5HGLA

Hexameric hiv-1 ca, open conformation
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
207
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein P24
total genus 73
structure length 207
sequence length 219
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hglA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hglA02
2M8PA 4COPA 4HTWA 2LF4A 4U0AA 3DS4A 1P7NA 1EIAA 2XV6A 4U0FA 1M9XC 2PWMA 1A8OA 5HGLA 2JO0A 4NX4C 2GONA 4J93A 3DS3A 3G1GA 3P05A 4U0DA 2XT1A 4QNBA 3VRLC 2XDEA 3LRYA 5DCKA 3DS0A 3BP9A 2XXMA 4XFYA 2PWOA 2WLVA 4XROA 3DTJA 2XGYA 2X2DD 4PH2A 5I4TG 1M9CC 2ONTA 1D1DA 4INBA 2EIAA 4WYMA 4XRQA 1AFVA 4U0BA 4DGEC 5HGKA 1AUMA 4U0CA 4XFXA 4B4NA 5HGMA 1L6NA 3DS5A 1A43A 1QRJA 2WLVB 5HGOA 2L6EA 3MGEA 4COCA 3NTEA 3G21A 2XGVA 2M8NA 1U7KA 1EOQA 1AK4C 4IPYA 4PH3A 1G03A 2PXRC 3G26A 2BUOA 4DGAC 3DS1A 2M8LA 4U0EA 3G0VA 2X82A 1M9DC 2GOLB 4PH1A 1E6JP 1M9FC 3H4EA 4M0IA 3G29A 5JPAA 2KODA 2JYGA 4PH0A 2V4XA 1EM9A 3G28A 2Y4ZA 3G1IA 1BAJA 4E91A 2KGFA 1M9YC 2X83A 4XFZA 2JPRA 4LQWC 3DPHA 1GWPA 1M9EC 4E92A 3DS2A 2JYLA 5HGNA 3H47A 2XGUA
chains in the Genus database with same CATH superfamily
2M8PA 2MD9A 4H2WC 2GZFA 4COPA 5KP8B 1YJWP 1M9XC 1S72P 1RO2A 4NX4C 3CXCO 2JU1A 4QKOA 2K0DX 2XT1A 1VQ5P 2BHVA 1NJIQ 2KR5A 1M6NA 2PEJA 1VQ8P 2Z46A 2KG8A 2WLVA 2KGCA 2EG5A 2N6ZA 2QNWA 2X2DD 3GJNA 2N5HA 3EJDA 1AUMA 4U0CA 4XFXA 4B4NA 1ZMBA 2MVUA 5HGMA 1Q86Q 1K9MQ 1FR2A 2KOOA 1KC8Q 3CPWO 2XZ0D 1VQ4P 3RG2A 3OW2O 2K0YA 3I56P 1RNIA 1DV5A 2GZGA 4DG9A 1DNYA 2VLNA 5BS1A 4H2YC 1G03A 3G26A 2BUOA 3DS1A 2M8LA 1MZ8A 4U0EA 2VSQA 1M9DC 5KP7B 3CCVP 3CCEP 3H4EA 1YHQP 2LPKA 3EJBA 1M1KQ 1Z6MA 3HYBA 1EM9A 3CC2P 2KWLA 1BAJA 4E91A 2FADA 4NEOA 4LQWC 2N5IA 1M9EC 3DS2A 2XGUA 3LMOA 2FVFA 2AF8A 4HTWA 2QEXP 4U0AA 2PEIA 1YJNP 1VKUA 2XV6A 1A8OA 2JO0A 2GONA 1IMPA 2LMLA 1HQBA 1M74A 3VRLC 2GDYA 2XDEA 3LRYA 1VQ6P 1HY8A 3E2DA 3DS0A 1CEIA 2K92A 2OTLP 4XROA 3DTJA 2XGYA 4PH2A 5I4TG 2JAZA 3GZMA 2FVEA 5HVCA 3CC4P 2EFJA 1AFVA 4U0BA 4DGEC 4GR2A 4PXHB 1Q81Q 2LTEA 1VQPP 1VQOP 3Q20A 2NO8A 2X2BA 2GZEA 2FHSC 