5HGLA

Hexameric hiv-1 ca, open conformation
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
207
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 73
structure length 207
sequence length 219
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hglA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hglA02
3DS2A 2JPRA 2JYGA 1AK4C 2L6EA 3G26A 2EIAA 3G0VA 1AFVA 4PH2A 3G28A 1EM9A 2KODA 2M8LA 4U0FA 3DPHA 5JPAA 1M9CC 3DS4A 2PWMA 3MGEA 4U0DA 4J93A 2Y4ZA 5HGMA 3DS3A 2XGUA 3H47A 3DS0A 1M9DC 2BUOA 4COPA 2PXRC 4NX4C 3H4EA 2M8NA 3G21A 1M9FC 4U0AA 4E91A 2M8PA 1M9YC 5HGLA 2WLVB 4PH1A 4WYMA 2PWOA 4XFXA 4XFZA 2LF4A 3NTEA 2XDEA 4LQWC 2X82A 4XRQA 5DCKA 3DTJA 5I4TG 4HTWA 4U0EA 3DS1A 1M9XC 2XGYA 1M9EC 5HGKA 1BAJA 4M0IA 3LRYA 4DGAC 2JO0A 1EOQA 4XFYA 1A43A 4E92A 2XXMA 4XROA 5HGOA 3BP9A 1GWPA 3G1IA 1EIAA 1QRJA 4B4NA 3VRLC 4U0CA 4IPYA 3P05A 2V4XA 4DGEC 4PH3A 2ONTA 2X2DD 2KGFA 3G29A 5HGNA 1P7NA 1A8OA 1U7KA 1D1DA 1L6NA 2GONA 1AUMA 4COCA 2X83A 4QNBA 2XV6A 4U0BA 4PH0A 2XGVA 2JYLA 2WLVA 3G1GA 2GOLB 3DS5A 1G03A 1E6JP 4INBA 2XT1A
chains in the Genus database with same CATH superfamily
2K5XA 2KORA 1M6NA 2MY5A 3G0VA 1CEIA 2KWLA 1EM9A 1NJIQ 2FAEA 2CWOA 1M6EX 3CCQP 3CCVP 3DS4A 2PWMA 1VKUA 1Z6MA 2GZEA 3H47A 2FVFA 1YJWP 1EMVA 2JBGA 1QVGO 4H2YC 1VHNA 2MF4A 4E91A 4DG9A 2PEMA 1ACPA 3M1MA 2KGCA 4H2WC 4PWVB 3CMEP 2WLVB 2EG5A 4WYMA 2AVAA 4XFZA 5BS1A 4IZ6A 2K94A 2N6YA 3NTEA 5F2KA 3CMAP 4LQWC 1BXIA 2LKIA 3DTJA 2KGDA 2VLOA 3NY7B 1VQ5P 3CCSP 3E2DA 2PENA 2FQ0A 4XFYA 4E92A 3G1IA 5KP6B 4B4NA 1VQMP 2M5RA 1MZ8A 1YJNP 5KP8B 4IPYA 3EJEA 2KG8A 5HV8A 2P9XA 1HQBA 1Q81Q 7CEIA 1P7NA 1U7KA 2LMLA 2LPKA 1KD1Q 4COCA 1GPJA 2XV6A 1VQ4P 3CCEP 2XGVA 3HZQA 4GR2A 2JU1A 5CZDB 3DS5A 3EJDA 1VQ9P 2JPRA 2JYGA 4MRTC 2LOLA 2L0QA 2L6EA 3G26A 2EIAA 2KOOA 3G28A 1FR2A 2KODA 3G4SP 4U0FA 2VSQA 3DPHA 5JPAA 3CCMP 1NQ4A 1YIJP 4J93A 3GKLC 2JU2A 5HGMA 4NEOA 2OTJP 2MVUA 3DS0A 1VQ6P 2GZIA 2BUOA 2LIUA 2LTEA 5KP7B 1VQNP 1M9FC 4GR6A 1RO2A 2GYKA 2PWOA 3CD6P 4XFXA 2VLNA 1ZNVA 2XZ1C 4XRQA 5BS2A 3CC2P 2GDYA 3DS1A 