5HGLA

Hexameric hiv-1 ca, open conformation
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
207
Chain Sequence
b'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 73
structure length 207
sequence length 219
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hglA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hglA02
4B4NA 1L6NA 4XRQA 5HGLA 3NTEA 1AUMA 1P7NA 1BAJA 4XROA 5JPAA 1U7KA 4WYMA 2XT1A 4COCA 2ONTA 2WLVB 2XGUA 1A43A 4HTWA 1E6JP 4IPYA 1GWPA 3G0VA 3P05A 3G29A 1M9EC 1D1DA 4XFXA 2WLVA 2M8PA 2JYGA 2X83A 4U0EA 4LQWC 2XGVA 1M9CC 5HGNA 1M9XC 4XFYA 3VRLC 1EIAA 2GOLB 3DPHA 3G28A 1AFVA 2XXMA 3BP9A 3H4EA 4J93A 2X2DD 1AK4C 2L6EA 4M0IA 4XFZA 2JO0A 3G21A 2EIAA 4DGAC 1M9DC 2LF4A 3DS5A 2M8NA 4U0CA 4PH0A 5I4TG 1G03A 2KGFA 4QNBA 3G1IA 2V4XA 3DS2A 2Y4ZA 2BUOA 3DS4A 2XV6A 1A8OA 2JYLA 4E91A 2X82A 4COPA 2XGYA 4INBA 3DS1A 1EOQA 3DS3A 5HGOA 1M9FC 5HGKA 1M9YC 2JPRA 4U0FA 2PWMA 4PH3A 2XDEA 2M8LA 4DGEC 3G26A 2GONA 4U0DA 4PH1A 4E92A 3LRYA 3MGEA 5HGMA 3DTJA 4PH2A 4U0AA 2KODA 2PWOA 5DCKA 2PXRC 1QRJA 3H47A 4U0BA 3DS0A 4NX4C 3G1GA 1EM9A
chains in the Genus database with same CATH superfamily
3Q20A 2N5IA 1RO2A 3HYBA 2WLVB 2OTJP 2VSQA 2CG5B 3CD6P 1KC8Q 1W2BO 2JYGA 2X83A 4U0EA 4IZ6A 1YIJP 4LQWC 1NJIQ 1GPJA 2QA4P 1EIAA 1VQ8P 2GOLB 3DPHA 2EFJA 4BPGA 2N98A 3RG2A 1QVGO 2AF8A 1VKUA 5EJDA 4J93A 1Q82Q 2X2DD 1AK4C 1VQPP 2BHVA 2N6ZA 2P9XA 1YJNP 3G21A 5F2OA 3CMAP 4H2YC 1VQLP 3OW2O 3DS5A 2KW2A 1JJ2O 1VQMP 1VQ4P 1VHNA 2KGEA 1G03A 4QNBA 2K0DX 3I55P 5HV8A 1AF8A 4NEOA 3U43A 2EHSA 2CWOA 2JU1A 2LKIA 1DV5A 5F2KA 1A8OA 2VLOA 4COPA 1IMPA 2DGYA 5HGOA 2Z45A 2PEJA 2JBGA 1M9FC 1DNYA 5HGKA 3CC2P 2GDXA 5KP7B 3CMEP 1RNIA 4PH3A 5CZDB 2KORA 5F2NA 3M1MA 3DTJA 4PH2A 2DNWA 2E1MA 2EG5A 5DCKA 2K0XA 3H47A 4U0BA 3CC4P 1T8KA 2KR5A 1IMQA 4B4NA 1GXGA 2WPTA 1P7NA 1KLPA 4XROA 2PENA 2AFDA 1YHQP 1A43A 4BPHA 2L4BA 1KD1Q 3P05A 1K30A 4XFXA 1ZNVA 5HVCA 2WLVA 1YITP 5KP8B 2JU2A 4GR2A 2GZGA 3H0DA 1M9CC 5HGNA 2GZFA 3CCJP 4XFYA 1L0IA 3G28A 1L0HA 2XXMA 2FVEA 2L0QA 2MR7A 1VQ6P 2FAEA 3WBHA 2FVFA 3H4EA 