5HGKA

Hiv-1 ca n-terminal domain, open conformation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein
total genus 49
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgkA00
2M8LA 2XGVA 1EIAA 3H47A 2LF4A 4DGEC 4NX4C 3BP9A 2X82A 1D1DA 4XFYA 1M9CC 2X2DD 4QNBA 4E91A 4U0BA 2V4XA 1E6JP 4PH2A 5HGNA 1QRJA 2PWMA 4U0AA 5JPAA 5HGKA 1AK4C 3P05A 4U0DA 2PXRC 4XFXA 5HGMA 1M9EC 1P7NA 2WLVA 1M9FC 4PH0A 5HGLA 1U7KA 2X83A 4WYMA 5HGOA 4E92A 1M9YC 4XRQA 1AFVA 1M9XC 2GOLB 2GONA 1M9DC 2Y4ZA 2PWOA 2M8NA 3NTEA 4HTWA 2EIAA 3MGEA 4INBA 4LQWC 4U0EA 2XGYA 4PH3A 4XFZA 2JPRA 4B4NA 1EM9A 4J93A 1L6NA 1G03A 2WLVB 4U0CA 2XDEA 2XGUA 3H4EA 2KGFA 2M8PA 4U0FA 4XROA 4DGAC 1GWPA
chains in the Genus database with same CATH superfamily
2M8LA 2XGVA 1EIAA 3H47A 2LF4A 4DGEC 4NX4C 3BP9A 2X82A 1D1DA 4XFYA 1M9CC 2X2DD 4QNBA 4E91A 4U0BA 2V4XA 1E6JP 4PH2A 5HGNA 1QRJA 2PWMA 4U0AA 5JPAA 5HGKA 1AK4C 3P05A 4U0DA 2PXRC 4XFXA 5HGMA 1M9EC 1P7NA 2WLVA 1M9FC 4PH0A 5HGLA 1U7KA 2X83A 4WYMA 5HGOA 4E92A 1M9YC 4XRQA 1AFVA 1M9XC 2GOLB 2GONA 1M9DC 2Y4ZA 2PWOA 2M8NA 3NTEA 4HTWA 2EIAA 3MGEA 4INBA 4LQWC 4U0EA 2XGYA 4PH3A 4XFZA 2JPRA 4B4NA 1EM9A 4J93A 1L6NA 1G03A 2WLVB 4U0CA 2XDEA 2XGUA 3H4EA 2KGFA 2M8PA 4U0FA 4XROA 4DGAC 1GWPA
chains in the Genus database with same CATH topology
2M8LA 2XGVA 1EIAA 3H47A 2LF4A 4DGEC 4NX4C 3BP9A 2X82A 1D1DA 4XFYA 1M9CC 2X2DD 4QNBA 4E91A 4U0BA 2V4XA 1E6JP 4PH2A 5HGNA 1QRJA 2PWMA 4U0AA 5JPAA 5HGKA 1AK4C 3P05A 4U0DA 2PXRC 4XFXA 5HGMA 1M9EC 1P7NA 2WLVA 1M9FC 4PH0A 5HGLA 1U7KA 2X83A 4WYMA 5HGOA 4E92A 1M9YC 4XRQA 1AFVA 1M9XC 2GOLB 2GONA 1M9DC 2Y4ZA 2PWOA 2M8NA 3NTEA 4HTWA 2EIAA 3MGEA 4INBA 4LQWC 4U0EA 2XGYA 4PH3A 4XFZA 2JPRA 4B4NA 1EM9A 4J93A 1L6NA 1G03A 2WLVB 4U0CA 2XDEA 2XGUA 3H4EA 2KGFA 2M8PA 4U0FA 4XROA 4DGAC 1GWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8L A;  2XGV A;  1EIA A;  3H47 A;  2LF4 A;  4DGE C;  4NX4 C;  3BP9 A;  2X82 A;  1D1D A;  4XFY A;  1M9C C;  2X2D D;  4QNB A;  4E91 A;  4U0B A;  2V4X A;  1E6J P;  4PH2 A;  5HGN A;  1QRJ A;  2PWM A;  4U0A A;  5JPA A;  5HGK A;  1AK4 C;  3P05 A;  4U0D A;  2PXR C;  4XFX