5HGBA

Hla*a2402 complexed with hiv nef138 8mer epitope
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 70
structure length 274
sequence length 274
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hgbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hgbA01
1AFVH 3IDYB 5DWUL 3SE3C 3LRSB 2FX8H 1S7UA 2ZSVA 1C08A 1PSKL 4L4VD 3S5LB 4WTZA 5MEQA 2C3GA 3HLAA 3B2VL 4LHQB 3KWWB 5ILTL 5BJTA 3T3ME 2DLHA 4L8DB 3OKDB 5F7KC 1IBGH 1QFOA 1RU9H 5GGUB 3BD3A 1WGOA 2I24N 4ORZC 2X4TA 4Y4KA 4ZS6D 4U6XB 3ARBC 1CF8H 1X4YA 3V5KB 4H26A 4JRYA 2R4RL 2R56L 3BSZL 4U2ZA 3KPSD 5C0AA 3GM0A 3LS5L 4NNPL 2NNAB 1RVFL 1ONQB 5DRZA 2OBGA 5J06A 4D0DA 3DHMA 4JZOB 3VXRB 3LKRB 1XF2A 2O26U 3NIFE 3D5OF 3FFCA 1BZ9A 1QEWA 2CUIA 4ELKA 1WZMA 1E4XH 4RQQA 2X09A 5JW3L 3UTTB 1IARB 3CFEB 2EDRA 3U6RA 1VADB 1I9JL 4P46A 5L6YL 1KYOJ 4OZHA 1I7RA 2A6IA 1YDPA 2PN5A 2DICA 3EYQD 2NXZB 1KT2A 5ECJE 1HN1A 4PG9A 4W70A 5CKGA 4TRPL 2QJDA 2Z35A 4IHOB 4PJ5D 4UDTA 2ZOKA 3QIUA 1U92A 2OP4L 2R39A 3ARRA 3CUPB 4KROB 3S36H 1VCAA 1HHHB 4P2OB 4JDTH 4FQXA 4LVEA 2VIRB 4I18C 2NTSP 4K23H 3WKML 3ULVH 1T2XA 4P23B 3EYVA 1S8DB 4ZO8A 4JFQB 3L3OA 5FCUL 1QVOB 5IT2L 1RZ8A 1GH7A 3H9SE 2E9WA 3MRBA 4UDUB 2EDFA 3VFPA 5GRYA 2FX9H 1IKNC 2VXSL 5T3XD 4PP2A 3WS6A 2FHBA 1RZIB 2BNUB 4NO3A 3SGKC 3Q3GA 3CLFL 5ETUA 2EKJA 2V7NA 4NQEA 3JV6B 4YHKL 5CWSA 4MMZC 5MHSD 5D7LA 4G8GE 5F89A 4WRLA 5I1HL 3AM8C 3UROR 4RGNB 4N9GB 1E6OL 4JANA 3AY4C 2QSCL 4JFYA 3K1KC 2F58L 4HUXA 5EU7E 3FMGH 5EO9A 1IILE 1CZ8L 1AQKL 4NWTL 1ACYH 2YZ8A 4JDVB 1T83C 4QHNB 4S1DD 4M7KL 5DO2D 1BD2A 3V79C 4ZODA 3VFMA 4P2CG 1WC7B 1R3IL 3EHBD 4RFNC 43C9B 4PLKC 1N2RB 1N4XH 3N1GC 2VXQL 4A2LA 2FJHB 4M48H 5SWSD 2W0FA 1E4WH 1DANU 3S4SB 3GSOB 3LN4A 3KGRA 4HFUL 5I73C 1E28A 2FO4B 2O5ZL 5DJ2B 5AAMA 4X4MA 3CVIH 4XPFL 2OM5A 4J8RA 5FYJD 2YC1A 4P4KB 4CNIB 5FHBL 4GUPA 3MUGA 4YXLL 2YKLH 4U6TA 4NN5C 3V0VA 1NLBH 4WW2A 5EIVA 4ODXA 3HZKB 4WW2C 5JHDD 1HINL 1EEYB 3S35X 4X7TA 3H3KA 4ODUA 4FQJH 1VFAA 1MY5A 1CU4L 2F53E 5F9OL 2DTML 3D9AH 2EH8L 3ZHLA 4IEFB 5GGRY 4PREA 3BOVA 1DQML 5J6GB 4YQXL 1EZVY 3GSVA 2A73A 1YY9C 4OZ4B 3VDAA 4EI5D 3SKNB 4RGMC 4FQLH 2W07A 1WZ1L 2IPUG 1WBYB 4LK4A 4NNPH 2DJUA 4JFDD 1D5IL 4LCWD 5IB2B 1CDYA 3G08A 1T6WA 3PWNB 4PJCB 3WIIL 1X44A 3GHEH 2JJSA 2MCG1 3UPCA 4F3FB 1R3LA 3G6DH 3FOLB 1EZVX 3GMPB 2AJSH 4JPVL 2YN5A 5F88A 5C0BD 1BOGB 5I1EL 4PB9L 4AEFA 1KENH 2H6PB 4R7NB 4LVOC 1AR2A 4ELME 4N0UB 1OB1A 1UKQA 3HE7B 4NQXA 4MNHB 4CAGA 1EH9A 5EO0B 3HPLB 2PYEE 2HFTA 4AYFA 5C09E 1E27B 4HFWB 2R0WH 3QEHB 4RBPH 1D9KD 3SGKA 4ESKA 2DWDA 5GS1A 5DSCA 3U1SH 2FR4A 3ARYA 1QLRA 2EDJA 5ESAB 1HNFA 1XMWA 3D18A 1J05A 1UJTA 2Q8BL 2HFFB 3LRHA 4HBQA 2XWJB 4MDJA 2NY4D 4OF0A 1J0IA 5LGHH 5EOTB 5EA0L 3ZSTA 5JXED 1CD9B 3S9DB 1A14L 3BESR 1S5IL 3A6CH 5FV2A 4HBCL 3GJEA 5D5MB 3F65A 1PEWA 3T65A 3BDXA 2CIKB 4WFFE 3BRDA 1KCKA 3F7YA 5DMKB 3J8F7 4N1EA 3U79A 3VRLE 1MFAH 3VGAB 1EBAA 1KCLA 2PXYA 5DFVD 4NHCL 5I76B 3MRHA 1RSFA 1GGTA 5FM5M 4JN2A 1NGYB 2VQ1A 4GAGL 1DBKL 4WW2B 3WJJC 4TVPD 4LSSH 4Z0XA 4J1UB 2K7QA 3PWJB 2EYRB 3T4YA 5DT1L 3WNKA 1BOYA 1R3HB 4CADA 1GC1L 1RD6A 3TP4A 1Q0XL 4N5EA 4KMTL 3EZ8A 3S37H 1QBML 1RZ7L 5HVWA 5JHDA 3RVWD 2XZQL 4OGZA 3BN9C 5DQDH 5EORH 4PJEF 2JLLA 3RPKA 5FYJU 3ARGB 4ZO6A 3T8XB 2OI9B 3BISA 4P5KA 3TFKD 2CH8A 3TGXA 5IB4B 4EI5A 3HAEB 4WI4A 2FO1A 2AXHA 3OKLA 1X4ZA 4F8QA 3AU1B 3ZE1F 2LTQB 5LBSL 4AZ8A 4DGIH 1C5CH 3TV3H 2D0FA 4NQCB 1OAYH 1CGXA 3LD8B 1X3DA 1A3RL 1CGTA 2JJTA 2PO6B 5D7LB 4N5EC 5F89B 2OYPA 5HSFA 4TUOA 1BPVA 4LLUB 1EMTL 3QXDB 1FZOB 4AEHH 4ENEC 4K7PL 4R97C 4UNVA 4YXLH 4FQQA 4NZRL 4P5TD 2FD6H 4TOYL 4U1LA 1PLGL 3CVIL 4JRXD 4XPFH 1GAFL 4G5ZL 4YFLF 1ES0B 3FZUC 4KXZI 1K6QL 1MCWW 1EFXB 2OQJA 1OAKL 4NGHL 5E5UB 2FNBA 2PYEB 4LCWE 3D39B 4R7DB 4DTGL 5E03A 3OQ3B 4L3EA 4UDTB 5D7IB 5KS9F 5E2JA 4WUUE 1F3RB 2E8YA 1U8NA 2J7LA 4C4KO 5DMGC 3QUYD 1EFQA 5D4QA 2X70A 1ADQA 2KBGA 2X4OB 1MIEH 4FABH 5D1QC 1KXVC 4N90E 1JZ7A 4UMGA 1NCBL 4FFEX 4FP8L 5C3TA 3IFPB 1VFBA 2H41A 3UTSB 4G3YH 3MLSH 3ARGA 1UWGH 3SGDI 4N1CA 3QUZD 1B88A 1NUGA 1ZLVH 1DL7L 2X4RA 4GJTB 2BVTA 3ORJA 1WV7T 4HKXA 1F4AA 3AU1A 1BM3H 4Z9KB 3VFNB 5ANMB 5JOPE 5F8QC 3MLPA 1QNZL 3OJMB 2YD9A 2AEWA 4JFHE 1RZGB 3D2UB 4GBXA 3LN4B 1YEJL 4DZBB 4JRYE 3PV7A 3VXUD 5GGUA 5ALBH 4R97B 3T4YB 5CJ5A 1LO4L 1EHLL 4OFYA 5JPNB 2Z31C 3PXHA 4M4RA 5DS8B 4N1HB 1IGFH 3T09A 1ZEAL 3Q6GL 2VSDA 4D9LL 2IGFL 1K4DA 3GIZH 3L1OL 1ZT4B 3DYMA 4OCRL 4KHXH 1XF3B 1FNSL 3PHQB 4L9LB 1MRCH 5IMOA 2D03H 3T4AA 1NMBH 1QRKA 3IFOB 5I1AA 4PJHA 4WO4D 4HSQA 3VMOA 1ACZA 4NO5A 2XRAL 1BBDL 2QQLL 2V17L 1N3NB 4X6BB 3S6CA 2BRRH 4AM0A 1MWAL 4OT1L 4QXGL 4YFEA 2EDQA 3OWEA 4U0RC 1FH5L 1EAPB 3HS0A 3UX9B 1LHZA 1OARH 2VL5B 3C8DA 2DYPD 4N9OB 1CXEA 2Q76B 4HS3A 1U95B 4YQXH 1U58B 1EUTA 5D2NC 4Z7OE 4P2OA 5AYQA 2IGFH 3NPZB 4H5SB 3FB6B 3QIUB 5DRWA 1JTOA 3KPRA 2Q3AA 1EDQA 1W8OA 2G5BA 1OAQH 5CP7A 5HPMA 4YBHA 2X70B 5E56A 1HYSD 3VFRA 1TZHA 3MCG1 2DQEL 2C4XA 4JHZA 5F7NC 1ORSA 4DKFL 3MUJA 5TE7H 1SEQL 2FBJL 4ZQKA 2FRGP 4H8WH 3TYFB 2HVKA 4S1DC 1MRFL 5D7IA 4KAQL 3GK8L 4WHDA 4JRXA 3KLDA 3HE6C 4EVNB 