIUA 3ZDYF 1BM3H 4P9HC 2FEEI 3DI3B 4JDVB 4YLQT 4I9WE 4MNQA 5KW9H 3QPXH 5CBAA 1QRNA 1BEYH 5SWZD 4KROB 2ITDB 4ZG1A 3FCTA 3MACL 5INCA 4WJ5B 2DQJL 5GS1C 5IJVA 2VXSH 5B3JF 1RJYA 1U95B 5DRXB 2GSGA 5DMYA 1E4WL 5BXFA 5DK2A 3I6GB 3TNNB 1S9XA 1CF8H 3NIGF 4KK6D 1LEIA 4TPRH 1DBKL 2HLAA 1FZKB 2IAND 3VXUB 1H8SA 1ZT7B 1OLZA 5D1XD 1A7RH 1NBVL 2P5WE 5DVLA 4S0UC 3L9RB 1KPUB 3LKNA 3D85B 3F62A 3MRDB 1JPSL 3P77A 3HI1B 1A22B 4WW2C 4GS7B 3OKOB 1WEJH 5FO7B 5CJOL 2RIKA 1J1OH 4U3HA 2VQTA 4NQDB 4RFEA 1ZLUH 3QNXB 4PJAB 3VG0H 5I73B 4XZUA 2NY5H 5L7XL 5E8EB 5KJRL 3WUZA 3HI5H 2P5EE 2D7TH 3D69A 3C60A 1B4RA 1KG0B 2BNRB 1NAKH 4XBGA 1CDIA 1JGUL 5FYKE 5C0BA 5TQ2L 2X4QB 4Y4FC 1YY9D 1JWSB 2DDQL 4PD4J 2G9HA 1CICA 5SX4H 4QHMB 1N2RA 1CLCA 2DLFL 2PYFB 4JGUA 3OAZK 2VLRE 1BQLH 2FX7L 3FB6A 2IBBA 5F9JB 4U1NA 1F6AB 1ETZA 4Z7VE 2F58H 3HC4L 5ENWB 3PGDA 3DUSB 2IPKA 4U6YB 4IDLA 4MB3A 1KNOA 4QGYA 4QOKA 4N0CC 3HZYA 5DVOA 2D7PA 5K9QI 1FE8H 2DQHH 3GMQA 5CZVL 1OAYH 2PTUA 4D8PA 3EYSH 3PHQA 4JKPL 4NWTH 4K94L 3WFCL 3IFLL 4PJXF 4K07A 4X7TB 3RIAF 3DBXA 2O61B 1IGYB 3BPLB 4JQXC 1DQMH 1HWHB 4PJIE 1RIHH 5FCSH 5F88A 1SEBB 3UJIL 4JPKH 3OKMA 2FGZA 4LCUA 4QT5B 1YMHA 1ERNA 4M9PA 4ZDHB 4ZFFB 2LU7A 1JGDA 5DRWB 2PW1B 1G9MC 3DUUB 2V5RA 2V5SA 3KYNB 4ORZC 4OZHE 5HGBA 2Q76A 2MKLC 1MAMH 4M1DL 3FJTA 2Z91B 5I66B 1A14L 1IM9B 4LVOB 3VG9B 3HC0A 4KK5D 3VXRD 2WBJD 4NRYA 1A6VL 3ZE1F 3GMRB 5ITFA 1D5IL 3UJTH 3HZKB 2OQJA 3WO4C 1LQVA 3DYPA 2EDJA 1P69B 1K8IA 4NN7C 4R0LC 4URTB 1VFAA 4MXQC 3TPUB 2EH8L 1BJ8A 1HXYB 3OF6A 4BSWB 5IIEA 4LHJB 5GGQL 3S4SG 1GGIH 3HNSH 1WTGT 4U1IA 1AD0A 1QFWM 4MJ2A 5CJ5A 2AI0H 2X9XA 3NTCH 5FYLL 3ES6A 2X4UA 4IIQB 3TBSB 1C7TA 1KCLA 3EO1B 5L6YL 3EYFB 5DD6B 1T7VA 1C5DA 5KVFL 4XH2B 3HLAB 4WO4C 3HE6A 4Y19B 3FZUD 5D2LF 5KSAB 1OCWH 5C09B 5FB8B 4PJ9B 4TVSa 1WSST 1NBZB 1UH3A 3GB7B 3B2VL 1QNZL 2HJFA 2KBGA 4XVUC 1L9MA 4F9PC 5J56B 4MA3B 2EDEA 2I9LA 4H8WH 5JW5B 1JJUA 2IBZX 2F74A 2OL3A 3U4BL 3BN9C 4Y5XB 1RFDH 1G6RH 2Z8SA 2QKIB 1DBJH 1QHPA 3ESUF 3QUYC 4PJ5B 5T5FL 1P9MC 3C87A 4OIIL 3OZ9H 3BT2H 5JA8B 2B4CL 4HKZA 1TNNA 2HFFB 1OW0C 4CL7A 5I15H 2VN4A 2GTWB 1MCNA 3L5XH 4PJCF 1CFQB 2GITB 2V2TB 2XWTB 4LCYB 5C07E 4XWGH 2E27L 3NFSH 3A6OA 2DMCA 4LFHG 4NO5A 1T0NB 3IF1A 3MZTA 3QO0A 4PRID 1A6TA 5GJTL 5IWLA 1PAMA 2A6JA 4JPWH 3RA7H 2DQGL 2YA0A 4X5XA 4PGDB 4FG6D 4L29A 1G1YA 1UEYA 3PIQA 4MS8A 2R1YB 1ADQA 1FJ1B 1FC2D 5F1NB 1IGIL 4Z6AT 2ILLA 4M62H 1EZVX 3IFNL 4LLYA 4M00A 2Z0BA 3GO1H 5GRZA 5D2NE 2A77L 4I3RH 5CCKH 3IDNB 5GSRB 4JANA 4UMGA 3WIHL 1FN4B 2DOCA 3TFKC 1N8ZB 3SKOB 1Y0LA 1AR2A 4HWZB 4JN1H 1AY1H 3QQ4A 1T89A 2JIXA 2YZ8A 4Y4HA 5CD3B 4ETQB 4U0RB 3TIEB 1HINL 1K5NA 4HDIB 5CWSA 1F4YL 5ADPH 1CFBA 2V5MA 3CSYB 5E6ID 1M7DA 3MNZA 4D9LH 1INDL 4BH8B 4NQCE 3TZVB 2VAAB 3QB7C 4K23L 3FFCB 3VXSA 5HBBA 2WMPA 1YJDH 1QBAA 2MHAA 2A9ML 3RU8L 1SM3L 2VITB 1HE7A 3H42H 5GGUB 5T3XH 1UB6B 5E03A 4YHIA 1NAMB 3FQUB 2ATPA 1R3JB 1YYLH 3V52L 3FN0L 4X80H 5EO9B 1JHTA 4RGOH 1YEFL 3WNOA 4ZPTB 2EXWD 3SDCC 3K2UL 3QDGE 2YSSB 3RWHB 5HY9B 3MUJA 4FFZH 2EDOA 5F7DA 3HPJB 1MIEL 4OV5B 2PYED 3BPOC 2Q6WB 3PQYE 5IB5A 4G6AC 2V2WA 3RIFF 1EUUA 2CRIA 4I2XE 3E6FA 2YPLB 1Q0XL 3WSQL 2A73A 4P2OD 1T7WA 3QWOA 5DJXB 5GGVH 1BZ9B 2COQA 3LH2H 1OHQA 3MR9B 1HXMA 5DWUH 5F7EL 1L6ZA 3MJ6A 4LLMB 1OF2A 4GAGL 3ZKXC 2CKNA 3KXFE 5I1HH 1BIHA 3RTQD 2E9BA 5DRZA 2CDEA 4G43A 1DQTA 5TDPA 5C92A 1CBVH 1U8LB 1IGMH 4JRXB 5C0GA 1TVHB 2UWEF 3MV8A 3R4DA 4FQCH 5JUEH 1MRCH 5IHZA 2VC2L 3KWWA 3RDTA 1A0QH 3HG1B 5IB2A 2AXFA 2ENYA 3DX7A 5CJXC 1T3FA 1KFAL 4H0HB 3JSSA 3NCCB 5D9SA 4OLWH 8CGTA 5BVPL 3U46A 3EFDL 4Z7OF 3RWJB 4G42B 4N0YL 1HKLH 3FQXB 5H35A 1J5OH 3BZ4B 3O11B 1FFOB 1XIWA 4NM4H 2VXVH 4JE4B 4HCRL 5CJBA 3WIIL 3FRPA 4I0KA 3D0LA 2DBLH 3GBNH 2YD2A 4LSQL 3K81A 5B39A 2RHEA 5DJ8A 1CF8L 2H2PC 5B8CA 4G3YL 3EJZD 2OM5A 1WCQA 4JFEE 1PD6A 3P4OB 4Z9KB 2R4RL 3B8YA 3Q6FB 1N6UA 5D7JC 2ZUQC 4HWUA 1AJ7L 4N5EC 4GXUN 3V5DA 1FZOB 3C6LC 1UH4A 4JKLA 1U8OB 3HA0A 4I0PA 4YHKL 3LS4H 2FSEB 3OKNB 1I1YA 1Z6JT 1FGVH 1KIQA 3Q2CA 3AS0A 2UZIL 4L3AA 2D7NA 2J7LA 3MLRH 4KKLC 2Z8VC 4R3SA 3VG0L 5HVHC 1U42A 4APQA 5EO1B 2R15A 4JFDD 2X9YA 