2XGYA 2ERHA 2BHVA 2N6ZA 1GXHA 3CE7A 1M74A 3LRYA 2FHSC 1A43A 1AF8A 2XXMA 5EJDA 3H0DA 1GWPA 1QRJA 2PEQA 2CGQA 1AYIA 2ROQA 3HYBA 2L4BA 4U0CA 1F80D 1KQSO 2MR7A 1YITP 2K0YA 2KG6A 2Z44A 1YHQP 2EHSA 4CA3A 2JQ4A 4DGEC 2KOSA 1VQOP 1A8OA 2PEKA 2CQ8A 2X83A 4QNBA 2N5HA 1T8KA 3GZLA 2E1MA 1UNKA 2JYLA 2WLVA 1K9MQ 1G03A 2PEJA 2JAZA 2LL8A 4INBA 4BPGA 2VLQA 1QVFO 1RO0A 5F2OA 3CC7P 1AFVA 4PH2A 2K92A 1L0HA 2M8LA 2KG9A 2KOPA 1Q86Q 1YI2P 1K73Q 3WBHA 2GDXA 1ZMBA 2FQ1A 2FQ2A 2AF8A 1VQLP 2K0DX 2QA4P 3DS3A 1OR5A 2PNGA 2GZJA 5HVCA 3CCJP 4COPA 3CCRP 4NX4C 3H4EA 4BPHA 3G21A 2FADA 3Q20A 4U0AA 3GZMA 2GZFA 2N50A 1VQ7P 5HGLA 1E0HA 2Z45A 2KW2A 3CCUP 1IMPA 2FVAA 2X82A 4HTWA 1M9XC 1K8AQ 2LIWA 1YJ9P 2GZGA 2PEOA 1M9EC 1BAJA 4M0IA 4DGAC 2PEIA 1EOQA 3CPWO 4R0MA 2KR5A 4XROA 5HGOA 2VLPA 2DNWA 1Q82Q 1KLPA 1HY8A 2MR8A 2EFJA 1IUQA 4F37A 2KOQA 1DV5A 2WPTA 1JJ2O 2V4XA 4PH3A 2X2DD 1Q7YQ 1D1DA 1L6NA 1AUMA 3OW2O 2AFDA 3EJBA 4U0BA 4PH0A 3G1GA 2MD9A 3U43A 2XZ0D 2K0XA 3DS2A 1AK4C 2K93A 3B5IA 2OARA 2JGPA 4PXHB 1X3OA 1M9CC 2N5IA 3GJNA 4BPFA 2N98A 3MGEA 4U0DA 1RNIA 2OTLP 2Y4ZA 2XGUA 2EHTA 1M9DC 1N8RQ 4H2XC 2PXRC 2CNRA 3RG6C 3G71P 2M8NA 4HKGA 3LMOA 2MVVA 2M8PA 1M9YC 2L9FA 2FVEA 3RG2A 4PH1A 1VQPP 1M1KQ 1W2BO 1UJZA 2LF4A 2XDEA 2JB0A 3B4QA 1S72P 3CCLP 3I55P 2K2QA 5DCKA 5I4TG 2KGAA 4U0EA 5HGKA 2NO8A 1IMQA 2JO0A 2QEXP 3CC4P 2CG5B 1KC8Q 3BP9A 1VQ8P 1EIAA 3G6EP 3CXCO 3VRLC 1VQKP 5EW5E 1DNYA 2Z46A 3P05A 2PY8A 1K30A 3I56P 1M90Q 2ONTA 2KGFA 3G29A 5HGNA 2FACA 2DGYA 2X2BA 4UHPB 2GDWA 2GONA 2L22A 1GXGA 2QNWA 2GOLB 2AFEA 5F2NA 1E6JP 1L0IA 4QKOA 2KGEA 2XT1A
chains in the Genus database with same CATH topology
1VQ9P 3DS2A 2JPRA 2JYGA 1AK4C 1M6NA 3B5IA 1QVFO 2L6EA 3G26A 1RO0A 2OARA 2EIAA 5F2OA 3CC7P 3G0VA 1AFVA 4PH2A 3G28A 1EM9A 2KODA 2M8LA 1NJIQ 3G4SP 4U0FA 2CWOA 1YI2P 1Q86Q 3DPHA 1M6EX 5JPAA 1M9CC 3WBHA 3CCQP 1K73Q 3CCMP 1ZMBA 3CCVP 3DS4A 2PWMA 3MGEA 1YIJP 4U0DA 1RNIA 4J93A 1VQLP 2OTLP 2Y4ZA 5HGMA 2QA4P 3DS3A 2XGUA 2OTJP 3H47A 3DS0A 1VQ6P 1YJWP 1M9DC 3CCJP 2BUOA 1N8RQ 4COPA 2PXRC 3CCRP 4NX4C 3H4EA 3RG6C 