2FH6A 1MVUB 3HG1D 1C7TA 4DAGH 4WFEE 2HVJA 4ZXBB 2E7HA 4R96A 3VJ6B 3BE1L 1QFWI 4XTRC 2Z92A 2D4DA 3IDXL 3TWCL 1U8JB 3BPNC 1NBZB 4M3KB 2DYPB 3UZVB 4V3DB 3FQWA 4JY6B 3UTZB 4LAJH 4XMPH 2DIJA 2PW1B 1W0WB 2X4PB 3ULUF 1C08B 1Z3GH 3QG6A 5IMKB 4CDGC 4S0UC 1KCRL 2FO4A 2VR9A 3G5VB 3P77A 2AJVL 4D0CB 1E4JA 2AJUH 1KCVH 4OM0L 3LZFH 4ODWB 3WNPA 1DCLA 1ZGLP 2CLZA 4IBLT 4E42B 1IEAB 2BJML 4U6HB 2GAZB 4P46C 5I0DA 5DRZB 5CJOH 3VU2A 1NCCH 4HMDA 2LVCA 1LNUB 3E1F1 4UUJB 4ZPVB 4Z77A 1CL7I 5CFHA 1N6QH 1G7MA 3WYRA 1BAFL 5ACLA 5T5NG 1FGNH 2H9GB 2DWEB 3D2UD 4OLVH 5MEQB 1MFEH 2UY6A 3BEVB 2CLRA 4P3CH 3KLHC 1YEFH 3CGTA 4Y4KC 3T0EC 4DKDC 1M7IB 1ZWIB 3GBNL 3QI9D 1WTGT 4M8QB 4NO0A 4PJBA 2D7NA 1A4JA 1H15B 1IAKB 4EJ1C 4EBQH 4IRJC 5CSBA 1SYSB 2QADB 1TCRB 3L3JB 3TPUA 1UM5H 1JJUA 5FO7A 1J1XH 4POZD 1DVFB 3VFOB 2HG5A 4UTAL 2AKRB 1UGNA 1KCUL 2OJZH 3DV4A 3M8OH 3LKPA 5C0EA 5J11C 3DX7A 3I50H 3CXDL 1JF1B 5HHPA 3U7WL 2AP2A 4XX1E 1IGFL 4KZEH 2ZUQB 4Z7WF 1G9ML 1NAKL 2CMRL 4NM4H 3PDDA 5I0ZA 5SWQB 5T1DL 5ERWA 5I15H 5DFVC 4X5XB 4KXZH 5E9DB 5DT1H 3HI6H 3KNBA 1IM9D 1FJ1A 3KPTA 5C0BA 3SE9L 2M2DA 1Q0YL 3V2AR 5T1MA 4QRRA 3TJHA 5AG9A 3UAJD 3ZL4H 1MIML 5EUKA 1F3DH 1HE7A 2QSQA 3QDMD 2FWOB 2R1WB 1WFUA 4NBXB 5EUOF 4E0RB 4HEME 4Z7VA 4ONOA 3C87A 3QIWD 1RHHA 4PGBA 3AC0A 1LNUA 4KY1L 4RDQF 3FB8B 2HLFC 1U8IA 4Y4KB 4PJIA 3IKCA 1AGEA 1PQZA 2GAZA 4C55A 4K94H 1SJXA 1YMMB 1CLZH 1MFBH 1SBSH 2C3VB 5D2LF 2E7LA 1JNHB 1M05A 2WANA 4TSCL 5C0CE 2X4SA 5ESQB 4APQA 2GK2A 4LQFH 2BHUA 4LU5L 3HHRB 4EN3A 1AHWA 2OL3L 5HHVH 5JR1L 3AAZA 4AEEA 3BP4B 1JF6A 3FT4B 2DM7A 4FRWA 1IGTB 2B1AL 3JWNC 4M6NH 4NQDD 4LEOA 4IOFC 1WT5A 4RGNE 4MMXC 2DLIA 3MV9A 4JN2B 1ZT4A 1BFOA 5CLTA 1EBPA 5JZ7D 5DJ8A 3WNOA 3REWA 1WWWX 2E6JA 3D69A 1JPGA 3EOTH 4YGVA 4LIQL 1FVEA 2W9LA 2VDKL 3K4AA 5INDA 3D39E 1DQTA 5FYJL 3D87B 1FYTE 2ITDA 1I7ZB 3W39A 4OD2B 5E00B 5T33H 4E5XA 3B2UD 4YAQB 4BQ9A 3F5WB 4CW1B 4Y1AD 5IQ9B 4MA3B 1KPVB 2ICCA 3TYFA 5BV7B 1BQLH 3V6OC 5E6IB 5HHNA 4AT6A 4BUHA 3MGAA 1P7KB 4C4KT 3QJHB 3TT3H 4OAWA 4TVPE 3OKNB 1NLBL 3TF7A 2QQQA 3V5HB 1J9CT 4YHLL 2NY1C 4OSUL 5K9KB 4YHKH 2VDRH 3QUZC 3LQAH 2YMXL 1N6VA 1P7KA 4MSWB 3D0LB 3QI9B 3T0EE 2ZPKH 3FN0H 5IBLC 1LO4H 1FGNL 3GMRA 1UVQB 2VITB 5IW3A 4FQLL 3VRLF 1CZ8H 4MNQD 5HHOA 2GY7B 1MCOL 35C8L 1AXIB 3QZWA 1SHMA 3MODH 5JO5A 4PJ9D 4V3EB 2J6EL 4WJ5B 3M07A 1QA9B 2VZVA 2XG5A 3HUJB 3L5IA 4YDJB 5H35B 3ULUE 1V7NH 4UB0H 3MNVA 4P0DA 3R8QA 3I84A 4Y1AE 1I7RB 5E2TH 1S78C 3HZMB 4PB0H 5F6HJ 3TN0B 4XMLL 2AEQH 4W68A 3K46A 5D7JB 2A2QT 3UJIL 5DRXA 3TWCH 3MRQB 5J3HC 4EZMA 5E2VL 5EDXA 4YDKL 3SKUD 2R2CA 5TFSL 1Y18B 3AFLA 1GHFL 3INUH 3SO5A 4RAVA 3OB0K 5HHOE 5HY9B 4C56A 4D3CH 3VGDA 5DJYA 3KAAA 3ZHDA 1A6AB 3ROOA 3FCTB 1WICA 1JGEB 3CLFH 1L0XA 1FLTX 4PJFA 3LKNA 5T3ZE 4YHYC 4ETQA 2OS7A 2P8LA 5T1KD 1I8LC 1QFPA 4ELMA 4NKDB 5DVKA 3KPLB 4WUUD 4R2GD 4EDXB 3NFNB 2F58H 2DQUL 3IDNB 3QHFH 1JGEA 3C6LB 2R1YB 3O6ML 4MNQA 5HHOD 1QHOA 3O8XC 1K9TA 1S7TA 1A6ZB 5JW4M 1I7TB 5HGGS 4WHYG 3OHXA 4XVJL 5B4MC 4YUEH 3TBVA 3D3VA 2R4RH 2HT4C 2BC4B 3EYFA 5FUZL 5CZVL 1T2JA 4H25A 3L6FB 3Q3GB 3ZKSD 2ARJQ 3ARDB 5DD0H 4P5TB 1INEL 5C2BL 3IAQA 3MRBB 3QDME 1ZVSB 3P0VL 3FJTA 1RZKH 3AB0B 2A77L 1MNUH 4FG6C 1Z9LA 5F97E 4JFZL 1RFDH 3UYRH 1MVUA 4YNYA 3EOTL 2E9BA 3RIFF 4LSPH 4R0LA 5F8RC 4RWYH 2IAMD 2CSPA 3TIEB 4ODSL 3BGMA 1T20B 4WHCA 4EQ2A 2HFGH 4LCIL 4LU5H 1NGXB 4NSKB 2NLJB 1TZHB 1RZJH 2ITCB 1KJ3L 3JTSA 2BVYA 5ENWA 1OAZL 2W9DH 4JCLA 3MC0A 5T3ZL 3ARTA 3HNTH 4BKLB 1FYTA 1G7IB 2G9HA 3MGTA 4KV5E 4OKDA 4PD4J 3OXSA 4GRLD 3OKKA 4B7LA 4DVRL 5GGTA 4LOUD 3CX5J 3QNZB 4Q9BA 3V6FB 4O2EA 3H42H 4MA1C 4YHPA 3TIDA 3GKZA 1BIHA 1AKJA 2D7TH 1NBYA 3QUKA 3VXQA 1NANI 1IZKA 4JN1H 4LLWA 4OZFB 5CINL 4YXKL 3MLSL 4PJ9A 1DE4A 1CFBA 5LCVL 4NGHH 3ARFA 5D2LA 4OF5A 4NBYB 2OR9H 3MV11 3NAAL 2HN7B 4X6DE 3MRDB 3Q1SL 4MDIA 3LEYH 5D2NA 3ERYA 4LSUL 3AAZB 4PREB 1ZT7B 4RZCB 1KPRA 2VLJD 5D96C 4LFHG 1FNGA 1ZVYA 4BZYA 4APQB 3QXAA 1GGCL 1CT8B 2DI9A 3ZSSA 1D5XA 4POZC 4BH8A 5I16A 3ARBD 1TPXC 4GSDH 4Z76B 4Z78B 4M6AA 1S7RA 4TSBL 2LVEA 3V4PL 2VL4A 3UBXG 3GJFA 3N1QC 2V2WA 3RUGA 4HUMB 4WFED 2KH2B 4IRJB 2VAJA 2MQ3A 4NC0B 4JY4A 1X5JA 4YZFF 4Q58C 3WLWD 1M4KA 1G9EA 4F15B 4YHOH 4MNGE 2YPLA 1Z5LA 4HKZB 1FFOB 2VABA 1DR9A 4XCEA 2VOTA 4LGPB 3SDDA 3QEHA 1WC7A 3OXSB 3EYQC 4S1SL 1W0YT 3MGTB 5C0BB 1Q0XH 1P4BL 4KUCD 4CJ1A 1XF4B 1XCTB 2WLYA 3BHBA 1Z9OA 5F9AC 4YC2B 5HYSG 1T3FB 3MJ7B 3HC4H 5A1AA 3MRCA 3ARQA 2NTFB 4HUUB 4WEUD 3QH3A 5D1QD 3ULSA 3EFDL 4WUUB 5JLZA 5HHNB 4AT6B 4XXDA 1YNKL 4N8VB 3RL1B 2N56A 3ESVF 5KVFL 2G5RA 5AZEH 5E2VH 3FFDA 3MOAH 1P2CA 3HRZB 5I6XC 1I3RA 4J6RH 5A3IC 4H5SA 2JK5A 2ESVD 1OP3H 3O41A 1DQLH 4MZ2A 1UZ8B 3V7AG 5E1AA 2WBJD 1RJYA 2VUOA 3TBWA 4ZS7H 1VDGA 1PGRB 4DCQB 1TFHA 3Q6FA 3LQAL 4M1DL 4XP6L 2HWZH 4MSWA 4LLQB 4XP4H 1EEZA 1NL0L 4LBEB 4LPXA 5C0RH 2E3VA 1KTKE 5IROC 2X4QB 2I9TA 1FYHB 3VD5A 4N0FA 4QXUL 4JZNA 4OV5A 1MH5A 5BO1L 3RIFK 2PO6A 3HNTL 3Q5TA 4L4TB 4MQ7B 1J0HA 4ZTPH 5HGAA 4N68A 4OJFH 3AROA 3JV4A 3VWJA 5E2WH 5BVJA 5B39G 5TE7L 4HIJB 4IJ3C 4JFZH 1LO3L 1X6NA 1DQQA 4LVNC 4I3GA 