4WFFD 1KIRA 1S9VB 3G5ZA 3QEUA 2APBA 3MRJA 5EZIH 4Q9QL 3BFOA 4M6NL 2Z4QA 1KCGC 4MVBC 3IU3B 4QNPE 3OWEA 1UT9A 4HK0B 2EDYA 2WNGA 1S7UB 4HQQL 1FFNA 4BZYA 3MRFB 3PGFL 3MUHL 5GGTA 1Z5LB 3KYMA 4RMQA 3ZDXE 2BSRA 3KVQA 3MCG1 1MEXH 1MJJA 3UTSA 4OLVL 5E6YA 2ERJB 1U8MB 3MCKB 5E6ZA 1YEKH 3KPNB 1X5HA 4L3CB 3MNVA 4LPUA 5BRZA 5DYOA 2R2EB 2Q7YB 1VFBA 4U6VH 1BLNB 3X11B 2VABA 4P2RB 4X9GA 4ZFZB 3OR7B 3OKYA 1V7NL 2BVPA 3BP4A 4JVWA 2ZG3A 3HCVB 2NXYB 1JMXA 1D5XB 1N7MH 4M7LT 5K9QG 1EX0A 4WGVB 1ZT4B 4RFOL 2ZP0T 3T65B 2ZKHL 1UM4L 3BW9B 4TNWK 2PXYB 3LVEA 4F58H 1G0XA 4A6YH 5DEFA 2EXYC 2F54D 4N90D 4YXKH 1WF5A 5C0FA 1J87A 4XHJC 1OAKH 3VFTB 1H3GA 3DNKA 4OKVB 1EO8L 1RZGA 1FNEB 4LQ1A 3UAJC 5F96H 2QSCH 4TTGA 2VDLH 1U58A 2AAVA 3ARWA 4Y4FD 3A6BH 1LP9F 1QSEA 4AJ0A 4EBQH 4OQ1A 5C70A 3TO4A 1K8DB 2YK1H 2CDGB 2Q8BH 5MEQB 4NYLA 4JFOB 3UPRB 1FNGA 2JKXA 4OZFG 43CAB 1JF1A 1MAML 5DJ2A 1D6EB 2OMNA 4GMTL 2VO5A 5D5MF 3MROB 5EOCJ 1MLBB 1NUNB 2FIRT 4MDIA 3TN0C 1ZS8A 3MBEA 3MREB 1J0YA 4HUMB 1GXEA 2WANA 4DJMA 4N0CD 3QFJB 5ESQA 3MV9B 1KCUH 5D72H 2R2BA 3VE0B 3TVMB 4V1DE 3SEPA 1R5WA 4XPGL 1JYVA 4EVNB 5HGDB 4WHYH 1A6WH 1OAUH 3P4LA 4G80B 5LJYH 5IG7A 3WJLC 1D5BB 1GGIL 4Z77A 1Q0YH 5MEND 1NQBA 3IRZA 1FAIL 1DEEB 1GJIA 4LNVA 5ESAA 5C0AE 3HE7B 2ZNWA 4OLZH 3IGAB 4ZFGH 4LF3B 2AJVH 4ZPVB 5LAXB 2D7QA 2FIKA 4G8GA 4J1UB 4OIBA 4QTHA 5FFLA 2GJZA 4H1LB 5E2UH 3EW3B 4YPJA 3GI8H 2XG4A 4NIKB 1M7IA 5JLZA 3GSNH 2YPVL 3AROA 4WJ5A 4LPXA 4EOWH 4JLRA 1MFDH 1DR9A 2VXUH 5BO1H 3C6SB 4XVTH 3NBNA 5DRXA 3FMGL 3K1KC 4HZLB 1XF2A 2EICA 2NMSA 4PJHB 2E8ZA 3AB0B 4Z7UE 1IGTB 3TNNA 4WI6A 4HS8L 1SJEB 1DBJL 1MUJB 2GUOA 4QTIL 2XQYK 3BZDA 4D9QD 2DJUA 3MBXH 5EU6B 5KS9E 3ECBA 4JRYD 3CH1B 4DW2H 4MXQD 2GQHA 1J0JA 5SWQA 4LLQB 3D25A 4YPGB 3OKOA 4WCYL 5E9DB 3VFWB 4OV6F 3NFSL 2DQDL 1HHIB 1HHGA 5E8EA 2FBJH 5I9QC 3GSOA 1H5BB 3G08B 5FOBB 5KVEH 1RK0B 4JFPB 3ZDYE 4UT7H 1KG0A 4WO4D 4FQLL 2X4QA 2X4PA 3FQWA 1C5CH 1S7VB 3U0TB 3JV0A 3NIFF 4GSDH 2H9GB 1JWSA 4XNQA 2VLKB 2CMRH 4UILH 4J2XA 4C56B 4XVUD 5IB3B 4QHMA 3VXOB 5CCKL 1EJ6A 5B3JE 3QHFL 4G8IB 1KEGH 4HMDA 4UT9H 4U1SA 1M05B 2PYFA 1Z3GH 2IH3A 2H45A 3GJEA 1A21A 2V6HA 2QHRL 1WFNA 4ERSH 3NIGE 3MLZH 3PG2A 3QUYD 5F9JA 4WUUD 3RNKA 3N9GH 5E0QA 1QBLH 1AO7D 3EOYG 3MLTA 2QTEA 1F6AA 3MRPB 1YEJH 4OZIA 5MEOA 3QI9B 4U6YA 2GJ6B 2R69L 3D18B 1JVKA 3KPRD 5A3IC 4IRSB 3WV0A 4BH7B 4X8JA 5FUZL 3TYGH 2QV2A 4JCMA 4NO2A 1FL5A 3GJFB 2F53B 3V4PH 5JHLH 5DSCA 4X6FB 5T3XL 3WL9B 3KLAA 2JB6B 1U3JA 3KPSD 5JXAH 3RZCC 4RGOL 4JDZA 5EOTB 3IDYB 4GO6B 4HJGB 4E0RB 1ZANL 5EUOB 5A16B 2RGSA 1CGVA 1JK8B 2H3NB 4LIQL 2E7LC 4NOFA 4LCIH 4M1GH 4DKFH 4NKOB 1FORH 3WE6A 4LCWB 3CAFA 3TBWB 5IESL 5T1LB 3DUUA 2YA2A 1NC2D 2HN7A 5FOJA 1LNUB 5E2VL 2NY3B 1QFUH 1INQA 3SDXA 3KYNA 2E6PA 4EUPB 2YUVA 5I1EL 5AG9A 2FO1A 3TFKD 3QG7H 5E95B 4NO3B 5D1ZB 2R1WA 4AEFA 1AFVH 1X7QA 5I66A 1IM9A 3S35H 5A2FA 5DVMA 4QO1A 5F9WC 3I84A 1CD9B 4HIEB 4JHAL 1YECH 3T0AA 2YMXH 1S7QB 5MP6H 3GMRA 3N50A 2IALA 5I1HL 4NT6B 3B9EA 1CL7I 3QIUB 5CHNB 4BFEA 3TPUA 1CBVL 5M95B 3DYMA 3BKJH 2Q20A 3G5XA 5GSVB 3GMLB 4MD4B 1DBBH 4DK6A 4M6AA 4PJXE 3ROOB 4HIIA 5KVDL 1YEGH 1ZGLM 4GUPA 2NY1B 4X6DF 3B9AA 4P57B 4UNUA 4ZYKB 1YMMB 2UVFA 4P46A 3SDCD 3OJ2C 2V9QA 4P48A 3GBLA 3MO1A 3EYFA 4EI6B 5D93B 4KI5F 1T83C 4O5LL 1MCQA 4OCLC 1LO5B 4G6AD 2MQCA 1A4JB 4NM4L 1ES0B 5C09A 5FB8A 2R1XB 4W6WB 4ZUTB 2X4NA 3IJYA 2IQAB 1HOCB 2NXZB 1A7NL 3SGEI 1NJ9A 3P0YH 3INUH 5FYJD 2ZG1A 2FHBA 1TCMA 4LSRH 5FGRA 4BFBD 3PHSA 5D7KD 3ZE1E 4XHQA 2R0LL 2A6DA 2WBKA 3OL2A 4BFIA 3LB6C 4GRMB 1CG9B 4YK4C 2P44B 1FH5H 2NLJA 4YHYB 1FLRH 3RUGB 3MLSH 5T1DH 1N5YH 5F21B 5DD1H 2GITA 2HFTA 2FGWL 4Z8FL 4L5FL 1FGNL 2D4DA 2V7NB 1HILB 3QUZA 1DDHB 1T0NA 1EFXD 3MRLB 3PGCA 5ETUB 3UTZB 1HWGB 4JQVC 1NEZG 4KAQH 4NSKB 3WIHA 4UIKH 4PGDA 3RY5A 2EYTB 3U2SA 4UZGA 2BSTB 1BVLB 1PJ9A 4JO4H 5D2LE 2IMNA 1OPGL 3UO1H 4FMKA 3AFLA 3GIZH 3L95A 5EIIB 3ESVF 5EC2A 2XRAH 5T3XE 2H2PD 4P4KB 1ZE3C 1IL1A 1QG3A 1RZIB 4YEFA 1SEQH 3O6LL 1UZ6F 2GTZB 5D7JD 4RGMC 4N5ED 1I7TA 3IDNA 5GSRA 3C6LD 1FN4A 2MPAL 3LN9A 4UBDC 4YDIL 5TE4L 4LRNH 1KELL 5D7LE 5KAQG 1N8ZA 4PRHA 1B0GA 