3U43A 1QRJA 2KGAA 1M90Q 2XZ1C 2WLVB 1YITP 5HGOA 2L6EA 2VLOA 3MGEA 2GDXA 2KG9A 1M6EX 3G21A 2XGVA 3CE7A 1KLPA 2M5RA 2E1MA 3M1MA 2L4BA 2KW2A 1AK4C 5HV8A 2PXRC 4DGAC 5KP6B 3G0VA 2MVVA 2X82A 2GYKA 2ERHA 2KGEA 4PH1A 1AF8A 1T8KA 4H2XC 1VQKP 2FVAA 5JPAA 2KODA 1EMVA 4BPGA 4PH0A 1N8RQ 1KQSO 2Y4ZA 3G1IA 4CA3A 2GZJA 2AFDA 4BPFA 1GWPA 2MY5A 3H47A 1L0HA 2OARA 2L9FA 2PY8A 3EJEA 3DS4A 2N6YA 1P7NA 1EIAA 2PWMA 2ROQA 1GPJA 3G1GA 4U0DA 4QNBA 7CEIA 2FQ2A 1YIJP 1K8AQ 1AYIA 2OTJP 2EHSA 1QVFO 3BP9A 2XXMA 3GKLC 4R0MA 2FAEA 1F80D 3B5IA 1VQMP 3CCLP 1D1DA 2VLQA 2N50A 4INBA 2PEKA 5HGKA 1ZNVA 2LIWA 2KG6A 1W2BO 3DS5A 1A43A 4BPHA 2PENA 2VLPA 2L0QA 2JU2A 2N98A 4COCA 2K2QA 3CCJP 2PEQA 1UJZA 1BXIA 3WBHA 2JB0A 2GZIA 2FACA 2EHTA 3G6EP 2K0XA 5EJDA 2GOLB 1K30A 1KD1Q 2JGPA 4M0IA 3G29A 3H0DA 2KGDA 2PEOA 2JYGA 3NY7B 4PWVB 2L22A 3G28A 1M9YC 2X83A 4XFZA 1UNKA 2JPRA 4E92A 2CNRA 3RG6C 5HGNA 1IUQA 3CD6P 3CMEP 2JQ4A 2MF4A 2CWOA 2AFEA 2LF4A 2QA4P 4U0FA 3GZLA 2K94A 2LIUA 5HGLA 2FQ0A 4J93A 3DS3A 2CGQA 3P05A 5DCKA 3G71P 2CQ8A 1IMQA 4XFYA 2PWOA 3CMAP 3HZQA 2KOQA 2AVAA 1K73Q 1M9CC 2ONTA 1X3OA 4MRTC 2LOLA 4GR6A 2EIAA 4WYMA 4XRQA 5CZDB 2PEMA 2FQ1A 3CCRP 1L6NA 1L0IA 3G4SP 2JBGA 4IZ6A 5F2KA 4HKGA 1VHNA 5BS2A 1YI2P 4UHPB 3CCMP 2LL8A 3NTEA 3CCSP 2KOPA 5F2NA 2GDWA 2K5XA 2M8NA 1VQ9P 1VQLP 2CG5B 1U7KA 1EOQA 1RO0A 4IPYA 4PH3A 1GXHA 1GXGA 1ACPA 2Z45A 2LKIA 2KOSA 3CCQP 2PNGA 1E0HA 1VQNP 5EW5E 3B4QA 1E6JP 2KORA 1Q7YQ 2Z44A 1M9FC 1Q82Q 1JJ2O 5F2OA 2MR7A 1QVGO 2MR8A 3CC7P 2V4XA 1VQ7P 4F37A 1YJ9P 1OR5A 3I55P 2KGFA 2DGYA 3CCUP 3DPHA 2WPTA 1NQ4A 2K93A 2JYLA 2DNWA 2P9XA
chains in the Genus database with same CATH topology
2PY8A 2M8PA 2CWOA 4COPA 4HTWA 2LF4A 4U0AA 2QEXP 3DS4A 2PEIA 1YJNP 1P7NA 1EIAA 2XV6A 2QA4P 4U0FA 1YJWP 1M9XC 2PWMA 1A8OA 1S72P 5HGLA 2JO0A 1RO2A 4NX4C 2GONA 3CXCO 4J93A 3DS3A 3G1GA 3P05A 1VQ5P 4U0DA 1M74A 2XT1A 4QNBA 1YIJP 3VRLC 2BHVA 2XDEA 1K8AQ 3LRYA 1NJIQ 3E2DA 5DCKA 3DS0A 1VQ6P 1QVFO 3BP9A 1M6NA 2PEJA 3G71P 2XXMA 2OTJP 2OTLP 1VQ8P 2Z46A 4XFYA 2PWOA 2WLVA 3B5IA 4XROA 2EG5A 3HZQA 3DTJA 