5HGBA

Hla*a2402 complexed with hiv nef138 8mer epitope
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 70
structure length 274
sequence length 274
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hgbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hgbA01
5ISZD 4PRIA 2GTWB 5JPNB 2XRAH 3IDXL 5MEOB 1L8JA 3DO7B 3FO1A 3VG0L 4R4FH 5SWQB 1JL8A 4LU5L 2N1KA 1WC7A 3C5ZC 4L4VB 4NO5B 3ETBF 1H3VA 1P4BL 2ZWLT 1DVFD 3OTTA 3ZT6A 4MZ3A 4PJGA 3WCYA 4POZC 4LLVB 1VFBB 1G7LA 3PGDB 1MFDH 2A6JA 2XY1A 2RFXB 1HYRC 3JWDL 1KIQA 5TPWH 1G7QA 1I9EA 5EIQA 1I8MA 2WK2A 5B38A 1E6OH 3C2AL 5IBTH 1MI5B 1P2CA 5I17B 4X80L 4MA3A 4R4BA 1PG7H 2AJSL 2XZQH 3O3UN 3ARVA 4LARL 3RDTC 3WFEL 1YN6B 4PRIE 4GRWE 4DQOH 1FFOA 4RGMC 3WNMA 3DTXA 4RIRB 1AO7B 4DKDC 3L6FB 1DEDA 4WW1B 5EBWA 1PYWB 4ZUUA 4LK4A 1ZT1B 5TDOA 4PRHE 1CLCA 1GC1H 3FZUD 1I3RA 5IFHL 2MQ0A 4HHAB 5D1ZA 3QUYC 4PJGE 2GIYA 4Y5YA 2X6MA 3BZ4A 1LO2H 1HXMB 1BD2D 1F4YH 1OARH 4AENB 4I48A 4GT7A 3BESR 4F7MB 2Z93B 1AGFA 4PRNA 4PY7A 1HE7A 1CL7H 3CDCA 4Y4KA 4J8RB 4XC3L 1G1CA 1HXYB 4P57B 2DQGH 4AEHH 3LB6C 5DFWH 5J06A 5CZKA 4FABH 3MBEC 2JJSC 3BIKB 1DQJA 1EERB 4X6BB 3U4EA 3BT2H 1WAAE 1NFIB 3W39B 2B0SL 5FYLL 5C0ND 1KELL 1M7DA 3IETB 3I02A 1JMZA 3LEVL 4W70A 3RWIA 3O2VH 3ARGA 1QFUL 5FKPB 1RMFH 1ZLSL 1LO0L 1BIIB 4D9QD 3BN9D 2ZP0T 5H35B 1S78C 4PFEA 1S7TB 3L3HA 1E6JH 3PGFH 5AYUL 3ECBA 3QO1B 1Q1JL 4M6NL 4HJGA 2B4CH 4KFZC 4F9PC 5FDWA 1FNHA 4X98B 2VXSL 4OV6F 4WJ5B 5DD0H 1QRNB 4HJ0D 5IFAH 4P2QB 4EVNB 4WU7A 3GBML 3HPLA 3DMMB 3U6RB 1RUKL 2NXZB 2QSVA 5I6XB 3B8SA 5E99L 4XBPA 4HUUB 4DVBB 3IDYC 4ODTH 4C57C 1LE5B 2QTEA 2Q76A 1FG2B 3MV01 2A73A 4JG0H 4UV7L 3TM6A 2QQLH 2X1OA 3DX6B 4PS4H 4ZXBA 1KCLA 1H0DB 1MIEL 4I4WB 4WHTB 1PG7W 2HWZH 5A16A 5ESVB 4KI5E 4APQC 1WFUA 3MRMA 1A47A 1IARB 3IXAB 4LSUL 4PJXB 1IC5L 4DN4H 3I75A 1QR4A 3HRPA 4GW5B 3RWEB 4JZOA 3OB0H 4JREB 3ZKMD 4QXUH 4UQ2A 3FQRB 4Y4HC 4JHWL 2DL9A 3SKUD 1MWAA 4U6HB 1E4KC 5JQ6L 5K9OA 1EIBA 1R5WA 5GZND 5TGBA 2EIZB 4OZGF 3IF1A 3OJMB 3DVGA 4HWUA 2JIXA 5FAAA 4P23B 4XAKD 1DDHB 2HAZA 3CVHB 4E41A 1U95A 3TT3L 1D6EB 4JDZB 1T20A 2XICA 1KIPB 4JFEA 5DURB 1QFWL 1TZGL 2ERJB 3OGOE 4N5UA 2I26N 4D3CL 4V1DB 1CGWA 4N5ED 4XVTL 4KY1L 1OVZA 4HKZB 4NQEB 3SE8H 1LEKA 5EIIA 4M4PA 1EHNA 5E6ZA 4OQ1A 2IPUK 5KVEL 1OF2A 2X1XR 3LRGA 4JKWA 3C6LD 1BQLL 5IJVA 2HP4A 1S9XB 1EHLL 5EOTA 3QDAA 1A1MA 4M9PA 1ZANH 3O9WC 4Z6AT 4C55A 1CFSB 2V17L 4YC2C 5HDBE 1WWBX 2QKIB 5F1KC 4OLYL 1ADQA 1FVDA 5I76A 1MFEH 3CXHJ 1UCBH 4Y89A 3L3KB 2PW2B 3WN5C 4OCSH 4LCYB 1N3NB 4KQ3L 1JHKH 2GW5A 4LRNH 2B1AH 5T5FL 4ZFOB 4KZDL 1P1ZA 1NDGA 5L2JB 3BGFC 3RPIA 5IM7A 4ZUVB 5E24E 3V8CA 1NCTA 4OCXH 1A9BA 4ZO7A 3GKZA 3MLZL 3MRIB 2FR4A 2PTTA 4HKXA 1KSRA 5D7KD 4LVHC 1FZKB 3UTZB 1RIHL 2X9YA 4M5YL 3VXMD 3WXWH 2Z0BA 5HDQL 1RAMA 1JJUA 1U91B 4KPHL 1YYLL 4JZJC 1J8HA 2AV1A 4I77H 5CFHA 4OKVB 1FYTA 1NBZB 3UO1L 3VDCA 4B53A 5E8OA 4NN7B 3GJEB 2UY6A 4PGCA 1Q9LA 4G6KL 2DYPA 1U3YA 2BRRL 4OSUH 1VCAA 4PREA 1FZJA 1I9IL 5I8KL 2LU3A 3PWPB 1B4JH 3ZT5A 3K2UH 2RIKA 2AKRB 1CTOA 3SGJC 2WM0A 3U0WH 3HE7D 4G7VH 5DJ6A 3R1GL 2FZ3A 1KV3A 3TIDA 3O3BA 3DURB 3VFUA 2XZCH 1GZPA 1S3KH 1S8DB 4S1RL 3QISA 5EUOE 3WLWC 4PLOB 2D7TH 1ZMYA 1T0NB 1X5ZA 1KB5H 3HC0A 3OKYA 4KJYA 1IC4H 4HKBA 4JPIB 1U8LB 2BY0A 3M1BB 4H0HB 4Z7OF 3QUZD 5T3ZH 3NFSH 1J8HE 5C8JA 3VXUD 1FYTE 3KPRD 1EHAA 5BW7C 3MNWB 4YWGH 2EE2A 3CU1A 1J1XH 3VWJC 1KYOK 3MPCA 4BZ2H 1M6OB 4QT5B 5A2LH 3BYTA 3RJDA 4ELMB 3IFPB 2E9IA 4V2BA 3MFFB 2DKUA 2EE9A 5DD6A 3BH8B 5I8EB 1I8IB 2JELH 1CFQB 4ORGA 4N8CH 4PP1D 3CUPA 3HR5B 4QHMB 2EDWA 4NHUA 1R24A 1TVHB 2ICWJ 3OMZA 3NZ8A 3TN0C 3O8XC 3O6MH 3TBWB 2UWEA 3SDCC 4CVUA 3D2UB 5CMAB 2ADIB 2D0GA 1LO3H 4FFYL 5AYQA 4ZD3H 5F3BB 1KCRL 1B4RA 1RIVL 4L9LB 1D9KB 5IF0B 2WV3A 3FFDA 2Q87A 1M71B 5E00B 1Q0YL 4AJ0A 1B3JA 5DUPH 4NRYB 1FVCB 3WBDA 5F7MC 1JIBA 1OLLA 2Q1EA 3G5VB 2IMNA 2J7LA 2PTVA 3LEXA 4OZFA 3BKYL 1MREL 1I7ZB 5FYKU 4Z7WB 5IVXA 1T1WB 3SCMB 4G8EA 5EU6D 3GMLA 2O5ZH 3GNML 4NHUE 1I1AD 3GI8L 4UTAH 3T2NL 4Z78B 1KXQE 1F90H 4P5TB 4YHNA 2VXUL 4EI5A 4WVRA 5E9DD 3B9KC 4QRQA 5IW3A 3QCVL 3EBAA 4NRZA 3DX9B 1CVSC 4HPOL 2ZUTA 3IDJA 2UWEE 2LABA 3NVQA 1YN7A 3E8UH 2JB5L 4AT6A 3U2SA 5J9PB 2C7UA 4MX7B 3GK8H 1F8TH 5HVHC 1W8NA 4Y2DC 5HGHA 5I1IL 1JPFB 1IC7L 4H20H 1J10A 3SPVB 2XV6B 1WWCA 3X11B 4UAOC 3IJYA 5IVXE 3N1PC 4U1IB 1C08B 2OCFD 1DQLL 2NXYB 1JWMA 1JWUA 1RJLB 2VDPL 3H9SE 2GAZB 4QYOB 4NWUH 3N85H 2VXVH 1MCHA 1XR8B 4LSTH 1G6RB 4LKCB 1A3QA 4QHNA 3BVNB 4JZNA 4S1QH 4XC1H 2C3XA 3G6JA 5HHOD 3MRNA 2XWBA 2DTML 1ZTXH 2DLEA 2ED9A 1NMCB 4FN0A 2LAGB 5I1GL 5KSUB 4KGJA 2Y72A 3B9EA 4KHXH 4X7TA 1IAII 1IQDB 4HCRA 3V4PH 4U6VL 5I1CL 3QNZB 2CLZA 4H0GA 1J87A 2F5AL 1KGCE 3A67H 5TQ0H 3TNMA 2Z91B 5GRYA 3KPNB 3GMOB 2X89A 5DJDB 4YO0A 5MI0B 5LQBH 3MLRH 3FFCE 3SKJL 4LKXB 4PJ8B 3V6FB 5KSAC 5FB8B 3ARBA 3VWKA 4BQ8A 3EYOA 1E4WH 1CDIA 4TVPH 3KPPB 5GGQL 5I18H 5IFJA 4Y5XB 2NTFA 5J13B 3DHMA 2RBLA 3FONB 1RVFH 4Q2ZB 5ADOL 1G7JA 1DQQA 4YPJA 4FQIL 5CHNB 2MFNA 1EPFA 1JRHL 3V6BR 4TNVF 4PRPB 3LH2L 3QIBA 3DV6B 2YXMA 4WTZA 5F21B 3M8OL 4R7NA 1F3RB 3QG7L 