4HWZA 4NWUL 1HSBA 4M5YL 1JGLH 3ARQA 5GQBA 1KT2A 4ETQA 2FLBT 3CGTA 4KKLD 3K1DA 2X7LA 1N3NB 4IS6B 4LSUH 4PJCE 1LQSR 1MFNA 4R8WH 4XMPL 3P11L 4YX2H 3IDXL 3LKOB 1T0MB 3LHPL 2BNUB 1A02N 1P5VA 3FFCA 1UYWH 1Q9LB 1WV7T 4MHHG 4MVBD 4RGNB 25C8H 3PL6C 1NAMA 3FQUA 1Z9OA 2IFGA 2HJLB 1DBML 5AUMA 4WI9A 1QBMH 2BXZA 5A2JH 4EBQL 2KQMA 4P2QE 1NDMB 4NC1E 2YSSA 4GKNB 2Q8BL 3P9LB 4QXTA 5JNYA 1MCHA 1ACZA 1KTKE 5J11B 2Q7NA 4D0BB 4OV5A 4LLWB 1FBIL 1P2CB 4JCLA 2OI9A 4ODVH 1IZKA 3V8CA 4TNVF 4KDVA 2YXFA 2YD4A 1Q1JH 5FUOL 5T1KB 2QADC 5DJXA 1A9BA 4IJ3B 2HYMA 1NGXB 1NMBH 1BZ9A 2OJEB 1X5IA 4GAJH 3EYOA 2J4WH 1H9VA 1F3RB 3HZMA 5FF6A 4FQ1H 2EXYD 1ZHLA 1NC4B 3PWPD 1ZMYA 4XHJD 3QA3A 3O3BA 4IRJB 3F7RA 3RHWK 3SCMC 1NH6A 5C0JB 4JRXA 4WFEE 4XCYB 3UAJD 2AJYH 1B9ZA 1JPST 2C4FT 4WEBL 4NQED 4PJEF 4ZUSB 3RPKA 4RMRA 4QF1A 1ACYL 2XFXA 5DEZA 5TDNA 1BZ7B 2BVQB 4L8DB 3GI8L 3WXWL 4F80A 2P5WB 4A2LA 1X4ZA 3GSNL 3QDJE 1MOEA 1KB5B 5J1SC 4DTGH 4EOWL 1ZWIB 4MSWB 3B9VA 5BO1L 4YXHH 4PJGF 1FFOA 4XVTL 4L3EE 2MCPL 3FRUA 3N85H 4HIXL 4ZO9A 1MY7A 4IM8A 1RUML 5LWYH 5L2JA 3O6FC 3MTRA 3SE3A 2VIRB 5T3ZH 4L8BA 3QH3A 5EU7C 1GC1C 3KJ4C 2P5EB 1LDSA 4GMSL 1K4DB 4WI5A 3V4UH 1U8OA 2HJKA 3MRRB 4MLIA 4NBZB 3R8QA 4X9BA 1IAOA 4Z7WB 1OM3L 3OKNA 1HHKA 4WU7B 3TEUA 2Y07L 4ZFOB 4QY8A 3SN6N 2ZCHL 2C7UB 1T6VN 4XP4H 2AW2A 4GRLB 2XNAB 4KXZI 4Y2DC 3DVNB 4YHLH 5D8JL 1T5WB 2UWEE 5EO1A 4LFHD 4FQXA 1A6UL 2W9DH 2R9HC 5E8PA 3IDIB 2VLRB 4UT7L 4NN6C 5IBUB 5SV3A 1W72B 3P4MB 5GRJH 4ZAKA 3DSFH 3U7WH 2EH7L 2EO1A 4PJFB 1TQBB 4L4VB 4Z7OE 1ZGLA 3RPIA 3SGDI 3O4LE 4S1QL 5DURD 2R8SH 1MI5D 2DI9A 4JR9H 4HC1L 4PRDA 1XF4B 3JWDL 3HUJA 4OF5A 5T1MA 3KPNA 3NPSC 4ERSL 5I1KL 1JUFB 3N9GL 3C60C 3U7YL 2EE2A 1BX2A 2R2EA 4KRPC 2Q7YA 3ZT7A 3W81A 2BVOA 1G9MH 5ISZA 5J57B 5TE7H 3X11A 3O6ML 4NPYB 2FD6H 4M6OL 4ZFZA 4GBXA 4Y5YB 4PJIB 4EIGB 4WI8A 4N1CA 3DURA 4HGMA 1MHPL 1BD2D 1D5XA 3V4PL 1R5IB 4QHLA 1ZT4A 3T65A 3X17A 4RX4A 3BW9A 1XGTB 3DIFB 3SBWA 4U1HA 1D9KA 3ZKNC 4X6BB 4NP4L 3MODL 1C5BL 2X4RB 1JP5A 4OZHB 4XC3H 4GW5B 2IH1A 1J10A 3B4NA 4MLSA 4I18C 3WLBA 1JZ2A 3UDWC 5F7YC 4LCIL 1FORL 2VLJA 1SY6H 2KZWA 3LKSA 2XXMB 5C9KA 3CFJB 3F58H 1K8DA 1DN0B 2DRUA 5MEQA 5CBEB 1PVHA 1OTUD 1RSFA 4X98B 1PEWA 4FQQB 2BNQD 1SMAA 1L6XA 2Y9RT 2MKWA 1FC1A 4N8VB 1WIPA 2BVUA 3TT1H 4WV1A 1EPFA 3MREA 3TA3B 4ONFH 1FVCB 2YR3A 2UUDH 1S9WB 5A3ID 2IBGA 5EZOL 4DK3A 1FO0H 1U93A 3VE0A 3LKRB 4J7RA 4BJLA 5I2IB 3BRFA 5B21A 4YDKL 3CFBA 3WFEH 3W9DB 4EVNA 3W5MA 4TUJB 1W2KT 2FX9L 4V2BA 1YZZA 4L9LA 3BJ91 3SQOH 3OJVC 2AV7B 3DXAE 1D5BA 1YEGL 5I76A 3PHOB 15C8L 1BZQK 5HDQL 2PW2B 1ZOXA 3RZCD 1JL8A 4IOIA 2B7DT 4KV5F 4XAWL 3IGAA 4I77H 1EO5A 1HHHB 2DQUH 2FDBP 3LPWA 1CFTB 4Z78B 3J7HA 4X83A 3LSOA 2JJUA 3HMWH 4RNRA 1BFVH 1ZT1A 4R90L 1LP9E 5KSBA 1NGWB 1LEKB 5HI3C 5H94A 4TULL 3O3DA 1CFVL 1F4WL 4CRPA 4EN3C 1YN7A 3CFCH 3BQUC 3CLEL 2XN9B 1BJMA 3QXAA 3STZA 4KKCC 3EFFB 3CXHK 5D5ME 2R29H 3BD5A 5C07B 4YHMH 1HH9A 2B1AH 1MPAH 2ADJB 5ICXB 3BP6A 1WFOA 2D4FA 3BAEL 3QUMB 5FCUL 5GHWH 4CAGA 4JFXA 3OPZH 4KH2A 3CH1A 4L1DA 4FP8L 4LPVA 3GSUB 5HHPB 1CDUA 4UTBH 3MLSL 4UU9A 5T1DL 4LLQA 1N5YL 4G8EA 5DVNA 3EGSB 5DD1L 1JMZA 3PWLA 2Y25A 1D5ZA 3FO9B 3U82B 4LCCC 5D2NB 1H0DB 3G6JA 3LEVL 4HUXB 4KGLA 4JJ5B 4EZMA 4W4OA 1PW3A 4PP2A 4HK3J 5EO0B 3GFUA 2A1WH 4UIKL 1RK0A 1OP9A 5BS0A 1CS6A 2X1QA 1XGPA 3U0WH 3U6RB 1XCQB 2WV3A 3PXHA 1WBXB 4S2SB 1FSKB 1WWBX 3PWUB 1CZ8L 2QQKH 3CZFB 1ZLWK 4L8SB 3GIZL 4FN0A 2H9GA 1PY4A 1U8PA 5EUKB 5SWSD 3D0VB 4XNZC 1GCFA 4WHCA 2CXGA 4ENEC 4CU6A 4NQCB 6CGTA 1NCDH 3GHEH 1FG2B 4LRNL 2FJHA 4KTDH 3U30B 2AK4E 3D6GA 4MAYC 4MJ6A 1RZ7H 3LB6D 3Q6GH 3MRPA 5JQHC 4I3SH 4MS8C 1BIIB 1KN2H 2HAZA 3JVGC 3JWOC 2GJ6A 3H9HB 3H9SA 3P4NA 1AXTH 4Z5RB 4WFGE 1N59B 4R8WL 3S3PA 3QDGB 5E24E 4LSVL 1U8KB 4F7MA 2BK8A 3LQAC 1MCPL 1IC4L 2GFBA 3BPCB 5I75B 5JPNB 1YEHH 3PQYB 1KB9J 1U8QB 3RWIB 1YEDA 5L2KE 1J8HD 3G6AB 5FDWB 3BYYA 4QRTA 5FGBA 2FHFA 1MHHB 3HRPA 3N1GC 5EOQH 3TM6A 2YD8A 1PKQE 4HJGA 2VDOH 4NDMB 5EUOA 3LOWA 2F8OA 3MGAA 1JK8A 5I6XB 3NIFE 3QRGH 4YC2C 5DJYB 4U7KA 4NKOA 4P9HL 3UP1A 2PTTB 4IRZL 5BMFH 5BOZG 4NM8L 1LNUA 2BY3A 1NGZB 4JFYA 