1EIBA 2OI9A 1EJOL 1OAZH 5HHXL 5DHVH 3U4BH 1YMMA 1ZSDA 2PR4L 3IJYB 2P8LB 3THMH 3LCYA 4URTB 3MJ6A 3E2HC 2CUHA 3DGCR 3VFWB 1FSKC 1PG7H 4IDJL 2A77H 3GIVB 4WFGD 4K7FA 5EBWB 3V5KA 2DQCH 1OSZA 1X5IA 4XRCA 1B2WH 1M7XA 4O02L 3SY0A 3ZDYE 4DUWA 2VLJA 3C2AH 3RZCA 4I48A 4MQXC 3CFCL 4XNQA 4JHAH 4PIRF 1VFBB 5IJVB 3L1OH 2NY1D 2X40A 1RZJL 4V2CB 3K8MA 4JKPL 4LCCB 1MAMH 4P59H 3ILPA 4LCYA 3HC0A 3RWDA 4LSTL 4OFVA 4JRXE 1EHXA 2O5XH 3BQUD 4Y0GA 3WJJA 4MD0B 5DHVB 1REIA 4DUVA 5TDPB 3RWEA 3UTOA 4XTRD 1N64H 4XMKH 1N5AA 1INEH 3ARSA 2DF3A 2L4OA 4QO1A 4G43A 5CCKH 5GS2D 3IVKB 4NIKB 1FV1A 2IQ9L 2Y23A 5TGBB 3WS6C 4XNZC 5E7BA 4HUVA 5JHDE 2ZUXA 4Y4HA 5MERA 4ZPTA 2CRIA 4FQHA 2OX5A 2UZIH 4DGYL 2D7MA 4HT1L 3AB0C 1HHKB 4YPJA 5E6YA 2A6KA 1CGVA 3HA0A 1U95A 2UWEF 3MLYL 2B4CC 4PJCE 3FRUB 4GKSB 1UH4A 1ACYL 1INQA 2CXKA 1H8OA 5GSVA 5EBWA 2UWEB 3KPRB 4HIIA 4U1SB 5JORA 5FKPA 5BS0A 1C16B 2Q1EA 3F58L 4K9EL 3HI1B 3IDMB 3B3IB 4M48L 1D6VL 3CU7A 5JQ6H 4Z78A 3DOSA 3TPUB 1R3JB 5JHDB 3WV0A 2PO6D 5DI8B 2EZ0D 4UIKH 1KPRB 4NKOA 3SDYH 3J7HA 3VGHA 3W5MA 3MV9B 4XP4L 2VERN 3GMLB 3KLHD 4GXUM 4QHKJ 3PHSA 4MA1B 3T0ED 5EZJB 1P7QA 1MWAA 2CR6A 1Q72L 3WFEH 4MAYA 3RA7H 3V0WH 4XPGL 3S3SA 2EYSB 4NKOB 2R29H 5FUOL 4M5YL 4PUBH 1ETZA 3KPOB 5C0JB 2OK0L 3WKMH 3U9UB 2GI7A 3BKML 2BDNH 2ERJB 1F2XK 4Q9RH 3GFUA 2IG2L 4DGVH 3EYUL 3K4ZA 1ZA3B 4O2CA 3VXUE 2COQA 4FXGB 2MOVA 5AYUL 4KI5C 1ODAA 4PRHD 4YK4C 1HILA 1U91A 3DSFH 1DDHA 3MRRB 2DQFB 3HAEH 3RTQB 3T1FA 2OTWA 5H8DA 5ICXB 4U1SA 5JORB 1U8HA 1P2CB 3HRZA 2ZG3A 4PGDB 3GSRA 5DD3L 2X4OA 4ZQKB 4GKSA 3VXRE 4BK5A 4OLVL 4X4XB 3KPMB 4WUUA 5J6HA 1JZ4A 1T03H 1YN7A 5GHWH 5TDPA 4OUUA 2PYFA 4JM2B 1XGTA 2R4SL 2D2OA 2F19H 5DUBA 4JJ5A 4IIQB 5J13C 3BH8B 3QWRA 5DVMA 2VB5A 3WFBL 3QA3B 4KH2A 1ZGLA 5I74B 1IE5A 4WV1C 1UH3A 2HLFD 3E3QE 4HX1B 3GNMH 1GSMA 3C09B 1RJYB 5IM7A 3LDBC 5D2LE 2F5BH 4Q6IC 5I1JH 3CH1B 4G6JL 1NKOA 1HHHA 5D7SL 3H9HA 5FYJH 2DTSA 3QUZA 4KMTH 1NDGA 1DQJA 1R6VA 4DW2L 1B0GA 3MRJB 4YHIB 1R5IA 4GAYA 3DTXB 1NFDF 5ACZB 4I8DA 1GGCH 1RK0A 2ESVB 1ITCA 5I1CL 3U0WH 4NRZA 2CDGB 5DURB 4IOIA 1XGQB 4M6ML 3VG9B 4U1MA 3FB5A 5HHME 3L7EA 1ZWIA 3CFEA 3RAJL 5CEZH 2J88L 4IOFD 3C8KB 2Y1VA 4KY1H 1PKOA 5CMAB 1JK8B 3T8XA 5HGDB 2VLLB 3O4OC 3KR3H 3MRLB 3U9PL 2CK0H 1VFMA 2VLKB 5GRZA 4LEXH 3PJSA 3K80A 5CJXC 3MRPB 1G7MB 1J1PL 1PY9A 4NM8L 3HMXH 3OKLB 2YOCA 4GG6E 1RUQH 5GRVK 1UYWH 1DE4B 1NCTA 2X89A 3JV0A 3WIFA 3VFWA 5IVXA 3S4SA 4X6BA 3RWFB 2NX5D 4M5ZH 3B2UC 3GM8A 3G6JA 4MCYB 5I1AB 4I9WD 5KZCB 4AH2A 2EIEA 3I3DA 5DRXB 5C6PB 5E5MB 4IJ3B 4OZIF 2I26N 5C0DB 5CCKL 1TJGH 3VD3A 3HZMA 2CKBB 4QRTB 1YEKH 1OGTA 3UDWC 4J1UA 3GI9L 3JVGC 5EU3B 2VISA 5F9OH 5K9QI 2XTLA 1WCQA 3EAKA 3TZVA 3BPCA 5DLMH 5KANG 2ZUSA 5IBUB 3O9WD 4YZFE 3I75A 3BP6A 3BDYH 3S37X 1HQ4A 4NOFA 3O11A 3S4SG 4S11A 1WZ1H 4O00A 3Q6FB 4M8VA 1NCDL 2R69H 2XWTB 1NEZG 5EWIL 4ZUUA 3S3JA 1HHKA 2VLME 3WHE1 5IHZB 4X80L 4PJ9C 4TNVK 2VH5H 3O3EA 2MPAL 1HXYB 1C5BH 4Z5RB 2H6PA 4R7NA 2WUCH 4HH9A 4G43B 2IADB 4GW1A 2CGRH 2BDNL 3HE7C 4X6DB 1BWMA 2X6MA 5IV2A 2VZ1A 4YHZH 5D1ZA 5GS1B 4MD4B 4F2MA 3DV6A 1YUHB 3IDJA 5K33A 5J3HD 3K81A 2B2XH 3V0WL 1QNZH 1BGXH 4GG8A 4Y4HC 3X3GH 4W4OC 4NQXB 5E8NA 5HGHA 1KCRH 4JHWL 5INDB 1NCDH 3WDHA 2YWYA 4Q74A 3U4EB 1BD2E 2ICWI 4JFOB 3RJDA 3RTQD 1D9KB 2X2YA 4X8JA 4LVNB 1MCRA 3IT8D 4UV4L 4BH7A 5DJCB 5DJ8B 2XZAL 4JRYB 3P9LB 4PJCA 3IJSA 5CP3H 5F6HI 4CU8A 4KK5D 3CC5B 1S9VA 3PWLB 4I77H 3E6FA 5E8OB 2C1OB 2Q7YA 3WFCH 5A43C 4RMUA 3I3EA 5F1IA 4GFTB 3GMLA 1AGCA 4ZUWA 1OSZB 5CD5D 2BFVH 2CKBA 3IJSB 5KVDL 3RWGB 3FO1B 1CFNA 4XCCL 3WIHL 3W11C 3OGOE 3LIZL 3NCCB 3ZZ1A 1NGZA 1DBJL 1DN2A 1TTUA 3WS3A 1QA9A 3BZEA 3VXMD 3VXTA 1ZXQA 1OLZA 1UQSA 2HA1A 4YHOL 1RZ7H 2VXSH 3QFDB 3VWKB 4LDOB 4M1GH 3R0MA 3EYSH 4CADB 1MJ8H 4LF3A 1Z9MA 4F33B 5I18L 4Y4KD 5FO8A 1GGIH 4BQCA 3IETB 1LD9A 1OQOA 4WI8A 1N2RA 4MS8D 5DF0A 5KSBB 4WV1A 2VQ1B 4QRRB 3RGVC 1RZIA 3MSPA 3ARPA 3PWUA 2PXYB 1XIWB 5E9DA 2MQ0A 2NCMA 3P4OA 3DUUA 4JFYB 5AUMB 3C09C 3VWJC 4FQPA 5DHYB 5DZLA 3LHPH 3MV7D 4XVSL 3SDAD 4QRRD 3TN0C 1FP5A 2A6DB 3RWEB 4JG1L 1A4KB 3V4PH 8FABA 4H1LG 1A7QL 3H0TB 3C5SB 4JFEA 5HJ3B 3MJ9A 2UZXB 5E8PA 5F9WB 5GRVL 3CH1A 4Z8FL 3N85H 5IESL 4RFOH 4OZ4A 3LQAC 4OIIH 4OLUL 1DQLL 1Q9WA 1PSKH 1JPGB 4YGVB 4PRIE 4JFHD 3CXHK 3QUXD 2I9LB 1YEDB 3MOBL 4ONHA 1RU9L 1QYGL 1G7QA 1KBGL 5CSZB 4DZ8A 4LP5A 1BM3L 1P4IL 1F3JA 1CIDA 3LKNB 3MLVL 3ABZA 2XXMB 5GS2H 3QFDA 4WDIA 1NGQH 4KKAC 3FAWA 3QQ4A 1EHLH 4RWYL 1LO2L 3QIBB 3CZJA 1A5FL 3HZYA 4HWBL 3BGFB 1RZFH 5HGDA 2AEPH 5HDBE 1OP9A 4D0DB 2W0PA 1KCUH 5GGVL 4XBEL 2IQAA 1I4FA 4JFED 5BVJB 5BVPL 1T0MB 3O6FA 4GRLA 4NQDA 3LS4L 3O0RH 2H32H 1JE6A 5E8DH 4J4PC 4F80A 3GMOB 1MWAB 1YEFL 4XBPB 2DI8A 4PV9B 5GRUL 1J87A 5JXAH 3OKOA 1IFHH 3VFGL 1DBJH 2P47B 3MRHB 2XTJD 5IFAH 5B39A 1X5FA 2VITA 1UZ6E 3GO1H 3FO2B 3BZFB 25C8L 1Q9WB 5ERWB 2VZOA 4QCIB 3CSBA 2HLAB 3R06A 2BFVL 2F15A 3TH4T 3Q1SH 1U8OA 4ODTL 3A67L 1MFEL 4M1GL 1NEZA 1I9IH 3RPIB 1VENA 4PBVC 1MHEA 4QRUA 3S7GA 3BH8A 4M7KH 4FXLA 4KRPB 2RCSH 4YBQD 3N9GH 2EC9T 5KG9B 2Y6SD 4G9DA 3G6AB 2R2HB 2XFXB 3QT2A 4HUXB 2MWCA 