1UG9A 4YHYB 2F54A 3WSQH 3S36L 4PJ9D 2C1PA 3FRPA 1NFDB 4YDVA 2IJ0C 3P4OB 2GY7B 5I1AB 4HV8B 4GG6B 1UM6H 4UQ3B 1BECA 2XKNA 4JQIL 1JPTL 2QQKH 2VXQL 1GGCL 2YA0A 1BLNA 2AJ3B 4AG4L 4NQCD 1FCGA 5CEZD 1QSVA 4RGOL 5CJQL 4CVZB 4GXUN 2O26U 4Y1AB 3MA7A 2HH0H 2FD6L 5D70L 3BKCH 2F9BT 4JPVH 4JY5L 4J2XA 1XGRA 3MGTA 3OAZK 1P7QD 5TFSH 3NIDF 3QFJA 3H3BC 4NWTL 1OAYL 3KNBB 1CT8A 5B21A 5F72S 2GCYA 3RTQA 5IB5A 2FX7H 4R90H 1CLYH 4LFHD 3BW9B 4ETYA 2F54E 5I66B 1JF5A 5A3ID 2B1HH 2BNQD 2D3VA 4EDWL 4OLXH 1DVFA 3L3OA 4X4YA 1NGZB 2HJKB 5CJXA 4M02A 5J12B 1E27A 2A9NL 1FHGA 1CLOL 5B8CA 5KVDH 2X41A 5EZIH 1LDPH 3BQUD 4X5WA 3FOLA 1W72A 2XQBH 3PL6B 3QFJE 4HFWB 4TULL 3OAYH 3QUMH 1SBSH 1E4XH 3MRRB 3A6CL 1FO0L 2VABA 4X5LA 3WO4B 5FM5O 1U8PB 4MJ6A 5E6YA 1B0RB 5KSBF 1A14H 1A4KA 1MFNA 2KH2B 3DIFB 1A6TA 1ED3B 3MR9B 4LASH 2Q86B 4O58L 2AEWA 1OT1A 4J3XA 4WCYL 2B5IB 3DXAD 1H8OA 2P48B 4LIQE 1QPPA 2KL6A 1CG9B 1MPAH 1LO4H 2W38A 3QI9B 4MWFA 2QADC 4O5LL 2P8PA 4RAUB 3TV3L 1OHQA 4FTVA 1BQUA 4PGZA 4RMRA 3JZ7A 4GMSL 1R3KA 5I16B 4IIQC 1DTUA 1YYMH 5EOCJ 3BRDA 1U8QA 3GKWL 2FWOA 3P0YL 5EBMA 4JPWL 2P49B 1XEDA 4HMCA 4UNVA 1JVKA 1BOGB 4OZ4B 2OR7A 5EBGA 4JKPL 4Q9CA 4FP8L 4PJDA 4M7ZB 3NCJH 4OLUH 1WAAF 5F7YC 4EI6B 1UH3A 1YA5A 1RUQL 3WDJA 4X9IA 4YEFA 3JXAA 3DX8B 3MX0A 4TQEL 4K23L 1AI1H 3AREB 1AQDB 5HYSG 3S88H 4I3SH 4G6FD 3GBNL 3TO4C 2FRGP 4WO4D 3LMJH 2O5YH 2DBJA 2YD8A 4GOSA 2P5EB 2AK4D 1NUNB 3L5XL 4XAWL 3NCYS 2ICWI 2I25N 5JOFB 4FTVE 2CRYA 3MNZB 4XPFH 3ORJA 3FL7A 3VFVB 3TO2A 5B22A 1VA9A 1IGJB 2VH5L 4PJFF 3F8UB 3TA3C 5C0CD 1BVLB 1SYVA 4PJDE 4LLWA 4YLQT 3QJHA 3MV9D 1FORL 4BELD 4OIIH 4BQCA 4LCIH 3GO1L 5EZJB 1OP5H 4WUUD 4Q0XH 2IQAB 5E2TL 4N90D 1HSAB 4N8VA 2WZPD 3T1FB 4R7DB 4LF3B 3MLTA 4I5BA 4L1DA 4YX2H 3OF6A 4JRWA 2CDEA 1SVZA 4KI1A 1AXTL 1J7VR 2NY0B 1FC1A 1QSFD 4FZEH 3ULUD 1RURL 2VITA 4G7YL 3CXHK 5EO1A 3TWCL 1CFVL 1S9WB 3T0WA 3GSNA 4DK6A 2AQ3A 2KKQA 1NBVH 3BHBA 3H8NA 3CDGA 2HMIC 1GZQA 4M61A 4M6OL 5ELIA 3KDMB 3TJHC 1FV1A 2JJTC 4NCC2 4FFVC 4NT6A 3X3GL 1U8MB 3VD9A 1L7IL 4JY4B 2IPTL 3O45B 2LVEA 1M7IB 3RIAK 3GJFK 1JP5A 3CFEB 1RULH 1YEEH 1YMHA 3QCTL 4XCEA 2A1WH 1INEH 2FJGA 4OLVH 1H5BB 1CK0H 1QPXA 1PZ5B 1RK0B 3KAAA 4R96A 5F9WB 4KRLB 1JZ2A 3BDYH 5E6ID 2AK1L 4L3ED 4PRIB 4GRWB 4OGZA 3FO1B 1C5DA 3IT8D 2M26A 3GSVA 3D5OF 1WC7B 4JQXA 1KFAH 2Z35B 2GI7A 3UPCA 1QYGH 5E2UH 4OV5A 1LVEA 5ILTL 1HSBA 3WDHA 2A6JB 4XWGL 1KIQB 5LGHH 1G7QB 4U4BA 4FMKA 1C5BL 1I8MB 5B38B 1LE9A 1RD6A 5EFIA 4BJLA 1P2CB 5TF1L 4UT6L 4J3TA 1CDYA 4JO4H 4MA3B 4R4BB 5ITFA 12E8H 35C8L 1FFOB 1D6VH 3PWLA 1IVLA 2NY6B 3DTXB 3I2CH 2BDNH 5EBWB 3B9VA 2XKSA 3QYCA 4ZUUB 5TDOB 1QLEL 3T0BA 5AZ2L 3SDYH 1JFQH 1I3RB 2K7QA 5IT2L 4M03A 4NFBA 4M5ZL 5D1ZB 4PGJA 4Y5YB 3VXMA 3BZ4B 5EC1A 4FNLH 1OSPL 3GMPA 4I48B 5IQ7H 1RUPH 1SY6H 1AGFB 4PRNB 4PY7B 4RNRA 4Y4KB 3WFCL 4XHJC 2XWTA 4HXAL 4F7EA 3VMPA 2CJUH 4ZUTA 2ENSA 4YFEA 3SDXF 3Q6GH 5C07D 4TVSa 1NCDH 2NY5H 1OGTA 2NW2A 4RFNB 3T4YA 5TDPA 1DQJB 1TETH 4ZNCD 1G1YA 1I9JL 1X5AA 3MBXL 5TE6H 3U4EB 3NCMA 4D0DA 2EDRA 5DD5H 1FH5H 4YQXL 1JPSL 2VDRL 4XXCA 4NC1E 5AWNH 3HE7A 1M7DB 3I02B 1A6UL 4M1CD 1ZT4B 5EUOF 3F7PC 1WUNT 1IGTA 3ARGB 3TT1H 1DL7H 5D7KE 3FHAA 2PW1A 3VXME 3L3HB 1FFNB 2EKSA 3WXVL 4JB9L 3QDGD 3RHWK 3ECBB 3ZSTA 3RAJL 1M4KA 4M43H 3QUZA 4HJGB 3GIVA 4KKBD 1BZQK 3ARQA 4BFGA 1MWAH 5FDWB 3HG1D 3VXUA 4BZYA 3GIZL 3VD4A 3KPRA 1JGUL 1HQRA 2FATL 4WU7B 5BJTB 3HPLB 3ARTA 2Y06H 1J18A 4LCCC 3O6KH 3RWFA 4G3YH 3UTSE 2EDJA 5HI3D 4OF5A 4X7EC 5DK2A 1RUAH 4XBPB 1A4JA 1AHWC 3RZCC 3RVXD 1Y6KR 5F89A 3VGFA 1H3UA 2Q76B 3BSZL 1T83C 4K07A 4DTGL 2VB5A 1DSFH 2A73B 2UZYB 3GEWB 3V5KA 3VI3F 2IFGA 1EO8H 4R0LA 2DM4A 3MRJA 3T0DA 1U3ZA 1MRDL 4ZXBB 3EOTH 5CWSA 1AY1L 5LGJA 1I1RA 5A16B 4PJBA 3P30L 1JI1A 3BYYA 1J12A 3H7BA 4KK5D 3QEHA 4BH7B 4QHLA 5E5MB 4NQXA 1L9MA 3VXUE 1CICC 5F7DA 3KPRE 4K7PL 1VEPA 4DFHA 3I75B 4UU9A 1NLDH 5FYJU 4JZOB 4XP9L 2MKWA 3HNTL 5D7JD 3GSQA 3TZVC 4UQ2B 4GAJL 1CL7I 1T89C 1EGJL 1RZKH 3EO1A 2NCMA 4MA8H 5KSVA 3BPCA 4X6EA 1FN4B 1MWAB 4MQSB 4KUZH 4L4TD 5K9OB 2APTA 1HNFA 4NKMA 4WWKC 1R5WB 3SE4A 5TGBB 4XCYA 1R3IH 3IF1B 3ILPA 3DVGB 2J88H 1UXWA 3BIBX 3EHBD 4K3JH 3DUHA 2JIXB 1QZ1A 4JJ5A 2AJXH 4E41B 1U95B 5E4EC 5AEAA 1T20B 3OGCB 2IMMA 4JFEB 4YR6B 3QG6A 4PJBE 3KPTA 1ZWIA 4LLUA 4ZS7L 4LCUA 3QUXC 2I5YL 1WFOA 4K8RH 4L8SC 5E9DA 1AKJD 1LEKB 5EIIB 4PV9A 3B9DA 3TH2T 3STBA 4GS7C 1OF2B 5IJVB 5EOTB 1A1MB 1B0GA 4Q9BA 5B4MC 1C16A 2C1OA 4RMQA 3UROR 1KNOA 1J1OH 1N7MH 3FMGH 4NPYA 3UPRA 1RSFA 1FVDB 1Z9MA 2W07A 3RVVC 3RA7H 5I76B 4F37K 5T5NG 3BH9A 3DRQA 1P1ZB 5F7WC 3W5NA 1NDGB 1YEFH 1TLKA 3RPIB 5IM7B 2PO6C 3CZJA 2IAMD 2DQDL 3TVMC 1A9BB 3VXNA 3WFDL 1RUMH 5E9DE 5GGTA 2FR4B 5HI5C 2W1NA 3G6DH 2PTTB 4HKXB 4L8BA 3TEUA 4PJAE 4GG8A 4Z8FL 2WAHA 1Q9KA 1TJGL 5HHOA 3PQYE 4HK3J 3RVUD 4ZG1A 2IPUG 3S37X 1J8HB 2AV1B 4FQHA 4NYLA 4M93B 4EUPA 5L8LB 1FQ9C 4RAVA 2QHLA 3D39D 4PG2C 5E8OB 3BJLA 3VDBA 4PGCB 1Q9LB 2DYPB 3ARDD 2A38A 1CYGA 1NSNH 2R4RL 1K3IA 1KCUL 1FGVL 1A2YA 4PREB 4LPWA 1FZJB 5JZ7D 2VL4A 1B6UA 1BPVA 3EYSL 3KJ6H 1S5IL 1YPZA 1E28A 2Z31A 2YS4A 5DJ6B 