5HHDG

Crystal structure of chemically synthesized heterochiral {rfx037 plus vegf-a} protein complex in space group p21
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
63
structure length
63
Chain Sequence
b'RRGGSTYKLILNGKTLKGETTTEAVDVFDAFDVFFVYAASNFSDFDDWTYDDATKTFTVTEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vascular endothelial growth factor A
publication title A Potent d-Protein Antagonist of VEGF-A is Nonimmunogenic, Metabolically Stable, and Longer-Circulating in Vivo.
pubmed doi rcsb
molecule tags De novo protein
total genus 16
structure length 63
sequence length 63
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hhdG00
4OZCA 1Q10A 2GB1A 1C9FA 3V3XA 4KGTA 2ZW0A 2PLPA 1PGAA 1IGCA 2J53A 2ON8A 2ONQA 1KH0A 2KDMA 1HEZE 1K52A 5HFYA 2QSDA 2N9KA 2IGHA 1YNTE 1ZXHA 2JXTA 1JMLA 2KACA 1FCCC 2JSVX 2RMMA 1HZ5A 1P7EA 1MHXA 4GLSC 1K51A 3MP9A 1MI0A 1FD6A 4OZAA 1GB4A 1IBXB 2N7JA 2KN4A 2PTLA 4HKZE 1IGDA 1QKZA 2QMTA 4IOIE 1K53A 3UI3A 5BMIA 2OEDA 2IGDA 2N9LA 1HZ6A 1XCTL 1F2RC 3GB1A 1MVKA 5JXVA 2JZPA 1MPEA 1MHHE 4WH4A 5BMGA 4D2KA 1K50A 2LUMA 1XCQL 2JU6X 4KGSA 1XF5L 5HHDG 2I38A 1UWXA 4KGRA 2I2YA 1YMHE 2KWDA 2LGIA 2LHDA 5HI1A 3FILB 2IGGA 1IBXA 4MACA 2LHEA 1F2RI 2JWUA 5HG2A 2RPVA 2GI9A 1GB1A 2NMQA 3FILA 2KQ4X 2EELA 1EM7A 2ZW1A 2K0PA 1D4BA 1FCLA 1P7FA 4IKGA 4HJGE 5BMHA 2PW9A 2J52A 1PGXA 4OZBA 1PGBA
chains in the Genus database with same CATH superfamily
3PREA 2GBKA 1T6BX 4E74A 1DYQA 1UH6A 1WXQA 2D11A 1V1OA 2PE6B 3BINA 4DK5A 2WX0A 4A6QA 2V0GA 1XLPA 4NAMA 4CO7A 5LNK1 2L7RA 1UBQA 3BK2A 2R61A 1LO5D 1WFYA 2LGSA 1GC7A 1I4PA 3RNEC 1FD6A 1YIWA 3B2FA 1JWSD 3ENEA 4PS3A 2ICIA 3Q3NC 1K8RB 4BKTA 5EDSA 2K6QA 1A5RA 1J7CA 