2BSSB 5J6HB 3QJFB 4QHUA 3QEGL 4LARL 3LKOB 3WIHH 3GRWL 5J13B 4ZUVB 1JHKL 2WNGA 5I74C 3AGVA 3JWOH 1F6AB 5CEZE 3MBED 2EE2A 2YN3A 3G5YA 4L8CA 2XN9B 5I1DA 1QFHA 1KIQA 1CLYH 5FM5O 2IF7A 2BCKB 2GQHA 5C9JA 1S5IH 2A1WH 2GUOA 4TPRH 4ZTOL 1Z5LB 4ONGL 4HJJL 1QG3A 2I60H 3LIZH 2MFNA 3VMPA 1UB6A 4U1JA 1OAXH 2ADIA 3N85L 5A2LH 5IESH 1GXEA 1NMCB 4PRIA 5IIEA 3OX8A 1U3JA 4OIAA 1A9BB 5EUOA 2R23B 4XNXL 3PIQA 3QHZL 1BVLB 5C1MB 4KK9D 5F7UA 1V3JA 4JDZB 2LAAA 3HZVA 5DJ0A 3S5LA 5B3JE 5J6GA 2JJTC 5DJXA 3BZFA 1QRNE 1P69B 3REWB 1NGPL 4NQSB 5BW7C 4PYHA 5A2IH 5JW3H 2DQTH 2X5PA 3CZFB 3QO0A 3RWHB 3A6BL 1NMCC 4FFYH 5F1IB 12E8L 5I1EH 2ZKHH 2CQVA 1I1AC 2C1OA 2Q7YB 2UZIL 3LKRA 3MXVH 2R15A 3HI1A 3IDMA 4BSVA 2ENYA 4L8BB 1LGVA 3SJVB 1SM3L 5D5MF 3RIAK 4OLUH 2NY7L 5L9DL 2B2XL 5ANMA 3S3PA 2HP4A 2XA8H 4KJQC 4R2GC 1FC2D 2F54E 4I2XA 3NGBB 3SKOA 3ECBB 5GIRB 5GS0L 3QR2A 4AIZB 4NFBA 2CDEA 4G6FD 4ODWA 1P6AB 4LSQL 4Y2DC 4I0PA 1YY8A 2NX5A 3TT3L 3BXNB 3CMGA 3WHE0 3MLUH 1MCKA 5GGTH 1AO7E 3HE7D 3ALXA 4NC1C 4PJHE 4LAQL 1U42A 3KYNA 1O5DT 3RVVD 2AJ3A 1HSBA 4BQ8A 3HN3A 1N7ML 2CLVA 5HDLA 2BVQB 4CRPA 4PJEB 4JQIL 4XC1L 5I71B 5CSZA 1Q8MA 3MV8B 1CICC 3DARA 4R0LB 3BUTA 2BXYA 4KTDL 4FG6D 2X1QA 1HZHL 1YNTA 3VFOA 1IM9A 5E1HB 3VW3L 1A21A 3LPFA 3ZDXF 4J23A 3VI4F 3QISA 5E8PB 2R0KL 1AGFA 3KYOA 5GZOC 3RHWF 4ZFOL 5HJ3A 5GS1C 1YPZB 1XZ0B 4OTXH 4OUUB 1T04B 4HGWA 4Z7UE 4UAOB 3VD9A 3VRIA 2ZPKL 5JIIA 32C2B 2H2PC 1HYRC 2E7LE 2FH8A 4ZYKB 3SCMD 4GOSA 1U8QA 2OL3B 2A1WL 4PJ8A 4LOUC 4YEEA 4M7LH 1K4DB 1L9MA 1MFBL 1SBSL 5CJXA 5I1CH 1L0YA 1IL1A 1QKZH 2DQFA 1QLFA 3T1FB 5DJ6A 2E9JA 1CLOH 1J8HD 4YC2C 1ZS8A 2CO7B 1JZ3A 2CDEB 3TZVC 1U58A 4G8GD 4YXHL 2C3HA 3NCYP 5BRZB 3O6KL 4G8EB 1NC2A 1W8NA 5L2KD 3GBMH 3FO1A 3UDWA 3VWKA 1OGAB 3ETBF 3T04D 1I8MA 4NRXA 4F15C 4X9GA 3CDCA 5DJYB 3FONB 5EU6E 4TOYH 4KI5D 1IAII 2Z9TA 3SDXB 2HKHH 4WHTA 2K9UA 1I3GH 3PL6B 3OKDA 1CLYL 1T66C 4L29B 3RY6A 5AYUH 4B41A 1MCPH 3C9NA 3OAZK 3GI8H 3PABB 1QLEH 2NYYC 3FB5B 2WIIB 2ATPB 3JTTA 4YDLB 1UXSB 3HG1A 1A02N 2BVOB 2PW1A 4HCRL 2GW5A 3TN0D 2IANE 2BNQD 5I9QC 2BNQE 2KQNA 1FBIH 5DGQA 3O41B 4MA7L 4XP5H 1H3TA 2V9QA 3ZDYF 1CXKA 3QBTB 3D39A 3QPQD 4PG2A 1A6TA 4R7DA 2C3WA 4WFHE 3MOAL 4RGNC 4Z7VB 3QNYA 4U7KA 2W9EL 2K3TA 4DVBB 4E41B 1J0KA 1IGYB 4YPGB 1FFQA 4O2EB 1KIPA 3OL2A 4GBXC 1T0PB 3KPSE 4OKVB 1GRWA 5KOVC 1FLRL 3CK0H 4QOKD 3BMVA 3O4LA 1S9YA 5J56B 2AJVH 5IHBA 3V4VH 4OLYL 1A7RL 1F11B 5MEND 3GMQB 5ISZD 3HI5L 1CXHA 2W92A 4J3WA 3KDMB 4DQOH 5B38B 5D7KD 4JFFD 3LEYL 1HK6A 3UTPE 1NGXA 3QWOA 1LP9A 3L9RA 3DX9B 3O11B 4KKAD 4PY7B 4G8IB 2Y07H 1MUJB 3C5SA 3EO0A 5LCVH 4EEEA 2X89D 3BWAA 4LSRL 3TZVB 3BW9B 2FECL 5K9OB 3OB8A 4I0KA 3L5HA 1UWXK 1Z2KA 4IM8A 4OZFH 3S97C 1FO0B 3H2WA 1WAAE 5IMLB 4O2CB 1PD6A 1X5YA 3TJEH 1CFVH 4XZUA 5DFTA 1D6EA 1J0YA 3S5LG 3RY4A 3L3DA 4JM2C 1VPOH 3BUYA 3JTTB 4J3SA 5CIPB 1KEMH 2PW2B 3BH9B 3U9UA 1AXSA 5FF6B 3VD7A 4M6MH 3K4DA 5IJVA 4WTXA 5E5MA 3QDJB 1IC4H 4N0CC 1S7SA 1NDMB 3LV3B 5D2NB 3C5JB 3ZT7A 3LVEA 1K5NB 1RULL 2QSVA 4G7VL 4J8RB 2Y07L 1FZJB 4DZBA 4NQDB 1FQ9C 2IQAB 1SJHB 3VI4E 1KC5L 4W6WB 1VB9A 4YE4L 1IRAY 1I1RA 3ZDXE 5MEPB 4X8JB 1WEJL 2WBJA 3DROB 3VE0B 1CXFA 2QTEA 4FFVD 4LLVB 2ZJSL 1U0QA 2GTZB 1P9MC 3GK8H 4QYOA 3B9AA 3K2MC 4PRPE 1M7DB 1Y0LB 2V7HB 3DLQR 3L3HB 2XA3A 3ROLA 3L7EB 4QY8B 1DUZB 4PGBB 1YC7A 4PJAA 1JL8A 2DLEA 2VO5A 3BVNA 1LP9B 1XH3A 2ZCKH 5CS7A 2CDGA 5CBAB 3CFDA 3FQTA 2A83B 4ZSOE 5HVGB 5ISZE 2H32B 4QRPD 4X6EA 4Z5RA 5K93A 1Q9KB 3I50L 4RSVA 3HRPA 1BFTA 5C08A 2XNAA 5JDJA 4MXQD 5GRJL 1FJ1B 1CFQB 4OIBA 1BWWA 3TNMB 3MLUL 1CS6A 5BRZE 4C83B 2VN4A 3BQUC 4HX1A 4OBSA 1NCCL 4JO1L 4NQED 4KMLB 5E08L 1YNTB 4YIQA 4P2OC 4GG6F 3V6OA 1S3KH 1JWUA 5DTFA 5SX5H 1U9KA 2W38A 5TQ0H 1KSRA 4LASL 2BC4A 3EYFB 4LPWA 4UBDC 3CSGA 4Q2ZB 1EJOH 2WY3A 1FRGH 3D18B 3WXWL 1A7PH 5CUSL 1LVEA 4KROD 3ZDZF 4C54A 2A73B 5F7EH 3DRTB 2IAMA 2C1PB 5MENA 1IAMA 5F9JB 5FGCB 1UM6H 4NPYA 1QACA 4QY8A 1G1YA 2YKLL 4GH7B 5C0DA 3WNNA 4GXVL 5GQBA 3C6LA 4I4WB 1CD1A 1I1AD 5SWZB 5HTSA 4P3WA 3TBYA 5CD5C 4BZ2L 4IRSB 5FYLL 1AJ7L 4M3JA 3PP3H 4LLVA 3SDYL 3RZCB 1NFDE 4DEPB 3EDDA 3EKCA 4HKJB 1R3LB 1BZQK 2GJZB 1NCAH 2F53D 1TVHB 3MV8E 2X7LB 3F5WA 2FB4H 1S9XB 1XF5B 5ICXA 3QPXL 1KELH 4JDTL 2DQIL 3DIFA 2DLGA 4QYOB 2EYRA 2P5EA 2P7TA 5K9JH 2PO6C 5EU3A 2VQUA 4PJHB 4TSAH 4Y2DD 4LVHB 2F8XC 5IMOB 3DMMB 2OTUB 1B4JH 3O8XA 2HH0H 5B8CC 4MD5B 1BJ1J 4LCCC 4Z7NE 1BFVH 4CVXB 2MMXA 1OTSC 1PAMA 2A9ML 1MAML 3IRPX 4U1IA 4YDJA 5C08E 4XPTH 1G7LA 3EJJX 5FYKU 1UM4H 3ULVL 5DJAB 4X7EC 3P4LA 4X9BA 5IVOA 1CICD 1NAMB 2EECA 2D4FA 5EOTA 4Y4FA 3JUZA 1Q9OB 4IMLA 1E28B 5B8CB 1MCOH 3W5NA 4Y19E 5E94A 3P4NA 4PJAE 1RUML 3QUKB 3I6KB 5EZLA 3MREB 1N8ZB 5IJKA 1RIHH 5EBLA 3BO8A 3CFIC 1NFKA 1RHFA 1ZANH 2DAVA 1N0XH 1ZK9A 4JFFE 3OKKB 2NY6C 4NCC1 3L5XH 4IIQA 1MJJB 2EEAA 3CFKA 5D72H 3GSNL 2ZJSH 2WIMA 1YN7B 4QRPA 1VACB 5CILH 5TDOA 4R90L 3DRTA 3FRUA 3SCMC 1KTDA 2YD2A 3ULSB 5D6CB 4QXGH 3MJ7A 4ZPTB 4XAWH 3RVWC 3TA3A 4KUCF 3LQMA 3O4LB 4OLZL 3U2SB 4MNHA 5JW4Q 1WBXB 5JDSA 4S1QL 3QXTA 4M93C 5GGRB 4PRNB 4G9FE 4GW5A 3S37L 4AEIH 5AG8A 