3IAQA 1RZGA 2FZ3B 3TIDB 4AZ8A 3O3BB 4OCYH 3VFUB 1GZPB 3FHQA 1XH3A 4NM8L 2BNUA 5K9KA 1T7ZA 4NO0A 3VI4F 4DOHE 5DFTA 5DJYA 3HC0B 4KJYB 4HKBB 1NAKH 2B2XL 4UIMA 1MCCA 2BSTA 4ONFL 5C8JB 2I9TB 5LG1A 3QQ9C 5C2UB 2OMBA 4DVRL 2DLFL 3ALWA 3PG2A 2DM7A 4OZFH 4QRUA 4PJ9A 1BZ7A 1Z5LA 1N0XH 1WIPA 3VXTA 1T6VN 4HBCL 1K85A 4OZHF 1ERNA 1NANH 3H42H 4GXVH 4OJFL 5DJCA 2LE9A 2FBOJ 4NQCA 4K3HA 3QFDA 4ORGB 3O0RL 4WEMB 5TDNA 5EU3A 3CUPB 4ZO6A 5I8OH 3D18A 5I1JL 4NHUB 2VL5A 1P7QA 1R24B 5HVFB 3CJJA 2ZCLH 3LS4H 3VG0H 1YEDA 2IANE 3NZ8B 5KVGL 1MRFL 2UWEB 2GJ6E 5GS0H 2DD8L 3HCVA 3O2DL 1U3JA 4LEXL 2BNQA 3FFDB 2NW3A 3U0TA 1JNNL 3BKJL 4PJHF 5FYJD 2VLKB 4NO2A 3HTLX 4IDLA 1NUDA 1MHPL 3C2AH 4PJEF 4FOMA 4NQCE 4X80H 4LSPH 3ZO0A 5CEZE 2YRLA 3LEXB 3AY4C 3E6HA 3BQUA 5IVXB 4LARH 4G8EB 3GMLB 1FRGL 3LKPA 4WI9A 1IKNC 3MRBA 4YHNB 4EI5B 2QQNL 5K33A 1EUTA 1UWEL 4HCRH 4NRZB 6CGTA 2X44D 2BJML 3G5ZA 3IDJB 2H1PL 2YUVA 1YN7B 4AT6B 5E2JA 2ZUYA 3U2SB 4PDCE 2C7UB 1EUUA 1UKTA 2G60L 4Y4FD 1QNZL 3QEQD 5HGHB 4FZ8H 3J7HA 3VFGL 2YEZB 1U8KA 4XC3H 3SN6N 5FGCE 1KPRA 5JOPD 3KWWA 1MFAH 4PUBH 4XI5D 4OKDA 3QXVA 1T7WA 2D7OA 3DMMC 3D9AL 3IJYB 2NXZC 4P49A 5I6XC 1O7VA 5IESL 2J6EL 5INDB 1JWUB 1JWMB 3AVEA 4GMTL 1J0KA 3G9VA 4JHAL 5FYLH 1T03H 4QHNB 4JZNB 3IKKA 5DQ9A 4ZSOA 2DQEL 3G6JB 1MELA 4LSSH 3IU3A 3MCLL 2XWBB 2XA8L 2PUQT 1ORQA 2QSQA 1QBML 1SYSA 2ZKHL 1XZ0A 2FHFA 1I85A 4XPAL 4WY7H 4X7TB 3D69A 2VDKH 4P59H 2CLZB 2VXSH 3HMXA 3TNMB 5JXEC 1MJ8H 3NIGF 4ZTPH 1KLUB 3AU1A 4YO0B 4WI8A 4JREC 5C0CA 1ZT7A 3MJ8A 5BS0E 5DZNA 3W5MA 2IQ9L 1K4DA 3MV9A 5E99H 3RVWC 3ARBB 4FFZL 4U1GB 3EYOB 5IFJB 4YAQA 2NTFB 2DKSA 4WUUA 5HHMD 3UMTA 4ZSOE 1IAIL 3EO9L 2YKLH 4P23C 4UV7H 2CIIA 5BMFL 1G7JB 1DQQB 1T0PB 5EPMA 3RL1A 4LIQH 4GUPA 1J05A 1FSKC 2ITDA 3BJ91 5I2IA 4HQQL 5GGRY 2ERJC 4MXQA 1QSFA 2F15A 4U1NA 5HI4C 15C8L 3INUL 2DQJL 3QIBB 4LSUH 1IQWL 3UYPA 1QSED 3UTOA 3VGGA 3OWEA 4TUOA 4R7NB 5DJ8A 3RIFK 1ES0A 2F54B 3MLWL 2XFXA 5C0CE 3WIFA 4FQ2H 2C1PB 1J0ZA 3QCUL 4YDVB 3GSUA 1V3LA 3VRLF 3MV9E 4KXZH 1A8JH 5ENWA 4HLZG 5H37H 3WNLA 4B0MM 2XKNB 4PB9L 1MEXL 1BLNB 1CQKA 4WUUE 4MSWA 2IC2A 5E8NA 2R1YB 3OQ3B 2VSDA 2YZ8A 3E1F1 2JB6A 3MA7B 3ZHLA 1FNFA 3TT3H 1DN2A 2YA1A 1XGRB 3MGTB 4JKLA 5CILL 5E6IA 4YXLH 3QFJB 5ISZB 4L3EA 3ULUE 2GY5A 1NDMA 2EZ0D 2YD4A 1P7HL 5ICYA 1CT8B 4XNYH 3HPJA 2GCYB 4KY1H 1NCAL 3RTQB 5IB5B 4OFVA 2ZCHH 1PKQA 3SDXA 4TUKL 5IBLC 2V2TA 4RA3A 4JFDD 3CVIL 1YNKH 3FB6A 1DVFB 3RP1A 2RCSL 4X4YB 3VJ6A 5CIPH 3VW3L 1E27B 5HVGB 1WLHA 2ZUXA 4HXBL 4NN7C 5ABDE 4WFFD 3HMWH 5B8CB 3HUJF 3LKNA 2EEBA 2FECL 4X5WB 2VIRA 3FOLB 1W72B 5F44A 1JF1A 3IDGA 3IRPX 1NCBL 4ZAKD 4WHYG 4G6JL 3EGSA 1ZLWH 1BAFH 2VABB 4KTEH 4MJ6B 1A4KB 1A6TB 5FM4A 1PKQE 2BCKA 1DANU 3P11L 4Q74A 1CXIA 1RIHH 3EFFA 2EC9U 1EK3A 5KBNC 4M5YH 1UCTA 4MWFB 3OPZL 2P8PB 4XBGA 3LIZL 1FPTL 2J12B 3DWTA 1YYLH 5J1AB 1JWSA 1R3KB 1FJ1A 4TRPH 2AJVL 4NM4L 1CF8L 1MFBH 4OF8A 4G6KH 1U8QB 2FWOB 5EBMB 2X70B 4YGAB 3OAUL 5C07A 5I8KH 4TOYL 4PJDB 1VFMA 4Y8DC 4MNGA 1B9ZA 3QAZB 5GHWH 2ARJA 5FIEA 1II4E 1Z0MA 4HSQA 1FIGL 2X4TA 4B5EA 5DWUL 5I19H 1S9VA 4ZFGH 3K7UA 2OK0H 3GM8A 3CC5A 3VA2C 3GGWA 1QFPA 2P24A 3IU4H 1UWGL 4XHQA 3DOSA 2DQTL 3EYUL 4N0CA 3KYNA 5DQDL 4IMLA 4ZOCA 3WJJA 4PP8C 3C9NA 2EO9A 4U0RC 1O5DT 4O2FB 3IFNH 5D96B 3TO2B 1FL3A 2R4SL 2VN7A 2KQMA 3HG1A 4HF5H 1AGCA 4NKDB 1EO5A 4I3RL 3PP4H 3QWOB 5K93A 5JHDD 4XWOD 5C07E 4M7KH 1SYVB 4LLWB 3I9GL 4MNGE 1C5CH 4N0YL 4L9LC 3QJHB 2R15A 4EN3D 1RZ8A 2XN9E 4G8GD 4MVBD 4DGVL 2R39A 1TFHA 2YN5A 4N8VB 4QWWD 1KTRL 4DGYL 4HJJL 4MD0A 3MLTB 4I5BB 5CAYB 5L8KB 4Z7NF 1JZ6A 1ZGLA 1CR9L 3BPLB 1VADA 2CDEB 3SCMC 1E4XI 4KDWA 5DMIL 4CRPA 1F42A 2IPKA 2VITB 3V7AG 5EO1B 4P5TC 5DHVH 2MQCA 1XF4A 5J1TC 1MQKH 3GSNB 4YBLB 3A6BL 3P4LA 3BHBB 3CDGB 4UOW0 1GZQB 4S0SD 4M61B 3NABL 4XX1E 4FQ1L 2R8SH 5B38G 1FV1B 4GRLD 1KCRH 5F8RC 3HFMH 5D7JA 3R8QA 3QWRD 1GGYA 4UBDD 5GRUH 3QUKA 3ARXA 5IV2A 1YMHB 4XCEB 4L4TA 2FJGB 5HHXH 4MJ5A 5GRVK 4NOFA 4R96B 3UTTD 3BKYH 1MREH 5DRZA 3T3ME 2N7BA 4G6AC 4ENEC 1OAUH 4BUGA 2NXYC 1YJDC 1BM3L 3GNMH 2IG2L 3GI8H 1BJ1J 2PYED 5F6HJ 3T2NH 4P3CL 2VDNL 4YXKH 2VXUH 1AE6H 1C5DB 4WHCA 1ZLVH 5ECJE 2DM3A 5KW9H 3GSVB 1LK3H 2XG5A 3KLSA 3EJJX 3B6SA 2NY3D 3VFPA 4O2CA 1A7NH 1AKJA 2L0DA 4UINL 1DFBH 3ZDZE 2JB5H 2GSIA 2HJLA 4X6DF 4MJID 5CGTA 1IILE 1NMCC 3FT4A 4OV5B 1HSBB 3V79C 3C6LB 5FXCH 5BRZE 5I1IH 3S4SG 4LQFL 4L4TE 4NQTA 3ZDYE 1LE9B 2FO4A 5EFIB 2AAVA 2YK1L 1MHHB 2MNUA 5MI0C 2IEPA 2HTKD 4HFUH 4PJ8C 3CDYA 1HYSD 4FRWA 5CKGA 1DP0A 5C2BL 1IGIL 3PWLB 1XFPA 4GQ9L 1Z2KA 2Y36L 1G7IA 4Y5XC 3M45A 5J13C 1IBGL 2EH8H 1VEMA 3B3IA 4PR5B 4PJAF 4KKCD 3TF7A 1S78D 1JTTA 5B3NA 3VXMB 1HNGA 5EC1B 5EBLA 3GMPB 1URLA 4RNRB 2EYTB 5I1CH 3S36X 5JW5A 2XWTB 4RISH 3SGEH 4F7EB 3MFGB 4HH9A 3H3PH 4ZUTB 3D39A 2OBGA 1N64L 4YHYC 4M6MH 1OGTB 4QTHA 5M94B 2NW2B 3T4YB 1RZJH 3OKEA 4YBQD 5TDPB 2GHWB 2FEDD 1PX3A 1IGFL 1Y18A 3OL2A 3HE7B 1S7VA 4JKMA 5GGQH 1CXLA 1IGTB 4IOFD 4K3EL 5ADOH 5D6DA 1DBMH 1JZ3A 2EKSB 4AEIH 3OKOA 3TYGH 2YPVH 1KIUA 5T1MB 5SWZD 3QUZB 3TH4T 3GIVB 5LWYL 3PJSA 3VXUB 1G9MH 3D39E 5L0QB 3V7MA 2ZUWA 