1V2YA 4BAXA 3VTWA 4IWPA 3SD5A 3AE4B 3QX1A 2CHWA 3FC4A 2CU1A 4N58A 3O13A 1NI2A 3ZRCA 2L76A 2KTFA 1P1AA 1SBBB 1FNUA 4JWSC 2MX2A 2JU6X 3N20C 2FCMA 4RCOA 4TSSA 2BW2A 1TYGB 3AE9B 2G45B 3EFUA 2JYEA 3DDCB 4OW0A 5MPOA 2KMMA 4K7SA 1HXYD 2KFKB 3U2SC 4BBNC 4QAYA 2WGSA 2KQ4X 4LJOB 3IVFA 1EM7A 3M3JA 3SFDB 2N9XA 3N9YC 1YOVB 3EFCA 2JZZA 4LNFA 5TSSA 4I6PA 2INCC 1C9FA 4MDKE 3NJTA 3ZO5B 1HA5A 1RFKA 4BKSA 2JF5A 3ZNHB 3D32A 1IGCA 3PO0A 1WMHA 2KDMA 3RD2A 1QT9A 4IM3A 4RGOS 5HFYA 2MBOA 1YNTE 3Q8FA 5GMVA 2MRPA 4JL9A 4ZHPA 1D6EC 2DWQA 1R4NB 1QQRA 3KVFB 1HZ5A 2X8XX 3Q8AA 4IDIA 4JGHB 1N5XA 1SF0A 4OZAA 5BYQA 3W1SC 1UUPA 3WCQA 3LJ3A 1PUTA 1J7BA 1IPGA 2O6VB 5AZHA 2KVZA 3B0AA 4IOIE 4RGNA 3HM3A 2OEDA 1P0RA 2N9LA 2ZPNA 4GB9A 2I1JA 2J0KA 1EU3A 1Q1OA 2LXAA 4GU2A 3I63C 1JWBD 1YJIA 3AE7B 2AWTA 2BKFA 4S0RA 4AJYB 2EKEC 3NVVA 2K6DB 2LUEA 1UWXA 1ZXIA 1ET9A 4KDLB 2JXXA 3H9DA 1SB3C 2M56B 4LDTB 1JWAD 2LGIA 4PK1A 4A3OA 3RNGC 3AE3B 3TJPA 3N32A 3BYTB 3AH7A 3H8HA 4W9FA 3MHSD 1JW9D 4MEMA 2QC8A 5H8YE 2MWSB 2NBVB 4LNOA 2NMQA 4XWWA 1V49A 2PKOA 2KLGA 4FHJA 1L6VA 3VUWA 4HXDA 2W54A 2PVGC 4RH6A 1FEHA 2ZW0A 3CSTA 4GSWA 5HKHA 4GDLA 3VH4B 1WYGA 1UGMA 4LTUA 1CMXB 3L08A 2NR2A 2LGXA 3VTUA 3ZGZA 1SIFA 1WZ0A 3DVNU 4HDQA 4MT5A 4P16A 2JSVX 3L4PA 2BKRB 1AWDA 3PLUA 4HK2A 3AM9A 2BF8B 4IM2A 1WJUA 1OEYJ 1GB4A 2QIEB 1PYWD 3KWVA 4JX1C 2Y5CA 2C60A 4N6EB 1D5XC 3UINB 3HK0A 1BXTA 2MBHA 1GPXA 1PFDA 1I7HA 1QOGA 4RF0A 1HZ6A 3VVWB 3T9LA 2MHJA 4YTMB 2IYDB 1HE8A 1B1ZA 3WALA 3N1XC 2HDEA 3U7ZA 5DPSA 4TV3A 3L54A 2JY6A 1L0VB 5CHWA 5FR3A 3TMPB 1UGJA 2WXJA 3ZXRA 2RDHA 2J42A 2N1WA 2UWQA 1E90A 2FE8A 2IY0B 2EMTA 2V9HA 4KGRA 4L2YA 3RPFC 1FRDA 3WANA 4DXAB 3CMMB 3Q3FA 5D7GA 4JQWC 2IGGA 4WJOA 1X1MA 3H7PB 