5HGLA

Hexameric hiv-1 ca, open conformation
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
207
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 73
structure length 207
sequence length 219
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hglA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hglA02
4B4NA 2PWMA 4E91A 3DTJA 2M8LA 4J93A 2GOLB 2JYGA 1M9XC 4U0EA 4DGEC 1A43A 1M9EC 5HGKA 4U0CA 4PH2A 4XROA 2JO0A 3DPHA 1L6NA 3DS2A 2X2DD 2LF4A 2PWOA 4XFXA 2XDEA 2V4XA 2XT1A 1P7NA 4XFYA 1A8OA 1AK4C 1M9CC 2XGUA 1GWPA 3VRLC 5HGLA 3MGEA 2X82A 2Y4ZA 1EOQA 5HGOA 3BP9A 4PH1A 1AUMA 2L6EA 1G03A 4COCA 2M8NA 4U0DA 1M9YC 3DS5A 2XGYA 1EM9A 1M9DC 2XV6A 4LQWC 4DGAC 2BUOA 1M9FC 4XFZA 4U0FA 4U0BA 2M8PA 5DCKA 5HGMA 3DS0A 2KODA 2JPRA 4U0AA 3G26A 4XRQA 3G1IA 2EIAA 2WLVA 3LRYA 1BAJA 4E92A 4HTWA 3G0VA 2PXRC 3DS4A 3DS3A 1U7KA 3NTEA 3G28A 5JPAA 1AFVA 1EIAA 3G1GA 5HGNA 4M0IA 3G21A 4PH0A 3H47A 4NX4C 4QNBA 3H4EA 3G29A 4IPYA 2JYLA 5I4TG 1D1DA 1QRJA 2ONTA 4PH3A 2WLVB 4COPA 2GONA 2KGFA 2XGVA 4WYMA 3DS1A 3P05A 4INBA 1E6JP 2XXMA 2X83A
chains in the Genus database with same CATH superfamily
4B4NA 1Q7YQ 2LOLA 1KLPA 4PWVB 1ZNVA 2PENA 1M9XC 4U0EA 2K93A 1KQSO 3EJEA 3CMEP 2JO0A 3DPHA 2VSQA 3DS2A 3CCSP 1N8RQ 2XDEA 2P9XA 5KP8B 3CC2P 1L0IA 4XFYA 2MVUA 2FADA 1AK4C 1DV5A 1HY8A 2PEOA 1M9CC 2XGUA 1RO2A 1DNYA 1K8AQ 1VHNA 5BS2A 2N6ZA 5HGLA 1GXHA 3MGEA 4F37A 2JAZA 4PH1A 1YITP 2Z44A 2PEQA 2CGQA 1UNKA 3CCEP 1EM9A 4LQWC 5HVCA 3GKLC 2VLPA 5F2NA 2M8PA 2MR8A 4NEOA 1M1KQ 4UHPB 4BPGA 3GZLA 2EIAA 2LTEA 1BAJA 2PEMA 2MF4A 3G0VA 2EHSA 2X2BA 2K92A 5KP6B 1QVGO 2FAEA 1NQ4A 3G4SP 1VQ9P 1VQLP 1L0HA 1X3OA 3G29A 2K2QA 1K9MQ 2GDXA 1VKUA 2L4BA 2LIWA 2FVEA 4WYMA 2K0XA 3CC7P 1M90Q 3CCVP 2K0YA 2MY5A 2QNWA 2JQ4A 3CCLP 4H2XC 2KOPA 2XZ1C 2M8LA 1QVFO 2GOLB 2JYGA 1AF8A 2KWLA 2JGPA 2PEJA 2L9FA 4HKGA 3I55P 1M9EC 1VQ7P 5HGKA 1Z6MA 1VQ4P 4DG9A 2X2DD 4BPFA 2QEXP 2PWOA 4XFXA 4BPHA 2V4XA 2EFJA 2ROQA 2DNWA 1A8OA 5EW5E 1IUQA 1GWPA 3VRLC 2CG5B 2KR5A 2X82A 1EOQA 3CXCO 2JBGA 1FR2A 2FVAA 2KOQA 2M8NA 1M9YC 3DS5A 