1MJUL 2DLTA 1IEBB 4IDJH 4XNXH 5F3HB 2EYTB 3HB3C 5F1SA 4J3UA 2IH3A 5DHXB 3JSSA 3OXRA 5GJTL 4R4FL 3BRGC 1IGJB 4R9HA 5C0JA 2VDPH 3PWNA 5JIHA 4U6XA 2EE9A 1T66D 3CPLA 2Z8WC 4KJYA 4TUKL 5KN5A 3P30L 4PLOB 3BKCL 2GSIB 3FTGB 4N5ED 4EI6B 3TNNB 5BRZD 1JF5A 2X44D 4HPOH 2JIXB 3KJ4C 2FD6L 1OGTB 4FQ2L 5J1SC 2BSRB 4ENED 1XH3B 4G9FB 4K3GA 3TBSA 4CMHB 1L7TL 1TJHH 1UCTA 4HHAB 4KI5E 4UT7H 4U3XA 4Z7QF 1MFCL 4FA8A 3E6HA 4OZGA 5CBEB 2XQYK 4AH2B 4D9QD 1FL5B 6FABH 1BLNA 4XB7A 2Q8AL 3MRIA 2L0DA 4L4VE 2I5YL 4QTIH 2R23A 3QPQC 2AV1B 1OGAA 2IG2H 3VWJB 3WIHA 2X4TB 4OLYH 3OR7B 1ULVA 5DMGD 2I07A 3QUYC 3VFVB 4NN5B 2G75B 1U8KA 4Z0XB 4LCUA 2CKBL 5KVDH 3QNZA 1P9MA 4PJAF 4FFWC 4OI8A 5DQ9B 2P5WA 2NQCA 4NO3B 4APQC 1CR9H 4I5BB 4NQSA 1YNLL 3O6LH 3L5JA 3TT1H 2WP3T 2MJWA 4AL8H 1BBJA 2E7CA 4UAOC 4PRDA 4P3DA 2NLJA 4HXAL 3GRWH 1G7HB 5FECB 3ULVC 4JPKL 3C6SA 4AJ0A 1C8PA 1UA6L 3KJ4B 3UC0L 4C59B 5KVMC 1UJ3C 4MLSA 1JF1A 2WQ8A 2XWJA 4MDJB 4G8FA 5I6XB 2RCSL 2Z35B 5D71L 3X3FL 4D9RE 3WFHB 4PV8B 3L9RB 4R8WH 1HCFX 5HHQA 1JIBA 1GGBH 1EO7A 1TZIB 4MJIE 4G6MH 4HAFA 1FGVL 2BZDA 5J8OA 3RDTA 1FZMA 1AO7D 2WWKT 1AQDA 4N0CD 3GMNA 1T21B 1WK0A 3OKEB 1GIGL 4O4YH 4IMKC 5I19L 4XBPA 4XCEB 1WAAA 3O4LD 3FQRB 1NJ9A 3CCHA 1FRGL 3SY0B 2GSGA 2AJ3B 4Y4HD 4XNUL 3U30C 3HPJB 4P23C 3V6ZB 4HIXL 4FQ1H 2HJFB 4HT1H 1RK1B 2MCPL 4FQCL 4Z0BH 1D6VH 5GSRB 3RTQC 5I17B 2V9RA 3ZMRA 3BE1H 4EDXA 4GXVH 1AY1L 2APWA 3S36L 4LHUA 1ZKAA 2EKSB 1XR8A 1U8OB 2FSEB 4KJQD 3SKOB 4PJDF 1ONQA 1N8ZA 3MREA 4OLZH 1MI5D 3MO1B 1ZHLA 1HSAB 3P30H 4D0CA 2ARJA 3F58H 4Z7WE 2F54A 1H3GA 1GGYA 3RU8H 1JUFA 1KJ3H 4GW4A 3E0GA 2X9YA 5IOPB 4YK4B 4RAUB 4S2SB 2X4UA 3C5JA 4F57L 3MRNB 5D1XA 4HPYL 2FIKB 2WINB 3PP4H 3RVVC 5CJBA 1G7PB 3BD5A 4NQTA 3QO1A 5GS0C 1C1EH 3K0WA 4DKFH 1C5BL 2YR3A 3LKSA 5CD3A 1QBBA 3PWVA 1V3MA 4JFDA 3NFSL 4R96B 3VJ6A 2R56H 3WIIH 4BFIA 3KPRD 1AGDA 2XKSA 4DCQA 2W60A 4OGYH 2E7BA 1MHHB 3WE6A 1XT5A 1HEZB 1JMZA 4MNGB 1QFWH 5BV7L 3MCKA 1RUAL 5I1DB 4DN4H 4GKZB 2V2XB 4X7DC 4LKXA 5JR1H 2BRRL 4MS8C 1K2DA 4P2RA 2HTLD 3OTTA 4JG1H 5ENWB 4KROC 4M02A 3RGVD 1KIRA 5GZOD 2ITCA 4XPBL 4CKVX 1T5WB 2QLVB 4L4TA 4MQ7A 1J8HE 4OGXH 1G7JB 1MAJA 3M17B 3QIUC 3ALPA 3P4OB 1ZANL 4X6FB 1E4XL 1B6UA 1I1CA 4JZNB 5F7MC 3VWJD 3WFZA 1HXYA 3ZE0F 5C0AE 5C6TL 2X4QA 3GIZL 1LO3H 5C0GB 3BIBX 3RI5F 3ZE2E 5DEZA 3SDAC 3N50A 4P4KC 2ZNWA 3CH8A 1RVFH 2C1PA 5MENB 3G5XA 3SN6N 1MRCL 4F58L 1G7JA 2RB8A 3M17A 2LV4A 4JFXA 4E41A 3EYVB 2AEIT 5L0QC 4Y2OA 3O3BB 3NPSB 3ULVE 1HKFA 4WU7A 3RUGF 2VDQH 4Z7QE 4D3CL 1I1FB 1WVZA 1XFPA 4ZNEE 1DEEB 5GGQL 2AKRA 1FE8L 4XP1H 3QUXC 3HI6L 5JOFA 3WS3B 5ITFB 4LSRH 3L3IB 4LKCB 2Z8RA 1UWXH 2E6PA 2XZAH 3GHBL 1F58L 4O51A 3TCLB 5FFLA 4CVXA 4I18A 3WUWG 1CK0L 3C9NB 5IB3A 3L95B 3DMMA 4S0TD 4FQ1L 5KSBF 3V5DB 4H88L 4I48B 4GUPB 1S9VB 3HC3L 4ETQB 4AMKH 2JCCA 4HG4K 4FTVE 3O6FB 2YEZA 1JUFB 1GIGH 3GBLA 4O4YL 5KZCD 3HC4L 5M94B 1KJ2B 3QSKB 5JPMB 2V2WB 1KB9J 4NUGH 4I0CC 4DJMA 1IZJA 5C0RL 3BZEB 2FJHA 4BSWA 2F54D 4EUPB 5J11B 3LPWA 1HDMA 5IR1A 1FL5A 5IFJB 3ZL4L 1YA5A 2EDLA 4N8PA 4H0HB 2AQ1A 2GYSA 4PJGB 3LRSA 1DVFC 4XP5L 4J4PD 4OZIA 3ARXA 4HLZH 4HZLA 2IH1A 4CMMB 3UAJC 2Z31A 3F7QA 3UYOD 1EMTH 4EXKA 1EO5A 5HGAB 2IEPA 3REVB 4F7PA 5JA9A 1Y18A 2XTJC 5ITFA 1RZJC 4MJID 4ZMAT 1TQBC 2V5RA 3FQXB 2WWMD 3HCVB 4Z7VF 4Y16B 3GI8L 5DC0A 4M61B 3T77A 2OXHA 2IFFH 4KKNA 1U8PB 4CGTA 4W6YB 3NIGE 3GI9H 5C07B 1PFCA 3VXPB 1MVFA 3RY5A 2BNRE 5J12B 1I3GL 3NPSC 4S10A 4YBQC 3HB3D 4XT1C 1WEJH 2A9NL 2Y6SC 4Y16D 5EORL 5F21B 1I9JH 1A6UH 1UZ8A 1HQ4B 4QRQA 1U8PA 1NGQL 4PTUB 3VFTA 4RMSA 2DBLL 1MCNA 1V05A 4RIRA 2VDKH 8FABB 5T1LB 5HI3C 4K7PX 2NPLX 3IETA 1K8IB 3PV6B 4PJ5B 1BEYH 4WWKB 5DJDB 3TV3L 1WFTA 1JCKA 4FMFA 1JPSH 5JZ7C 2PCPA 1CN4A 4OZHB 1QYGH 2WV3A 3KYKH 3MLZL 1NLDH 2FJFB 4LHUG 1M7IA 3UO1L 5B38G 5GXBB 2OMNA 1RJZB 1LO2H 1U2CA 5HYIA 5FYLD 3NBNA 1B0RA 4DOHB 1P5UA 4PJ7A 1QFUH 2ORBH 4XP9H 3MLVH 2AK4A 4PBXA 1A14H 1MFDH 5EOCJ 1WCBA 2YHGA 2DQGL 2MNUA 1HHIA 3MV8D 4ZOEA 2WLZA 1JNLH 1SVZA 3UP1A 3PWPE 2XPGA 2V5SA 2VDOL 1JMXA 4XNZB 5DMIH 3HCVA 4F9LA 4D94A 5T3XL 1JPSL 2ENSA 1UXSA 4JZJB 5GZND 1I4FB 3MYJA 4LSTH 1G7PA 5DEGA 3RWCA 3OAUH 2B4CL 4KWUA 3QWRD 1E6JH 3VXUB 4PJ8C 2VKXA 1IAOA 4NKDA 3KXFE 1BFVL 2YPKA 3U0WL 1UACH 2ERJC 1RUMH 2FEEI 2P7TB 3CC5A 1MJ8L 4L4JA 3GMMB 3SGEI 1N7MH 3RL2B 1TNMA 3BW9A 3T2NL 2BOBB 2RR3A 3QUZB 4GMTH 4HPYH 4DW2H 4WU7B 2DKSA 2EC9U 4L4VB 5E99H 4PRHB 3WEXA 4WY7L 1RIUL 1RMFH 4PS4L 4UBDD 3NH7L 1CBVH 5EB9A 3VWKC 2M8XA 5TFSH 2EIZB 1U8IB 1YJDC 3B9VA 3M1BA 3GMNB 5I18H 1CGUA 4XVTL 1J0ZA 4JJHA 3S96A 4MS8A 4O51B 3TCLA 4NHUB 4WEBH 3NZ8A 3QFJE 1IKFL 2YS4A 1NJ9B 3CCHB 5DMJB 3GSNH 3MV7E 1D5BA 1O7SA 5LGJA 1T22A 4EXPX 4JO2L 3MR9A 3ELAT 3VFSA 3QFJB 5B3JF 3WNLA 4PRBA 4OT1H 4OFIA 3STZA 2AK4E 4X6CF 4K8RL 3NFSH 4JM4H 3RVXC 5FYLH 4KHTH 2YUVA 2GJ6B 5ADOL 3MJ8A 3SDDD 4Q9CA 3DUUB 3FN9A 1N5YH 3O8XD 3BEWA 3I75B 5L2KE 1EUUA 3V5HA 4M9OA 3PABA 3TO4D 3BRFA 1U93B 4KPHL 5B4MD 1W72B 4EN3C 3D3VB 3HNSL 3T0VA 5CEZD 2HT4D 4IIQC 5E6IA 3FT4A 2A74A 1ED3A 2YPVH 4L9LA 5GS0D 1CICA 2XACC 3X12B 4ODHL 3TZVD 1B6DA 4PJBB 4P2YA 