3G71P 1QVGO 1VQNP 2M8NA 3G21A 3Q20A 1M9FC 4U0AA 4E91A 4GR6A 2PEMA 2M8PA 1RO2A 1M9YC 1VQ7P 5HGLA 3M1MA 3CMEP 2WLVB 4PH1A 1VQPP 1M1KQ 2EG5A 2Z45A 4WYMA 2PWOA 1W2BO 3CD6P 4XFXA 4XFZA 5BS1A 2LF4A 3NTEA 5F2KA 3CCUP 3CMAP 2XDEA 1S72P 4LQWC 3CCLP 2X82A 3I55P 4XRQA 5BS2A 3CC2P 5DCKA 3DTJA 5I4TG 4HTWA 4U0EA 3DS1A 1M9XC 2XGYA 1K8AQ 2BHVA 1VQ5P 3CCSP 3E2DA 2PENA 1YJ9P 2PEOA 1M9EC 5HGKA 1BAJA 1M74A 4M0IA 3LRYA 4DGAC 2PEIA 2JO0A 1EOQA 2QEXP 3CPWO 3CC4P 4XFYA 1A43A 4E92A 2XXMA 4XROA 3H0DA 5HGOA 1KC8Q 3BP9A 1Q82Q 1VQ8P 1GWPA 3G1IA 1EIAA 3G6EP 1QRJA 2PEQA 3CXCO 4B4NA 3VRLC 1VQKP 1VQMP 3HYBA 4U0CA 1YJNP 4IPYA 2EFJA 1IUQA 1KQSO 2Z46A 3P05A 1YITP 2PY8A 1K30A 2Z44A 1YHQP 1JJ2O 2P9XA 2V4XA 3I56P 1Q81Q 1M90Q 4DGEC 4PH3A 2ONTA 2X2DD 1VQOP 2KGFA 3G29A 5HGNA 1P7NA 1A8OA 1U7KA 2DGYA 1Q7YQ 2PEKA 1D1DA 1L6NA 2GONA 1KD1Q 1AUMA 3OW2O 4COCA 2X83A 4QNBA 2XV6A 1VQ4P 4U0BA 2E1MA 3CCEP 4PH0A 2XGVA 3HZQA 4GR2A 2JYLA 2WLVA 3G1GA 2GOLB 1K9MQ 3DS5A 1G03A 2PEJA 5F2NA 1E6JP 4INBA 2XT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS2 A;  2JPR A;  2JYG A;  1AK4 C;  2L6E A;  3G26 A;  2EIA A;  3G0V A;  1AFV A;  4PH2 A;  3G28 A;  1EM9 A;  2KOD A;  2M8L A;  4U0F A;  3DPH A;  5JPA A;  1M9C C;  3DS4 A;  2PWM A;  3MGE A;  4U0D A;  4J93 A;  2Y4Z A;  5HGM A;  3DS3 A;  2XGU A;  3H47 A;  3DS0 A;  1M9D C;  2BUO A;  4COP A;  2PXR C;  4NX4 C;  3H4E A;  2M8N A;  3G21 A;  1M9F C;  4U0A A;  4E91 A;  2M8P A;  1M9Y C;  5HGL A;  2WLV B;  4PH1 A;  4WYM A;  2PWO A;  4XFX A;  4XFZ A;  2LF4 A;  3NTE A;  2XDE A;  4LQW C;  2X82 A;  4XRQ A;  5DCK A;  3DTJ A;  5I4T G;  4HTW A;  4U0E A;  3DS1 A;  1M9X C;  2XGY A;  1M9E C;  5HGK A;  1BAJ A;  4M0I A;  3LRY A;  4DGA C;  2JO0 A;  1EOQ A;  4XFY A;  1A43 A;  4E92 A;  2XXM A;  4XRO A;  5HGO A;  3BP9 A;  1GWP A;  3G1I A;  1EIA A;  1QRJ A;  4B4N A;  3VRL C;  4U0C A;  4IPY A;  3P05 A;  2V4X A;  4DGE C;  4PH3 A;  2ONT A;  2X2D D;  2KGF A;  3G29 A;  5HGN A;  1P7N A;  1A8O A;  1U7K A;  1D1D A;  1L6N A;  2GON A;  1AUM A;  4COC A;  2X83 A;  4QNB A;  2XV6 A;  4U0B A;  4PH0 A;  2XGV A;  2JYL A;  2WLV A;  3G1G A;  2GOL B;  3DS5 A;  1G03 A;  1E6J P;  4INB A;  2XT1 A; 