3CMAP 1VQMP 2XGYA 1K73Q 2X2DD 3CCLP 3CD6P 4PH2A 5I4TG 1M9CC 2ONTA 1D1DA 4INBA 2PEKA 4GR6A 2EIAA 3CC4P 4WYMA 4XRQA 2EFJA 1AFVA 4U0BA 4DGEC 5HGKA 4GR2A 1AUMA 1Q81Q 1VQPP 4U0CA 4XFXA 4B4NA 2PEMA 1ZMBA 1VQOP 1W2BO 3Q20A 3CCRP 5HGMA 1L6NA 3DS5A 1A43A 1Q86Q 1K9MQ 3G4SP 2PENA 1KC8Q 1QRJA 5F2KA 3CPWO 1M90Q 2WLVB 1VQ4P 1YITP 5HGOA 5BS2A 2L6EA 1YI2P 3MGEA 3CCMP 3OW2O 3I56P 1RNIA 4COCA 3NTEA 3CCSP 1M6EX 3G21A 5F2NA 2XGVA 2M8NA 3CCJP 1VQ9P 1VQLP 2PEQA 2E1MA 3M1MA 3WBHA 5BS1A 1U7KA 1EOQA 1AK4C 1RO0A 4PH3A 4IPYA 1G03A 2PXRC 3G26A 3G6EP 2BUOA 2Z45A 4DGAC 3DS1A 2M8LA 4U0EA 3G0VA 3CCQP 2X82A 1M9DC 1VQNP 2GOLB 1K30A 1KD1Q 4PH1A 1E6JP 1Q7YQ 3CCVP 2Z44A 3CCEP 1M9FC 3H4EA 4M0IA 1YHQP 1Q82Q 3G29A 1VQKP 3H0DA 2PEOA 5JPAA 2KODA 1JJ2O 2JYGA 5F2OA 1QVGO 1M1KQ 4PH0A 1N8RQ 3HYBA 3CC7P 2V4XA 1VQ7P 1KQSO 1EM9A 3G28A 2Y4ZA 3G1IA 1YJ9P 3CC2P 1BAJA 3I55P 4E91A 2KGFA 1M9YC 2X83A 4XFZA 2DGYA 2JPRA 4LQWC 3CCUP 3DPHA 1GWPA 1M9EC 4E92A 3DS2A 3RG6C 2JYLA 5HGNA 3H47A 1IUQA 3CMEP 2XGUA 2OARA 2P9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8P A;  4COP A;  4HTW A;  2LF4 A;  4U0A A;  3DS4 A;  1P7N A;  1EIA A;  2XV6 A;  4U0F A;  1M9X C;  2PWM A;  1A8O A;  5HGL A;  2JO0 A;  4NX4 C;  2GON A;  4J93 A;  3DS3 A;  3G1G A;  3P05 A;  4U0D A;  2XT1 A;  4QNB A;  3VRL C;  2XDE A;  3LRY A;  5DCK A;  3DS0 A;  3BP9 A;  2XXM A;  4XFY A;  2PWO A;  2WLV A;  4XRO A;  3DTJ A;  2XGY A;  2X2D D;  4PH2 A;  5I4T G;  1M9C C;  2ONT A;  1D1D A;  4INB A;  2EIA A;  4WYM A;  4XRQ A;  1AFV A;  4U0B A;  4DGE C;  5HGK A;  1AUM A;  4U0C A;  4XFX A;  4B4N A;  5HGM A;  1L6N A;  3DS5 A;  1A43 A;  1QRJ A;  2WLV B;  5HGO A;  2L6E A;  3MGE A;  4COC A;  3NTE A;  3G21 A;  2XGV A;  2M8N A;  1U7K A;  1EOQ A;  1AK4 C;  4IPY A;  4PH3 A;  1G03 A;  2PXR C;  3G26 A;  2BUO A;  4DGA C;  3DS1 A;  2M8L A;  4U0E A;  3G0V A;  2X82 A;  1M9D C;  2GOL B;  4PH1 A;  1E6J P;  1M9F C;  3H4E A;  4M0I A;  3G29 A;  5JPA A;  2KOD A;  2JYG A;  4PH0 A;  2V4X A;  1EM9 A;  3G28 A;  2Y4Z A;  3G1I A;  1BAJ A;  4E91 A;  2KGF A;  1M9Y C;  2X83 A;  4XFZ A;  2JPR A;  4LQW C;  3DPH A;  1GWP A;  1M9E C;  4E92 A;  3DS2 A;  2JYL A;  5HGN A;  3H47 A;  2XGU A; 