3CCMP 1M9DC 1M9FC 1T8KA 4MRTC 4U0FA 3HYBA 3DS0A 2GZFA 1RNIA 3G26A 3LRYA 2LPKA 3I56P 1K30A 2PXRC 2WPTA 3G28A 2KW2A 5JPAA 2LIUA 4H2YC 1UJZA 4NX4C 3H4EA 3U43A 1YHQP 5I4TG 3RG2A 3CD6P 2AFDA 5CZDB 1NJIQ 4COPA 4H2WC 4GR6A 2Z45A 3CCQP 1CEIA 4INBA 2AVAA 1EMVA 2X83A 3DTJA 2GDYA 4J93A 3CCJP 3RG6C 3EJDA 4DGEC 1OR5A 5HV8A 3CPWO 1M6NA 4U0CA 4PH2A 2PY8A 1VQ8P 4XROA 1E0HA 1L6NA 2EG5A 2VLNA 2EHTA 3WBHA 1GXGA 2FACA 3HZQA 3E2DA 2L0QA 2GZIA 2VLQA 3M1MA 2GZEA 2OTLP 2Y4ZA 5KP7B 1M74A 5BS1A 3BP9A 2K5XA 3GJNA 1AYIA 1G03A 2KOOA 4U0DA 2KGCA 2XGYA 2N6YA 1BXIA 4XFZA 5HGMA 2KG9A 2KOSA 4CA3A 1KD1Q 2KODA 2MD9A 4U0AA 3G71P 4XRQA 2N98A 3G1IA 1VQ5P 2WLVA 1IMPA 2PNGA 2QA4P 3B5IA 2PEIA 2M5RA 3NTEA 1VQPP 2MVVA 4QKOA 2N5IA 2E1MA 1EIAA 3G1GA 5HGNA 4M0IA 1VQ6P 3NY7B 3G21A 2KG8A 1K73Q 2K0DX 1IMQA 4QNBA 1YJWP 3CCUP 4IPYA 3GZMA 1KC8Q 2KORA 2JYLA 1D1DA 1VQNP 1QRJA 2ONTA 2LL8A 1YJ9P 3B4QA 2GONA 3DS1A 3P05A 3Q20A 2AFEA 5EJDA 5F2KA 1VQKP 2PWMA 4E91A 2KGEA 2VLOA 2FHSC 2FQ2A 2CQ8A 2Z46A 4R0MA 2KGAA 1A43A 1VQOP 2N5HA 1MZ8A 2N50A 3CC4P 2MR7A 2XZ0D 2LF4A 1ZMBA 2CNRA 2L22A 2XT1A 1GPJA 2AF8A 1P7NA 2OTJP 7CEIA 1Q86Q 1F80D 1HQBA 2KG6A 4IZ6A 3CCRP 1YIJP 1W2BO 2PEKA 5HGOA 4GR2A 1AUMA 2L6EA 4COCA 3OW2O 2KGDA 2JU2A 3CE7A 2XV6A 4DGAC 2BUOA 2FQ1A 4U0BA 5DCKA 1Q81Q 1VQMP 2GYKA 2OARA 3CMAP 2JPRA 2DGYA 4E92A 4HTWA 2JB0A 2LKIA 2BHVA 3DS4A 2K94A 2CWOA 3DS3A 2FQ0A 1U7KA 5F2OA 3LMOA 2GDWA 1AFVA 1ACPA 3EJBA 4PH0A 3H47A 2NO8A 2LMLA 1JJ2O 2ERHA 1RO0A 2GZJA 1YJNP 4PXHB 4PH3A 2WLVB 2JU1A 2KGFA 2FVFA 1Q82Q 2XGVA 1M6EX 2GZGA 3H0DA 3G6EP 1S72P 1YI2P 1E6JP 2XXMA
chains in the Genus database with same CATH topology
1VQKP 4B4NA 2PWMA 4E91A 3DTJA 1Q7YQ 2M8LA 1QVFO 4J93A 2GOLB 2Z46A 2JYGA 3CCJP 2PENA 3RG6C 1M9XC 4U0EA 4DGEC 2PEJA 3CPWO 1A43A 1VQ7P 3I55P 1M9EC 1M6NA 5HGKA 1KQSO 4U0CA 1VQOP 4PH2A 2PY8A 1VQ4P 1VQ8P 3CMEP 4XROA 2JO0A 3DPHA 1L6NA 3DS2A 3CC4P 2X2DD 2LF4A 1ZMBA 2QEXP 2PWOA 4XFXA 3CCSP 1N8RQ 2EG5A 2XDEA 2V4XA 2P9XA 2XT1A 2EFJA 3CC2P 1P7NA 4XFYA 2OTJP 3WBHA 1A8OA 3HZQA 1Q86Q 1AK4C 2PEOA 3E2DA 1M9CC 1IUQA 