2EE3A 5F6IC 5TE4H 5M7QA 4RQQB 1ZLWH 3BEVA 1Q1JL 4G6KL 3RGVA 3DX6A 1MHHA 2XZZA 4QHLA 1MQ8A 2VLRD 5F96L 4YHNA 3X11B 4WW1B 4Z77B 1HXMA 1BGXL 1VKXA 1R24A 3TJHC 4PLJD 1FORL 4G7YH 4L3ED 1MLCA 4P9ML 5KSVB 1UB5B 4MHHG 3SHSA 2EO1A 3RRQA 4R4ND 2XYCA 4TN9A 1CE1H 1NQBA 4P9HC 3QUYB 2Z8SA 1FL6A 4E41D 4FFZL 1G7QB 1CDJA 5EZOL 3C8KA 1NGYA 5L6YH 4G6AC 2HJLA 1II4E 4D2NA 3TN0A 4DOHE 1J7VR 3VFPB 3NACH 4IDLA 4NQVA 1JHTA 3TESA 3RIAF 4HWEH 1OPGL 1QVOA 3NCBB 2AABL 5KN5B 1C12A 3NZHH 5K9OA 1T7VA 3IKCB 4JVWA 3ARGC 4L3EB 1I85A 3SOBH 4RMRA 5GGTL 4GBXD 1MREL 3SDCD 4PY7A 3OXRB 5L0QB 2AS5M 5AAWA 5T1KA 5LGJB 2BERA 2D03L 4L5FL 3MBXH 2VLRB 5FXCH 5C9KA 4BA8A 1J5OL 3ARVA 5GRJH 1TLKA 2LU7A 4NJAL 1UYWL 2YA0A 3OGCA 5GGSY 3MRCB 2DQTL 1BBDH 2RHEA 2FX8L 1HH6B 3IGAA 1VHPA 1FC1A 1OP3K 1T1ZA 1VEMA 1F6AA 3GSWB 3SE8H 4JQXA 4HMCA 2Q7NA 3H9YA 1VEOA 5IUSA 4JZOA 4PRID 7FABL 3VXNA 4YHMH 2I07B 1IGCL 3VFVA 4O2FA 4ZNEA 2PTVA 1GOFA 4EDWL 4XAWL 2BVEA 1R24B 1OD9A 3VG9C 4IMLB 3NA4A 4NKQB 1ZA6A 2V7HA 5IB2A 4S1QH 4PJIF 5D1ZD 4ONGH 3T2QA 3DJ9A 4LQFL 1J1PH 3HAEG 4NP4L 4YE4H 4I9WE 2YPKB 3R06B 4PJGE 3VXUA 4NM4L 1XF3A 3D69B 7CGTA 2Q3ZA 4KU1A 4MXVF 1GL4B 2OTPA 3DECA 4OFYD 5FCSH 3VRJB 2VDMH 4PRPD 3BIAX 1QSFE 5FIEA 4AY0A 3BPLB 5E9DD 1C7SA 3ESUF 4FZ8L 4NO5B 5JPNA 4HC1A 2ED7A 1FG9C 3OKMB 5SX4H 1K85A 4APQD 3RZWA 3IJHB 4L29A 2CIIA 3PIQB 2FGWH 4B7IA 2A9NH 1T5XB 1KGCD 2GHWB 5MEOB 5CGYC 4KTDH 1A3RH 1CDUA 3FONA 2WBJC 1B3JA 1EEQA 2YD5A 5FA4A 2R4SH 1RUAH 1EEZB 3VCLA 1D9KA 4XWGL 5DA4A 3EO9H 4Y16C 4KVNL 4XBGA 4GW5B 4JO3L 2BXZA 4GO6B 3ZYJA 3SO3B 1LEIB 4U1HA 1BD2B 2PNDA 1ZA6B 1NC4A 4N0YH 3MR9B 4HUWB 5DYOB 4ZAKC 4QGYA 1YUHA 4PBWD 1E0OB 1U3HB 4O2FB 1KN2H 5F72S 5IEKB 3ZLQC 3VXNB 2HKFH 2RAMA 4ZFOB 3NZ8B 4PJDA 2FX7H 1IGIL 4HJGA 3L5WB 2Q87A 2R29L 4RCAA 3T3MF 3VFUA 4WEMB 2XTJE 4HD9A 4RIRB 2VWEE 1NDGB 1R3IH 2IPTL 1OOAA 3H9HB 2Z91B 3K8KA 4YIQB 4OI7A 4P23D 1FV1B 1KN4L 3UXFA 4LNVA 2DOCA 4P2OD 1KIPB 5D7KE 3P9WB 4P9MH 5T5FL 1UWEL 5KVGL 1CE6A 4P57A 1Q1JH 3WMSA 4CVWA 4NWUL 4X83A 3BPOB 1EAPA 3HS0B 5B39B 5I1HH 1U2HA 1AXTL 5KTEL 3ZKQD 5F96H 5DQJB 4JO2H 1UENA 5IVZB 2QADD 3FFDB 1AR1D 4OF6A 1QQDA 5IGXL 1NAMA 1KF9B 3FHAA 2BRQA 4MQXD 4KKBD 1BZ7B 1S7RB 1KG0A 5D7JC 4Q6YA 4U33A 4Z76A 2JJUA 5BZDA 1QLEL 3CFJA 3IS0X 4DGYH 5HPMB 2HMIC 3D0VB 3I3BA 4MJ4A 2OR7A 4PJXB 2OMBA 2C9AA 5JW5B 3B5GA 4AMKL 3UTTA 3IDNA 3U0PA 1E6OH 4R3SB 1T7WA 1F58H 2K1MA 1U3YA 5E2TL 3JXAA 3P11L 2EDTA 1FNLA 4LLDA 2G60L 5LQBH 1MCEA 1B90A 2YD1A 3RGVB 5EBLB 4M00A 3CJJA 2IPUK 1GZPB 1CVSC 1J5OH 3RZCD 3O2DA 5E5RB 4RFEB 2E7LC 4JPVH 3IU4L 5M95B 3PGDB 4Y19D 2DLFL 5HY9A 4XVTH 1TIUA 2ZP0T 1F5WA 1WCBB 4JM4L 4MAYB 1Q38A 2GTZA 4RMWA 1X5KA 4Y5XC 3VWKD 3MRLA 1P5VA 1OTSD 3DX6B 4K71C 1HOCA 2HTLC 4U1IB 4GRMB 5EWIH 1QR4A 2QHRH 2QV2A 1D5ZB 4X5WB 2XQBL 4LGSB 5T33L 3DX8B 1T1XA 5HYJE 3B83A 3QIUD 2ZCKL 3BKJH 2ED8A 2OL3A 2UYLB 1BQLL 5BV7C 4X0KB 2C7UA 2XXCB 3MUZ1 4FQJL 5ICYB 4O02H 1H3VA 5CGTA 4Q9QL 5DD6A 1OGAE 1T0NA 5E08H 2JELH 3VFSB 4ZFFB 5HHOB 4ACPA 2X1PA 1FFRA 3F7YB 5DMKA 1CE6B 1P1ZA 3MJ8B 4U7MA 5L2JB 5D6DC 2YXMA 2EZ0C 4ZTPL 5GRWA 2IFGA 1GVIA 4NP4H 4YGAB 4DKEH 5LJYH 3QFJA 5BMFL 4EN3D 1DLFL 1VGEH 4EUPH 3A6BH 3TBTA 12E8H 4HIEA 1U3ZA 4L1DA 3X13B 4HWZB 1S5HA 3MRGA 4CN1A 3QCTH 1H0DA 3F12A 1UG9A 1HSBB 4KRPD 4F7PB 4FABL 4JFEE 5I8EA 1N5AB 3W0WB 4NN7C 1T20A 5DD5H 1QO3A 2EDKA 2ORBL 5EZOH 1EO8H 2OJEB 3MNWB 3BAEL 1I8IB 3FQUA 3HAEA 4GKZA 1G9MH 1NAKH 4GMSH 2R2BB 3EDJA 4ZUSB 2R9HC 5I1JL 2BHYA 3GJFB 3MYZA 1BX2A 4F7MB 5E8EB 4KKLC 2VDOH 1EVUA 2J6EH 3KHQA 3SE3A 2IPTH 3VCLB 1QFWM 3TJHD 4PLJC 1JYWA 4QNPE 5J89A 2RJMA 3QXWA 3GEWB 4UT6H 4ODUB 4K23L 5FAAA 5BCAA 1N3NA 5LGKA 4JZJA 5MEOA 1QHPA 3MROA 1DVFD 5I66B 3MRNA 2VLMD 4JR9L 5ICYA 4OD3L 5IG7B 5B21A 2FEDD 3L3KA 5TF1H 2YC1B 2HN7A 2BMKB 5KSVA 2X41A 2HKFL 3VRJA 2WMPA 3FOMA 3QAZC 1R5VB 1I9IL 3QEGH 4LARH 1Z6JT 3JVGA 4P5MB 5CIPA 2FHFA 1ZT7A 2NW3B 5CZKA 1HHIB 4K3JL 4RNRB 1M05B 1AE6H 1JNHA 1HOCB 4JFOA 3ZYZA 3O2WL 4ELMB 5J7CC 1YNLH 4QHLB 3L3GA 5MI0C 1CD0A 4K07A 1TITA 5D2NE 4ZG1A 4Y19A 1T2QH 3I2CL 3O45A 4KQ4H 5MEPA 3QULB 2GJ6D 5KVGH 3NIGF 2UWEA 4ODTH 1QRND 3UTSD 1JGVH 4FFWD 1G84A 1RI8A 1NFDA 1LO0L 3GKWH 3V6ZA 4AQ1B 1HQRA 2C5DC 1QBLH 4JVPA 3IU3A 3E2HA 3HE6A 1GC1C 3EFDH 5K9KA 4OV5B 1T04A 1DEDA 1KIQB 2QL1A 3OZ9H 4Y8AA 1D5MA 1QRNB 1JV5A 2YRZA 3WUWB 2DBLH 1P84J 3ULVD 1CQYA 3D0VA 4BJLA 4NO2A 4HF5H 3OGCB 4ZUUB 5C08D 3L3IA 1I7UB 1P84K 4R4BB 4X98B 3FQNA 3U48A 5IW6A 3BSZH 3STBA 4A6YL 5IQ9A 4CVZB 3DO7B 1CVRA 4XPAH 1H8SA 2NY3C 2D7OA 1CDIA 2C4FU 5ELIA 3VXME 2XTJB 1MQKL 4UT7L 2HFFA 1DTUA 1I7ZA 4OM0H 3ZYOA 2DQJH 2VDLH 4QXTB 2WP3O 4NZUH 3F7VA 4H8WL 1OF2A 3VH8B 4YWGL 2VIRA 1JP5A 1PY4A 5H2BB 1KFAL 3CUPA 3QCTL 5KW9L 2BY0A 1MPAL 1S7WB 2EIZA 3M1BB 5MENE 3L7FA 3QHTC 1GOGA 5I1GH 4OM1L 4KQ3L 5F3BB 1EO8L 3VGFA 1A7OH 3GJFH 5C8JB 2D7PA 3KLAA 4FQ2H 5D70H 1U8KB 2NY1B 5DWUH 3CFDB 1IGYA 4YPGA 2BNQA 5FV1L 3BVNB 5JPMA 5GGQH 2CUMA 3G04A 1KJ2A 3HG1E 4U0QB 1YEIH 2EDHA 3E8UL 1HSAA 3X11A 5E6IC 2X9XA 3QYCA 4KDVA 4L9DA 3BMWA 3BT2H 3BKCH 3MRKB 1N0XL 1UADC 3BJ91 4NN6C 2JE8A 4LPUA 