2LTEA 1Q86Q 2L6EA 4M0IA 4MRTC 1M90Q 4H2WC 2EIAA 4DGAC 2FADA 2M8NA 4PH0A 2PNGA 5KP6B 1M6EX 3DS2A 1ZMBA 2BUOA 3DS4A 2XV6A 3G6EP 1VQ5P 2JYLA 2LPKA 2X82A 2XGYA 3DS1A 1HQBA 1EOQA 2NO8A 1M9YC 2JGPA 2KOPA 2PWMA 3CXCO 2K5XA 2KOQA 2XDEA 3CPWO 4E92A 2GZEA 2KG8A 2PEKA 5HGMA 2OTLP 4BPFA 3GZMA 1S72P 2PWOA 1M74A 2LL8A 2XZ1C 2VLPA 4NX4C 2M5RA 1L6NA 4XRQA 1BAJA 2LOLA 1UNKA 2XZ0D 2N6YA 2JAZA 5JPAA 1IUQA 1VQKP 4COCA 2ONTA 2MR8A 3CCSP 2FACA 2KG9A 3GKLC 2K94A 2VLQA 1GWPA 1K8AQ 1OR5A 2FVAA 3CCEP 1M9EC 3CCQP 2PEOA 1UJZA 1RO0A 2AFEA 3CC7P 1HY8A 1K73Q 1AFVA 1VQ7P 2ERHA 2KGDA 1BXIA 2KOOA 3BP9A 1E0HA 1EMVA 2N5HA 3RG6C 4PXHB 2LF4A 2FQ1A 4U0CA 5I4TG 2LMLA 1VQNP 2X2BA 3CCVP 3G1IA 2V4XA 2Y4ZA 2AVAA 2CNRA 3I56P 2CQ8A 1GXHA 2KG6A 2N50A 4E91A 2GYKA 4INBA 3E2DA 2FQ0A 2PEMA 2QEXP 3GZLA 3B4QA 2LIWA 4F37A 7CEIA 1YJWP 1N8RQ 3EJBA 1CEIA 1K9MQ 4R0MA 3NY7B 2K93A 2GZJA 1QVFO 1QRJA 1F80D 3G1GA 1Q7YQ 1VQOP 5HGLA 3NTEA 1AUMA 2MF4A 2QNWA 4HKGA 1U7KA 4WYMA 2K2QA 2MVUA 2Z44A 2XT1A 2XGUA 2L22A 2PEQA 3CCRP 1Q81Q 4PWVB 4HTWA 1X3OA 1E6JP 2EHTA 2KGAA 4IPYA 3G0VA 3G29A 2GZIA 1D1DA 4GR6A 2VLNA 5BS1A 2M8PA 2GDYA 2KGCA 3EJDA 2XGVA 3CCUP 1M9XC 3CE7A 1MZ8A 2Z46A 3VRLC 3B5IA 1YJ9P 2PY8A 2KOSA 1VQ9P 1YI2P 1ACPA 2JQ4A 2KWLA 4XFZA 2JO0A 2FHSC 1M6NA 1M9DC 4DG9A 3CCMP 2PEIA 2GDWA 2FQ2A 3LMOA 2KGFA 3GJNA 2MD9A 1FR2A 3HZQA 3DS3A 2JB0A 2K92A 2JPRA 3CCLP 4U0FA 2MVVA 2LIUA 3G4SP 4CA3A 2M8LA 2K0YA 1KQSO 2OARA 4DGEC 3G26A 3EJEA 2GONA 4U0DA 4PH1A 1M1KQ 1AYIA 3LRYA 3MGEA 5BS2A 3G71P 2ROQA 5EW5E 1Z6MA 2MY5A 4H2XC 4U0AA 2CGQA 2L9FA 1NQ4A 2KODA 2PXRC 4UHPB 3DS0A 4QKOA 1EM9A
chains in the Genus database with same CATH topology
4B4NA 3Q20A 1L6NA 1Q7YQ 1VQOP 4XRQA 5HGLA 3NTEA 1AUMA 1P7NA 1BAJA 4XROA 1RO2A 3HYBA 5JPAA 1U7KA 1IUQA 4WYMA 2PENA 2Z44A 1VQKP 2XT1A 4COCA 2ONTA 2WLVB 2XGUA 1YHQP 3CCSP 1A43A 2PEQA 3CCRP 1Q81Q 2OTJP 4HTWA 3CD6P 1E6JP 4IPYA 1GWPA 1K8AQ 3G0VA 1KC8Q 1KD1Q 3P05A 3G29A 3CCEP 1M9EC 1K30A 1D1DA 4GR6A 3CCQP 4XFXA 5BS1A 2WLVA 2M8PA 1YITP 2JYGA 1W2BO 2X83A 4U0EA 2PEOA 1YIJP 4GR2A 4LQWC 2XGVA 1NJIQ 