2XGUA 1RO2A 1GWPA 1K8AQ 3VRLC 5BS2A 3CCRP 3M1MA 5HGLA 2OTLP 1YIJP 3MGEA 2X82A 2Y4ZA 1M74A 1EOQA 1W2BO 2PEKA 5HGOA 5BS1A 3CXCO 4GR2A 3BP9A 4PH1A 1AUMA 1YITP 2Z44A 2L6EA 1G03A 2PEQA 4COCA 3OW2O 2M8NA 4U0DA 1M9YC 3DS5A 3CCMP 2XGYA 3CCEP 1EM9A 1M9DC 2XV6A 4LQWC 4DGAC 2BUOA 1M9FC 4XFZA 5F2NA 4U0FA 4U0BA 2M8PA 5DCKA 1Q81Q 5HGMA 3DS0A 3HYBA 1RNIA 2OARA 1VQMP 3CMAP 1M1KQ 1KD1Q 2KODA 2JPRA 4U0AA 3G26A 4XRQA 3G71P 3G1IA 2EIAA 2WLVA 2DGYA 3LRYA 1VQ5P 1BAJA 3I56P 2QA4P 1K30A 3B5IA 2PEMA 4E92A 4HTWA 3G0VA 2PXRC 2PEIA 2BHVA 3DS4A 2CWOA 3DS3A 5F2OA 1U7KA 3NTEA 1VQPP 3G28A 2E1MA 5JPAA 1AFVA 1EIAA 3G1GA 5HGNA 4M0IA 1VQ6P 3G21A 1QVGO 1K73Q 4PH0A 3H47A 1JJ2O 4NX4C 4QNBA 3H4EA 3G4SP 1RO0A 1VQ9P 1YJWP 3CCUP 3G29A 4IPYA 1K9MQ 1KC8Q 1VQLP 2JYLA 1YHQP 5I4TG 1D1DA 1VQNP 3CD6P 1QRJA 1YJNP 2ONTA 1YJ9P 4PH3A 2WLVB 1NJIQ 4COPA 2GONA 2KGFA 1Q82Q 2XGVA 1M6EX 4WYMA 3DS1A 3H0DA 3CC7P 3P05A 3G6EP 4GR6A 1S72P 2Z45A 1M90Q 3CCVP 3CCQP 3Q20A 4INBA 1YI2P 3CCLP 1E6JP 2XXMA 2X83A 5F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B4N A;  2PWM A;  4E91 A;  3DTJ A;  2M8L A;  4J93 A;  2GOL B;  2JYG A;  1M9X C;  4U0E A;  4DGE C;  1A43 A;  1M9E C;  5HGK A;  4U0C A;  4PH2 A;  4XRO A;  2JO0 A;  3DPH A;  1L6N A;  3DS2 A;  2X2D D;  2LF4 A;  2PWO A;  4XFX A;  2XDE A;  2V4X A;  2XT1 A;  1P7N A;  4XFY A;  1A8O A;  1AK4 C;  1M9C C;  2XGU A;  1GWP A;  3VRL C;  5HGL A;  3MGE A;  2X82 A;  2Y4Z A;  1EOQ A;  5HGO A;  3BP9 A;  4PH1 A;  1AUM A;  2L6E A;  1G03 A;  4COC A;  2M8N A;  4U0D A;  1M9Y C;  3DS5 A;  2XGY A;  1EM9 A;  1M9D C;  2XV6 A;  4LQW C;  4DGA C;  2BUO A;  1M9F C;  4XFZ A;  4U0F A;  4U0B A;  2M8P A;  5DCK A;  5HGM A;  3DS0 A;  2KOD A;  2JPR A;  4U0A A;  3G26 A;  4XRQ A;  3G1I A;  2EIA A;  2WLV A;  3LRY A;  1BAJ A;  4E92 A;  4HTW A;  3G0V A;  2PXR C;  3DS4 A;  3DS3 A;  1U7K A;  3NTE A;  3G28 A;  5JPA A;  1AFV A;  1EIA A;  3G1G A;  5HGN A;  4M0I A;  3G21 A;  4PH0 A;  3H47 A;  4NX4 C;  4QNB A;  3H4E A;  3G29 A;  4IPY A;  2JYL A;  5I4T G;  1D1D A;  1QRJ A;  2ONT A;  4PH3 A;  2WLV B;  4COP A;  2GON A;  2KGF A;  2XGV A;  4WYM A;  3DS1 A;  3P05 A;  4INB A;  1E6J P;  2XXM A;  2X83 A; 