5EC1B 1HDMB 2NR6C 4PD4K 4FN0A 2JCCE 5C0ND 2WUCL 2MHAA 1JNLL 4I2XB 1KFAH 1CFTB 5KW9H 4PJFB 5LWYH 2WUBH 5D7JA 5C09A 1R5WA 3ULUL 1JHLL 4FFZH 1RHHB 1T7XA 1MCFA 1AGCB 3NCJL 1YYLH 3G9VA 3VDCA 2CIIB 4WO4B 5DUPL 1YEEL 1UM5L 4P2RD 2VZUA 3MQIA 1XR9A 3JV6A 4JY5H 4HWUA 1B0GB 2VXTL 3MRJA 4YHIA 1WIPA 4L4TD 4V1DE 3SE9H 4UV7L 3CFCH 3DO3A 3NZHL 4BH7B 4M62L 3N06B 4D0BB 1WISA 4X4YB 1FIEA 5E1AB 1AKJD 4F58H 2ED9A 2J5LC 3EDFA 5DJZB 4YR6B 3DVGB 3RVXD 4FQCH 4Z0BL 1FNFA 3G5YB 2VDNH 1P53A 3SDDC 3RWJA 2X42A 3BQUA 4QWWD 3T0AA 4ZYKA 3PV6A 5DJDA 1X5XA 1ROWA 5DVNA 2HMID 5JTWA 4PGCB 4Y89A 5JLZB 4P4KD 5GGSB 4V1DB 2L7JA 1XEDA 2O5ZH 2QHRL 3TIEA 4AENA 4PPTA 1XF4A 2LTQC 3BHBB 2VQTA 3RDTB 1RUQL 5DDHA 1E4WL 3KPSA 1L6ZA 4GRWE 5JOPD 3AS2A 3FMGL 1KB9K 3WN5C 3ARBA 1TZIA 4K8RH 3EO1B 3PP3K 4JG0H 3RZCC 4I3RH 3I6KA 1VEPA 5HHMA 4YDKH 3BWUC 2YD6A 2YWZA 3QO1B 4YBLB 1TZGL 4QXWA 2L7UA 3ZKMD 4NZRH 1LP9E 1TTFA 3O45B 1DN0B 4OFKA 2ZOLA 2DQHL 4TUJB 2Z8VC 4F7TA 1T1YB 3X3GL 4NKMB 4E42A 3JBG7 3MXWH 2D0HA 3IKKA 4GQ9L 2W60B 5FO7B 3T3PE 1FHGA 1KT2B 2AERT 1NL0H 4U4BA 1TCRA 1B0WA 3HG1B 1YDPB 1PEZA 1J8HB 1KCVL 4DTGH 5AZEL 5C92A 1XGYH 1BFOB 4EQ3A 2IQ9H 3K2UL 5L8JB 5HGBB 4IRZH 1R3JA 4OZGF 2CLRB 4NYLA 4XC3L 4Z7WA 3VI3E 3H9SA 1KXTB 4XB8A 2VLJB 3PL6C 2DBJA 4Z18A 4YHZL 5JA8B 3QCUL 5GIRA 1QUNA 4JB9L 4NKIH 5IQ7L 3PGDA 1A6VH 3OB0H 4BSJA 3VXQB 1GGBL 2IH3B 1I1YB 5DC9B 4H8WC 2GITB 2IANA 2X10A 3WXVH 3O3AA 3ARGD 4U1KA 3RBGA 4R26H 2BY2A 4DKAA 3DWTA 1XR8B 3ULUD 4PRNA 5BV7H 1F4XH 3SDCC 4U6VL 3TT1L 2F8OA 2X4NB 3KPQB 4HUVB 2WWMC 1ZAGA 5I2IA 4MX7A 4JO1H 2VDML 4UT9L 4JANB 3VFRB 1YEGL 2DN7A 3FTGA 2D0GA 3ALWA 1KC5H 1ZLSL 3SCMA 4KJYB 5T1MB 4P99A 2NY2D 1MSPA 3C60A 2B39A 1M6OB 1MHEB 4HGMA 2BVPA 1NMBL 2FZ3A 4LBEA 4EOWL 4JPKH 4JFXB 3FQNB 3V95A 4NJ9L 3MMEB 4KKCD 2P4AB 3EOAA 5AUMA 4DVRH 5D1ZC 4M03A 3WSQH 1EK3A 1IGCH 3FO2A 1ZEAH 4J4PA 1EGJH 1DZBA 4NNXA 4XP9L 5C0GA 1SEBA 2ADJB 3A0OA 4PJIE 3O2DH 2B5IB 3U36A 5TH2B 3DYPA 2Q6WB 1I8LA 2XY2A 1FL6B 2MCPH 1BQUA 1W72H 1KTDB 4XHQA 3X17A 2NTFA 4HUUA 2Y06H 2A6IB 3KR3L 4KV5F 3G6AA 4OIIL 4RISL 4P46B 2NX5E 2IH1B 2JB5H 4GG6B 4OQ1A 1CFTA 3MOBH 3W39B 5DQ9A 4W4NA 3RPIA 5IFJA 1JGDA 4OM1H 5FHAL 1VERA 1R3KA 3FKUS 2BK8A 5EC1A 2H9GA 4PR5B 1TDQA 4OLXL 4L4VA 4KI1A 4MB4A 1ITBB 1RZGA 3D2UA 3FT2A 5JNYB 2PYED 5FYKE 3D39D 3RL2A 1H3WM 4Y19B 3U82B 5GZNC 5IB5A 4BSVB 1UXWB 2AXGB 4LPCA 5HD8C 2GSIA 3VXSE 2ESVE 5IOPA 1TTGA 4PJ8D 4Y5YC 1RPQA 2ADFL 1ADQH 1N6UA 1MPAH 5FDYA 5KSUA 4PJXA 4F7EA 5DXWA 4YFDB 4OD1H 3GSUB 2O61B 2O5YH 5D7LD 1A6VL 1MCDA 3D85A 2JIXA 5AZ2H 1AO7B 4D8PA 2J3SA 4F37K 2F5AH 4LSVL 4I2XE 3R0NA 4LSDA 2ZUQC 1BVLA 4AK1A 5D72L 1KELL 3QHFL 2NY3D 2IFFL 1A6UL 5FUOH 4M6OH 1S7QA 4WDIB 4PJ9B 5DGRA 1CDCA 2VTFA 1YZZA 4KK9C 4Q9RL 3GMRB 4MD4A 5F3HA 2X4RB 4ZXBA 1SM3H 5K9QG 3QB7C 3K1DA 1AD9A 2P45B 1SMOA 4JGMA 5I71C 3PQYA 5F7DB 2QADC 1RZKC 1KULA 3W9DA 5SWSA 4XPGH 3TBYB 2DI7A 2P8PA 1V5JA 5E8NB 5F1OB 2ADFH 5FYKH 3SJVE 5HYSB 5TE6L 1QRNA 4BKLA 3EFFA 4HC1H 3H7BB 3F7PC 1QO3B 3ARFD 2B20A 3VH8A 4U6VH 1NCAL 4XWGH 1BVKB 4PJ5A 4GKOA 2J8UA 1W0VA 1YMHB 1EV2E 3QJFA 4QHUB 2D7QA 1ZHBB 1JFQH 3V6OE 1RZFL 2GIYA 5E94B 2X1WL 4ORGB 4G42A 3CVHB 4P2QE 2UZYB 1A3LL 1AJ7H 3H7LA 4JQXC 5E6ID 1U3HC 4HGKC 1YJDL 2QBWA 2NR6D 1UQSB 2XOTA 3H42L 2ILLA 4HXBH 4H0IA 4PB0L 2AK1H 3ARWA 2GK0A 1OL0A 3C2SA 1P1ZB 3HNVH 3TO4C 1J88A 4ZTOH 1M1SA 4JFDB 1I1AB 5SWZD 4Z6AT 3IAPA 5IP4A 5DEGB 1MHPH 3TO2B 1MCWM 3MTRA 3B4NA 4J3TA 3V6BR 2GJ6E 6FABL 3O8XB 2VRAA 2HH0L 5KSBA 1WZKA 3S98A 2NXYD 4KDTA 2NXZD 1HHGA 4K8RC 2RIKA 5CEXA 1CBVL 3O2DL 1FO0L 2FHCA 1MLCB 2QSTA 3QUMH 4MAUH 3G6JF 2P5EE 2XQBH 1OVZA 1M7DA 1Y0LA 1TQBB 3VG0L 1NC2B 3P9MA 1FNAA 2DQDH 2IC2A 1F42A 3MJGX 5ESVB 4XZUB 1NH6A 1IKFH 2YD7A 1IEAA 3EOBA 2VLKA 4HBCH 2B0SL 5ID1B 4P59L 3VD4A 3GGWA 1ORQA 3GUTA 2DM3A 3ZE0E 4NZTL 1ZOXA 1MEXL 3FO0H 3EYOA 4R4NC 4KTEH 2IMMA 5BS0B 4R2GB 3X14B 3G5VA 1WSST 5J57B 1NCWH 5JW5A 3BIKA 4MWFB 4POUB 1RK1A 3DHJA 4PJ8B 3ISWA 5EO9B 2YEZB 2HTKC 2BMKA 1ZHBA 1AC0A 1J05B 2BSRA 4G6AD 3PWJA 1W0VB 1YMHA 1QLRB 3FQRA 1WUNT 5IK3B 2NY5L 3LH2L 2KUTA 1NANH 5I66A 4NQDE 3X13A 2Q6WA 3L95A 4K3EH 3RX8A 2NY0D 1JYXA 3SO3C 4MZ3A 1NBZA 3P0VH 5HHMD 2X9WA 1GGIL 3U0PB 4Q9QH 4YDIH 3O3EB 1SEBB 3QEQE 3GSQA 4P2QB 5E95B 1UH2A 5E6ZA 3NCFB 3T65B 4NNYA 1JFMA 1CLZL 2P42B 2VLRA 1S8DA 1CCZA 2G2RA 3QNYB 1ZVHA 2KZWA 3DTXA 1C1EL 2I25N 4KKLD 3NOIA 1JRHH 3NVQA 4M61A 3JUYA 2W65A 3LKPB 3TYGL 1WWAX 1U8MA 3QPXH 4PYGA 1DVFA 3DVIA 1FVCB 3RVUD 4NN6B 2EXYC 4G8GB 4WI2A 2Y9RT 4HIXH 1JWMB 3GSVB 4OZFG 3WN5B 4X6CA 4KDWA 2NYYD 1FZKB 3ET9F 2VDLL 3GRWA 5FOBA 2PETA 3SDXF 3OR6B 3BIKB 1EHAA 5DRWB 4KJPD 4D9LH 1F8TH 3LRGA 1ORQB 5T5NF 1GOHA 2IAND 4Y5YA 4HKZA 1UXWA 3PE9A 4P4KA 5DRNB 2Q76A 4CNIA 1DQDL 2EH7L 4DVBA 3WHXB 5FA4B 3V0AC 1YQ2A 1XIWC 4JPIB 4MWFA 1KOAA 4NFCA 2YK1H 4ZFFA 1PYWB 4A6YH 2CD0A 4MA7H 5HHXH 4HXAH 3MNZA 1MHPL 5TJWK 4M6OL 3UPAA 2BSED 1LILA 5FCUH 4D8PB 1A1OB 1ZS8B 3F6IA 2VAAB 3CXDH 3CSYA 5ID0A 5E2WL 4QRTA 5HGBA 3BI9X 4U1NA 4UZGA 3SQOH 1RUKL 4X9HA 5FUCE 4LNRB 4UNUA 5KOMC 4UOW0 5TPWL 1FLRH 4Y8DC 3UC0H 