2SEBD 3RNAC 3AXCA 2L8JA 4WQOB 4EZKA 3RUIB 1JCKB 2LZ6A 3QARA 2DZMA 3UIPB 3W2DA 1T0SC 4FA6A 3C0RB 2MJ3A 1E5WA 2M19A 2V4LA 1F52A 4OZBA 2WHIA 5DPTA 2D10A 3VRAB 4MGZE 1ACCA 3BK1A 2LVOA 1ZPSA 4MJSA 4MGKE 1T0YA 2CS4A 4FJYA 4ZYSA 2ON8A 4W9HA 1NYRA 2KHWB 3U52E 2UU7A 2DHZA 2CHZA 1WH3A 2JX5A 3NZSA 3V6EB 1G6JA 2N0SB 4MH8A 3TEYA 3QHTA 1QF6A 2HTHA 2ZVOA 4DHZE 1M94A 4PYUA 4W9CA 1LQBA 1QOBA 1MHXA 3RYTA 3E56A 2L05A 2IJ0A 2ZEQA 3PTFC 2W82A 3RCZA 2G1EA 3VHTC 1HTOA 4AOFA 4RFBA 1NBFC 1VJKA 1ZP0B 2GRIA 5BMIA 1TZ1A 3HUIA 2XEWA 2DNFA 2LD9A 5IA7A 1RWSA 1WSPA 2BGFA 3IAM1 3OG5A 1ZGUB 2ZJDA 2A5UA 1DGJA 2NCNA 2HJ8A 1E8WA 2WDTB 5HHDG 2WS3B 1OQYA 4FBJB 2G4SA 3JYUA 2KFJA 2KX0A 1E6EB 4WURA 3RNCC 2KDEB 4L23A 2ZNVC 3ZKJC 4WWPA 1GAQB 5TR5A 2BYVE 2BBCA 1M4VA 3Q6BA 2IO1B 3IAS1 3P4QB 1L4DB 2E6XA 4LJPB 1T0QC 5AUKA 4AUQC 4DXFA 1SE2A 3U4EG 1FCLA 3A9KB 2LVPA 2PJHA 2C7HA 3L10B 2LASA 1ZDVA 1YJ1A 3K9PB 3GZNI 4B6WA 1UF0A 1ROEA 3PRPB 2FCSA 2D07B 4ZRPA 4EZJA 3GP7A 4ARIA 2MSED 1Q0WB 2NPTB 3ZTDA 2WQYB 2WU5B 3P4RB 1R7SA 2D3AA 2GBNA 2LJ5A 1XLOA 1KTKA 4JWUC 1TY0A 1ZOYB 5CHVC 4YT0B 2NTTA 2AQ2B 3LDZE 1WYWB 2J7QB 2WXFA 1SJED 1A70A 1WX7A 2KN4A 4A20A 2O2VB 1TKEA 1OEYA 1C77A 3Q8EA 3KH0A 3U30A 2WLBA 1SGHA 4YSYB 4F1SA 1MHHE 1I4RA 4D2KA 4YXDB 1XD3B 3PGEA 3UQAA 4YWGG 4C00A 1OQRA 3B1LX 1JQ4A 4XZ4A 1T0RC 3UF8A 1GNUA 3WAPA 3JSVB 2BS4B 4W9LA 2KQ7A 5G5GA 3DHIC 1WGYA 4KZ0A 4GOCA 3SDLC 2K9XA 5DPRA 1QOFA 3NVYA 2KOXA 1FFVA 4BBNF 3AMZA 2ZW1A 1MG8A 4KIKA 4HJGE 1VLBA 2KANA 3APFA 3QWZB 2B76B 3WIMA 1JRPA 5EE1A 2QEJC 3V60A 3UIOB 3OWEB 4DHZB 4JE3B 1IUEA 1HEZE 3AI5A 1ZKHA 1TIFA 3AE2B 4EEWA 2AX5A 3AEEB 3VUXA 1P98A 3BZDB 2D3BA 3I9V1 2FCQA 2AYOB 2KDFB 3Q3MC 4GDKB 4BKGA 1P7EA 5IOIA 1OGWA 4GLSC 