3H0DA 1M9CC 5HGNA 3CCUP 1RO0A 1M9XC 3CCJP 3CC7P 2Z46A 2QA4P 4XFYA 3VRLC 1EIAA 1K73Q 3B5IA 1VQ8P 2GOLB 3DPHA 3G28A 1AFVA 1YJ9P 2XXMA 1VQ7P 2EFJA 2PY8A 1VQ9P 1YI2P 1VQ6P 3WBHA 1QVGO 3BP9A 3H4EA 4J93A 1Q82Q 2X2DD 1AK4C 1VQPP 1Q86Q 2L6EA 4M0IA 1M90Q 2BHVA 4XFZA 2JO0A 2P9XA 3G21A 5F2OA 3CMAP 1YJNP 1M6NA 1VQLP 2EIAA 4DGAC 3RG6C 1M9DC 3OW2O 2LF4A 3DS5A 2M8NA 4U0CA 4PH0A 3CCMP 2PEIA 1JJ2O 5I4TG 1VQMP 1VQ4P 1VQNP 3CCVP 1G03A 2KGFA 4QNBA 3G1IA 2V4XA 3I55P 1M6EX 3DS2A 2Y4ZA 1ZMBA 2BUOA 2CWOA 3DS4A 3I56P 2XV6A 3G6EP 5F2KA 1A8OA 1VQ5P 2JYLA 4E91A 2X82A 4COPA 2XGYA 4INBA 3DS1A 3E2DA 3HZQA 1EOQA 2DGYA 5HGOA 2PEMA 2Z45A 3DS3A 2PEJA 2QEXP 1M9FC 5HGKA 1M9YC 2JPRA 3CC2P 3CCLP 4U0FA 2PWMA 3G4SP 3CMEP 1RNIA 3CXCO 1YJWP 4PH3A 2XDEA 2M8LA 1KQSO 2OARA 4DGEC 3G26A 3CPWO 2GONA 4U0DA 3M1MA 4PH1A 4E92A 2PEKA 5F2NA 1M1KQ 3LRYA 3MGEA 5BS2A 5HGMA 1N8RQ 2OTLP 3G71P 1K9MQ 1S72P 3DTJA 4PH2A 4U0AA 2E1MA 2EG5A 2KODA 2PWOA 5DCKA 1M74A 1QVFO 2PXRC 1QRJA 3H47A 4U0BA 3CC4P 3DS0A 4NX4C 3G1GA 1EM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B4N A;  1L6N A;  4XRQ A;  5HGL A;  3NTE A;  1AUM A;  1P7N A;  1BAJ A;  4XRO A;  5JPA A;  1U7K A;  4WYM A;  2XT1 A;  4COC A;  2ONT A;  2WLV B;  2XGU A;  1A43 A;  4HTW A;  1E6J P;  4IPY A;  1GWP A;  3G0V A;  3P05 A;  3G29 A;  1M9E C;  1D1D A;  4XFX A;  2WLV A;  2M8P A;  2JYG A;  2X83 A;  4U0E A;  4LQW C;  2XGV A;  1M9C C;  5HGN A;  1M9X C;  4XFY A;  3VRL C;  1EIA A;  2GOL B;  3DPH A;  3G28 A;  1AFV A;  2XXM A;  3BP9 A;  3H4E A;  4J93 A;  2X2D D;  1AK4 C;  2L6E A;  4M0I A;  4XFZ A;  2JO0 A;  3G21 A;  2EIA A;  4DGA C;  1M9D C;  2LF4 A;  3DS5 A;  2M8N A;  4U0C A;  4PH0 A;  5I4T G;  1G03 A;  2KGF A;  4QNB A;  3G1I A;  2V4X A;  3DS2 A;  2Y4Z A;  2BUO A;  3DS4 A;  2XV6 A;  1A8O A;  2JYL A;  4E91 A;  2X82 A;  4COP A;  2XGY A;  4INB A;  3DS1 A;  1EOQ A;  3DS3 A;  5HGO A;  1M9F C;  5HGK A;  1M9Y C;  2JPR A;  4U0F A;  2PWM A;  4PH3 A;  2XDE A;  2M8L A;  4DGE C;  3G26 A;  2GON A;  4U0D A;  4PH1 A;  4E92 A;  3LRY A;  3MGE A;  5HGM A;  3DTJ A;  4PH2 A;  4U0A A;  2KOD A;  2PWO A;  5DCK A;  2PXR C;  1QRJ A;  3H47 A;  4U0B A;  3DS0 A;  4NX4 C;  3G1G A;  1EM9 A; 