3WNPA 3KPRB 3QHZL 5DI8A 4XNMA 1HQRB 3QG7H 2WUCH 1KTLA 5T3XD 3RI5F 2WUBL 2F58L 3RWFB 3VFSA 2UUDH 1KN4L 1IT9H 2L4OA 5DK2B 1OPGH 4NQUA 1A4JB 1JPTH 5D5MF 1TJIL 2VXQH 5F89B 2V5TA 4R4FL 4YHZL 4AG4H 1BQHA 3V5KB 2VLRD 3QXWA 3ZTJG 3HI1A 4R0LB 4KK8D 3MGAA 2MOVA 4JFFD 2FD6H 5D70H 2IBZX 3MRJB 1JYWA 5BOPA 2AXGA 3HI6H 3PL6C 5CWSB 4NRXA 5LGJB 3UAJC 3H7BB 3OR7A 3WO4C 4QHLB 4U1MA 4NQXB 2OZ4A 4XMKH 5TPWL 5EU7E 1E0OB 4U1HA 5F7DB 4OCNC 1E6OL 2B5IC 4RBPK 5IBTL 2QSTA 3AB0B 1NEZG 4UU9B 4F3FA 3QI9C 2CGRH 3GSQB 4ODVH 3H3KA 1PG7L 2XZQL 3BIAX 5GSRA 3EO1B 4CU8A 3F12A 4NBZB 5KSVB 2UYLA 3BPCB 4X6EB 4DQOL 1SVCP 3GZKA 3QA3A 3LS5H 1NQBA 2A9NH 4NKMB 4NZUH 3MRLA 1CLOH 3SE3A 3ILPB 1UXWB 1C8PA 1NMAH 4JJ5B 5EOQL 2Y23A 4M7ZC 1WV7T 1LO2L 1ZWIB 4LLUB 4LCUB 1OARL 4YBHA 3AREC 4EUPH 1AIFA 4O58H 5E9DB 1HQ4A 1EEUA 3HB3C 1HKFA 2VOTA 4WCYH 4PV9B 1G9NC 1OTTC 1TMCA 2FHBA 1BWWA 3MJ9A 4P46D 2CXKA 1SM3H 4LEOA 2CXGA 2DQGL 2MCPH 4AEHL 4GKOA 4A2LA 4FABL 4NZRL 1B0GB 4Y4FA 4GMSH 3GSWA 1C16B 2C1OB 3QEQA 5FYJE 1KNOB 5DZLA 3UPRB 2DWDA 4S10A 2VQ1A 3FB5A 5FA3A 4Z7UF 4YZFE 1VKXA 3V6OA 3GKWH 3O2VL 3P0YH 4JPWH 1RMFL 5KS9E 1TQBB 3BH9B 3DRQB 4HWBA 2Z92A 3EFDH 3NPSB 5C0AD 4FP8H 1ZGLP 1WBYA 4FFWC 2QBWA 3ULVC 1E6JL 3PGFL 2MTPA 1OP3H 4JJHA 3VXNB 5M7QA 4TQEH 3NAAH 2CD0A 3GBNH 4L8BB 2EXYC 2WSKA 1QR1A 2GTZA 4GG8B 4DOHB 5IFAL 3L5XH 4KVNH 1Q9KB 4E42B 5H8DA 3DGGA 2A6IA 5HHOB 2QQQA 2W0FA 4U1KA 2IH1B 4EUPB 3QEQE 4FQHB 3KPQA 4NYLB 4RAVB 2E7MA 1HHKB 2YD3A 4ODTL 2EIEA 5D1QD 4OGAC 1S7QA 3ZYIA 3V6OE 1NLBH 4KDTA 5JOPE 3I85A 4J4PD 1A2YB 3C09B 4OGYH 4ONHA 5C0DA 4JG0L 1TCRA 1EO7A 3C8DA 4PS4L 5IMMB 1YPZB 1E28B 5A43C 2Z31B 2VZOA 1CN4A 2HWZL 1RZGB 1AQKH 4GBXD 3ZDXE 4JGUA 4RWYH 3ZHDA 1H5BC 2V2XA 2BNUB 5K9KB 4NO0B 2LQRA 5F9WC 5HHMA 5DJYB 1FDLH 4QHUA 4DN4L 2F19L 1J88A 1GPOL 1GVIA 4UIMB 4E5XA 4ZFOL 3SO3B 5FUCE 2CKNA 4G7YH 4R97C 3N1FC 5DRWA 2HLFC 5AUMA 1ZLUH 1UVQA 3EW3B 3SDCD 1QSEA 1S7RA 5D7IF 9CGTA 1FBIL 2FH8A 3UCRA 4NJ9H 5ANME 5AAWA 5A2FA 3UJIH 4QRUB 3X3GH 1ETZA 4PJ9B 2NY7H 1BZ7B 3MA9H 1Z5LB 2IPTH 4KDVA 3VXTB 4IOIB 2QEJA 3KLAA 3QCTH 2AQ1A 4UT9H 5DJCB 1MJJA 4NQCB 3SE8L 4ZTOL 5KAQF 2ZSWA 3RY5A 3QFDB 1HIMH 3OKKA 3SHSA 5TDNB 2VE6A 5I71B 1MNUH 5EU3B 5DJXA 1CGTA 3D18B 3LN5A 2NPLX 4ERSH 2VL5B 1P7QB 1L0XA 2PXYD 5E5RB 5EA0H 2NY6C 4U0QB 5C0JA 1ZA6B 1YEDB 3ARFD 1F45A 1FAIL 1JPGA 2AXJA 1EEZA 2CKBA 1QSEE 1I3UA 1UCBL 2C9AA 4HIIA 4OCSL 3HCVB 3DVIA 5D1ZC 3OXSA 4QOKD 4PJ5E 4Y5YC 1JHKL 1ZA3A 2BNQB 2NW3B 3U0TB 5ILTH 3O4LD 4Y2DD 5JNYA 1VEOA 4YDJA 4S2SA 4Y4KC 3DI3B 4NO2B 4OCXL 3CZFA 2OJEA 3VGAB 4JVPA 3PWVA 4U2YA 4O4YL 4UT6H 2PYFA 5D4QA 4RFNC 2VDLH 3PF2A 3E6HB 4RAHA 5IB2A 3BQUB 1MLCA 3WXWL 4F9LA 35C8H 2C3WA 4HD9A 3LKPB 3K4DA 2XT1B 4ZAKA 1U8IA 5BQ7A 5I74B 3MRBB 1I1FA 2AXFA 4I77L 4HWZA 3ARGC 3G5ZB 1QLEH 3HMXH 3QH3A 4OSUL 5IT2H 4O00A 1FNEA 5HPMB 1JZ5A 1P69B 4KI5C 3HLAA 4ISVA 3U0WL 3WFCH 1U8KB 4A6YA 1KPRB 2XZCL 3KWWB 4WFFE 3SY0A 1F6AA 2D7TL 5GS2D 2M1KA 4DW2H 4ZUWA 1IC4L 1EZVY 5KSAD 5HYSA 3NCYP 3E3QA 1KJVA 1JPSH 3LRSA 1NANI 1IL1A 5T3ZL 3D48R 4PJIA 2VZUA 1EEYB 3NFSL 2A9MH 2NY5C 3W9DA 4G6FB 4HC1L 5DQ9B 2VMFA 4ZSOB 5EUKB 4YWGL 3IU3B 1J1XL 1HILA 2CR3A 3BD4A 4ZXBC 1ORQB 1OTSC 1SYSB 3QULA 2M8XA 1XZ0B 3RAJH 3FO2A 2VZ3A 3UC0H 5F9DC 3D69B 3X13A 1HHIA 3SQOH 1KCSH 3FRPG 3GIZH 1MY5A 4OCWH 3BEVA 4R9HA 4KVCL 3AU1B 1WCBA 5JHDA 2JELL 1ITCA 5C0CB 3QR2A 1ZT7B 3MJ8B 4N8CL 2OTUA 1K4DB 4DKFH 3MV9B 4EN3A 2HKFH 3EZ8A 4PJIE 5DRXA 1KEGH 4G8GA 3U1SH 3H0TA 4A2MA 4MVBA 2H45A 3BSZH 4YAQB 4PGEA 1DLHA 5SWQA 4DTGH 4WUUB 3U79A 3F5WA 3L3GA 4Y0GA 2HT3D 3IJSA 3O6ML 3OBAA 4YUEH 2CIIB 5F7UA 4LVNB 5K59E 5EPMB 3RL1B 4GUPB 1J05B 2ITDB 4ZD3L 3VXSD 5I2IB 3P30H 1AC0A 1QSFB 2KQNA 1BVKA 2NZ9D 4U1NB 1YJDL 4NN5B 5DUPL 5FHAL 3VD5A 4TUOB 3U9PH 5DJ8B 5C1MB 2O5XH 1ES0B 1LD9A 2XFXB 3QXUA 4QGYA 4XP9H 3HNTH 3HI5L 5JHDE 1M05A 4PJCF 3WIFB 2R23B 3LQZB 3MO1A 1JGEA 4GRLA 4LLYA 4GAJH 3GSUB 4MB4A 5ENWB 3I6GB 2ADJB 3FN0H 1U8OA 1F90L 4KV5F 4OCRH 3H9HB 4MSWB 1WFTA 2OJZH 5E8NB 4L4VE 5IHUH 3NZHH 2JB6B 4P2RA 3K80A 3UTTA 1JZ8A 5E6IB 1RZKC 3L95B 4K55A 5T1KD 4WI4A 3GK8L 3U36A 1SEQH 4L3EB 4OBRA 1NDMB 4ZS7H 2PYEA 4OLWH 5FA4A 5ICYB 1X3DA 3HPJB 3LZFL 4LSRL 4O02L 3UTPD 4G6MH 3U7AA 2DWEA 3SDXB 1FFRA 4GLRH 4OFKA 5DVMA 5GGUA 1MI5E 1ND0A 2LFGA 1OL0A 4KJWC 3ZDZF 4H20L 2V2TB 4YHIA 4P57A 4GKZA 2GFBA 2QADD 3SEPA 1PW3A 3FB6B 1INDL 4MJIA 1T6WA 1EMTH 4X6BA 4LOUD 4KROD 1UGNA 3VRIA 4NWUL 3KS0H 3WHE1 2VXVL 1AO7E 3LKNB 3RX5A 4S1QL 3PP3H 4XC1L 4BQ6A 1A6VL 2VIRB 4P2RE 3CFIC 5JIIA 1XF2A 4ZS6D 2QJDA 3QQ3A 3IDGB 1WZKA 1ZTXL 2W65A 2DOCA 5F9JA 3EGSB 4JDTH 3OR6A 3QO1A 5MHSE 3BRFA 3L3JB 3TCLA 2OMNA 3GM0A 4KHXL 4ODWA 4G80A 3TO4D 2BCKB 4ZDHA 3EFFB 2VDOL 2JTDA 3BAEH 1TJGH 4P2QA 5I15H 1CFNB 5LQBL 3NACL 3P0VH 4XBGB 2ZPKH 4X9GA 5T1DL 1OTUD 3T0EA 2EDFA 2FB4H 1JWSB 5IR1A 1SQ2N 1FJ1B 4HUUA 3KPSD 3REVB 1TCMA 3DO3A 1LE5A 1E4WL 4RDQF 4I9WE 5C7XH 1KCUH 1FGVH 4MMZC 3U4BL 1IEBA 5C07B 1RVFL 3BXNA 4POYA 2H8PA 4KXZI 4MNGB 4NZJA 3EYSH 2VUOA 3DX6A 4N8VG 3D87B 2WWMC 2ARJB 4I4WA 5IW1A 5F93C 4OF7A 3LKQA 8FABA 1OD7A 2HJFA 