#chains in the Genus database with same CATH topology
 4B4N A;  1Q7Y Q;  2LOL A;  1KLP A;  4PWV B;  1ZNV A;  2PEN A;  1M9X C;  4U0E A;  2K93 A;  1KQS O;  3EJE A;  3CME P;  2JO0 A;  3DPH A;  2VSQ A;  3DS2 A;  3CCS P;  1N8R Q;  2XDE A;  2P9X A;  5KP8 B;  3CC2 P;  1L0I A;  4XFY A;  2MVU A;  2FAD A;  1AK4 C;  1DV5 A;  1HY8 A;  2PEO A;  1M9C C;  2XGU A;  1RO2 A;  1DNY A;  1K8A Q;  1VHN A;  5BS2 A;  2N6Z A;  5HGL A;  1GXH A;  3MGE A;  4F37 A;  2JAZ A;  4PH1 A;  1YIT P;  2Z44 A;  2PEQ A;  2CGQ A;  1UNK A;  3CCE P;  1EM9 A;  4LQW C;  5HVC A;  3GKL C;  2VLP A;  5F2N A;  2M8P A;  2MR8 A;  4NEO A;  1M1K Q;  4UHP B;  4BPG A;  3GZL A;  2EIA A;  2LTE A;  1BAJ A;  2PEM A;  2MF4 A;  3G0V A;  2EHS A;  2X2B A;  2K92 A;  5KP6 B;  1QVG O;  2FAE A;  1NQ4 A;  3G4S P;  1VQ9 P;  1VQL P;  1L0H A;  1X3O A;  3G29 A;  2K2Q A;  1K9M Q;  2GDX A;  1VKU A;  2L4B A;  2LIW A;  2FVE A;  4WYM A;  2K0X A;  3CC7 P;  1M90 Q;  3CCV P;  2K0Y A;  2MY5 A;  2QNW A;  2JQ4 A;  3CCL P;  4H2X C;  2KOP A;  2XZ1 C;  2M8L A;  1QVF O;  2GOL B;  2JYG A;  1AF8 A;  2KWL A;  2JGP A;  2PEJ A;  2L9F A;  4HKG A;  3I55 P;  1M9E C;  1VQ7 P;  5HGK A;  1Z6M A;  1VQ4 P;  4DG9 A;  2X2D D;  4BPF A;  2QEX P;  2PWO A;  4XFX A;  4BPH A;  2V4X A;  2EFJ A;  2ROQ A;  2DNW A;  1A8O A;  5EW5 E;  1IUQ A;  1GWP A;  3VRL C;  2CG5 B;  2KR5 A;  2X82 A;  1EOQ A;  3CXC O;  2JBG A;  1FR2 A;  2FVA A;  2KOQ A;  2M8N A;  1M9Y C;  3DS5 A;  3CCM P;  1M9D C;  1M9F C;  1T8K A;  4MRT C;  4U0F A;  3HYB A;  3DS0 A;  2GZF A;  1RNI A;  3G26 A;  3LRY A;  2LPK A;  3I56 P;  1K30 A;  2PXR C;  2WPT A;  3G28 A;  2KW2 A;  5JPA A;  2LIU A;  4H2Y C;  1UJZ A;  4NX4 C;  3H4E A;  3U43 A;  1YHQ P;  5I4T G;  3RG2 A;  3CD6 P;  2AFD A;  5CZD B;  1NJI Q;  4COP A;  4H2W C;  4GR6 A;  2Z45 A;  3CCQ P;  1CEI A;  4INB A;  2AVA A;  1EMV A;  2X83 A;  3DTJ A;  2GDY A;  4J93 A;  3CCJ P;  3RG6 C;  3EJD A;  4DGE C;  1OR5 A;  5HV8 A;  3CPW O;  1M6N