#chains in the Genus database with same CATH topology
 2K5X A;  2KOR A;  1M6N A;  2MY5 A;  3G0V A;  1CEI A;  2KWL A;  1EM9 A;  1NJI Q;  2FAE A;  2CWO A;  1M6E X;  3CCQ P;  3CCV P;  3DS4 A;  2PWM A;  1VKU A;  1Z6M A;  2GZE A;  3H47 A;  2FVF A;  1YJW P;  1EMV A;  2JBG A;  1QVG O;  4H2Y C;  1VHN A;  2MF4 A;  4E91 A;  4DG9 A;  2PEM A;  1ACP A;  3M1M A;  2KGC A;  4H2W C;  4PWV B;  3CME P;  2WLV B;  2EG5 A;  4WYM A;  2AVA A;  4XFZ A;  5BS1 A;  4IZ6 A;  2K94 A;  2N6Y A;  3NTE A;  5F2K A;  3CMA P;  4LQW C;  1BXI A;  2LKI A;  3DTJ A;  2KGD A;  2VLO A;  3NY7 B;  1VQ5 P;  3CCS P;  3E2D A;  2PEN A;  2FQ0 A;  4XFY A;  4E92 A;  3G1I A;  5KP6 B;  4B4N A;  1VQM P;  2M5R A;  1MZ8 A;  1YJN P;  5KP8 B;  4IPY A;  3EJE A;  2KG8 A;  5HV8 A;  2P9X A;  1HQB A;  1Q81 Q;  7CEI A;  1P7N A;  1U7K A;  2LML A;  2LPK A;  1KD1 Q;  4COC A;  1GPJ A;  2XV6 A;  1VQ4 P;  3CCE P;  2XGV A;  3HZQ A;  4GR2 A;  2JU1 A;  5CZD B;  3DS5 A;  3EJD A;  1VQ9 P;  2JPR A;  2JYG A;  4MRT C;  2LOL A;  2L0Q A;  2L6E A;  3G26 A;  2EIA A;  2KOO A;  3G28 A;  1FR2 A;  2KOD A;  3G4S P;  4U0F A;  2VSQ A;  3DPH A;  5JPA A;  3CCM P;  1NQ4 A;  1YIJ P;  4J93 A;  3GKL C;  2JU2 A;  5HGM A;  4NEO A;  2OTJ P;  2MVU A;  3DS0 A;  1VQ6 P;  2GZI A;  2BUO A;  2LIU A;  2LTE A;  5KP7 B;  1VQN P;  1M9F C;  4GR6 A;  1RO2 A;  2GYK A;  2PWO A;  3CD6 P;  4XFX A;  2VLN A;  1ZNV A;  2XZ1 C;  4XRQ A;  5BS2 A;  3CC2 P;  2GDY A;  3DS1 A;  2XGY A;  2ERH A;  2BHV A;  2N6Z A;  1GXH A;  3CE7 A;  1M74 A;  3LRY A;  2FHS C;  1A43 A;  1AF8 A;  2XXM A;  5EJD A;  3H0D A;  1GWP A;  1QRJ A;  2PEQ A;  2CGQ A;  1AYI A;  2ROQ A;  3HYB A;  2L4B A;  4U0C A;  1F80 D;  1KQS O;  2MR7 A;  1YIT P;  2K0Y A;  2KG6 A;  2Z44 A;  1YHQ P;  2EHS A;  4CA3 A;  2JQ4 A;  4DGE C;  2KOS A;  1VQO P;  1A8O A;  2PEK A;  2CQ8 A;  2X83 A;  4QNB A;  2N5H A;  1T8K A;  3GZL A;  2E1M A;  1UNK A;  2JYL A;  2WLV A;  1K9M Q;  1G03 A;  2PEJ A;  2JAZ A;  2LL8 A;  