#chains in the Genus database with same CATH topology
 3Q20 A;  2N5I A;  1RO2 A;  3HYB A;  2WLV B;  2OTJ P;  2VSQ A;  2CG5 B;  3CD6 P;  1KC8 Q;  1W2B O;  2JYG A;  2X83 A;  4U0E A;  4IZ6 A;  1YIJ P;  4LQW C;  1NJI Q;  1GPJ A;  2QA4 P;  1EIA A;  1VQ8 P;  2GOL B;  3DPH A;  2EFJ A;  4BPG A;  2N98 A;  3RG2 A;  1QVG O;  2AF8 A;  1VKU A;  5EJD A;  4J93 A;  1Q82 Q;  2X2D D;  1AK4 C;  1VQP P;  2BHV A;  2N6Z A;  2P9X A;  1YJN P;  3G21 A;  5F2O A;  3CMA P;  4H2Y C;  1VQL P;  3OW2 O;  3DS5 A;  2KW2 A;  1JJ2 O;  1VQM P;  1VQ4 P;  1VHN A;  2KGE A;  1G03 A;  4QNB A;  2K0D X;  3I55 P;  5HV8 A;  1AF8 A;  4NEO A;  3U43 A;  2EHS A;  2CWO A;  2JU1 A;  2LKI A;  1DV5 A;  5F2K A;  1A8O A;  2VLO A;  4COP A;  1IMP A;  2DGY A;  5HGO A;  2Z45 A;  2PEJ A;  2JBG A;  1M9F C;  1DNY A;  5HGK A;  3CC2 P;  2GDX A;  5KP7 B;  3CME P;  1RNI A;  4PH3 A;  5CZD B;  2KOR A;  5F2N A;  3M1M A;  3DTJ A;  4PH2 A;  2DNW A;  2E1M A;  2EG5 A;  5DCK A;  2K0X A;  3H47 A;  4U0B A;  3CC4 P;  1T8K A;  2KR5 A;  1IMQ A;  4B4N A;  1GXG A;  2WPT A;  1P7N A;  1KLP A;  4XRO A;  2PEN A;  2AFD A;  1YHQ P;  1A43 A;  4BPH A;  2L4B A;  1KD1 Q;  3P05 A;  1K30 A;  4XFX A;  1ZNV A;  5HVC A;  2WLV A;  1YIT P;  5KP8 B;  2JU2 A;  4GR2 A;  2GZG A;  3H0D A;  1M9C C;  5HGN A;  2GZF A;  3CCJ P;  4XFY A;  1L0I A;  3G28 A;  1L0H A;  2XXM A;  2FVE A;  2L0Q A;  2MR7 A;  1VQ6 P;  2FAE A;  3WBH A;  2FVF A;  3H4E A;  2LTE A;  1Q86 Q;  2L6E A;  4M0I A;  4MRT C;  1M90 Q;  4H2W C;  2EIA A;  4DGA C;  2FAD A;  2M8N A;  4PH0 A;  2PNG A;  5KP6 B;  1M6E X;  3DS2 A;  1ZMB A;  2BUO A;  3DS4 A;  2XV6 A;  3G6E P;  1VQ5 P;  2JYL A;  2LPK A;  2X82 A;  2XGY A;  3DS1 A;  1HQB A;  1EOQ A;  2NO8 A;  1M9Y C;  2JGP A;  2KOP A;  2PWM A;  3CXC O;  2K5X A;  2KOQ A;  2XDE A;  3CPW O;  4E92 A;  2GZE A;  2KG8 A;  2PEK A;  5HGM A;  2OTL P;  4BPF A;  3GZM A;  1S72 P;  2PWO A;  1M74 A;  2LL8 A;  2XZ1 C;  2VLP A;  4NX4 C;  2M5R A;  