A;  5HGM A;  1M9E C;  1P7N A;  2WLV A;  1M9F C;  4PH0 A;  5HGL A;  1U7K A;  2X83 A;  4WYM A;  5HGO A;  4E92 A;  1M9Y C;  4XRQ A;  1AFV A;  1M9X C;  2GOL B;  2GON A;  1M9D C;  2Y4Z A;  2PWO A;  2M8N A;  3NTE A;  4HTW A;  2EIA A;  3MGE A;  4INB A;  4LQW C;  4U0E A;  2XGY A;  4PH3 A;  4XFZ A;  2JPR A;  4B4N A;  1EM9 A;  4J93 A;  1L6N A;  1G03 A;  2WLV B;  4U0C A;  2XDE A;  2XGU A;  3H4E A;  2KGF A;  2M8P A;  4U0F A;  4XRO A;  4DGA C;  1GWP A; 
#chains in the Genus database with same CATH topology
 2M8L A;  2XGV A;  1EIA A;  3H47 A;  2LF4 A;  4DGE C;  4NX4 C;  3BP9 A;  2X82 A;  1D1D A;  4XFY A;  1M9C C;  2X2D D;  4QNB A;  4E91 A;  4U0B A;  2V4X A;  1E6J P;  4PH2 A;  5HGN A;  1QRJ A;  2PWM A;  4U0A A;  5JPA A;  5HGK A;  1AK4 C;  3P05 A;  4U0D A;  2PXR C;  4XFX A;  5HGM A;  1M9E C;  1P7N A;  2WLV A;  1M9F C;  4PH0 A;  5HGL A;  1U7K A;  2X83 A;  4WYM A;  5HGO A;  4E92 A;  1M9Y C;  4XRQ A;  1AFV A;  1M9X C;  2GOL B;  2GON A;  1M9D C;  2Y4Z A;  2PWO A;  2M8N A;  3NTE A;  4HTW A;  2EIA A;  3MGE A;  4INB A;  4LQW C;  4U0E A;  2XGY A;  4PH3 A;  4XFZ A;  2JPR A;  4B4N A;  1EM9 A;  4J93 A;  1L6N A;  1G03 A;  2WLV B;  4U0C A;  2XDE A;  2XGU A;  3H4E A;  2KGF A;  2M8P A;  4U0F A;  4XRO A;  4DGA C;  1GWP A; 
#chains in the Genus database with same CATH homology
 2M8L A;  2XGV A;  1EIA A;  3H47 A;  2LF4 A;  4DGE C;  4NX4 C;  3BP9 A;  2X82 A;  1D1D A;  4XFY A;  1M9C C;  2X2D D;  4QNB A;  4E91 A;  4U0B A;  2V4X A;  1E6J P;  4PH2 A;  5HGN A;  1QRJ A;  2PWM A;  4U0A A;  5JPA A;  5HGK A;  1AK4 C;  3P05 A;  4U0D A;  2PXR C;  4XFX A;  5HGM A;  1M9E C;  1P7N A;  2WLV A;  1M9F C;  4PH0 A;  5HGL A;  1U7K A;  2X83 A;  4WYM A;  5HGO A;  4E92 A;  1M9Y C;  4XRQ A;  1AFV A;  1M9X C;  2GOL B;  2GON A;  1M9D C;  2Y4Z A;  2PWO A;  2M8N A;  3NTE A;  4HTW A;  2EIA A;  3MGE A;  4INB A;  4LQW C;  4U0E A;  2XGY A;  4PH3 A;  4XFZ A;  2JPR A;  4B4N A;  1EM9 A;  4J93 A;  1L6N A;  1G03 A;  2WLV B;  4U0C A;  2XDE A;  2XGU A;  3H4E A;  2KGF A;  2M8P A;  4U0F A;  4XRO A;  4DGA C;  1GWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...