5ANMA 3S5LB 5I1DA 4UBDD 2AJSL 2FHCA 2DLGA 4LARL 2X42A 4JO3H 2J5LC 2PO6A 2GY5A 2HT4D 5EORH 2ZCLH 4GAJL 1KLFA 3DMMD 4NQSB 2LV4A 3PABB 4MDJA 5CJQH 1N6VA 4GW1B 5HHVH 1MFEH 4FQ1L 4NT6A 1CDHA 3P9MB 5J7CC 4DUVA 3RBSA 12E8L 4KK9C 4OGXL 3UTPD 1BBJB 1MFCH 2AJYL 4PLJC 3PL6D 3I9GL 5T5NF 3HAEH 2VDNL 4OFDA 2A6IA 4JFEB 1B0WA 4POUB 4U6XB 1XGYH 4XAKE 2ORBH 1MWAH 4K55A 5HYJD 3ZZ1A 4EI6A 2R2CA 1AP2B 1YYML 4YXHL 4MYWB 4CNIB 5CZKA 2DKSA 4LGPB 3VRJB 1TQCB 1RZFL 1IAMA 3IXTB 1UG9A 3Q3GB 3TJEH 4KY1L 3TV3L 4YE4L 2Q3AA 4UOW1 3QYCA 3IFOB 4XPBH 4BA8A 1HYRC 1MCLA 5I1CH 3VGAC 4A2MA 4OCWH 1YPZF 1S7XA 3RUGA 1JFQL 2KQNA 3PP4H 3SCMD 3NCBB 2NCMA 3E6HB 3SE9L 5D1QB 1MRFH 4JZNA 5HHNA 4OLYH 1NBYB 3MUY1 3VFUA 4X6DE 4IHOB 3T77A 2F5BH 5TDOB 3GI9H 3BP7B 4I0PC 1U91B 1FPTH 3CFDA 2VXTH 1QUNA 2YC1B 4TN9A 2EYTA 4KI5E 4GG8A 2AXHA 2R8SL 5JHDE 4OD3L 1F3JA 1C08A 2I07B 2V2XB 5CSZA 5J6HB 5AYUH 5C0NC 1MHCB 3H0TB 1BQHA 3ZE2F 2EYSB 2VLLA 5E94B 3IVKA 3FOMA 3O2DL 1NCAH 5HVFB 2BVTA 1F11B 4ODUB 3O6FD 4C54A 3TYFB 4MA7H 2IANA 1G9ML 5D1XA 3N06B 2B2XH 4MNQD 4DWHA 3UMTA 3CPLA 5K9JH 4RRPG 2XXCB 2ARJQ 4K7PY 1SJVA 3LY6A 4G9FE 4YDJB 2D31B 2WP3O 3VWKB 4Y2DD 1NGQH 4LEXH 3K4DA 3D3VD 2R9HD 4ONGH 1T0MA 4JHBA 4N9GB 3WKMH 1HH6A 1Q9LA 3L1OL 1X6LA 1A9EB 4TTDC 1EMTL 1P7KB 3B8SA 1KJ2L 3DJ9A 4QHUB 4W70A 2HVKB 4K7FB 2UZYB 5J13B 1GAFH 3V6OA 1ZEAH 1J05B 3F58L 4ZUVA 1B6DA 4HAGA 3IKCA 5LXGH 4V1DB 2MFNA 1XGQA 2VZVA 1BGXH 1MVUA 1P2CA 4X6CF 3C60D 4KRPD 4JQIL 5L9DH 3L3JA 3MGTB 1UZ6E 2OP4H 3VCLB 1DLHB 4LRIC 4FTVA 5C0BD 1NGYB 3FB7B 3M17B 4ONFL 5T1KA 1EEYB 4DOHE 4K7PH 3TPKA 1PLGH 3G04B 3ARBC 3PDOB 2BXYA 3UZQA 3KS0H 1ORSA 2AS5M 4LGSB 3K8MA 1YA5A 5DK0B 5IFJB 3ZKND 5T3ZE 1FRGL 2W60B 4ONHB 4TSAL 4K9EH 4PJBF 5TF1L 1G6VK 3RNQA 3KPQA 1CCZA 2KH2B 4XCYA 4LU5L 2YKLH 2H2SC 4MMXC 3JV6B 4Y5VA 4JY4B 2O5XH 4HEPG 1OAZH 1CK0H 4U1LA 1XCTB 5T33H 3FN9A 4KQ3L 2NY0B 3OKKB 1HK6A 3JV4B 1MVFA 3GM8A 5KS9B 1NCCL 3LAFA 1ZWIA 3V9FA 4NNPH 1DQQA 3OKEB 1S5IL 3WYRA 1JE6A 3H6JA 3IJHB 4AEIL 3VXRA 5DDHA 4H5SB 3I85A 2WBJA 4FABL 4L8CA 3IDGB 2LABA 4FQIH 5C08E 1X5ZA 2I27N 4D0CA 4CN6A 5IKCA 3WXVL 1OAXL 1K4DA 1PDKA 1BAFH 1VADB 1QLFB 4Z7WA 3DO7B 32C2B 1R3LB 2P47B 4KROC 2Z92A 4YNYB 3O8XB 1TZIA 2C7UA 2LQRA 1R0AL 2HRPH 2X4SA 5GS0H 4O4YL 4JB9H 2ED7A 3NVQA 4HC1A 3WHXA 3GSVB 1BFTA 5DJDB 1P4BH 3BIKA 3QG6A 3CVHB 3T3MF 2A1WL 1CD0A 2QR0B 4PJEE 4MQTB 3MXVL 1IC7H 2P8MB 1X5JA 5HI3D 3UTTE 1U92A 4HHAB 1NFDA 4PJFA 5IVXF 3GIVA 2YBRA 2BERA 5TPWH 4L4VA 3LN5B 4EN3D 3BQUD 2GT9A 4GS7C 2AJ3B 4KKCD 4PJGE 3IXAA 1I8MA 5IB4B 4JRYE 5I73C 3NAAH 3RY6C 4DEPB 2XWJA 2X09A 1FZMA 3CMGA 3ZHKA 1JUFA 1CIUA 3H9YA 3HNVH 5HPMB 4PB9H 4MWFA 3MUGA 1MH5A 4R4NC 3AS2A 5HDBF 5LG1A 2OTUB 3OJMB 3OKDA 5D6DA 1TVBB 2NX5D 4KMQA 5FYJL 3BN3B 2EKSB 1UH2A 2L4OA 4PRIA 3RWGB 1NMAH 3D1MC 4X6BA 4PBXA 3G5YA 3QUXB 5MERA 5LQBH 4LLVA 4TSBH 4S1RL 3T4YB 4MNHB 3Q5TA 1ZHNB 1VERA 2VDOL 4GW5A 4IBLT 5EPMA 4RDQF 4B53A 1JHKH 1NANI 2FB4H 4XP9H 5DJCA 2P8LA 4N1EA 1YEEH 1MCWM 4X4YB 3T0EE 1E6JL 3Q1SH 3CFJA 2ZOKA 3P0VH 3PV6B 3KPMB 4ENED 3S9DB 3GKWL 2OR8A 4GG6F 3QNYB 1EERB 3DO3A 2VZOA 1URLA 3RGVB 5L88L 5DUPH 4OD1L 4MAYD 1VFMA 1G6RB 2AXGB 4XXCA 2ZCLL 2MWCA 3LKQB 3NN8A 3BPLC 1AGEB 1OGAE 1QPXA 4MS8D 4PJXB 1NCUA 2I5YH 4JM2F 5H37H 3MLVL 1FVCA 1ZVSA 2C3WA 3BVNA 4GXVL 3TBTB 2N1KA 5CJQL 3DHJA 3KPSE 5HHVL 1OP5H 5F1IA 3WUWA 4PGBA 3W9DA 4TUJA 1CE6A 4TSCH 1RUPL 2FNBA 3EDKA 2AV7A 1I3GH 2MMXA 1MCOH 1I9JH 3ZKMD 3FO1B 2JIXD 3VG9C 3QDME 1A6AA 4RCAA 1XGYL 4XGZB 2N4IA 3OMZA 4Z78A 1B0RA 2PYEA 2BMKA 1LEKA 3ABZA 3VXSD 3UZEA 5HYQA 1MREH 4X7FC 3KGRA 1R3IH 5E2JA 1E0OB 5MEPA 4BKLA 1ZGLP 2XN9A 4WI7A 3X13A 3D39E 4KZDH 3C09B 3VI3F 2IADA 3TJEL 1HNFA 1VSCA 5CAYB 1UC6A 1R24A 2XZCH 4HUWB 1ZA6A 2JLLA 3OXSB 4IIQC 3KPOA 5B4MC 4O51A 5ICXA 1NUGA 5I1CL 1T2QH 5JR1L 1P7HL 3RTQA 5F6IB 4OCWL 5KSAC 4PRBA 2BOBB 1T66C 4PRNA 3GSUA 4PJ9C 3LEYL 4TUOA 4S0TD 3S4SB 5ABDE 5EC1A 4KK9D 2F8XC 1KTDB 5D2LB 5IBTL 4PLJD 1IKFL 2OR9L 3HMXL 4X9FA 1XZ0A 5HJ3A 1ONQB 4MXWH 3AM8C 4HJJH 5IMLB 4EXKA 5DEGB 5HHMD 4OLYL 4O02L 2Y1VA 4Q7DA 3GM0A 4KV5E 4HUXA 4ZO7A 4JJ5A 3PWVB 4Y5XC 4M48L 5I16B 4Y1AD 