4INB A;  4BPG A;  2VLQ A;  1QVF O;  1RO0 A;  5F2O A;  3CC7 P;  1AFV A;  4PH2 A;  2K92 A;  1L0H A;  2M8L A;  2KG9 A;  2KOP A;  1Q86 Q;  1YI2 P;  1K73 Q;  3WBH A;  2GDX A;  1ZMB A;  2FQ1 A;  2FQ2 A;  2AF8 A;  1VQL P;  2K0D X;  2QA4 P;  3DS3 A;  1OR5 A;  2PNG A;  2GZJ A;  5HVC A;  3CCJ P;  4COP A;  3CCR P;  4NX4 C;  3H4E A;  4BPH A;  3G21 A;  2FAD A;  3Q20 A;  4U0A A;  3GZM A;  2GZF A;  2N50 A;  1VQ7 P;  5HGL A;  1E0H A;  2Z45 A;  2KW2 A;  3CCU P;  1IMP A;  2FVA A;  2X82 A;  4HTW A;  1M9X C;  1K8A Q;  2LIW A;  1YJ9 P;  2GZG A;  2PEO A;  1M9E C;  1BAJ A;  4M0I A;  4DGA C;  2PEI A;  1EOQ A;  3CPW O;  4R0M A;  2KR5 A;  4XRO A;  5HGO A;  2VLP A;  2DNW A;  1Q82 Q;  1KLP A;  1HY8 A;  2MR8 A;  2EFJ A;  1IUQ A;  4F37 A;  2KOQ A;  1DV5 A;  2WPT A;  1JJ2 O;  2V4X A;  4PH3 A;  2X2D D;  1Q7Y Q;  1D1D A;  1L6N A;  1AUM A;  3OW2 O;  2AFD A;  3EJB A;  4U0B A;  4PH0 A;  3G1G A;  2MD9 A;  3U43 A;  2XZ0 D;  2K0X A;  3DS2 A;  1AK4 C;  2K93 A;  3B5I A;  2OAR A;  2JGP A;  4PXH B;  1X3O A;  1M9C C;  2N5I A;  3GJN A;  4BPF A;  2N98 A;  3MGE A;  4U0D A;  1RNI A;  2OTL P;  2Y4Z A;  2XGU A;  2EHT A;  1M9D C;  1N8R Q;  4H2X C;  2PXR C;  2CNR A;  3RG6 C;  3G71 P;  2M8N A;  4HKG A;  3LMO A;  2MVV A;  2M8P A;  1M9Y C;  2L9F A;  2FVE A;  3RG2 A;  4PH1 A;  1VQP P;  1M1K Q;  1W2B O;  1UJZ A;  2LF4 A;  2XDE A;  2JB0 A;  3B4Q A;  1S72 P;  3CCL P;  3I55 P;  2K2Q A;  5DCK A;  5I4T G;  2KGA A;  4U0E A;  5HGK A;  2NO8 A;  1IMQ A;  2JO0 A;  2QEX P;  3CC4 P;  2CG5 B;  1KC8 Q;  3BP9 A;  1VQ8 P;  1EIA A;  3G6E P;  3CXC O;  3VRL C;  1VQK P;  5EW5 E;  1DNY A;  2Z46 A;  3P05 A;  2PY8 A;  1K30 A;  3I56 P;  1M90 Q;  2ONT A;  2KGF A;  3G29 A;  5HGN A;  2FAC A;  2DGY A;  2X2B A;  4UHP B;  2GDW A;  2GON A;  2L22 A;  1GXG A;  2QNW A;  2GOL B;  2AFE A;  5F2N A;  1E6J P;  1L0I A;  4QKO A;  2KGE A;  2XT1 A; 
#chains in the Genus database with same CATH homology