5CGYD 4NRZB 1I9EA 4G6FB 4HMEA 4XXCC 1ZLVK 5ADPL 4MJ6B 4OCXL 5KVFH 5JOFB 3X3FH 1FO0A 3T1WA 5IEHB 2CJUL 1XZ0A 5I8CB 3V52H 4HIIB 4HWBA 4NRXB 1SY6H 1IGIH 1VFOA 1KLFA 3TCXA 4N90D 2J6EA 2C3XA 3M8OL 3L3DB 2ZCHL 1PBYA 4LLQA 3MJ9H 2GFBB 3KS0H 1GC1H 4JM2D 4QKXB 4XCYB 3KPPA 4ZAKD 2FR4B 5DZNA 1TENA 4LSSL 2BCKA 3TVMB 4PJIB 3S34L 5C7XH 4DUXA 3BX7C 5L8LB 2FYYB 1INQB 2RGSA 4M6NL 4XH2B 3W9DB 4XBEH 4F2MB 5C0CD 1JWMA 3PQYB 5IV2B 2ICES 4TUKH 4PJFE 1I75A 3HC3H 3SPVA 4Q2ZA 4XNMB 1RJCA 3S96B 1NBQA 4LIQE 4OUOA 3QUMB 1G9MC 1NBVH 4MXVE 43CAB 2BNUA 5GRUH 2J8UF 3QEQD 1XCQA 1LE5A 2OTWB 1FE8H 3DVGA 3GBML 4XP1L 3OPZL 3LKQB 1BZ9B 1QEWB 3MJ9L 4FFVC 4FOMA 4JLRA 5FB8B 1EAJA 1OSPL 2AJYH 3ES6B 5IB1A 4LP4A 2CO6B 4MAYD 5F70A 1Y6MR 4LCCA 3WXWH 5D7JD 3KJ6L 3MBEB 1FSKB 1WIOA 2YUWA 4BK4A 3SE8L 5HVHC 4LLUA 5D1XB 4Z8FH 3MV7B 5BXFA 1P7QB 3EZJB 4S2SA 3PL6A 3ULVF 4X0KA 1GZQB 3AREC 1KENL 4NYLB 4MXQC 3WKNA 4LSPL 3RWHA 3CIQA 3QEQB 5EN2B 1A4JB 4HG4J 4CMMA 4OCYH 1D5ZA 1NSNH 4LCIH 3RTQA 4OB5H 5HDQL 1P4IH 1G1CA 2DQJL 3LEXA 3SGEH 2FDBP 3PXJA 1GGUA 1H9VA 5GJTH 1DN0A 3UYRL 1ZT1A 5EU7C 4GG6A 3MCLH 4OSUH 5FK9B 2VXVL 3WFDL 5L88H 4LMQI 4I0PD 4JRWA 2DDQL 2LU3A 5DLML 3T0XA 4P48A 4PR5A 2AK4B 3AS0A 2A6KB 5AWNH 5I8OH 5EUKB 1DBBH 3HLAB 2VLLA 4K9EC 5KJRH 3UZQA 1IM3B 2Q86B 2W9DL 1J11A 4I4WA 4FQHB 4IOSD 3P77B 2OK0H 1UM4L 5C2BH 4B53A 4JQIH 2KQMA 3UTTD 3UTSE 3P73B 1AGFB 1VGKB 5A2FA 1CICB 3X12A 3NCEB 4ZNCD 5T3XE 2XV6B 1K8IA 1BMGA 1T4KB 2JJVA 4X9FA 5IMLA 1U8NB 4RX4A 3VRIB 1U8MB 1W72A 4YX2L 1MH5B 3HNVL 4HGWB 5EPMA 5LWYL 1C16A 3PWPB 3CX5K 4JFEB 4KGJA 5IQ7H 3SJVD 1T7ZA 3O3UN 4YO0B 4HDIB 3VG0H 2XRAH 4RGMB 4K3HA 5IB1B 1KTLA 4XCNA 4POYA 3WUZA 5LQBL 4JM2F 4P3DB 3UJIH 4JHWH 2VMFA 1HKLL 3UCRA 4NRYB 1MI5A 1E27A 4HFWA 3B6SB 4UILH 3U2SA 4ZXBD 4MXWL 2XN9A 5EOCH 3HPLA 1BVZA 4P4RA 1I3RB 4TQEL 4KRPC 5D8JH 2UUDK 3MLXH 4C57C 5J1AA 2NXZC 2XQYG 3KXFB 4K8RD 2B5IC 1JBJA 4AIOA 1OP5K 3VXRA 2A83A 1YMMD 4PJBF 4ZO7A 2R9HD 5T1KB 3TA3C 3FOLA 4XRCB 1NFDB 2YD3A 4JREB 2VXQH 4PJAB 3SDXE 2DJSA 4F37F 1VADA 3L3HA 3PL6D 5D96B 1CGSL 3QULA 3K2UH 4CUCA 1A7BA 1INDL 3DXAA 5EOQH 4X4YA 5IR1B 5ID1A 3OAYH 3QDMB 2NY6D 2ZG1A 3DUSB 3MXVL 2BNRB 5HYFA 3O3AB 4MVBA 4GQ9H 3E6HB 3QQ9D 4OZGB 4AG4L 1OAXL 1MCQA 1OAKH 1QPPA 3N0PB 1Q0YH 2HTKD 3ULUC 3MGOB 4ISVA 2ADGB 1NBVL 1VA9A 2ID5A 2JCCB 1LO5B 1A3QA 5IROA 5H37G 1OTTC 2Y72A 2YBRA 4G80A 4ZFZA 4H0GA 3RNKB 2DS4A 2H1PH 5L2KB 3MRQA 4WCYL 4GQPH 3LEVL 4XGZB 3P40A 4JKLA 4Y5XA 5EO1B 3CZFA 5F6IB 2Y5TA 2MKWA 2F54B 5E99L 3BPOC 3IS1X 2VKWA 2HRLA 2Z92B 1JWSA 3BDYL 2CIKA 4GT7A 1IC5L 1D7FA 2YUZA 2GJ6A 4NO0D 4ZD3L 4WJ5A 2FGZA 4OD1L 43C9A 5J1TC 5H94B 3RX7A 2DDQH 3O6FD 2VC2H 2LABA 4PRBB 2JK5B 1VSCA 4C58B 3RWIB 2F53A 4X80H 5DK2A 2F5AL 3FQUB 4LSVH 4K2UL 3RVTC 1TVHA 3JWDC 5KJRL 5D1QB 5GSVB 3I85A 4JO3H 3CX2A 1OT1A 4P3CL 2EXYD 1MFDL 5I8EB 4WWKA 2PR4H 3H9SD 4GAJL 2F74A 4PGCA 4PJEE 5ILTH 4R4BA 3D48R 3NGBC 4GW1B 4MVBC 32C2A 4X98A 3O2VL 2OSLA 3WFDH 4EIZC 2Y7QB 4MQSB 5IFAL 1CFSA 2JJSC 3CDYA 2OZ4A 1F11A 4N0FB 4XC1H 3Q6GH 4JRYD 4L8CB 4Y1AB 5DMIL 1AD0B 1J1OL 1TVBB 3LN5B 2AV7A 1BQHB 1N59A 3DURA 4KI5F 1KEGL 4N0UA 4LAQH 1OF2B 2OSLB 3RHWK 4CBPA 5L2JA 1TMCA 3MA9L 4LSUH 1FYTD 4WFFD 4NM8H 1WFNA 2QR0A 3C6LC 5BS0E 5F1NA 3IDYC 3T08A 3TJEL 5MP6H 3TPUE 3ARDA 4JQVC 4MGXA 1ZTXH 1G6RB 1I3VA 4JFFA 4M93B 2J1KA 3QXVA 4H1LB 4PTTA 3GMMA 3UBXB 1O0VA 4ZO9A 1RURH 2G2RB 1ES0A 4N8VA 3E8UH 2VWEC 5KVEH 4OD3H 1IC4L 4WO4A 4B50A 4ALAL 4AEIL 1DBKH 3RKDC 1A6ZA 4LVHC 4P5MA 2KPNA 4WTZG 3QQ3A 3PWUB 4TULH 4NHUE 2X4NA 4H1LH 3T2PA 3E3QC 2R1YA 1JN6B 4QT5A 3VGGA 2CK2A 2DKUA 1Q9KA 3SDDB 3V4VL 3AXLB 4GLRI 4RGOH 3W81A 3LDBB 2DWEA 5DZOA 3EBAA 3MRKA 1IEHA 2VDQL 4TNWF 3WSQL 1VESA 1I1YA 3QP3A 5EFIA 5FUZH 5C09B 4MYWB 4JAMA 2BOBA 2DM4A 1X6LA 5C0NC 3UPRB 5HBBA 1NFIA 3EYOB 1OHQA 3PHOA 2RFXA 5A16A 4L8BA 1CDBA 2UV3A 2R1XB 3VXOA 3IJYA 3U7WH 2EIDA 4U7SA 4EUPA 5T3ZD 5BOZG 4DFIA 4NJAH 2BJMH 4WI3A 1EXUA 3IFPA 1VGEL 1R5VA 4ONHB 3IXAB 4HWEL 5FGBA 2IAMB 3HPJA 5KSAB 2VLJE 4HAGA 4Z7OF 4QXTA 5JQHC 4MDIB 2EDNA 4EI6A 3TH2T 3MRDA 1QPXA 3ARFC 3STLB 3OF6D 2ZOLB 1PLGH 2AJZA 3PDOB 5ETUB 1EEUA 1MREH 1ADQL 3MLRH 2V6HA 5BZWB 1XF1A 4QRQB 3GBNH 2V5YA 1QBLL 1HWHB 4X5XA 3WBDA 5D93C 4P9HL 1YMME 3MNVB 2QR0B 4HCRH 5IW6B 4N0CA 3O6LL 5E7FA 4OFDA 4MXQA 1LK2A 2YSSA 4EUPG 1KTLB 1INDH 4C83A 4YO0A 1JGLL 5TE4L 4QWWC 3SKMA 3WUWA 1I3UA 1U8LB 1WITA 4JM2A 1MUJA 3BD4A 3QXDA 4CU6A 1KJVB 4AENB 3DV6B 3EYUH 5HI5C 1S9KC 4PJEA 3S8WA 3KVQA 4HIHA 3BAEH 3B5TA 3CVHL 1LQSR 2DRUA 3QH3B 2A0LC 4P49A 2P5WD 5DYOA 2CDFA 3IXAA 3VXSB 5DEFB 3IFNH 1V3LA 5AD0B 4H20L 4PTUA 3VFTB 3ZTJH 4PJGF 4L4TE 5B3NA 3U0TB 4X6FA 1N6QL 2VJXA 5ICZB 4XX1G 2CKNA 3ZKMC 1HI6B 4O58L 1KIRB 4UNTA 1DUYA 4LLAA 5BW7A 4XNUH 8CGTA 1SVCP 1YJDH 5EO1A 4Z7UB 4IRJA 3BPCB 5D6DA 4HWBH 4XGZA 1YPZE 1J10A 3IXTB 3FN3A 1DSFL 3SEPA 4Z7UF 2CLZB 3KG5A 3B8YA 3H9SB 1W2KT 1LO5A 4M7LL 4DK3A 3T0DA 1RIUH 1AGBA 5F7YC 4RMTA 4YX2H 5F7EL 4X4ZA 4XMKL 4LSQH 2FJGA 1P4BH 2IJ0C 3JWOC 5LAXA 4BELD 2OCFD 3DBXB 3DI3B 1HH9B 1GZQA 5D71H 2X4PA 3NCMA 5BZDB 1X7QB 1UWEH 1KB5A 1MHCA