5HGKA

Hiv-1 ca n-terminal domain, open conformation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 49
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgkA00
3MGEA 2XGYA 2XGUA 2EIAA 4XFYA 2GOLB 4PH2A 2X82A 2PXRC 4XFXA 4XROA 1QRJA 3H47A 4LQWC 4DGEC 1L6NA 1M9FC 1E6JP 2XGVA 2WLVB 4U0CA 2M8LA 4E91A 3P05A 4WYMA 2M8NA 4U0EA 4DGAC 1AFVA 2PWMA 2V4XA 3NTEA 1EIAA 4U0DA 2GONA 4XFZA 1GWPA 1M9YC 2LF4A 2Y4ZA 1M9XC 3BP9A 1G03A 1EM9A 1P7NA 1U7KA 2WLVA 2XDEA 5HGMA 5HGNA 4HTWA 4B4NA 4PH3A 4U0AA 5HGKA 5JPAA 4INBA 1M9EC 2X83A 2X2DD 2JPRA 5HGOA 2KGFA 2PWOA 4QNBA 1M9CC 1M9DC 5HGLA 4U0FA 4U0BA 3H4EA 1D1DA 4NX4C 4PH0A 4E92A 1AK4C 2M8PA 4XRQA 4J93A
chains in the Genus database with same CATH superfamily
3MGEA 2XGYA 2XGUA 2EIAA 4XFYA 2GOLB 4PH2A 2X82A 2PXRC 4XFXA 4XROA 1QRJA 3H47A 4LQWC 4DGEC 1L6NA 1M9FC 1E6JP 2XGVA 2WLVB 4U0CA 2M8LA 4E91A 3P05A 4WYMA 2M8NA 4U0EA 4DGAC 1AFVA 2PWMA 2V4XA 3NTEA 1EIAA 4U0DA 2GONA 4XFZA 1GWPA 1M9YC 2LF4A 2Y4ZA 1M9XC 3BP9A 1G03A 1EM9A 1P7NA 1U7KA 2WLVA 2XDEA 5HGMA 5HGNA 4HTWA 4B4NA 4PH3A 4U0AA 5HGKA 5JPAA 4INBA 1M9EC 2X83A 2X2DD 2JPRA 5HGOA 2KGFA 2PWOA 4QNBA 1M9CC 1M9DC 5HGLA 4U0FA 4U0BA 3H4EA 1D1DA 4NX4C 4PH0A 4E92A 1AK4C 2M8PA 4XRQA 4J93A
chains in the Genus database with same CATH topology
3MGEA 2XGYA 2XGUA 2EIAA 4XFYA 2GOLB 4PH2A 2X82A 2PXRC 4XFXA 4XROA 1QRJA 3H47A 4LQWC 4DGEC 1L6NA 1M9FC 1E6JP 2XGVA 2WLVB 4U0CA 2M8LA 4E91A 3P05A 4WYMA 2M8NA 4U0EA 4DGAC 1AFVA 2PWMA 2V4XA 3NTEA 1EIAA 4U0DA 2GONA 4XFZA 1GWPA 1M9YC 2LF4A 2Y4ZA 1M9XC 3BP9A 1G03A 1EM9A 1P7NA 1U7KA 2WLVA 2XDEA 5HGMA 5HGNA 4HTWA 4B4NA 4PH3A 4U0AA 5HGKA 5JPAA 4INBA 1M9EC 2X83A 2X2DD 2JPRA 5HGOA 2KGFA 2PWOA 4QNBA 1M9CC 1M9DC 5HGLA 4U0FA 4U0BA 3H4EA 1D1DA 4NX4C 4PH0A 4E92A 1AK4C 2M8PA 4XRQA 4J93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGE A;  2XGY A;  2XGU A;  2EIA A;  4XFY A;  2GOL B;  4PH2 A;  2X82 A;  2PXR C;  4XFX A;  4XRO A;  1QRJ A;  3H47 A;  4LQW C;  4DGE C;  1L6N A;  1M9F C;  1E6J P;  2XGV A;  2WLV B;  4U0C A;  2M8L A;  4E91 A;  3P05 A;  4WYM A;  2M8N A;  4U0E A;  4DGA C;  1AFV A;  2PWM A;  2V4X