A;  4U0C A;  4PH2 A;  2PY8 A;  1VQ8 P;  4XRO A;  1E0H A;  1L6N A;  2EG5 A;  2VLN A;  2EHT A;  3WBH A;  1GXG A;  2FAC A;  3HZQ A;  3E2D A;  2L0Q A;  2GZI A;  2VLQ A;  3M1M A;  2GZE A;  2OTL P;  2Y4Z A;  5KP7 B;  1M74 A;  5BS1 A;  3BP9 A;  2K5X A;  3GJN A;  1AYI A;  1G03 A;  2KOO A;  4U0D A;  2KGC A;  2XGY A;  2N6Y A;  1BXI A;  4XFZ A;  5HGM A;  2KG9 A;  2KOS A;  4CA3 A;  1KD1 Q;  2KOD A;  2MD9 A;  4U0A A;  3G71 P;  4XRQ A;  2N98 A;  3G1I A;  1VQ5 P;  2WLV A;  1IMP A;  2PNG A;  2QA4 P;  3B5I A;  2PEI A;  2M5R A;  3NTE A;  1VQP P;  2MVV A;  4QKO A;  2N5I A;  2E1M A;  1EIA A;  3G1G A;  5HGN A;  4M0I A;  1VQ6 P;  3NY7 B;  3G21 A;  2KG8 A;  1K73 Q;  2K0D X;  1IMQ A;  4QNB A;  1YJW P;  3CCU P;  4IPY A;  3GZM A;  1KC8 Q;  2KOR A;  2JYL A;  1D1D A;  1VQN P;  1QRJ A;  2ONT A;  2LL8 A;  1YJ9 P;  3B4Q A;  2GON A;  3DS1 A;  3P05 A;  3Q20 A;  2AFE A;  5EJD A;  5F2K A;  1VQK P;  2PWM A;  4E91 A;  2KGE A;  2VLO A;  2FHS C;  2FQ2 A;  2CQ8 A;  2Z46 A;  4R0M A;  2KGA A;  1A43 A;  1VQO P;  2N5H A;  1MZ8 A;  2N50 A;  3CC4 P;  2MR7 A;  2XZ0 D;  2LF4 A;  1ZMB A;  2CNR A;  2L22 A;  2XT1 A;  1GPJ A;  2AF8 A;  1P7N A;  2OTJ P;  7CEI A;  1Q86 Q;  1F80 D;  1HQB A;  2KG6 A;  4IZ6 A;  3CCR P;  1YIJ P;  1W2B O;  2PEK A;  5HGO A;  4GR2 A;  1AUM A;  2L6E A;  4COC A;  3OW2 O;  2KGD A;  2JU2 A;  3CE7 A;  2XV6 A;  4DGA C;  2BUO A;  2FQ1 A;  4U0B A;  5DCK A;  1Q81 Q;  1VQM P;  2GYK A;  2OAR A;  3CMA P;  2JPR A;  2DGY A;  4E92 A;  4HTW A;  2JB0 A;  2LKI A;  2BHV A;  3DS4 A;  2K94 A;  2CWO A;  3DS3 A;  2FQ0 A;  1U7K A;  5F2O A;  3LMO A;  2GDW A;  1AFV A;  1ACP A;  3EJB A;  4PH0 A;  3H47 A;  2NO8 A;  2LML A;  1JJ2 O;  2ERH A;  1RO0 A;  2GZJ A;  1YJN P;  4PXH B;  4PH3 A;  2WLV B;  2JU1 A;  2KGF A;  2FVF A;  1Q82 Q;  2XGV A;  1M6E X;  2GZG A;  3H0D A;  3G6E P;  1S72 P;  1YI2 P;  1E6J P;  2XXM A; 
#chains in the Genus database with same CATH homology