1L6N A;  4XRQ A;  1BAJ A;  2LOL A;  1UNK A;  2XZ0 D;  2N6Y A;  2JAZ A;  5JPA A;  1IUQ A;  1VQK P;  4COC A;  2ONT A;  2MR8 A;  3CCS P;  2FAC A;  2KG9 A;  3GKL C;  2K94 A;  2VLQ A;  1GWP A;  1K8A Q;  1OR5 A;  2FVA A;  3CCE P;  1M9E C;  3CCQ P;  2PEO A;  1UJZ A;  1RO0 A;  2AFE A;  3CC7 P;  1HY8 A;  1K73 Q;  1AFV A;  1VQ7 P;  2ERH A;  2KGD A;  1BXI A;  2KOO A;  3BP9 A;  1E0H A;  1EMV A;  2N5H A;  3RG6 C;  4PXH B;  2LF4 A;  2FQ1 A;  4U0C A;  5I4T G;  2LML A;  1VQN P;  2X2B A;  3CCV P;  3G1I A;  2V4X A;  2Y4Z A;  2AVA A;  2CNR A;  3I56 P;  2CQ8 A;  1GXH A;  2KG6 A;  2N50 A;  4E91 A;  2GYK A;  4INB A;  3E2D A;  2FQ0 A;  2PEM A;  2QEX P;  3GZL A;  3B4Q A;  2LIW A;  4F37 A;  7CEI A;  1YJW P;  1N8R Q;  3EJB A;  1CEI A;  1K9M Q;  4R0M A;  3NY7 B;  2K93 A;  2GZJ A;  1QVF O;  1QRJ A;  1F80 D;  3G1G A;  1Q7Y Q;  1VQO P;  5HGL A;  3NTE A;  1AUM A;  2MF4 A;  2QNW A;  4HKG A;  1U7K A;  4WYM A;  2K2Q A;  2MVU A;  2Z44 A;  2XT1 A;  2XGU A;  2L22 A;  2PEQ A;  3CCR P;  1Q81 Q;  4PWV B;  4HTW A;  1X3O A;  1E6J P;  2EHT A;  2KGA A;  4IPY A;  3G0V A;  3G29 A;  2GZI A;  1D1D A;  4GR6 A;  2VLN A;  5BS1 A;  2M8P A;  2GDY A;  2KGC A;  3EJD A;  2XGV A;  3CCU P;  1M9X C;  3CE7 A;  1MZ8 A;  2Z46 A;  3VRL C;  3B5I A;  1YJ9 P;  2PY8 A;  2KOS A;  1VQ9 P;  1YI2 P;  1ACP A;  2JQ4 A;  2KWL A;  4XFZ A;  2JO0 A;  2FHS C;  1M6N A;  1M9D C;  4DG9 A;  3CCM P;  2PEI A;  2GDW A;  2FQ2 A;  3LMO A;  2KGF A;  3GJN A;  2MD9 A;  1FR2 A;  3HZQ A;  3DS3 A;  2JB0 A;  2K92 A;  2JPR A;  3CCL P;  4U0F A;  2MVV A;  2LIU A;  3G4S P;  4CA3 A;  2M8L A;  2K0Y A;  1KQS O;  2OAR A;  4DGE C;  3G26 A;  3EJE A;  2GON A;  4U0D A;  4PH1 A;  1M1K Q;  1AYI A;  3LRY A;  3MGE A;  5BS2 A;  3G71 P;  2ROQ A;  5EW5 E;  1Z6M A;  2MY5 A;  4H2X C;  4U0A A;  2CGQ A;  2L9F A;  1NQ4 A;  2KOD A;  2PXR C;  4UHP B;  3DS0 A;  4QKO A;  1EM9 A; 
#chains in the Genus database with same CATH homology