#chains in the Genus database with same CATH topology
 2M8P A;  2MD9 A;  4H2W C;  2GZF A;  4COP A;  5KP8 B;  1YJW P;  1M9X C;  1S72 P;  1RO2 A;  4NX4 C;  3CXC O;  2JU1 A;  4QKO A;  2K0D X;  2XT1 A;  1VQ5 P;  2BHV A;  1NJI Q;  2KR5 A;  1M6N A;  2PEJ A;  1VQ8 P;  2Z46 A;  2KG8 A;  2WLV A;  2KGC A;  2EG5 A;  2N6Z A;  2QNW A;  2X2D D;  3GJN A;  2N5H A;  3EJD A;  1AUM A;  4U0C A;  4XFX A;  4B4N A;  1ZMB A;  2MVU A;  5HGM A;  1Q86 Q;  1K9M Q;  1FR2 A;  2KOO A;  1KC8 Q;  3CPW O;  2XZ0 D;  1VQ4 P;  3RG2 A;  3OW2 O;  2K0Y A;  3I56 P;  1RNI A;  1DV5 A;  2GZG A;  4DG9 A;  1DNY A;  2VLN A;  5BS1 A;  4H2Y C;  1G03 A;  3G26 A;  2BUO A;  3DS1 A;  2M8L A;  1MZ8 A;  4U0E A;  2VSQ A;  1M9D C;  5KP7 B;  3CCV P;  3CCE P;  3H4E A;  1YHQ P;  2LPK A;  3EJB A;  1M1K Q;  1Z6M A;  3HYB A;  1EM9 A;  3CC2 P;  2KWL A;  1BAJ A;  4E91 A;  2FAD A;  4NEO A;  4LQW C;  2N5I A;  1M9E C;  3DS2 A;  2XGU A;  3LMO A;  2FVF A;  2AF8 A;  4HTW A;  2QEX P;  4U0A A;  2PEI A;  1YJN P;  1VKU A;  2XV6 A;  1A8O A;  2JO0 A;  2GON A;  1IMP A;  2LML A;  1HQB A;  1M74 A;  3VRL C;  2GDY A;  2XDE A;  3LRY A;  1VQ6 P;  1HY8 A;  3E2D A;  3DS0 A;  1CEI A;  2K92 A;  2OTL P;  4XRO A;  3DTJ A;  2XGY A;  4PH2 A;  5I4T G;  2JAZ A;  3GZM A;  2FVE A;  5HVC A;  3CC4 P;  2EFJ A;  1AFV A;  4U0B A;  4DGE C;  4GR2 A;  4PXH B;  1Q81 Q;  2LTE A;  1VQP P;  1VQO P;  3Q20 A;  2NO8 A;  2X2B A;  2GZE A;  2FHS C;  3U43 A;  1QRJ A;  2KGA A;  1M90 Q;  2XZ1 C;  2WLV B;  1YIT P;  5HGO A;  2L6E A;  2VLO A;  3MGE A;  2GDX A;  2KG9 A;  1M6E X;  3G21 A;  2XGV A;  3CE7 A;  1KLP A;  2M5R A;  2E1M A;  3M1M A;  2L4B A;  2KW2 A;  1AK4 C;  5HV8 A;  2PXR C;  4DGA C;  5KP6 B;  3G0V A;  2MVV A;  2X82 A;  2GYK A;  2ERH A;  2KGE A;  4PH1 A;  1AF8 A;  1T8K A;  4H2X C;  1VQK P;  2FVA A;  5JPA A;  2KOD A;  1EMV A;  4BPG A;  4PH0 A;  1N8R Q;  1KQS O;  2Y4Z A;  3G1I A;  4CA3 A;  2GZJ A;  2AFD A;  4BPF A;  1GWP A;  2MY5 A;  