1C7SA 2X4TB 3U0PA 3AGVA 1S9VB 4HG4J 4HMDA 3CC5B 2XACC 3GGWB 2AGJH 4LRIA 2H2SC 2HVJA 2P24B 5DTFB 1KBGH 4P2QE 1QFWI 3KYNB 1CU4H 3LCYA 3WNNA 1R3JA 4IMLB 4ZFZA 3LAFA 4PBXA 3C9NB 5ACMA 2Y9RT 1HOCA 4ONFH 3T0EE 2HRLA 5JHLH 1UM6L 2XY2A 1FL3B 3DVNA 5SWZA 2IH3A 1I1CA 1UM4H 3HG1B 2HMID 1AGCB 2DLFH 3BFOA 5FUZH 1G7MA 1RHHA 3BUTA 4UILL 5L2KD 3VU2A 4Z95H 3CVHA 1JFMA 2HH0L 3BKCL 4JPVL 4EQ2A 1A64A 5TFSL 1RZ8B 2SEBA 1S7SB 4R26H 3KYKH 4S0TD 5SX4H 2AV7A 4HBCH 3X17A 1IFHH 4P5MA 3TBSA 1Z9LA 2FX7L 4PJXE 4R90L 2LAAA 4MD0B 5F7LB 4XBEL 4AQ1B 1ZGLB 2VLRA 3C5JB 2QSCL 2AJYH 4X83A 1VADB 2PETA 2B1HL 4AK1A 4OLXL 2IPKB 3WLBA 1SJHA 5T33L 3NIFF 1S9XA 3GDBA 3DUUA 4EI5C 1ZSDA 5SWZE 1XF4B 1CFSA 2ZCKL 1M1SA 2NY1D 2N56A 2V9RA 1MRFH 3O4OB 5KVDL 2JCCA 2VLME 4NHCH 1SJXA 4IRZH 3WD5H 1QUNA 2J1KA 5T3XE 5D7JB 1FZMA 1X5HA 5IW6A 4PPTA 4X6FA 3QUKB 2YBRA 3PUCA 4XP6H 3IKCA 1E4XL 3NBNA 2BVOA 1JBJA 4RFOH 4L4TB 1UXSB 3MUJA 1WK0A 4N68A 1A14L 3Q2CA 3R06A 4MJ5B 4LASL 4IMKA 3GHBL 5GS0C 1YDPB 2EDOA 2VLRE 1K8IA 5DRZB 3B5TA 1MPAL 1LO4L 1FRGH 3MLYH 5E7FA 3RPKA 1NBZA 2OL3A 2BJMH 5MEQA 1YYML 3T65A 3AAZA 4JHBA 2H1PH 1VFOA 3B6SB 3L3IA 5E1HB 3VFPB 2JCCE 1RJZA 2FIKA 1AKJB 4O2CB 3FTGA 3MYZA 2GSIB 2HJLB 4P46A 2D7QA 3FT4B 1B0WA 2X4RA 4OLUL 3NCJL 4JFPB 5E95B 4XHJD 3UBXI 1F4AA 2FO4B 4GW1A 4QNPF 1AI1L 3S88L 4I3SL 2E9BA 5KS9F 1GGUA 3LMJL 2O5YL 4KKAD 3D9AH 5DJ0A 3K74B 4K9EC 4NZDA 1LK2A 5C0AA 3SDDD 1KEML 4RMUA 4XPFL 5DUBA 2FX9L 2IAMB 2Q8BH 3ARBC 3VWKC 4U1GC 1G7IB 5L6YL 4B7IA 4ZFFA 4D94A 1VHPA 1CQYA 4D9LL 3B3IB 4Y8AA 3MNWA 1WTLA 3MCLH 4LLQA 3B43A 2D9CA 1L7TH 3PWPE 5EBLB 1WIOA 1B2WL 2VISA 4OAWA 4PJ7A 5IGXH 5JW5B 3QIBC 1F4XL 4LCIL 4HH9B 3D39B 4KJQC 3QWQB 4Q0XL 5D1QA 3ULSA 3ARDB 4QTHB 5IROA 3OKEB 4J4PA 4MQXD 2E9JA 4LPYA 3MLVL 4JO1L 4CN6A 5GGSA 4YX2L 5C0AE 1MY7A 3P2TA 2IQ9H 4FZEL 1Y18B 4OB5L 1QEWA 5EB9A 5HSFA 4NKIH 5HYJD 4GBXA 2OXGA 2MQ3A 3JV4A 3S8WA 1A6ZA 1BWMA 3EO9H 2I60L 3JVGA 4OGXH 5E2WH 5DSCA 3BO8A 5EULV 5GGVL 3OKOB 5ID0A 4TNWF 5GRJH 3SQBA 1D9KA 4F15C 5IF0A 4U2ZA 4PJ7E 3PJSB 4XVUD 3RTQC 1KENH 1YEEL 1GIGL 1IQWH 1QP1A 2A1WL 1FVCA 1SMOA 4NRYA 1INEL 2P47B 5DI8B 4XNMB 1NAMA 4URTB 1CK0L 1KTLB 3MLWH 3CH8A 1DVFC 3BDYL 3IYLW 1I7ZA 3VFSB 3QCUH 4J3SA 2BC4A 3WIHA 4OLZH 5CJXC 5CD3A 2PTUA 1K5NA 1LP9F 2LVCA 4XNUH 2FX8L 5B8CC 3G04A 1BQHB 2D4FA 1HINH 5ALBH 2VTFA 3HI1B 1CD9B 1KOAA 2AXGB 1JGVH 4NRXB 1MCRA 4QRRD 1UFUA 4CL7A 1QYGL 5E2UL 3QUXD 3OR7B 4L5FH 5F1SA 4U1MB 4FQXD 2PXYA 1OAKH 5LGHL 3ARFA 4U1HB 1CD8A 1J0YA 4HLJA 1W2KT 4F3FB 1EVTC 1RZFL 1T2QL 1EGJA 3FZUC 4HWBH 1PLGL 3UZVB 5BOZG 2EDBA 5GSRB 3F12B 12E8L 2RCSH 2UYLB 1N4XH 1RJLA 2X2YA 3O4LA 5I0DA 1REIA 3QA3B 1D6VL 2GAZA 3VW3H 5JW3L 3BPOB 3TBVB 1G6RA 1X5GA 3FAWA 5IUSA 3RU8H 5C0IA 4W6YB 3E6FA 1WJ3A 1JFQL 4KMTH 2PO6D 1U58A 1NGQH 3QAZC 2EIBA 4CDHA 4FNLL 1BZ9A 5D2NA 1JYXA 5IQ7L 3D25A 1RUPL 1SY6L 4UB0H 1AIFB 5C0NC 1GRWA 1CLZL 1HQ4B 1G7HA 5DFVD 1TMCB 2CJUL 1BJ8A 4LEOB 3BN9C 3NOIA 4NUJA 2NY5L 1JRHI 3IS0X 1TETL 2C4XA 3LIZH 4Y4FB 5TE6L 5CINH 3GSWB 3DUSA 3O4LE 1FH5L 3QEQB 5D96C 4S1SL 3K46A 2WBKA 2DWDB 2VQ1B 3FB5B 3JUYA 5FA3B 5L88H 3KPPA 1J1PH 3TT1L 1UC6A 2Z92B 2ZUQB 5EWIH 3VMOA 3D85D 4W4OA 1WBYB 3M17A 4OI7A 2BOCA 4JRXD 1NGYA 4QGTA 4R8WH 5D2NE 1IGCH 5FFLA 4M43L 4Y19D 1PVHA 4PRPA 4RGND 5DWUH 4MS8D 3ROOA 1MWAL 2E7HA 3BP4A 1QR1B 2GTZB 3LSOA 1A6AA 3BPLC 5DQDH 3DGGB 2A6IB 2AP2A 2W0FB 1FP5A 4U1KB 2Y06L 4PD4J 3O6KL 4G3YL 4JGJA 2P43B 4LVEA 4BM7A 3KPQB 5I1AA 4HV8A 1RUAL 1QO3A 4YBLC 1TPXB 4QRPD 3ZE0E 1LILA 1S7QB 1AGBA 4KC3B 1DSFL 3ILQD 3WKMH 5CZVH 4ONHB 5C0DB 2DLIA 3I9GH 1TCRB 3ZKMC 4KWUA 2ESVD 3WMSA 4GAGH 4PRPE 4EEEA 2ID5A 4HT1H 3IJHA 4MZ2A 5GZNC 2V2XB 5DHYA 5K59F 5HHMB 4QHUB 3O41A 5CP3H 4P5KA 5I1LA 2Q6WA 4R2GD 4E5XB 3VXSA 1I8LA 4LFHG 1RZKL 5DRWB 3LV3B 3WUWG 4Q6IA 1UVQB 4U7MA 1R3IL 3UPAA 1QSEB 2J88L 4KH2A 1ZHNA 2APVA 4JQXC 3VXPB 4K3JL 1WSST 4UDTA 1EJOH 1ETZB 3T3PE 3BE1H 1K3ZA 2XTJD 2P42B 2J8UA 2F53D 4H25A 3MOBH 3MLXL 1B0RA 4K8RL 3ZYOA 4XZUA 4CMHB 4HAFA 1MJJB 2ZSWB 5C0EA 1E4JA 1MCBA 2HN7A 3OKKB 2VE6B 32C2A 5DJXB 3LDBB 2JF1A 4PRBA 1KB9J 3OKMA 3SJVD 5T1KA 2VDNH 4NC1C 4S11A 5C0JB 5E03A 4UMGA 4OI8A 3D3VD 3MUZ1 1JPGB 1EEZB 1N7ML 2CKBB 3OG6B 5DMYA 3FMGL 3IVKA 4UINH 2FH6A 2WW8A 4HIIB 2DJUA 4AEFA 3OXSB 4XP4L 3FAXA 1KCVH 1ZA3B 4J12A 3MOQA 1Z9OA 5CSBA 4MXWH 4N1EA 3ZHKA 4HG4K 2L7JA 4YDJB 4MXVF 4S2SB 4LQFH 2A6KA 4KTDL 3KYMA 2OJEB 4WFHD 1FVEA 1RUML 3BZDA 2X5PA 3EDDA 3PWVB 2XWJA 3G6DL 2DRUA 2PYFB 1KXVC 3DMMD 2H26A 1V7NL 3GSOA 5IB2B 1MLCB 4Q58C 1KC5H 5DA4A 3PGCA 1WICA 3CMOL 4GW4A 4LGSB 4JFHD 4XXCC 4ZAKB 1U8IB 5BQ7B 1CD0A 4PLJD 3HE7C 4CAGA 1I1FB 2AXFB 3L1OH 5CP7A 2C3VA 4HWZB 2X1PA 5C0BD 3UTPE 4JM2D 3QH3B 4S1DD 2GQHA 1OOAA 1FNEB 5D2LA 1MHCA 2DLGA 3KJ6L 3HLAB 4ISVB 3QUZC 4WGVB 5FO7A 5JXED 1NBQA 3X3FH 3FN9A 3S34L 4A6YB 5CD5D 4OCYL 4ZO9A 1CGXA 5L0QC 3C60D 5J4MA 3AS2A 2IQAA 3SY0B 2HTLD 1F6AB 5F7KC 4R7DA 5E08H 2VKWA 2P5EE 3AMKA 3FB7A 2YRPA 4ZUWB 4PYHA 4KRPD 1INQA 1KTDA 5EG6C 5HYSB 1NAKL 1KJVB 3RVWD 4CVXA 2YD1A 3LRSB 1IGFH 1IL1B 2W9DL 1S7XA 4PJIB 5GSVA 2C26A 1MCDA 4AM0A 3IAPA 