3KYDD 2GBJA 1EUVB 3L16A 3AE6B 4I6LB 2KAJA 4CHKA 3AV8A 3RT3B 3AEAB 4DQOC 1KLVA 2XK5B 4HDOA 3VAWA 3Q69A 2KTRB 4N9F4 1I4QA 1TS5A 2Z8LA 1BT0A 2BYFA 3MC0B 2K8CA 3P1MA 2BVCA 4OVUA 2L0TA 3IHPC 2KWDA 1EWCA 4F8CB 2J0MA 2BB5A 3Q8BA 5CHFA 3IT4B 1V5OA 4OVZA 2BWES 4C4VB 1N62A 2GI9A 4ZDVA 4C80A 2BPSA 2PW9A 4M01A 1PGBA 4C56C 3A1QB 1R4NI 4IW0A 2XN9C 3BVGA 2OJRA 3NZ3A 2W3SA 2FNJB 4HJKA 3IFWB 3T8MA 4FXCA 2KDBA 3NRZA 4XGAB 1AN8A 4E71A 1ZXHA 3MC9A 1FMAD 2KC2A 1FRRA 2C9WB 1BUIC 3QK0A 4OVVA 1WF9A 3BY4B 4ANXA 1RRBA 2IPKD 4WQMA 2BYTA 1CK1A 1EF1A 3LB8C 2DZIA 5C3JB 4ZYNA 5J2RA 4KX6B 2KMAA 1V97A 3MHZA 4HKZE 2QMTA 3IG3A 2MJEA 3KW5B 2FUHB 3PLVA 2CJNA 2Y3AA 4MELA 2RGFA 2KK8A 2N9PC 3W5UB 1C4AA 1VCBA 4DDID 2W3RA 2KQSA 4ZHOA 1SJHD 4IUMB 1E7VA 2LRUA 3ECIA 2MP2A 2JUOA 4DDGD 2HTME 1RAXA 4NJCA 4AWJA 1C4CA 4HCNB 5IP4D 1V5TA 2M0AA 2V3NA 4ARCA 1KLUD 4FHKA 3KUZA 4KZCA 4A8XC 3FILB 1IBXA 3V62A 5BYSA 5FR6A 3X0WA 1P3QU 2LJIA 3R3MA 1N5WA 2BB6A 4PS8A 2BT6A 2KN5A 5G2NA 2V3SA 4UDUC 3DBSA 1N61A 2PVOD 4A9AA 2GOWA 3R7QA 2KZRA 1FM0D 2DAJA 2K39A 4BVUC 3DBRB 2FUG1 3VR8B 3CF6E 2ZNVB 3L17A 2FIDA 2WXLA 2ASQA 2KJRA 1TY2A 2NS5A 3TCAA 1WIAA 3W9CB 1L2NA 2WYQA 2K22A 2YEPB 4KKJA 2DAFA 5LLIA 3VRBB 1OQQA 3NS1A 4K3CA 2RMMA 2LRWA 4KVGB 2AQ1B 1WGDA 1F1HA 2I1KA 2L83A 1K51A 2EMSA 1S1QB 3ZJUA 4O1NA 2R2OA 3IBEA 3Q3JA 5JZEB 3TEWA 1DOXA 4YSZB 1V81A 3EECA 1C78A 1PDXA 2MLBA 4WWNA 2PMVA 4WAAA 3NOBA 4EKUA 2HD5B 1C4PA 4BZAA 2JZPA 4CYEA 3I5JC 2QDFA 2OHFA 1V86A 1QILA 2XK5A 3HIZA 1OFFA 2WDRB 5KHOA 2WWZA 4JPSA 1WZ3A 2KTRA 2EKIA 2QHOA 4P1BC 3EC8A 2HJ1A 4WJNA 3W1YA 1VDVA 1JALA 2FBWB 2IO2B 3SFEB 3FKYA 2DX5B 1F9JA 1E9MA 4W9EA 5L95C 1H4RA 1WI0A 2RD0A 1XXGA 2V1YA 1TBEA 2Y5BB 2KYWA 2JWZA 2YEPF 3ZIMA 