3H47 A;  1L0H A;  2OAR A;  2L9F A;  2PY8 A;  3EJE A;  3DS4 A;  2N6Y A;  1P7N A;  1EIA A;  2PWM A;  2ROQ A;  1GPJ A;  3G1G A;  4U0D A;  4QNB A;  7CEI A;  2FQ2 A;  1YIJ P;  1K8A Q;  1AYI A;  2OTJ P;  2EHS A;  1QVF O;  3BP9 A;  2XXM A;  3GKL C;  4R0M A;  2FAE A;  1F80 D;  3B5I A;  1VQM P;  3CCL P;  1D1D A;  2VLQ A;  2N50 A;  4INB A;  2PEK A;  5HGK A;  1ZNV A;  2LIW A;  2KG6 A;  1W2B O;  3DS5 A;  1A43 A;  4BPH A;  2PEN A;  2VLP A;  2L0Q A;  2JU2 A;  2N98 A;  4COC A;  2K2Q A;  3CCJ P;  2PEQ A;  1UJZ A;  1BXI A;  3WBH A;  2JB0 A;  2GZI A;  2FAC A;  2EHT A;  3G6E P;  2K0X A;  5EJD A;  2GOL B;  1K30 A;  1KD1 Q;  2JGP A;  4M0I A;  3G29 A;  3H0D A;  2KGD A;  2PEO A;  2JYG A;  3NY7 B;  4PWV B;  2L22 A;  3G28 A;  1M9Y C;  2X83 A;  4XFZ A;  1UNK A;  2JPR A;  4E92 A;  2CNR A;  3RG6 C;  5HGN A;  1IUQ A;  3CD6 P;  3CME P;  2JQ4 A;  2MF4 A;  2CWO A;  2AFE A;  2LF4 A;  2QA4 P;  4U0F A;  3GZL A;  2K94 A;  2LIU A;  5HGL A;  2FQ0 A;  4J93 A;  3DS3 A;  2CGQ A;  3P05 A;  5DCK A;  3G71 P;  2CQ8 A;  1IMQ A;  4XFY A;  2PWO A;  3CMA P;  3HZQ A;  2KOQ A;  2AVA A;  1K73 Q;  1M9C C;  2ONT A;  1X3O A;  4MRT C;  2LOL A;  4GR6 A;  2EIA A;  4WYM A;  4XRQ A;  5CZD B;  2PEM A;  2FQ1 A;  3CCR P;  1L6N A;  1L0I A;  3G4S P;  2JBG A;  4IZ6 A;  5F2K A;  4HKG A;  1VHN A;  5BS2 A;  1YI2 P;  4UHP B;  3CCM P;  2LL8 A;  3NTE A;  3CCS P;  2KOP A;  5F2N A;  2GDW A;  2K5X A;  2M8N A;  1VQ9 P;  1VQL P;  2CG5 B;  1U7K A;  1EOQ A;  1RO0 A;  4IPY A;  4PH3 A;  1GXH A;  1GXG A;  1ACP A;  2Z45 A;  2LKI A;  2KOS A;  3CCQ P;  2PNG A;  1E0H A;  1VQN P;  5EW5 E;  3B4Q A;  1E6J P;  2KOR A;  1Q7Y Q;  2Z44 A;  1M9F C;  1Q82 Q;  1JJ2 O;  5F2O A;  2MR7 A;  1QVG O;  2MR8 A;  3CC7 P;  2V4X A;  1VQ7 P;  4F37 A;  1YJ9 P;  1OR5 A;  3I55 P;  2KGF A;  2DGY A;  3CCU P;  3DPH A;  2WPT A;  1NQ4 A;  2K93 A;  2JYL A;  2DNW A;  2P9X A; 
#chains in the Genus database with same CATH homology