3W9DB 4XTRD 1RZJC 4R0LC 1OCWH 3T08A 3T77A 5D2LE 4PP1C 2ZOKA 3QULB 4FHBD 2E5EA 2VWEE 3ULVE 1QRKA 1L0YA 4V1DD 4JY4A 5HI4D 5LWYH 1M7IA 3ZE1E 4NQED 3RVTD 3X13B 1HHIB 5IEKB 1PG7X 2ICEA 2Y6SD 1QBBA 1YQVL 3BEVB 3QHZH 3QJFA 3AB0C 1UENA 4H8WH 1WCBB 1KCKA 2WUBH 1YY9D 5JTWA 1PZ5A 5JHDB 4KQ4H 4NKOA 5L2KA 1OQOA 2OTUB 1L6ZA 2E8ZA 2PF6A 5I8OL 5F9OL 1G9MC 4EN3B 5DRXB 1TJIH 1V05A 4G8GB 2ZCLL 4LBEA 1YEKL 3SE4C 3LS4L 3H0TB 4YHZH 4PGEB 1DLHB 3PDDA 4U1SB 4PJXF 3F5WB 1MJ7H 3L3GB 2X1QA 3HAEA 3GSRA 3IJSB 1A7RH 2R56H 4PG9A 5IWLA 1H15A 4WW2A 4WWID 3WKNA 3RI5K 1X6LA 3QZWG 5GS0L 1ZXQA 3U4AA 4TSCH 4OZIA 2Z35A 1ONQA 1CE1H 1BVKB 4BKLA 3NA9H 1SJEA 2W91A 2XTLA 4IRSA 1EV2E 2JLLA 5JPMA 4WDIA 2A2QT 1LD9B 2H6PA 3ZE2F 4OFYD 4LSPL 3BD5A 1M05B 4HS8H 2CIKA 5L2KE 4IRJD 5GRWA 3MO1B 1JGEB 3QDMD 4GRLB 4LLYB 4PIRF 3S35X 4LLDA 1OP3K 3CLFH 4YDIH 2DBLL 1UWXK 3VGBA 1DBKL 1U8OB 5E8PA 4HUWA 1OY3B 4NDMA 3EYQD 3CIQA 1ZAGA 1J0JA 4HCRL 4MNHB 1TQBC 1YNTA 1I4FA 5EOQH 4P2RB 3NPSC 3V7AE 1OP9A 1U9KA 3UTTB 1KIRA 1UADC 4OZIE 3N1QC 2M2DA 3U36B 4K9EL 4ZYKA 2PYEB 1MAKA 5FA4B 3GMQA 2EC9T 3TJEH 1I7RA 4FZ8L 2DWEB 4I2XA 2GITA 5GIRA 2G9HA 3LPFA 5GGUB 1ND0B 1QBAA 1MFAL 4PUBL 4YHIB 1AFVH 2NY3B 4GKZB 2DIAA 2GFBB 3P4NB 5HGAA 1K9TA 3WHXA 1Q9WA 2HRPL 3S4SA 4HAGA 4NZRH 4DFIA 2Y25A 2JE8A 4MJIB 4JLRA 1W0YT 5IP4A 2LV4A 3HNSH 1D5ZA 4IJ3B 3GJFA 3VRIB 2CUIA 3CSYA 1O7SA 2ATPA 1T03L 1V7MH 3RWDA 1NCCH 1ZT4A 2VRAA 3DRTA 3C09C 2CDFA 1XF2B 1IEHA 4LSSL 3CPLA 5TQ2H 1FO0B 3QQ3B 1VERA 3D6GA 1FFNA 2W65B 2Z31C 5F9JB 3SDDA 2XYCA 3OR6B 5A2JH 3TCLB 4ODWB 4WY7L 4G80B 1N6VA 3LD8B 5GJSL 2VDKL 4P59L 2ARWA 4ZDHB 1MJ8L 2QHRH 1LEGA 4P4KD 4ZTPL 5T1LD 4HGWA 5JDJA 5BJTA 3CVHH 3L5WA 3SO3C 1HH6A 3F7RA 4LGPB 3T0EB 2GK0A 5C70A 2PCPA 2HYMA 5IR1B 4XX1G 5FM5M 2XQYK 3TIEB 2YKLL 1IEBB 4LLMB 5TE4L 3BXNB 5T3ZD 2H8PB 4LIQL 4PJ9C 3DETD 3PNWA 5IW1B 1EX0A 4YFLF 3LKQB 8FABB 3O6FD 4PRAA 3HZKA 2HJFB 4BH7A 5E5MA 3U0PB 1I3VA 2DQUL 4XPGL 4FMFA 5HYJA 3VD3A 2HVJB 3GUTA 5DC9B 2BXYA 3RUGA 3WNOA 4H5SA 1OD9A 2CSPA 2ARJQ 1UZ6F 5I71C 1T04A 2F19H 1GPOH 1R3JB 3CK0L 5CUSL 4ZFZB 2BRQA 3EIFA 4FQ2L 4QXTA 2E27H 1HOCB 1PJ9A 4D9RE 3WJLA 4E0RA 1IM9D 1IJ9A 1FN4A 3DVNB 4ELMF 5SWZB 3W0WD 5JW4R 2IH3B 4ODUA 2HKHH 1EFQA 1PX4A 3G5XA 1G7MB 5FF6A 3FKUS 5D71H 1RHHB 2VR9A 1A5FH 1FBIH 2D31A 3WS3B 3BOVA 5BXFB 2R0KL 5HJ3A 2ICWA 2VDQH 3I3EA 3OGCA 2DQHL 4YXLL 2SEBB 4U6XA 4YR6A 4D0BB 4ODBD 1WIUA 2AV7B 4MNQD 3VGAC 4XNYL 4P5MB 3SDAD 3TBSB 5CJ8A 2OL3H 3W81A 4ODSL 2ZCHL 4ZTOH 3RUGE 4F8TA 1Y6MR 4G6AD 2VLRB 2H3NA 3BQUC 2NXYD 4JFFB 3GI9H 2H32A 1YNKL 3DYPA 1FYHB 4XNZB 3WLBB 4QRRA 1SJHB 2ICCA 5I74C 2IBBA 3DUUB 4ETQA 1ZSDB 1NEZA 2CDGA 2EIDA 4FQXA 1FAIH 4W6WB 2KZWA 4FA8A 4Z7UB 2FNBA 5FGBA 3UZQA 3V2AR 3ET9F 3HMWL 1CTNA 2JCCB 4F7PA 1T1ZA 2Z8VC 4E41E 4DAGL 5C86A 4Z7WF 1FZMB 1NGPH 4YXHL 1BP3B 4JFEE 5IW6B 4X6FB 3RL2B 4XGZA 5FV1L 3RNQA 2YBRB 5C08D 5I1EH 3EJYC 3IKCB 5HPOA 1BAFL 2BVOB 4KTEL 1KG0A 3MRQA 3R06B 2YUWA 1CDUA 4Q9QL 3OXRA 4O4YH 1O0VA 3MUY1 4PD4K 5DVKA 1K8IB 5I1DA 4OI9A 1GSMA 2GT9A 2I9LA 4KHTL 2EECA 2ORBH 4ELKA 2RR3A 4QRRE 5LBSH 1CGVA 2OL3B 4TRPL 5MEQB 1G7PA 1JGDB 3AAZB 2H2PD 2WMPA 3T65B 1MFBL 3KLDA 3L3IB 2EDEA 4DUWA 1RJZB 2FIKB 7FABH 4FXGA 5HBBA 3T1WA 2MSPA 3FTGB 1T7VA 3EYFA 4P46B 4Z7QF 1X5LA 2X4RB 4MA7L 1Q0XL 5C09D 1I85C 2CO7B 1YQ2A 4DWHA 5CBAA 5GHWL 1BHGA 1D7FA 4GW1B 2XZAL 3H9YA 5I19L 2OQJA 4ZFGL 3ZT7A 2OK0L 3GSNL 4NBXB 3IU4L 5DJ0B 1DEEA 1MVFA 7CGTA 2KPNA 2VZVA 1LK2B 1RJYA 5C0AB 4YJZL 1F2QA 3D85A 4JRXA 4U3CA 5DUBB 5BZDB 2AVGA 5CGYD 1BMGA 2I9TA 3IFNL 4ZFFB 1MCWW 5DT1L 4Y19A 4MS8A 4HC1H 4HF5L 4LVNC 1NAMH 3TNNB 5IEHA 4LLQB 1VFUA 3PP4L 4N0UA 5HYEA 4M7KL 2N4IA 4X9FA 1A9EA 1C5CL 4MXQC 4TVPD 3ULUC 3RKPA 2VISB 4OAWB 4JO3L 5E0QA 3WIHH 4NN5C 4HIJA 4PJ7B 4XPTL 4Z7VF 3I50H 2V5SA 4QRPA 5D1QB 4KVCH 4KUCD 3ULSB 5J11B 2JKXA 1KB9K 1FLRH 4CMMA 1VGEL 5GPRA 5GGSB 1TTGA 2A0LC 3EAKA 1BQHG 1RZ7L 5AG8A 1A7PL 4JRXE 2R1WA 1QEWB 2ESVA 3DHJA 2EXWD 4GBXB 4WGWB 3THMH 4Y19E 3JV4B 4MJ4A 4RGNE 1A6ZB 1MQKL 5DSCB 3BO8B 4ODHH 4AMKH 3PL6D 4L4JA 6FABH 3KG5A 5E6IC 4YHKL 5KG9B 2R8SL 1NFDF 5ID0B 3HFML 5KVFH 1FC2D 4GG6F 4XT1C 4X6CF 1YJDH 5GRUL 2VC2H 1KLFA 1MH5A 4MHHI 5ACLA 2VLKA 2IADB 2MWCA 5FHAH 5FECB 4QRPE 5A2IH 5HD8D 1G6RH 5HHXL 1NAMB 3RWGA 3SDCB 3VH8A 4S0UC 4DN3H 4LNRA 3HI5H 4OTXL 4BYHA 4N8PA 3WFHA 2BC4B 1OAUL 1BEYH 2Z9TA 5CD3B 2DJ4A 1K5NB 2F53A 2CO6B 2VZ1A 4YXKL 1AE6L 3G04B 5J1SC 5KW9L 1VDGA 1QTYT 3RGVD 1MCOL 1LK3L 1A7NL 1DUYA 1DFBL 4KUCF 5GS1A 2BY3A 2OTWA 3TFKD 4X7SL 2PXYB 3SJVA 3I84A 3LZFH 4LSRH 4O02H 25C8H 1UKQA 2G5BA 1G6VK 2VLKE 3ARFB 3D3VA 2YEZA 3B5GA 1LMKA 1UB6A 4XNXL 1ZHLA 3O6LH 5DD3H 4HULB 1H3PL 1MAJA 2CUHA 3K81A 3FT2A 1INDH 4HFUL 4KAQL 4QOKB 5GS2H 1WISA 3FO0H 3UJJH 3S96B 5INDA 3L5HA 1IC1A 3O4LB 2F53E 3FO9A 3SBWA 1L9NA 3TBYA 2EH8L 4RCAA 3TP4A 5C0IB 4JVUA 3E6FB 1A6VH 3NFNA 4NC2B 3MV8A 4FFWD 4WU5B 1U58B 1YNLH 1BZ9B 1AGEA 2VZTA 5D2NB 3D25B 4M48L 3SJVE 4JG1L 1XGYL 3B9AA 3D3VE 1G7HB 3F65A 4M1CC 5HXMA 4ALAH 4RISL 5F3HA 5C0BA 4BZ1H 3H3PL 2VDOH 4JANA 3MQIA 2DN7A 4JM2A 4N0CC 1KLUA 4NUJB 4M6ML 