 1VQ9 P;  3DS2 A;  2JPR A;  2JYG A;  1AK4 C;  1M6N A;  3B5I A;  1QVF O;  2L6E A;  3G26 A;  1RO0 A;  2OAR A;  2EIA A;  5F2O A;  3CC7 P;  3G0V A;  1AFV A;  4PH2 A;  3G28 A;  1EM9 A;  2KOD A;  2M8L A;  1NJI Q;  3G4S P;  4U0F A;  2CWO A;  1YI2 P;  1Q86 Q;  3DPH A;  1M6E X;  5JPA A;  1M9C C;  3WBH A;  3CCQ P;  1K73 Q;  3CCM P;  1ZMB A;  3CCV P;  3DS4 A;  2PWM A;  3MGE A;  1YIJ P;  4U0D A;  1RNI A;  4J93 A;  1VQL P;  2OTL P;  2Y4Z A;  5HGM A;  2QA4 P;  3DS3 A;  2XGU A;  2OTJ P;  3H47 A;  3DS0 A;  1VQ6 P;  1YJW P;  1M9D C;  3CCJ P;  2BUO A;  1N8R Q;  4COP A;  2PXR C;  3CCR P;  4NX4 C;  3H4E A;  3RG6 C;  3G71 P;  1QVG O;  1VQN P;  2M8N A;  3G21 A;  3Q20 A;  1M9F C;  4U0A A;  4E91 A;  4GR6 A;  2PEM A;  2M8P A;  1RO2 A;  1M9Y C;  1VQ7 P;  5HGL A;  3M1M A;  3CME P;  2WLV B;  4PH1 A;  1VQP P;  1M1K Q;  2EG5 A;  2Z45 A;  4WYM A;  2PWO A;  1W2B O;  3CD6 P;  4XFX A;  4XFZ A;  5BS1 A;  2LF4 A;  3NTE A;  5F2K A;  3CCU P;  3CMA P;  2XDE A;  1S72 P;  4LQW C;  3CCL P;  2X82 A;  3I55 P;  4XRQ A;  5BS2 A;  3CC2 P;  5DCK A;  3DTJ A;  5I4T G;  4HTW A;  4U0E A;  3DS1 A;  1M9X C;  2XGY A;  1K8A Q;  2BHV A;  1VQ5 P;  3CCS P;  3E2D A;  2PEN A;  1YJ9 P;  2PEO A;  1M9E C;  5HGK A;  1BAJ A;  1M74 A;  4M0I A;  3LRY A;  4DGA C;  2PEI A;  2JO0 A;  1EOQ A;  2QEX P;  3CPW O;  3CC4 P;  4XFY A;  1A43 A;  4E92 A;  2XXM A;  4XRO A;  3H0D A;  5HGO A;  1KC8 Q;  3BP9 A;  1Q82 Q;  1VQ8 P;  1GWP A;  3G1I A;  1EIA A;  3G6E P;  1QRJ A;  2PEQ A;  3CXC O;  4B4N A;  3VRL C;  1VQK P;  1VQM P;  3HYB A;  4U0C A;  1YJN P;  4IPY A;  2EFJ A;  1IUQ A;  1KQS O;  2Z46 A;  3P05 A;  1YIT P;  2PY8 A;  1K30 A;  2Z44 A;  1YHQ P;  1JJ2 O;  2P9X A;  2V4X A;  3I56 P;  1Q81 Q;  1M90 Q;  4DGE C;  4PH3 A;  2ONT A;  2X2D D;  1VQO P;  2KGF A;  3G29 A;  5HGN A;  1P7N A;  1A8O A;  1U7K A;  2DGY A;  1Q7Y Q;  2PEK A;  1D1D A;  1L6N A;  2GON A;  1KD1 Q;  1AUM A;  3OW2 O;  4COC A;  2X83 A;  4QNB A;  2XV6 A;  1VQ4 P;  4U0B A;  2E1M A;  3CCE P;  4PH0 A;  2XGV A;  3HZQ A;  4GR2 A;  2JYL A;  2WLV A;  3G1G A;  2GOL B;  1K9M Q;  3DS5 A;  1G03 A;  2PEJ A;  5F2N A;  1E6J P;  4INB A;  2XT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...