 4B4N A;  3Q20 A;  1L6N A;  1Q7Y Q;  1VQO P;  4XRQ A;  5HGL A;  3NTE A;  1AUM A;  1P7N A;  1BAJ A;  4XRO A;  1RO2 A;  3HYB A;  5JPA A;  1U7K A;  1IUQ A;  4WYM A;  2PEN A;  2Z44 A;  1VQK P;  2XT1 A;  4COC A;  2ONT A;  2WLV B;  2XGU A;  1YHQ P;  3CCS P;  1A43 A;  2PEQ A;  3CCR P;  1Q81 Q;  2OTJ P;  4HTW A;  3CD6 P;  1E6J P;  4IPY A;  1GWP A;  1K8A Q;  3G0V A;  1KC8 Q;  1KD1 Q;  3P05 A;  3G29 A;  3CCE P;  1M9E C;  1K30 A;  1D1D A;  4GR6 A;  3CCQ P;  4XFX A;  5BS1 A;  2WLV A;  2M8P A;  1YIT P;  2JYG A;  1W2B O;  2X83 A;  4U0E A;  2PEO A;  1YIJ P;  4GR2 A;  4LQW C;  2XGV A;  1NJI Q;  3H0D A;  1M9C C;  5HGN A;  3CCU P;  1RO0 A;  1M9X C;  3CCJ P;  3CC7 P;  2Z46 A;  2QA4 P;  4XFY A;  3VRL C;  1EIA A;  1K73 Q;  3B5I A;  1VQ8 P;  2GOL B;  3DPH A;  3G28 A;  1AFV A;  1YJ9 P;  2XXM A;  1VQ7 P;  2EFJ A;  2PY8 A;  1VQ9 P;  1YI2 P;  1VQ6 P;  3WBH A;  1QVG O;  3BP9 A;  3H4E A;  4J93 A;  1Q82 Q;  2X2D D;  1AK4 C;  1VQP P;  1Q86 Q;  2L6E A;  4M0I A;  1M90 Q;  2BHV A;  4XFZ A;  2JO0 A;  2P9X A;  3G21 A;  5F2O A;  3CMA P;  1YJN P;  1M6N A;  1VQL P;  2EIA A;  4DGA C;  3RG6 C;  1M9D C;  3OW2 O;  2LF4 A;  3DS5 A;  2M8N A;  4U0C A;  4PH0 A;  3CCM P;  2PEI A;  1JJ2 O;  5I4T G;  1VQM P;  1VQ4 P;  1VQN P;  3CCV P;  1G03 A;  2KGF A;  4QNB A;  3G1I A;  2V4X A;  3I55 P;  1M6E X;  3DS2 A;  2Y4Z A;  1ZMB A;  2BUO A;  2CWO A;  3DS4 A;  3I56 P;  2XV6 A;  3G6E P;  5F2K A;  1A8O A;  1VQ5 P;  2JYL A;  4E91 A;  2X82 A;  4COP A;  2XGY A;  4INB A;  3DS1 A;  3E2D A;  3HZQ A;  1EOQ A;  2DGY A;  5HGO A;  2PEM A;  2Z45 A;  3DS3 A;  2PEJ A;  2QEX P;  1M9F C;  5HGK A;  1M9Y C;  2JPR A;  3CC2 P;  3CCL P;  4U0F A;  2PWM A;  3G4S P;  3CME P;  1RNI A;  3CXC O;  1YJW P;  4PH3 A;  2XDE A;  2M8L A;  1KQS O;  2OAR A;  4DGE C;  3G26 A;  3CPW O;  2GON A;  4U0D A;  3M1M A;  4PH1 A;  4E92 A;  2PEK A;  5F2N A;  1M1K Q;  3LRY A;  3MGE A;  5BS2 A;  5HGM A;  1N8R Q;  2OTL P;  3G71 P;  1K9M Q;  1S72 P;  3DTJ A;  4PH2 A;  4U0A A;  2E1M A;  2EG5 A;  2KOD A;  2PWO A;  5DCK A;  1M74 A;  1QVF O;  2PXR C;  1QRJ A;  3H47 A;  4U0B A;  3CC4 P;  3DS0 A;  4NX4 C;  3G1G A;  1EM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...