 2PY8 A;  2M8P A;  2CWO A;  4COP A;  4HTW A;  2LF4 A;  4U0A A;  2QEX P;  3DS4 A;  2PEI A;  1YJN P;  1P7N A;  1EIA A;  2XV6 A;  2QA4 P;  4U0F A;  1YJW P;  1M9X C;  2PWM A;  1A8O A;  1S72 P;  5HGL A;  2JO0 A;  1RO2 A;  4NX4 C;  2GON A;  3CXC O;  4J93 A;  3DS3 A;  3G1G A;  3P05 A;  1VQ5 P;  4U0D A;  1M74 A;  2XT1 A;  4QNB A;  1YIJ P;  3VRL C;  2BHV A;  2XDE A;  1K8A Q;  3LRY A;  1NJI Q;  3E2D A;  5DCK A;  3DS0 A;  1VQ6 P;  1QVF O;  3BP9 A;  1M6N A;  2PEJ A;  3G71 P;  2XXM A;  2OTJ P;  2OTL P;  1VQ8 P;  2Z46 A;  4XFY A;  2PWO A;  2WLV A;  3B5I A;  4XRO A;  2EG5 A;  3HZQ A;  3DTJ A;  3CMA P;  1VQM P;  2XGY A;  1K73 Q;  2X2D D;  3CCL P;  3CD6 P;  4PH2 A;  5I4T G;  1M9C C;  2ONT A;  1D1D A;  4INB A;  2PEK A;  4GR6 A;  2EIA A;  3CC4 P;  4WYM A;  4XRQ A;  2EFJ A;  1AFV A;  4U0B A;  4DGE C;  5HGK A;  4GR2 A;  1AUM A;  1Q81 Q;  1VQP P;  4U0C A;  4XFX A;  4B4N A;  2PEM A;  1ZMB A;  1VQO P;  1W2B O;  3Q20 A;  3CCR P;  5HGM A;  1L6N A;  3DS5 A;  1A43 A;  1Q86 Q;  1K9M Q;  3G4S P;  2PEN A;  1KC8 Q;  1QRJ A;  5F2K A;  3CPW O;  1M90 Q;  2WLV B;  1VQ4 P;  1YIT P;  5HGO A;  5BS2 A;  2L6E A;  1YI2 P;  3MGE A;  3CCM P;  3OW2 O;  3I56 P;  1RNI A;  4COC A;  3NTE A;  3CCS P;  1M6E X;  3G21 A;  5F2N A;  2XGV A;  2M8N A;  3CCJ P;  1VQ9 P;  1VQL P;  2PEQ A;  2E1M A;  3M1M A;  3WBH A;  5BS1 A;  1U7K A;  1EOQ A;  1AK4 C;  1RO0 A;  4PH3 A;  4IPY A;  1G03 A;  2PXR C;  3G26 A;  3G6E P;  2BUO A;  2Z45 A;  4DGA C;  3DS1 A;  2M8L A;  4U0E A;  3G0V A;  3CCQ P;  2X82 A;  1M9D C;  1VQN P;  2GOL B;  1K30 A;  1KD1 Q;  4PH1 A;  1E6J P;  1Q7Y Q;  3CCV P;  2Z44 A;  3CCE P;  1M9F C;  3H4E A;  4M0I A;  1YHQ P;  1Q82 Q;  3G29 A;  1VQK P;  3H0D A;  2PEO A;  5JPA A;  2KOD A;  1JJ2 O;  2JYG A;  5F2O A;  1QVG O;  1M1K Q;  4PH0 A;  1N8R Q;  3HYB A;  3CC7 P;  2V4X A;  1VQ7 P;  1KQS O;  1EM9 A;  3G28 A;  2Y4Z A;  3G1I A;  1YJ9 P;  3CC2 P;  1BAJ A;  3I55 P;  4E91 A;  2KGF A;  1M9Y C;  2X83 A;  4XFZ A;  2DGY A;  2JPR A;  4LQW C;  3CCU P;  3DPH A;  1GWP A;  1M9E C;  4E92 A;  3DS2 A;  3RG6 C;  2JYL A;  5HGN A;  3H47 A;  1IUQ A;  3CME P;  2XGU A;  2OAR A;  2P9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...