5JOPD 1RU9H 3SY0B 3FHQA 3VXNB 5D7LB 4YBHA 3DX8B 1WBXA 2F8VA 3CZFA 4FXGB 3CU1A 4XCNB 4Z7QF 2CKBL 1T5XB 2RCSH 3UPCA 3EOBA 5D7KE 4M7JH 5HGAA 3D0VA 1WBYB 3U0PA 4JFQA 4PJCB 3IS1X 4MA7L 5FM8A 3MFFB 3VFOB 5CIPH 1FG2A 5BV7H 1HI6A 1ZHBA 1AI1H 4H1LG 5C0RL 4MXVE 1BIIA 3P3YA 3O41B 4PRAA 5IGXH 1XF5A 5IV2B 2HFGH 3H9HA 4XCFH 5I8KH 5HTSA 2DQIL 1G9NC 3OXRA 4P2QB 4LEXL 1YNLH 1LEGA 4JFDA 1QD0A 1U8KA 4ONGL 3NZHL 5BCAA 3MJ9H 2D7MA 2X5PA 4CW1A 5EH1A 3G6AA 3T09A 4JREB 5D4QA 5EOCL 3EBAA 4N5UA 3S36L 1IQWH 3TJHC 1FHGA 1GAFL 5IMMB 1CFSB 2LFGA 3QUKA 4QRRD 1MLCB 4U0RC 5C0ND 2CXKA 3GMOB 1IM3A 1M1SA 5MHSD 4JJHA 3CDFA 2IEPA 4LVHB 3T2PA 5L9DL 3ILPA 1UZ8A 3BKCL 1C12B 1DQJA 3FONB 3FFDA 5F72S 2AV1B 1NGZA 1RK1B 3QJFA 5HHOD 5HD8C 2B1HL 1BWMA 2ED9A 43C9B 4WEMB 4K7PL 3QCVL 4FQHB 4WW2A 2ICEB 2NZIA 4YHOL 2MTPA 1F8TL 2L7UA 3R06B 4HWBL 4G7YH 2A9NL 1J1PL 2R0ZH 4AEHH 1PG7H 5EBWB 1R3HA 5F9OH 4OF3A 1AGBB 1IAIL 5E1AB 3QULA 4RQQB 1IKNA 3MX0A 2OI9C 2F54A 5K9OB 4F8TA 1YUHA 3AREB 1V8HA 3QDJB 2JB5H 2BC4B 1CGXA 1EBAA 3TNMB 4NHCL 1EAPA 5TGBB 4P9ML 4TTDD 1FYTD 1KENH 1JZ4A 1QLEH 3LZFL 4Y4FA 1BOGA 2NR6C 5J1AA 5J4MA 5EBMA 5T33L 3BEVA 2MJWA 2EDNA 3VXME 4L4TA 2IMMA 2IAMB 3U4EB 3S37L 3D9AH 2EEAA 5HGHA 3ARFB 3FTGA 5CEZD 2DWEB 3K8KA 5CJ8A 5FV2A 4EDXA 1NKOA 1OD9A 4FQIL 3IXTA 2YRPA 4AH2B 5I1JH 4OQTL 4N0CA 3P30H 4F2MB 2UWEB 1QSED 1TZHA 1HDMB 3ARBD 2QQNH 1KJMA 2CIKB 3PWPE 4QXGH 4OTXH 2ZJSL 5J6GB 3MRGA 5ILTL 1BF8A 5IROA 4JHWH 4NHUA 4OB5H 7FABL 4UIMB 1D3CA 3VJ6B 1IGFH 4I13B 2DI7A 3O4LB 4O2FB 4F37F 4JQXA 4EUPG 4H26A 4A6YB 3E6HA 1AQDA 4ZNCD 2ZUTA 4OBRA 4KUZL 4NZTL 1Q72H 3O2DA 1PFCA 4HH9A 4KHXH 1N0LA 3F8UB 1IC7L 2YD7A 1IFHH 1Z9MA 1RURL 2ZWLT 4O58H 1I9EA 2SEBB 1KLGA 3J8F7 4UB0L 2Q8AH 2E7BA 4U3CA 3NCFB 2DYPD 1WISA 2WIMA 5E7FA 2I07A 5C0CE 1N0XH 4OAWA 2CK2A 2BP3A 1T20B 5E94A 2FR4B 3ME0A 3GNMH 3RP1A 2FEEL 3O2VH 4OJFH 1Y6NR 4PB9L 2FJGB 5DI8A 5KG9A 4R0LA 1WWAX 5KANI 1EHLH 4EJ1C 3QQ9C 3V5HB 1ORQA 4KROD 4ZD3H 1KJ2A 3KLDA 4HKXB 1RUAH 4TRPL 3BEWB 1VEMA 1YPZE 4FXKB 3S35X 1XF3A 3MRNB 3BXNB 3S88H 4HX1B 4M7LH 2ERJC 4OLUL 1KV3A 4DGIL 1V7MH 1NMAL 3WFHA 5IW6A 1YNTB 5LBSL 3VXTB 5GRYA 5LQBL 4TSBL 1GHFL 1UADC 1VACA 3VXUD 4WO4A 1CLYL 4OBSA 4OFIA 5CS7A 2VLME 1B4JL 5E8OA 1JHKL 2VH5L 4YR6A 1RZ8B 3TBVB 3U9PH 5IEHA 1H3PL 4ORGA 4LBEA 2NXYC 1L0XA 4NQDD 1L4IA 3GSNB 3Q1SL 5ACZA 3ARZA 2QSQA 3UC0H 3ZE2E 3WNKA 4YHZL 3MLXL 5CMAA 1C7SA 1RULH 3QUYA 4WUUA 5ICZB 1AO7A 3MGTA 5FIEA 4HT1H 2BNRD 1BD2E 3DXAB 1AQKH 1FZJB 3M17A 3S97C 1OW0A 5E2WH 2XKUA 4R4ND 3KPRA 1DFBH 1W0WB 1DBAL 4F7PB 1KCKA 3G04A 1FYHB 1LK2B 4NZDA 3VXPA 1AKJB 1WT5C 5F1OB 3ZYIA 1LP9B 2OXHA 5B38G 4NKDA 3G5VA 3QO1A 2Z93A 3UYPA 2YN5A 2G75A 3DX9B 2VDKL 4JDTL 5ICYB 5DXWA 5LVEA 1I3GL 2IWGA 1GYAA 4QCIA 2BFVH 1MCOL 1IBGL 2IJ0C 4OZ4A 1ZLSH 4GLRI 4O2EA 3FT2A 3HS0B 2YUXA 5D5MB 4RAHA 4K3DL 1ZXQA 2HVJB 3V0AC 3T08A 2G2RB 4M8VA 3RX8A 4HIJA 1XCTA 3TVMC 3THML 4DAGL 1JYXA 1X5FA 1NC2A 1MREL 1RZKC 2OL3H 1A6ZA 5EBLB 1DQDH 1R3IL 3V0VA 3BWAA 2YN3A 4AM0B 3FB8A 3LD8B 1U8NA 4OZGA 4HKJA 4WW1B 3TFKA 2EIZB 4X6CE 4HS3B 4PDCE 1HCFX 5CGYC 3HE7C 4H5SA 2YXMA 5TFSL 1JRHH 2D03H 3WD5H 1F6FB 4TNVK 1JZ7A 1C16B 3G6DL 4WNQB 2ICWB 4AQOA 2W91A 1EJOL 2EDKA 1T2QL 1MJ7L 4R4FL 3NA9H 5E2TH 3BD3A 4JFHE 3T8XA 1OB1B 1EXUA 2OJZH 1VADA 1QLFA 1S5HB 4XPTL 3DO7A 5E00A 3C5JB 5J06A 3GK8H 3O8XA 2I26N 4HPOH 1ZLVH 5DD5H 1KC5L 4HV8A 2EDHA 4NNYA 1IM9D 4PJBE 2FX8L 3AB0C 3GSVA 5DQJA 1MCFA 4UQ2A 1N4XL 4DN3H 3CVHA 5I1AA 2VRAA 4D0DB 1V05A 1UVQA 3D2UB 4S1SH 2P8MA 4Z95L 2AK4B 4RA3A 4DZBB 4E5XA 1A3LH 4PY8I 1IAIM 3BDYH 5E7BA 4PLKC 2ZNXA 1Z9LA 5HSFA 2IG2H 5FA4B 2R23A 5IW1B 3FOLA 3T2NL 2G60L 4DQOL 1JI2A 1JNNH 4U6HB 5FKAB 2XQYG 1G7JB 2B0SL 1H5BC 3EHBC 5B4MD 5L2KB 5DS8B 3EOAA 4Y19D 1UCBH 5KSAD 5C09D 1T66D 3C8HA 2HFGL 3IETB 4HKBA 4PJ9D 1T1XB 3KHQA 1PKQB 5I1LB 4ZQKB 4Y8DC 1WFTA 3NGBB 5E5MA 3SE8L 1TVBA 2EC8A 4ZS7H 1P1ZA 5CJXA 2EO9A 4AZ8A 1Q9OB 4OCRH 4M8QA 1EFXA 1VCAA 1BBDH 3T3ME 4K3JH 4PJ5D 2Q86B 3QUXA 1HQ4B 1JWMA 1F02I 1J0HA 3QI9C 5IVXE 1CGSH 2WSKA 4NQXB 4M93B 1CD1B 4PREB 1ULVA 1WCBB 4CADB 4IRSC 4LLUA 3E2HA 4X4YA 3IDJB 1NSNL 4ODXA 