3NACH 1RZJL 3QPXH 5T1DH 3ESUF 3WJJC 5IHLB 4LCWD 2YPKA 5DK0B 4J3WA 4XCNA 3DUSB 1UH4A 2R29L 4EJ1C 1XGPA 1SEBB 3BP5A 3DYMA 4KKBC 4DZBA 5HGDA 1FGNH 3IDNA 1U41A 8CGTA 4KKLD 2HFGH 3C60A 5JIHA 3GHEH 3U4BH 3G6JE 3MV8E 3NN8A 2LU4A 1DBML 4EDXA 3M17B 1U8HA 2BOCB 3FQNA 3MUGA 1NGYB 5HI3C 2FJHA 4AEIL 2C4FU 3TYGL 2YPVL 1LQVA 1KCGC 2YD5A 3RVXC 3ROOB 1G9ML 3EYVB 3BP4B 5GGVY 5C0BE 3LSOB 1A6AB 2WUCL 1HI6A 2CK0H 4PRID 4FG6D 4HLZH 2DMKA 2HVKA 3FQTB 5BO1L 3ULVF 1IT9L 5CLTA 4KK5C 1DR9A 1OPGL 3OB8A 4JAMA 1QO3B 5FCUH 4PRHD 1AGBB 1ZOXA 3O4OC 1NCWL 5D1XD 2AABH 4UILH 1U8JA 2R1YA 3IS1X 5FGRA 5B39G 4U7KA 5D7JC 3K8MA 2Y5TA 3HI6L 1CXKA 3EO0A 2LTQB 5ISZA 4ZOBA 3ZKQD 4L29A 4NNYA 3IJHB 4CN4A 4XMKL 4RFEA 2FECI 3MRKA 4POUB 1FL5A 4AIXA 3F6LA 5DHYB 3EHBC 5CKAA 4TUJA 3O2WH 4XBEH 1I7TA 4Z77A 3O41B 3RWJA 2QSCH 4XPHH 1A3RH 3ZKNC 4P5KB 5I1LB 2NY4B 5IOPA 4FQQA 2V2WA 2CGRL 2Q6WB 5ALCH 4ODVL 2NY6D 1QQDA 3VXSB 5T33H 1X4ZA 4EBQL 4Y5VA 5C71A 3DROA 2ZCKH 5FHBL 4Q6IB 3NTCL 3LS5L 3A0OA 5FKAA 5DMGD 4NZUL 1Q94A 3KLHD 3EUUA 2D9QB 1ZHNB 4MYWB 4NKQB 3GSXA 2BNRD 1NMAL 1G9NH 4UDTB 4WHYH 2AJUL 4OFYA 2YUXA 4G43A 3OAZH 4GRWF 4IRJA 2J8UB 3QDMA 2ZNWA 3FQUB 5ISZE 4OIAA 5HTSA 4H25B 4EKXA 5KJRH 3WS6A 4XZUB 5FYKD 4OFDA 3GHBH 1CBVH 2OSLA 5C0EB 4I0PD 3MXWH 3TBTA 2HN7B 1SM3L 5C9JA 32C2B 2MCPL 4PJGF 3VXQA 2FGWH 1F4HA 3N1GC 4PRBB 3OKMB 1OAXH 5T1KB 3K8KA 5TF0A 5J1AA 1BD2A 3ULVH 3S97C 3MZGB 4IS6A 1XF5A 3GMRA 1TDQA 5HYIA 3TF7C 4KZEL 3IVKB 1UJ3A 3SKOA 4KK6D 1K6QH 1XCTA 2X70A 1T5WA 1ZKAA 4AQOA 2QADB 3EFDL 3F7VA 3UDWA 3QDME 3RVUC 2I27N 3W11D 3WHE0 2ZSVA 1TZIB 1JGLH 3P3YA 2A6KB 2BVEA 3KYMB 4KROB 1FVEB 4PB0L 1MCNA 4GRMA 2XWJB 3NAAL 1ZS8A 4NQDD 2WNGA 4YE4H 5EC2A 2H26B 2FL5A 4LSDA 3GSOB 5JZ7C 1QLFA 4KVNL 3PGCB 4M1GH 1KEMH 2CLRA 2E7LA 4GW4B 2FX9H 1BD2E 1P7KA 2W59A 5L6YH 4O2FA 4KGLA 5CP7B 2C3VB 5C0RH 4D9LH 3TO4B 4OZGA 4I8DA 2HG5A 3LHPH 3CLEL 1CIDA 4NKDA 2X10A 1NLBL 5F6IB 3ZL4H 5D6DC 3R4DA 5DUMH 5EZLB 3QWOA 2X4NA 1UM5H 4OGYL 4P4KA 5D2LB 1OTSD 2YHGA 3OKDA 5T1LA 1MHCB 5CEZL 5IJKA 1B2WH 1RIUH 4GRWH 1H3WM 5FO7B 5EU7C 2D03H 1F4XH 1FZOA 1AQKL 1ZGLM 4RWYL 43CAA 2NY2D 1MCJA 1KB5A 2RHEA 2VAJA 2AEIT 3HAEH 5KVMC 3HE6D 3FB7B 3MLVH 4JO1H 4D9QE 5BVPL 1FDLL 1INQB 1KTDB 3VFWA 4CVXB 2E7LE 1YY8A 4KI5F 4P3DA 1S7XB 4OB5H 5GSVB 3MRDA 1J5OH 3O6FA 1A1OB 4AM0B 4JN1H 4OZGE 4GAYA 5SX5K 1KTKE 4U7SA 4ZPTA 1PQZA 2I60H 5DJZA 3VFRA 1J0HA 5GGVH 4QY8A 3QSKB 3T77B 5KZCD 3ALPA 3OHXA 4NJ9L 2ZOKB 3UJIL 3QIUD 2NY7L 3MA9L 4G8FA 5DDHA 1T1XA 3RFZC 1GIGH 1IM9A 1I3GL 3ARUA 2ICEB 3W0WA 3QJFB 4UT9L 5GISL 4I18A 4XMLL 5C9KA 1RK1A 3AM8A 3BUYA 1DBAH 3JTCA 1HIML 4NKOB 5L2KB 1MNUL 1Q38A 3ARPA 1XIWD 1JYVA 1IKFH 4ERSL 4TNWK 2UY7A 1QKZH 1ACYH 5EA0L 4LBEB 1CVRA 3BPOC 2IWGA 2FX8H 5F88A 3SE3C 3ELAT 4MNQA 4UV4L 4BSVA 3UYRL 3MMEA 2R2EA 3HAEB 4N5EA 3GSRB 2RQ8A 3SDAA 4LSVH 2JJUA 4PG9B 4LDEB 1H15B 4WW2B 4XP5H 5E56A 3DVFA 4V3EB 4OZIB 2A83A 1ONQB 4XP1H 4J3VA 3GRWA 3C6LA 4X4XA 4BKLB 1I7UA 1SJEB 3FQWA 1CZ8L 3GJFH 4IRSB 5HDBF 3KPOA 2ADFL 4N1HB 4M7LT 5JPMB 4NN6B 4GKSA 1YC7A 2NY1B 4WDIB 2A6DA 4WTWA 1GGBL 1MHHA 2H6PB 1U8NA 1RZFH 1T2QH 2CIKB 2DB8A 2PNDA 2VDLL 2YWYA 1PLGH 5J3HD 4XAKE 1IAOA 4K8RD 4Y4FC 4LLDB 1FYTD 1AJ7H 3WL9A 4DKEH 2OR9H 5E8PB 5C08A 5JW3H 5LVEA 2DYPD 2ILLA 4MNQE 4HUWB 4NDMB 3V6OC 1T66D 5BV7B 3HMXL 4XI5C 1YNTB 4PR5A 1I4FB 1AD0A 2ZUQC 5K9JL 3PV6A 5KANG 1KIRB 1AP2A 4X8XA 1BVZA 4X8JA 4ZYKB 4RMSA 3HC3H 3GMQB 1I7RB 4CVWA 4XNQA 1CLZH 2EYTA 1UYWL 4I2XB 2GITB 5GIRB 2G9HB 4NCC1 1GAFH 2R9HD 5HGAB 3HZMA 3WHXB 4X0KA 1Q9WB 1Z6JT 3S4SB 1WT5A 1MUJA 4DW2L 4JLRB 5HGGS 5FUCC 4Z7OE 1D5ZB 3GJFB 4S1SH 5C09A 3CSYB 5C08E 1TPXC 2ATPB 4IHOA 3ULUL 2A9ML 3RWDB 4KDTC 3Q6FB 3BGMA 3DRTB 1CFTA 2CDFB 1NL0L 4K2UL 1YUHA 4TTDD 3B5HA 4U3HA 3CPLB 2WWMD 3SE9H 3GMMA 3SDDB 3UYOD 3TESA 5T1MA 3UC0L 3N0PB 4CU7A 4PLKD 1NC4D 3V52L 3SQOL 1KCSL 4OCWL 1LEGB 3LEYL 4HGWB 4K94C 5SV3A 3L5WB 1HH6B 1KULA 4JCLA 2GK0B 2PCPB 4DKFL 5AD0A 5F1NA 2AEPH 2HKFL 3ZTJH 1KEGL 1PY9A 3U1SL 3GFUA 1IGMH 1JNLH 4MQ7A 4YUEL 1D5BA 1VGKA 2V9QA 3NPZB 4JQVA 1RZIA 3PNWB 4UOJA 3L7FB 4N9GA 4PRAB 1W0WA 3HZKB 4HDIA 2NR6D 5EU4A 1A21A 3LN4B 5FO9A 4CMHC 5HYJB 1X5KA 5F97E 3GUTB 4P2OD 3RUGB 1ADQH 4H5SB 3U9PL 2O5XL 3WEXA 1T04B 2EYRA 1N5AA 3LDBC 2WY3A 4U05A 3H9SD 4KK9C 4QXTB 1F3DH 4JFQA 4PBWD 4JR9L 4E0RB 2VLLA 4TVPE 5CCKH 2APFA 4ODUB 3FN0L 3G5XB 4AY0A 1WZ1H 4NNPL 4OCRL 3EJZD 5GRXG 5FF6B 5FK9A 1TVBA 4HUKB 2OJZL 5F1IA 2BFVH 5IHUL 2D31B 3NZHL 5HJ3B 4D2NA 2WLYA 5LAXA 2ICWB 4Z5RA 3PDOA 3U7WH 3PV7A 4U6XB 5ADPH 5L9DH 5EU6A 1SEQL 1I1AA 1KGCD 3MLXH 2ITCA 4OLWL 1IZJA 4QCIA 3C87A 3LPGA 4U6TA 5DQJA 5I1KH 3MOAL 5GS0D 4G6ML 2P46B 2GUOA 4MGXA 2UWEF 5ID1B 4JPKH 5CS7A 3RGVA 3FFCD 4HUNB 5ITBH 5H94A 2H3NB 3E2HA 4F9LC 2H32B 2D7MA 5K9QI 4QXGH 4QRRB 4ZAKC 1EMTL 4I0CC 3QUXB 3TFKA 4ETQB 1NEZB 2CDGB 3PIQA 4FQXB 4NO3B 4WUKL 2V7NA 1F3JA 1MCIA 4F7PB 5CEXA 4M4RA 3V5HA 1T5XA 1Q72H 1T1ZB 3LN9A 4NFCA 4XP4H 4R4ND 3IDMA 2FIRT 3QUMA 5IVXF 3ME0A 3WO3B 1P84J 4LQ1A 3DI2B 4XGZB 5EU6E 3RNQB 1CDBA 4KTDH 4JDTL 3IB4A 2X4OA 5LXGH 1KG0B 4HUVA 3MRQB 3FRUA 