1Q10A 3DWMA 4MSMB 1WY8A 4AP4C 4MM3B 3ZRFA 2M0XA 2V4IB 3DHHC 1GG3A 1PGAA 2YVCA 3ZNZB 4ANVA 4DBGA 1BMLC 2XNAC 3LYYA 1UNSA 1GC6A 1E8XA 4ZRJA 2L0FA 3VUYA 2N9KA 1E7UA 2KFKA 1V8CA 2OOBB 3KWLA 2KACA 2K5PA 1IYFA 3WAOA 3A9JB 4IM0A 3MP9A 1TJEA 4NJ7A 4WJPA 3U8ZA 2REXA 2QJLA 4ZRQA 2BS2B 2IZVB 2RR9A 1Z5SB 1J7AA 2DLBA 2WXIA 3A4RA 1K53A 2MCNB 3UI3A 3DBLB 2JRIB 2IGDA 2V3PA 1JROA 4M0WB 3KUDB 3AN1A 5IAAC 1E8YA 2G4DB 3IT6B 1YJJA 4LNNA 4A3PA 4HEA1 2BS3B 4W9JA 1SSNA 3UQBA 5D3IB 1VZ7A 2INDC 2LI5A 1XF5L 2N4FA 3NVZA 2INNE 1L5PA 1V80A 2I2YA 1VR9A 4IG7B 4MGIE 1L0YB 2GMIC 4MACA 4NJ6A 2O6VA 4II2B 3WAMA 3W5VB 3QJZA 2CKHB 3FILA 3CIRB 4ZRKA 1WX8A 3VXWA 4HLEA 5BMHA 4NY0A 1AW7A 3OJ3A 3ZNGC 1FXIA 3M63B 4ZRIA 1CZPA 3BVMA 1DOYA 4LK0M 3ZDMC 4NZLB 2ACZB 3SR6A 4W9DA 4B9KA 1L7YA 2MJDA 1RYJA 2WXMA 3QIJA 3ABVB 2KD0A 3AU4A 1LFDA 3RN9C 3TEXA 1F0ZA 2Z59B 3P63A 3BYYB 1U4AA 1SE4A 1EWYC 1WX9A 3HRDD 2AEHA 5DCNA 4YSXB 2N7JA 4A55A 3DPDA 2YLMA 2LFIA 4JLCA 3QA8A 1YN5A 2WXKA 1ZDXA 4E3CA 4HPMB 2CR5A 3RMKC 3DBHB 4IWQA 1YX5B 2GBMA 1MPEA 4AQ7A 4IC7B 4PS7A 4WAFA 4K3BA 3TL5A 4DXGA 3AEDB 3NUHB 4G50A 4RF1A 4RNAA 3V6CB 1WM3A 2MW5A 1KRHA 2MEKA 1R4MB 5DPWA 4WJQA 3Q8CA 2WX1A 4ANWA 3B08A 2WXQA 2M8SA 1YN4A 3EHVA 3NS8A 3AULA 4GGQA 1EO6A 2LXCA 5E6NA 1WJNA 3HM6X 3E9SA 3TEZA 4M00A 2G9HD 4YTNB 1WXSA 3ML8A 4CQNA 5C1ZA 3AB5A 4IKGA 2J52A 3UGBB 3PT2B 2NBUA 4M8NA 5FKAC 2WXRA 5T8IA 2A4ZA 2N7DA 4M8MA 2KWVB 3OAWA 1C79A 2C7MB 2AL6A 4J6IA 1TGZB 2JYTA 2CU3A 1TS2A 4MGYE 4YL8A 2KJHB 3H7PA 1SE9A 1Y8RC 2K25A 4NAWB 3RNBC 4HPPA 1EU4A 5G5HA 2K8HA 3M95A 1F77A 1SE3A 1AARA 1MG4A 1MI0A 2JRHA 1KLGD 1CQVA 1NENB 4F7ZA 1C3TA 1TS3A 2IY1B 2D5GA 2C7NB 1FFUA 1ZUD2 3GOEA 1MVKA 4I6NB 3RNFC 3O65B 2Y5PA 4WIPA 