 1VQK P;  4B4N A;  2PWM A;  4E91 A;  3DTJ A;  1Q7Y Q;  2M8L A;  1QVF O;  4J93 A;  2GOL B;  2Z46 A;  2JYG A;  3CCJ P;  2PEN A;  3RG6 C;  1M9X C;  4U0E A;  4DGE C;  2PEJ A;  3CPW O;  1A43 A;  1VQ7 P;  3I55 P;  1M9E C;  1M6N A;  5HGK A;  1KQS O;  4U0C A;  1VQO P;  4PH2 A;  2PY8 A;  1VQ4 P;  1VQ8 P;  3CME P;  4XRO A;  2JO0 A;  3DPH A;  1L6N A;  3DS2 A;  3CC4 P;  2X2D D;  2LF4 A;  1ZMB A;  2QEX P;  2PWO A;  4XFX A;  3CCS P;  1N8R Q;  2EG5 A;  2XDE A;  2V4X A;  2P9X A;  2XT1 A;  2EFJ A;  3CC2 P;  1P7N A;  4XFY A;  2OTJ P;  3WBH A;  1A8O A;  3HZQ A;  1Q86 Q;  1AK4 C;  2PEO A;  3E2D A;  1M9C C;  1IUQ A;  2XGU A;  1RO2 A;  1GWP A;  1K8A Q;  3VRL C;  5BS2 A;  3CCR P;  3M1M A;  5HGL A;  2OTL P;  1YIJ P;  3MGE A;  2X82 A;  2Y4Z A;  1M74 A;  1EOQ A;  1W2B O;  2PEK A;  5HGO A;  5BS1 A;  3CXC O;  4GR2 A;  3BP9 A;  4PH1 A;  1AUM A;  1YIT P;  2Z44 A;  2L6E A;  1G03 A;  2PEQ A;  4COC A;  3OW2 O;  2M8N A;  4U0D A;  1M9Y C;  3DS5 A;  3CCM P;  2XGY A;  3CCE P;  1EM9 A;  1M9D C;  2XV6 A;  4LQW C;  4DGA C;  2BUO A;  1M9F C;  4XFZ A;  5F2N A;  4U0F A;  4U0B A;  2M8P A;  5DCK A;  1Q81 Q;  5HGM A;  3DS0 A;  3HYB A;  1RNI A;  2OAR A;  1VQM P;  3CMA P;  1M1K Q;  1KD1 Q;  2KOD A;  2JPR A;  4U0A A;  3G26 A;  4XRQ A;  3G71 P;  3G1I A;  2EIA A;  2WLV A;  2DGY A;  3LRY A;  1VQ5 P;  1BAJ A;  3I56 P;  2QA4 P;  1K30 A;  3B5I A;  2PEM A;  4E92 A;  4HTW A;  3G0V A;  2PXR C;  2PEI A;  2BHV A;  3DS4 A;  2CWO A;  3DS3 A;  5F2O A;  1U7K A;  3NTE A;  1VQP P;  3G28 A;  2E1M A;  5JPA A;  1AFV A;  1EIA A;  3G1G A;  5HGN A;  4M0I A;  1VQ6 P;  3G21 A;  1QVG O;  1K73 Q;  4PH0 A;  3H47 A;  1JJ2 O;  4NX4 C;  4QNB A;  3H4E A;  3G4S P;  1RO0 A;  1VQ9 P;  1YJW P;  3CCU P;  3G29 A;  4IPY A;  1K9M Q;  1KC8 Q;  1VQL P;  2JYL A;  1YHQ P;  5I4T G;  1D1D A;  1VQN P;  3CD6 P;  1QRJ A;  1YJN P;  2ONT A;  1YJ9 P;  4PH3 A;  2WLV B;  1NJI Q;  4COP A;  2GON A;  2KGF A;  1Q82 Q;  2XGV A;  1M6E X;  4WYM A;  3DS1 A;  3H0D A;  3CC7 P;  3P05 A;  3G6E P;  4GR6 A;  1S72 P;  2Z45 A;  1M90 Q;  3CCV P;  3CCQ P;  3Q20 A;  4INB A;  1YI2 P;  3CCL P;  1E6J P;  2XXM A;  2X83 A;  5F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...