A;  3NTE A;  1EIA A;  4U0D A;  2GON A;  4XFZ A;  1GWP A;  1M9Y C;  2LF4 A;  2Y4Z A;  1M9X C;  3BP9 A;  1G03 A;  1EM9 A;  1P7N A;  1U7K A;  2WLV A;  2XDE A;  5HGM A;  5HGN A;  4HTW A;  4B4N A;  4PH3 A;  4U0A A;  5HGK A;  5JPA A;  4INB A;  1M9E C;  2X83 A;  2X2D D;  2JPR A;  5HGO A;  2KGF A;  2PWO A;  4QNB A;  1M9C C;  1M9D C;  5HGL A;  4U0F A;  4U0B A;  3H4E A;  1D1D A;  4NX4 C;  4PH0 A;  4E92 A;  1AK4 C;  2M8P A;  4XRQ A;  4J93 A; 
#chains in the Genus database with same CATH topology
 3MGE A;  2XGY A;  2XGU A;  2EIA A;  4XFY A;  2GOL B;  4PH2 A;  2X82 A;  2PXR C;  4XFX A;  4XRO A;  1QRJ A;  3H47 A;  4LQW C;  4DGE C;  1L6N A;  1M9F C;  1E6J P;  2XGV A;  2WLV B;  4U0C A;  2M8L A;  4E91 A;  3P05 A;  4WYM A;  2M8N A;  4U0E A;  4DGA C;  1AFV A;  2PWM A;  2V4X A;  3NTE A;  1EIA A;  4U0D A;  2GON A;  4XFZ A;  1GWP A;  1M9Y C;  2LF4 A;  2Y4Z A;  1M9X C;  3BP9 A;  1G03 A;  1EM9 A;  1P7N A;  1U7K A;  2WLV A;  2XDE A;  5HGM A;  5HGN A;  4HTW A;  4B4N A;  4PH3 A;  4U0A A;  5HGK A;  5JPA A;  4INB A;  1M9E C;  2X83 A;  2X2D D;  2JPR A;  5HGO A;  2KGF A;  2PWO A;  4QNB A;  1M9C C;  1M9D C;  5HGL A;  4U0F A;  4U0B A;  3H4E A;  1D1D A;  4NX4 C;  4PH0 A;  4E92 A;  1AK4 C;  2M8P A;  4XRQ A;  4J93 A; 
#chains in the Genus database with same CATH homology
 3MGE A;  2XGY A;  2XGU A;  2EIA A;  4XFY A;  2GOL B;  4PH2 A;  2X82 A;  2PXR C;  4XFX A;  4XRO A;  1QRJ A;  3H47 A;  4LQW C;  4DGE C;  1L6N A;  1M9F C;  1E6J P;  2XGV A;  2WLV B;  4U0C A;  2M8L A;  4E91 A;  3P05 A;  4WYM A;  2M8N A;  4U0E A;  4DGA C;  1AFV A;  2PWM A;  2V4X A;  3NTE A;  1EIA A;  4U0D A;  2GON A;  4XFZ A;  1GWP A;  1M9Y C;  2LF4 A;  2Y4Z A;  1M9X C;  3BP9 A;  1G03 A;  1EM9 A;  1P7N A;  1U7K A;  2WLV A;  2XDE A;  5HGM A;  5HGN A;  4HTW A;  4B4N A;  4PH3 A;  4U0A A;  5HGK A;  5JPA A;  4INB A;  1M9E C;  2X83 A;  2X2D D;  2JPR A;  5HGO A;  2KGF A;  2PWO A;  4QNB A;  1M9C C;  1M9D C;  5HGL A;  4U0F A;  4U0B A;  3H4E A;  1D1D A;  4NX4 C;  4PH0 A;  4E92 A;  1AK4 C;  2M8P A;  4XRQ A;  4J93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...