1MJUH 1RHFA 4L9DA 3OXRB 4LPXA 4MMXC 2R0LH 1V7NH 5I1DB 2GT9B 2I9LB 1DE4A 2EDXA 3BAEL 4E42A 5I15L 4RMTA 3E3QC 4ELKB 3P0VL 2ZPKL 3CMOH 5C3TA 3VWKD 2IH1A 4C58B 2FB4L 4GSDH 1WBZA 3NH7H 3RQ3A 2NLJB 1HHKA 1G7PB 2CQVA 3S5LG 4FXGB 2V5MA 4YHLL 3EYFB 5C7XL 4ZPVA 1Y0LA 1H3GA 2YC1A 5EN2A 5FYLD 3UZEA 2A77H 2GEEA 5IMMA 3DARA 1A3LH 4LCWA 1P5UA 5CBAB 3S34H 3X12A 3T2OA 2WBWB 1X4XA 4JM4H 2ZJSL 2OQJB 4JFZL 2R2BA 4BUHA 3S37L 2AGJL 2H41A 3G6JF 1DEEB 2G2RA 4OD3H 1KBGL 5I8CA 1RJYB 1ZV5A 1CU4L 1JMXA 1ORSA 3D85B 5HHOE 3WNKA 1OW0A 4M8VA 4HGKC 1NKRA 4EN3C 4QLRA 3CFBA 4JRXB 5ACZA 2W9DH 2W0LA 4MAYD 4ZODA 5JHLL 2NYYD 4MVBC 4DEPB 2CMRH 4Y19B 4RGNB 4ACPA 1LEIA 2EYSA 5JXAH 1UM4L 4QWWC 5FUZL 5IEHB 4N0UB 3QFJD 4XH2A 4Z95L 3NIDE 1A9EB 5GZOD 1NGWA 2P1YA 4LCWE 1YPZE 4OM1H 4OUUA 4O9HL 3RTQD 4HIJB 4R26L 3KYKL 1K4CA 4IOIA 5HHQA 2ADGA 5KSBA 1ZVHA 4G9FD 4KJPD 1ZHKA 1IFHL 1YQVH 4QRPB 4PRHA 1YEJH 4U6YA 3IXTB 4JHZA 5CJOH 4CMMB 3VRJA 1F11A 5D1XA 3QO0A 1R3HA 3MGOA 2AJYL 4GRLC 4J23A 3N06B 5F9OH 5EORL 2AW2A 1L4IA 4YFLI 4UBDC 2R1WB 2ESVB 1YEKH 3PABA 2VN4A 5C6TL 1ZA6A 2BY1A 2R69H 1L0QA 4H8WC 1EFXD 1JV5A 3CFDA 2BXZA 4NHCL 4XB7A 1J8KA 2F8VA 3T09A 3E0GA 4IRZL 3UJTH 2Y5EA 3WD5L 1HHHA 1KJ2A 3WUWA 3EOBA 1WAAA 4Z76A 3LQAH 4R2GB 2GSGA 4QKXB 2PN5A 4KTYA 5J0BA 1DBJL 1MH5B 1DQTA 5KSBE 1BX2A 4XP6L 4RFOL 4HIEA 3QBTB 3RWGB 3VH8B 2AS5M 2NY3C 4LNRB 4FTVD 2BNRA 3EOAA 5LCVL 2F74A 3WFHB 3WIIH 5EOCH 4IJ3C 2DBLH 2XTJB 4XB8A 3MLYL 2X9XA 2F53B 1QFHA 1DBKH 3B2VH 4WENB 3U48A 2Q7YB 3OKLA 5MEND 2J5LB 1EAJA 3IGAA 1D5IH 4PJFA 1DUYB 4I0PA 3DXAA 5GS1B 3W82A 4RSVA 2HTKC 1HYSC 2BNQE 2OTWB 5HPMA 4K9EH 1R6VA 3SJVB 2G5BB 3LD8C 2UVEA 1JTOA 3D3VB 3S35H 1UB6B 4CN1A 3VFOA 5ICZA 1ZVSA 1ZHLB 4KKCC 4OQTA 2BNRE 1TNNA 2HRPH 2WWKO 5FCSH 3FT2B 5JW4Q 3T0EC 4OLEA 1ZEAH 3W9EA 5JOEA 4LPTA 3FO9B 3OX8A 3KXFD 3QHTC 2Q8BL 4MLIA 1EEYA 3KR3H 3EZJB 3TBYB 5FYKE 4PJFE 1GOHA 4JO2H 1BF8A 3OB0K 4WO4A 3DXAE 3NFNB 4NQDA 3MV8B 5EUKA 3U30B 1RQ5A 4YBQC 2AK4A 1L7TL 1SY6A 1I8KA 1AGEB 3TPUB 2FEDC 3CXDL 1KPUA 5ETUA 3MRCA 4FXLA 5IGXL 5GJSH 4LRIC 5F3HB 3RIFF 5C0BB 3QDJD 4IOFC 2UV3A 4JANB 2OS7A 5L7XH 4MA1B 4JM2B 3OF6D 1U6AL 4PJDF 5A2KH 2WBJD 2R2CA 2YPKB 1RY7B 2BK8A 3RY4A 1NC2D 2X40A 4XCNB 1JNJA 4JFOA 5F1OB 5IMKA 1XGPB 4P9MH 2R0ZH 2C3HA 3BP5B 4DZBB 3OSKA 5GJTH 5HGDB 5MEPA 2OZ4L 4NKIL 3V4VL 3IDNB 2YMXH 4UT7H 4ZUSA 3C60B 2P8MA 5TE4H 4NQDE 4OGXL 4UOW1 5E2WL 5MP6L 3NN8B 1BGXL 3HNVH 4EDXB 3HE6A 4W68A 2AK4E 1U8HB 4KRPB 3MUGB 3FQNB 2HT2D 4MAUL 2FJHB 3I6LD 5GRJL 4L1HA 5D72H 1CCZA 3BPNB 5F71A 2DL2A 2DQUH 3U7YH 2OM5A 4XPGH 2GK2A 5F8QC 5D9SA 1KENL 3MYJA 5FYJL 3JTTB 2DF3A 4KK8C 1YEHH 1PSKL 3P9WB 1HI6B 3NCBB 2V7HA 3Q3GB 3CK0H 1FSKB 5CUSH 2HVKB 1W72H 2R23A 4P48A 3LQZA 4XNZC 5KOVC 4F8QA 4YHOH 1A1NA 3QIUA 3MLUH 4OLZL 3I6GA 4JAMB 4GKNA 2ADJA 4XNUL 5D93B 1L6XA 2R0WH 4QXWA 1ZHBA 3H9HA 5CBEA 1HINL 1U8JB 5ALBL 4N90E 1D5MA 4OT1H 2R0KH 3MJ9L 1H8NA 2Y5TB 2DQHH 1JGVL 3L95A 1UACH 5IIEA 2FO1A 3EO0B 1XIWA 3QIWD 4Z0XA 1QSFE 4L5FL 4L29B 4NNYB 1MCLA 1OAKL 4RFEB 3MRKB 1FL5B 2H9GA 4IMKC 3QZWA 4MJ2A 4DUVA 4ODSH 4KKNA 4TUJB 4Z77B 1I7TB 3C2SA 3RWJB 3VCLA 3UEZA 1HZHL 1CIUA 4P2CG 5IOPB 3KPMA 2BMKA 3IAGC 4RDQG 4FQQB 2V2WB 4HWBL 2DIJA 1X9QA 1QQDB 1MRCL 3RKDD 4Y5VB 4N0FA 1N4XL 5E7BA 3LQMA 1HK6A 1OGAD 3DROB 4PV8A 4PTUA 5FKAB 4HZLA 1Q94B 2OI9A 5EUOA 3VXRD 3GSXB 2K7PA 4P46C 3B2UD 3RU8L 3WFZA 3LKRA 4DGIL 4H88L 3SOBH 4DAGH 2CRIA 4YXHH 4G43B 4KMTL 1QVOA 2XPGA 2KBGA 3QDMB 1QFOA 1NGQL 4HW6A 4IRJB 1FNGA 4L3EE 4HK3N 4AL8H 2O93L 1A0QL 1VPOH 4YIQA 3L3JA 3TH3T 1UJTA 4UB0L 1TXKA 4Q9QH 3PWJA 2OSLB 4HIHA 3SDXE 3B4NA 3TBTB 1H9VA 3U46A 1J0IA 4YFDB 1U42A 5C9JB 4MHHG 3UTSD 4KHTH 3SKNA 1U3HD 3VXQB 1CFNA 3DBXB 1B88A 3EOYG 2FGZA 5JO5A 5CINL 1BD2B 4IS6B 1XF5B 3REVA 3GMRB 5L88L 1UJ3B 3SKOB 2EDDA 1J1PL 1XCTB 1T5WB 3QNYB 5EWIL 5TJWK 3F7VB 3K1DA 2APXA 1Q0XH 3MJGX 4MA7H 5JMRA 2O61A 3MJ7A 2ZSVB 4K94L 2J8HA 1H3XA 4R8WL 4UDUA 1IGCL 4BFIA 2X7LA 1YZZA 4GRMB 2XZAH 5D1QC 3GSNH 5J11C 1PAMA 1ZS8B 5IROC 3AS0A 5EC2B 2FL5B 4J4PC 4Y16D 4XVSL 5DTFA 4EIGB 2BERA 2VUYA 1QLFB 2XOTA 2CLRB 3QQ4A 4NZTL 1PZUB 3QDGA 5E94A 1P7KB 2X4PA 4CJ0A 3T4AA 4GBXC 4CDGC 5DT1H 3IDIA 5IK3A 3L7EA 4OZGB 2HG5B 3ZKXB 3VI3E 3C8HA 1NC4A 3JVGC 5C6PB 3OJ2C 1QLRB 2F5BH 3ROLA 3WKML 2X4NB 5CZVL 4P4KB 4F57L 3OKDB 5T1LB 1NBYA 1D9KC 4U0RB 1Z9SA 4JO3H 1S7SA 4XPTH 3IFOA 1FZOB 4UIKL 4GAGL 3CAFA 4HT1L 43CAB 1KLGA 1KB5B 4HIXH 1NFKA 4QRTA 2CKBL 3MLSL 4NP4H 5D7SL 43C9A 1YEGH 1VGEH 3C5JA 3VFWB 1YMMD 3PWUA 1RZ7H 4RX4D 3HAEG 3K8LA 1A7PH 1R3LA 2Y07L 3CFCH 1YY8B 2YR3A 2WQRA 4P3DB 1HKLH 3QDGE 4AIZA 4G42A 3GRWH 4WI7A 3MRDB 3LKOA 3O6FB 3G5YA 3ARYA 3C5ZD 4GAYB 3HG1E 4ZPTB 1PQZB 2IFFL 5DJZB 3VFRB 5CGMA 3MACH 1P84K 4P2OA 4QY8B 4HWEH 3MV11 2VDMH 3QHFL 4PRDB 4YHKH 4POZD 3OHXB 5EH1A 1UA6H 1EJOL 3BISA 1MCFA 4C59B 2EDKA 2G75B 3BE1L 3H9SA 3MRHA 2PXYC 2XI9A 4G8FB 1F3DJ 5DDHB 3KHOA 1T1XB 4HX1A 1AD9A 1IM9B 3ARFC 2EEAA 3RWCA 3MOBL 4LMQE 1UXSA 3W0WB 1NCNA 1RJCA 4I18B 1RK1B 3BUYB 2C5DC 2VXTL 1P4IH 3N9GL 4OIBA 4OTXH 1YDPA 1MCWM 3PQYD 3KYAA 3RDTD 1OAQH 1CE6A 1X6NA