3PV6A 2YD3A 1QZ1A 4N5EA 1IZJA 1W0YT 4ZODA 3T2QA 3C6LA 3NABL 5C6PB 4K3EL 5FGBC 4UV7H 4XRCA 5IBUG 1W8OA 2A74B 4Z76A 2CGRH 5DHXB 3IDYC 3DRTB 4PIRF 3F7PC 1L7IL 1J8HE 3RVUC 4AEHL 4HGWB 1I7ZB 2M8XA 5HDBE 5F1SA 4EEEA 1H8NA 4JY5L 2ZSWB 1GC1L 4Q2ZB 3PP3K 3QIWB 4GKSB 2HT2C 2KKQA 5EZJB 3MQIA 5B3NA 3MA7B 4D9RE 2NY3C 4MVBA 3KJ6H 1P6AB 1ED3A 1MCCA 4PV8A 5C71A 2F5AH 4Q58C 1J88A 1A1OB 5D1ZC 4N9OB 4ALAL 3TJHD 1OGTB 4FFWC 2BOCB 4MB5A 3CFEB 4ZSOE 4XGZA 1RHHA 1CDGA 1BJ1H 3EDJA 3C8KB 1MCKA 3MOQA 4LEOB 1BFOA 4PGCB 2ADFL 3FFCD 1BFSA 3QIUC 2WZPD 4JAMA 1D5MB 3C9NB 4YBLB 4GG6E 5HD8D 2BSSB 4GQ9H 5I1JL 1FL3A 3HMXA 2GYSA 3H9ZA 2AEPL 2NY1C 1E4KC 2I60H 1WLHA 4UQ3A 2CUMA 1UJ3B 4OTXL 4YXLH 4CMHB 3EZ8A 3UTPE 4X6DB 4E41E 4JFFE 3FQNB 2WINA 4HUUA 5D93C 2QLVB 4ODHH 2BHUA 2EDRA 3OGOE 3IDMA 3L3KA 1AGDB 1RZJC 2BOBA 1UB5B 3W0WE 1G7QB 3S4SA 4OLXH 1NFIA 5JHDB 2YPLD 4HWEH 3S7GA 4TVPH 3HR5B 2VXQH 2ZSVA 3BHBB 2NXZC 4NQEA 4LSSH 5IMLA 2NR6D 5DEGA 1QFWH 5GGTH 4N8VG 1IFHL 1U41A 3SKMA 5HHQB 1CDYA 3O6KH 4O58L 2D2OA 4JY6A 5FUCC 1CL7H 5I8OH 3ULSA 4ZOEA 3RVWC 2KL6A 4YHYC 3DRQB 4FXGA 4DKEL 1TJIH 4G9FB 5GZOC 5JW4M 4JRXD 4QRSB 5AD0B 4CVWA 1QTYT 2FO4A 1EHAA 3WIFB 2OZ4H 5DFWH 3HG1D 4OJFL 3VI3E 2WP3T 4R7DA 2EECA 3EYUH 3QEQA 4QLRA 5D6CB 1T04B 4XP5H 5I18L 1UWEL 1JNLH 3CLFH 4UINL 4I1NB 4XCEA 3W2DH 3OJDB 4ZD3L 2Y5EA 5KANG 1EH9A 1SYSA 3WJLA 2CLZB 5CEZH 4HUKB 4ETYA 3P40A 3S88L 1MFAL 1H15B 4ZUUB 4UUJA 3WMSA 4P4KC 4HGKC 4XNYL 3RWDA 2OK0H 1T03H 4M4RA 4Y0GA 1MY5A 2QEJA 3MRBB 3CVIH 1LO3H 4M61A 1MQKL 1MQ8A 1NCBL 1B2WH 2G5BB 5EU5B 1IGJB 1OSZB 3F7YA 1YN6B 2NY6C 4P23B 2VDPL 4EQ2A 3T0XA 2UV3A 4J6RL 3EKCA 1ZSDA 2P24A 3PDDA 4U33A 3X3GH 4DOHB 4HUVA 3GSRB 1FVEB 1H8OA 3CK0H 1MI5A 3VD7A 1CT8B 3S34H 1ZHKB 4XMKL 2DQFB 3GMOA 4Z0XB 3I6LE 4MNQE 4RMTA 2W9LA 5DLML 4Z7QE 5DJ6B 4HWBA 1J86A 4PJ7A 2X9WA 3RWFA 2CJUH 1MNUL 1QRNE 3O3AA 4UV4H 1WZMA 1LK3H 1KIPB 5IBLC 4MD5B 4ODSH 1T1WA 3KYOB 1C12A 3FONA 5DJ0B 1QVOB 2AV1A 1AQKL 4RMUA 2XQBL 4RGNC 43C9A 3QQ9D 3EYQC 3TBYA 4FQHA 4PJDA 4XP6H 3F12A 5A2LH 2ICEA 1X5YA 3MACH 3GMPB 3AC0A 5JMOC 2DQJH 3V6OC 4LP4A 4KUCD 4OZIF 1E4WH 2RBLA 4ZUWA 5EBWA 4F3FB 3EDEA 5J11C 2YRLA 2DTSA 4PR5B 1DBKH 5E1AA 3T1FA 5K9OA 4J4PC 4PTTB 2BC4A 4AT6B 1JV5A 2GEEA 1ZLSL 3JTTB 5I71B 1NBVH 3U4AA 3LV3A 5TGBA 4P2RD 1LD9A 3NFNA 4IJ3C 1QKZL 1JPSH 3ROLA 1CIDA 4X4ZA 1AIFA 1S9KC 4OQTA 5IVZA 1VKXB 5JDSA 2NXYD 5CJOH 5C08B 5M94B 5IFHL 3UBXB 3MFGB 5C0BE 1DQDL 1PG7W 5F8RC 4RX4D 5L7XH 4MD0B 5KJRH 2AERT 5EN2B 2D7OA 2H32A 3NH7L 2BNQA 1A1MA 2V9RA 4M7KL 4Y16B 4IRJC 5C0IB 5JOFB 4DGVL 3NCYS 1JGUH 1K3ZA 1CE1L 1WWWX 5TQ2H 5JW3L 1FG9C 3SDXF 4TUKL 3R0MA 2R39A 3KPLB 4GW4A 2YEZA 2DDQH 2V5TA 3NA9L 2WM0A 4PJEB 2MNUA 2VE6A 4Y7MA 2DLFH 2XKNA 1K2DA 3H7BA 1JWUB 2C1OB 3UTTB 1RUKH 3RAJL 3OKLB 1CXFA 2FX7H 3GK8L 4QOKE 4DZ8B 4BZ1L 4PV9B 4FZEL 4O2FA 5IT2H 1ADQL 3RZCA 3S5LG 3JWOL 4XBPA 3PWNA 4PJGB 3HC4H 1KUMA 5F70A 4YQXL 5IF0A 4WDIB 5DQDL 4M1CC 3QFJD 2E7LA 5EWIL 5LGJA 3LQAL 5TF0A 1Q94A 4AENA 1W0VB 3L3OB 4KTEL 3TVMD 5CZVH 1X3DA 1T4KB 4OFYD 3BE1L 1T2XA 2ADGA 4BM7A 2ARWA 1HSAA 2J6EA 2C4FU 1KLUB 4K94H 3WFCH 2IFFH 4FQ2L 2Y5TA 4IMLB 4ELKB 1YC7A 3B9DA 1FCGA 3I2CH 3IFLH 5IOPB 1T7YA 5F71A 4NGHL 5H2BA 4GRLC 1RPQA 3G9VA 3BH9A 5CGYD 2ZOLB 3HE7D 1JZ6A 1JNNL 2CDFB 3IDUA 3JWDC 3UJIH 4WFHE 5D7IB 2ESVB 4YFEA 3C5ZB 1DUYA 2C1PB 3VFMA 1NFKA 1YDPB 1VFUA 4LOUC 4DKAA 4K8RC 1WBZB 4N0FA 1G7LB 2JJTC 3CDGB 5ID0B 1FO0B 5C6WH 1TQBC 2RQ8A 3I75B 2J8UA 3HRZB 3I6KB 4HS6B 4HKXA 1Y18B 4Y89A 5BW7C 2G5RA 4FXLA 4M1DH 1HHJB 3BEWA 4R9HA 1XFPA 4WEUD 4AIOA 1I9IL 1A14H 1F42A 3T0EB 4OCYL 2J12B 3KLSA 3VRLF 2AJUL 2XWBB 1BBDL 5FGCE 1A6VH 4L9DA 1S7TA 1T83A 1T22B 2H6PB 1NBQA 1D5IH 1G7IB 3JTSA 3F7VB 5EU6D 3T0VA 3JZ7A 2L7JA 4Y5YC 1A5FL 1OGAB 4PLKD 3TBVA 2EH8H 5FKPA 5SWSA 4NNXB 3KR3L 4HIHA 5E9DD 4KXZH 1AGFA 5AZ2L 5HHXL 3QIBB 2DQTL 3GMMB 4I4WB 5FYLH 1BPVA 3I3BA 1A2YB 4UV7L 3EHBD 3N1FC 4K3GA 5L6YH 2AK1L 4P59L 5KVFH 3OAUH 2VB5A 5EFIA 3ZHDA 3QDMB 3MYJA 1W0WA 4RAUB 1A7QL 4GH7B 2VLKD 1QNZH 3V5KA 4BUGA 1LK2A 4C56D 1SBBA 5F89A 1QHOA 3QEGL 5KOVC 1M6OB 5C9JB 4JZJB 4JKMA 2ITCB 1KTLB 5DJZB 3MLYL 4NJAL 5F7MC 4JQVA 2R0KH 5BJTB 5L8JB 3LN4B 5T5FH 2YRZA 5JPMB 5GJSL 5IB1A 4OIIH 3ISWA 3T4AB 3D39B 4J3VA 1NL0L 2B4CH 3QI9D 3TA3C 2HG5B 3T0BA 2GJ6D 2WWKO 3W39A 1F58L 4IRSD 2VISA 2C3XA 4MCYA 4H0GA 3RWEB 3VXQB 3NZ8A 2EEDA 4I5BB 4OZFA 2F53D 5JXEC 3SJVA 4AIXA 4WHDA 4NZRL 3FB5B 1NDGB 3KDMB 3RL1B 2DQGH 2ICES 2X4OA 4HS3A 4XXDA 3RI5F 2Y7QA 1QRKA 4QYOB 4ELMF 3UJJH 1QSFA 1IGIH 3DMMA 1N6QH 3DX6B 3RVUD 3IFNH 5DHYB 2R56H 1C16A 1WZKA 4R6UA 4XC1H 4LNRB 4LCWD 2A77H 1WQVT 2JCCA 3GSWA 3QNZB 4WUKH 5T1LD 2HT2D 1I7RB 2NY3D 3L7EB 1SJHB 2VXQL 3WIHH 1LE9B 1T21B 3PL6A 1AD9A 3QJHB 5D1ZD 5GGTL 3MSPA 3FAXA 1G7PA 2C3HA 4XI5C 3VXSE 4FFWD 2EEBA 1QA9A 1G9NH 1JGVL 1HINH 1F4YH 3SGKC 3TO2A 5HYJA 5ALCL 3DTXA 4KJQC 4K23H 2MCG1 5L8KB 3QIUD 3HB3C 4HBCL 1KOAA 2A9MH 5I8EB 2F19L 4QXWA 4JN2B 1SM3H 5KSVA 4PG9B 4WWKB 3I3DA 4UTAH 2APFA 3V52H 3FN0H 4OFPA 2NY1D 5JO5B 5IW1A 5D2NC 2XTLA 1WZLA 1YMMD 2O5ZL 4KQ4L 4O2CB 3K2UH 2UVEA 4F7EB 2NNAB 4HF5L 5IQ7H 3WS3B 1AE6H 3W2DL 1JNHA 3O45B 5EG6C 1MIEH 1SMOA 3TCLB 4M43L 2WUCL 5ESVB 4YGVA 4JZOB 1FSKC 2FYYB 5CEZL 3IETA 3SCMA 2Q87A 1RAMA 4L8SC 5A40E 4PGEB 1KPVB 5JOPE 1Q0XH 3WSQH 2NXZD 2OK0L 4K7PX 3CVIL 4U1MB 3UEZA 3IAGC 1Q9OA 4PJ8B 3F7QA 3HAEB 2CO7B 1J11A 5F7EH 1XH3A 4XB7A 1EA9C 4NC0B 3MV8E 3U30C 2M26A 3PE9A 4GAGH 1HQ4A 1MWAB 2C3VB 3FAWA 3RVWD 2DQCL 5KTEL 1S7WB 4LKXA 3VGFA 3OSKA 5GZOD 4J3WA 1WCBA 1T0PB 3VI4F 2VC2H 3O6FA 4KGJA 4ODSL 2O5YH 1DSFH 5I75C 4E42B 1KFAH 1AXSB 5BZWB 3VWJB 2I9TA 3HUJF 3JUYA 5BVPH 3STLA 3EFDH 4N0UA 4N0YH 4YO0B 4XP6L 3S37X 2A74A 3H3BC 4Y4KB 4LDEB 3L5WB 2YWYA 3OX8B 4ISVB 4ZOCA 4HCRH 3WIIH 3MGOA 4Y2DA 4NUJB 5I6XC 4LSQH 3B3IB 3T1WA 4P4KD 3D3VA 3VXMB 1PSKL 4G3YH 2H41A 3V7AE 3U79A 2R4RH 4GKSA 2LTQB 3WFDL 1U3HB 1AJ7H 4CJ1A 3MA7A 1GH7A 1I3RB 3C5SA 4KPHL 4PY8J 4YAQA 2NY6D 4PTUB 4YHKH 3EO0B 1I8IB 5INDB 1WVZA 3MJ7B 4UDTB 5IJKA 1RIVL 1SQ2N 2UZIH 5IMOA 2QSTA 3SGJA 3CFEA 2YUZA 4CDHA 1M4KA 3MMEA 4G6FB 3PWPB 1X5GA 4KFZC 4XMLL 4PRPA 4TVPE 3L6FA 3C8KA 1H3WM 1LDPH 5IBLD 1IKNC 1RJZB 5K33A 4PGZA 5I17B 4Q9QH 4M6NH 1A3RL 3UTSE 1CLZL 1M71B 4KJWC 4RGND 2E7CA 2RB8A 4UNVA 5DQ9A 3EYQD 5IMKB 3WEXA 4HQQH 5BQ7A 3QEHA 4OD2B 5FHBL 2X70A 3PGFH 5BRZE 1UACH 5HYIA 2WLZA 4DFIA 1KJ3H 3OAZH 4X6DA 4OLVH 3WBDA 1RUKL 4MA1B 5FA3B 3RKDC 3X3FH 1UXSB 3TN0B 4YDLB 1TMCB 1DVFB 1U8JB 5IT2L 1UB5A 4J4PD 4U2YA 3UTQA 3BH8B 3VA6A 2XZZA 1E27A 4FTVD 2W0FB 3VFRB 5C0CB 2DTML 1TQCC 3WN5B 1HQRB 1PGRB 5T1KD 1UM5L 3K8LA 4I18A 3QZWB 1K6QH 3QCTL 3UDWA 1DLFL 5JA9A 1X5XA 3ZSSA 5J9PA 1V7NH 5HHQA 4HWNA 1IQDA 5CEZE 5DMKA 1YEIH 3ZTJH 2AVGA 5IROC 4NQVA 4RFOH 2ZKHH 4I9WD 1UM4H 3FQTA 2IFFL 2D0GA 3I2CL 1DUZB 5C2BL 1QSEE 3W9EB 5KSBF 3DRQA 5HVWA 1NC4D 1A1NA 4HMCA 4IRJD 4G9FA 1QO3B 1YPZB 1HIML 1EO8H 5GS2D 3AAZA 5D1QC 4KZEL 1JGEB 1T6WA 1HEZA 5TQ0H 3VA2C 3HNTH 4MCZA 1V3LA 4YHNA 2P5WD 2DJSA 2E5EA 4IMKA 2VL4A 2CLZA 4YDVA 4GMTH 1Q9WA 4ZUUA 3WO3B 1S7SA 1JPTL 1XR8B 5KN5B 4KRNA 1NEZA 3MRBA 4M1CD 2CIIA 1J0ZA 2ICWI 2P5ED 5EU5A 3OG4B 3G6JF 3PNWA 3FT4A 2DL2A 4XPGH 5DTFB 2LAAA 4EN3A 5FYKD 5E8NB 3BQUA 3F6LA 3QXDA 3EJJX 4G8GE 1CXLA 3VGHA 3GHBL 4M5ZL 3VFSB 3VWKC 4GRLD 1FAIH 3QSKB 2GK0B 5FXCH 1CLOH 4X4XA 1KIPA 2BVEA 3MRQA 4JPVL 2OR7A 4HH8A 2VLRD 2VNCA 1LO0H 2BCKB 3KYOA 3OAUL 4DCQB 4LOUD 2VSDA 1G7HA 4K8RD 4KVCL 4JHZA 4YIQB 3BO8B 4L4VD 1ZA3A 5J12B 4F33A 4KRLB 3RQ3A 1VGKB 2YPVH 3ZLQC 5J13C 2W59A 4R26L 2NX5A 4LCCA 1GGCH 4XP1L 3HPLB 3FMGH 3SPVB 2H8PB 4HS8H 2R0KL 1T7XA 5CZXC 4QTIH 5GIRB 1TCRB 4CN1A 2EYRA 1FVDA 4LAQL 4X6CB 3M1BB 3CXHJ 3JUZA 5I74B 3L3GA 4U4BA 5C0EB 4XX1E 5C08A 4WCYH 1XR9A 3KYKL 2DQDH 1IEAA 2DM2A 5IP4A 5EUOF 2AJZA 5E99L 1UQSA 2ZUSA 1T1ZA 2A83A 2NY5C 4MAYA 5HI4C 2YD9A 2XOTA 5JOFA 3UJJL 4EI5A 3U9UA 5F7FA 2A6KB 4FQLH 4XPFL 3NA4A 3JVGA 1N6QL 4PJBB 2R56L 1I7UB 2XTJB 3MRHA 4XC1L 2X4TA 1QR4A 4Q6IB 3L3HB 3NFPA 4RZCB 4WUKL 2NY0C 3QHFH 2D0HA 4OZIE 1IEBA 1JWUA 1ND0B 1JCKA 2PCPB 4GT7A 1SYVB 3JTCA 2QHRH 3TH4T 2QBWA 4DZ8A 1TTUA 2X44D 4LSTL 5ELIA 3MRMB 3CC5B 5E5RB 4R2GB 1A4KB 3PV7A 5A2IH 1GSMA 3BZEB 2Z31B 1G9NL 3TA3D 1TJGL 1QACA 2R69H 4WDIA 3GSQB 3QDAA 1NLBL 1MHEA 4P4RB 5FUZH 4F15B 4I48B 5JXED 1NCWL 1T4KA 3MA9L 4G8FB 5JW4R 1BMGA 1SY6A 2AEQL 1JPFA 3TIDB 3VFVB 5LCVL 5FO8A 4KJPC 2ATKA 3ARDB 3O8XC 4MJ5A 4EDWH 3EYVA 4UTAL 4ZNEA 5CUSL 3PWJB 4HFWB 5GRVK 1ZANH 1S9YB 5IQ7L 1E28B 3SDXE 1AE6L 2Y6SC 5D7IA 2ESVA 3C5ZA 2BX5A 4LIQH 3KPPA 2C1PA 1YDPA 5IESH 5FV1L 3GJFK 5K9KB 3VGEA 5E2VH 3I75A 5I1EH 5FYLE 5IVXB 1NAML 2XN9D 1AGCA 1HHJA 1RVFL 1VGEL 5ERWB 5HHMA 2W0PA 1PYWB 4FHBD 4MNGA 4XI5D 2W9EL 1TPXB 3RUGF 1ZAGA 3HZVB 4LKCB 5C07D 4JHAH 3TPUE 4DEPC 4NRZA 3HFML 4Y1AA 1PG7X 4OF7A 4U1KB 2C5DC 4OGAC 1T22A 3O0RL 3V0WH 3F7VA 4KJQD 3B9KB 4FZ8H 2JJSC 1I8KA 5F7NC 3HB3D 3MV7B 4P2CG 2DWDB 5DMIL 2ADIB 2BY2A 2O5YL 5KVDH 1DSFL 3QIBA 2EIDA 1CFNB 3BPNB 4X99B 4BQBA 1AC6A 1GGBL 4MQSB 3X12B 4TNWF 3QFDA 3UPAA 1MSPA 2WIIB 1X4YA 5IFAL 2MSPA 2FZ3B 3QUXC 4O5LH 1EEZA 2AKRB 4U1JB 5J3HC 1QEWA 1GZQA 3IJSB 1FL6B 4ZSOB 3E2HC 5DHVA 2XPGA 1A7NH 3BKYL 2EE6A 2HH0L 5I8CA 4QRQB 1PZ5B 3ARGB 4BSVB 4JZJA 5TH2B 3DUHA 1BVKB 5DMGC 2FEDC 3BGMB 3VRLE 4H8WC 1I75A 3RGVC 3LN4A 4GG6B 1U8IB 2R0LH 3E3QE 1N5AA 4CVXA 5HYSB 3N1PC 1FDLL 3D39A 4QRRA 1L9NA 4J23A 5IVOA 2IPTL 3MJ8B 4JM2B 5C8JA 3QDGD 4WHYG 3SO3B 4E41B 4JFFB 1LDPL 4R7NA 3RWEA 2FGWH 4Q97A 4Z8FH 4L5FH 5EU4B 2NTFB 1FGNH 3PQYD 2FL5B 1NDGA 5CP7B 3CUPA 1QQDA 3KDMA 5IHLB 3MXWL 1EGJL 5HHOA 3W0WB 4CVZB 5CIPB 1I85C 3QRFM 1PY9A 3ZYJA 5BV7B 1UACL 1E6OL 4GAYB 1RD6A 4ODWA 5F9AC 1KJ3L 5IR1A 3Q0HA 1OPGH 1HYSC 1MJ8H 2APWA 1T80A 3X3FL 2ICCA 2YPKB 3L5JA 3V6ZB 4PRHE 2QADB 1YQVL 3O6LH 2XT1B 2CQVA 4RIRB 1OP3K 4PLNC 1A8JH 2CK0L 4J3TA 3L7EA 1LE9A 1FYTA 1PQZB 3U36A 3ZMRA 2MPAH 4YDIH 2PR4L 5TE4H 1KELH 1K6QL 3FO0H 1F97A 2NW2A 3TWCL 3C09C 2JK5A 4Y2OA 2H1PL 4XNUL 4NBXB 4NWUH 1NPUA 3FFCE 1KXVC 2UZXB 4M5YH 1UM6L 5EA0L 4TQEL 1YEIL 3S96A 4JGJA 4DVBA 5A43C 4XMPH 4BQ9A 3P11H 3OR6A 3AMLA 2FJFA 3IDXH 3LHPH 4MHHI 5F6IC 5IW3A 3SDDB 4MJ4A 2OYPA 2VQ1B 1P4LB 4LRIA 2NY7L 4WU5B 1YJDC 4KJWD 3E8UH 1U8HB 1GIGL 4C83B 1KPRB 4FFYL 4MX7B 4H0IA 5TQ0L 1EBPA 5JO5A 1DBMH 3ARBA 3WDIA 4ELME 3HNTL 3BGFB 3RWCA 4F7EA 4POZC 2IF7A 4L4TD 2VZUA 1B90A 3OB0H 5FK9B 4U05A 3UBXI 5ITBL 5JW4N 4R96A 1DE4B 3RKDD 4OCNC 4Q0XL 3PDGA 4H25A 2AQ3A 3R0NA 1FBIH 4UI2A 4JZOA 3MJGX 1QSZA 4LLAA 4GAFB 3ALXA 5DO2D 2P7TA 4Z7WF 5FUOH 5IQ9A 1FFPB 1WK0A 4GKOA 3SDYL 5CBAB 4U1MA 1QRNB 2ARJB 1BP3B 3FCTB 5FGSA 1EVUA 4QEGA 2VR4A 4JRXE 5IJVB 1RJYB 5DRNA 5CFHA 2K9UA 2GSGB 3EZJB 3MLWH 1MCRA 1WZ1L 2DYPA 5DK2B 2E3VA 1ITCA 2C3VA 5DUBA 2HFEA 4XCCL 1S9XB 3CMOL 1LEIB 2YD6A 1NFDF 4PJFF 4NN6B 3LPFA 2J88H 5DD0L 1CLOL 1KCRL 4NC1C 5D1QD 3PXJA 4WEBH 4RA0C 5I30H 1JTOA 3LKNB 3SKJL 1LO0L 1KJVB 4E42A 3P77B 5DMJB 4JDVA 4U6TA 1RZKL 4P5MB 3EUUA 4J12A 1ACYH 4JREC 5GGSB 4JFZL 4WTZG 3WXWH 2N7BA 2ITDA 4Y4KA 4XZUB 5SV4A 3OX8A 1I9RL 1U95A 1GGCL 4Q74A 2AJXH 3D69B 2MCPH 4HIXH 1N26A 2DS4A 4R97B 5AWNL 1RUMH 3I6GA 3UTOA 1BOYA 5AG8A 1OTSD 3DPBA 5I19L 5IHUL 1I1CA 4I3GA 1FZKA 4LVHC 3DLQR 3VXUA 1ZT7A 4NFCA 4GMSH 5KVGL 4JO1L 3L9RA 1I3RA 1KPUA 1CICB 2BVYA 4HXBH 3D85A 1AR1C 1N2RB 4BQCA 3MRDA 3EO0A 1OM3H 1I8IA 3U7AA 3HI1A 4XNMB 4UDTA 2Y07H 5FO7A 3SKNB 2E8YA 2ZCHH 4NQDA 3FB6B 3VWKD 3QNXA 4PJAA 5JQ6L 1NEUA 4U1NB 4P3CH 5D8JH 3RY6A 1ETZB 1II4E 1A6UH 3VI4E 5EBGA 2BNRA 3AREC 4QOKB 2EH7H 4JM4L 3HUJE 4YJZL 2Z9TA 3D5OF 4D8PB 3BKML 3PHQB 4B5EA 4S1QH 4X8XA 5ISZE 4HC1H 3DBXB 4V1DD 2IAMC 3JWDH 3IKKA 3BDXA 5SX5H 3UCRA 4NKIL 1OD7A 1UGNA 5I1KH 5CZXD 1OTUC 3ARVA 5F88B 3ARFC 4PPTA 3U7YH 1FFRA 4LCUB 2VDML 1YMHB 5C3TA 4PS4L 3O6MH 5ENWA 3WN5A 3DUSA 4M6OH 1JGDB 3UYRH 1MHPH 5HGBB 2Q76B 5DVKA 4RWHA 4NUGL 1SVCP 1RJLB 3WFBH 3ARYA 3K74B 1H3VA 3HC0B 4OCXL 4EDWL 5GRVL 1KXQE 4X7TA 4NP4H 3MODH 1C5BH 2O61A 5HI4D 1IGYA 1OAQH 2VLJE 1MCBA 4BZ2L 5ITFB 2OQJB 1TJHL 4HLZH 1SEBA 4QT5A 1K8IB 1VFAB 2J1KA 4HG4K 3TF7C 4QWWC 4WHTB 4ZDHA 4ZFFA 5FGCB 1PKOA 5DRWA 2PW1A 2NY0D 4LQFL 4U1IB 2WUBH 4D3CL 2UYLB 1IARB 2Z91A 3CX5K 1JFMA 4AEEA 1C5DB 3NPZB 3HE6B 1XR8A 4ZXBB 4PUBL 2P48B 4W4NA 1F2QA 1CVSC 3BUTA 3HZKA 5EZOH 3V0WL 4FZ8L 3HKFA 4YDKH 1IC5H 4FFEX 4C59B 2HJFB 2FX9H 5KZCB 1KCSL 2I9LB 1HXYA 4F7TB 1DJSA 4OCMC 2OL3B 4KJPD 1LO2L 3MRKB 3O8XD 4BSWA 4O9HL 2VOTA 5KSBE 2P42B 15C8H 5HDQH 2DJ4A 4XAWH 4IIQA