3ZLZA 5D2MB 2K3UA 3DVGY 4G11A 1WE6A 1XQQA 1NYQA 4HWIB 1FPYA 1WJ4A 3BWUD 1YMHE 4B95A 1Q5WB 3ZXVA 2RDGA 3AEFB 4RM9A 1VRAB 1AYFA 3PHWB 3OJ4B 4XDCA 4HKQA 3AU5A 2L32A 1RFAA 2IDYA 1RLFA 1DOIA 1WGRA 5E6PA 2LVQA 2KLCA 4M02A 2Q5WD 5LXHA 4ICUA 2OJWA 4J3OD 3ZW3A 2KDIA 3DCGA 1WRIA 2K0PA 1WR6E 5AEKB 5G55A 3ONSA 2M17A 3AE8B 4OZCA 3Q3OC 4LLGM 3KUCB 4BOZB 2G3QB 1KJTA 4Q2JA 4XE0A 3AE1B 2RSUA 3T3OA 3HVDA 1NVID 3ML9A 5BYRA 2KWUB 5LXIB 2FAZA 3NY5A 4AJWA 2JXTA 4ANUA 3AEGB 5J17A 4NQKE 2D2QA 4KKIA 3AECB 3IXSA 1LXDA 4RGTA 4EUTA 5CX3A 4K7WA 3EA6A 1NI3A 2DYBA 5D6JB 4HVBA 5D94A 3QAQA 1LGRA 1WR1A 3A9KA 3KQ4A 1TT5B 3ZTCA 3CWIA 1HQRD 3RFZB 1IGDA 2WNMA 3PRMB 4ACFA 1YQ4B 3Q2AC 4L1BA 4P7IA 3AE5B 3PRZA 4HPLB 3TSSA 3MC8A 1E10A 2W9NA 2NBWB 5IKCM 2VZKD 2NPTA 2ZVNA 1NEKB 2L52A 3SEBA 2L1AA 4KGSA 2I38A 1KOTA 4MJSB 1V1PB 2HE7A 2KT7A 1UELA 4K1RB 4G3XB 1JRUA 2LHDA 3R7RA 5GXGB 4NNJB 1N60A 1RM6C 3DBRI 3PZ7A 2O2VA 3KLSX 4ZOHC 4FLHA 3ETRA 3VH3B 2KWCA 4GN1A 5HG2A 4EZLA 5L83A 1YN3A 5EE0A 4GXBA 3CSFA 2MBQA 3B9JA 3X23A 4K7UA 1WGHA 2QCZA 3MJWA 3W1SA 2KVRA 3APCA 2GB1A 2WXOA 4ITKA 3VFKA 4WWMA 3PSEB 1VZ6A 3JVZX 2J53A 1WJ6A 4K81A 2LMCA 2ZCCA 4AS1A 4C7ZA 5FK9C 1VD2A 4PT5A 3JSVA 2IGHA 3ZVVA 3ZUNA 1WGGA 4II3B 1FCCC 2LGDA 1FXTB 1STEA 1HTQA 1FNWA 1XLQA 1WXMA 3H6NA 3PHXB 2CJOA 4FJVB 2WXGA 2N9EB 2KNBA 1ZW7A 2K8BA 4DWFA 4NAWA 2WU2B 3N3KB 3R8BA 4HCPB 2PTLA 2W55A 3GE8C 4OHJA 1QZEA 4XC2A 2K1FA 4FULA 2KX3A 4DHJD 2CHXA 1XCTL 1I35A 2N1VA 3C19A 2MA9B 3VQIA 2LUMA 2GLSA 2PPHA 4BKSD 3PV1A 5E6JA 4GDKA 3A4SC 4GMVA 1WWTA 3PPAA 3KYCD 5BO4B 3C8YA 2LEKA 1QLBB 1QOAA 1XT9B 3P4PB 5HI1A 4TUUA 3VR9B 3J9CA 4LNKA 4EFOA 2LHEA 4REZA 1F2RI 1Z2MA 3NVWA 2IO0B 1YQBA 3PZ8A 4US8A 1TKGA 1MJDA 1N63A 1ET6A 4G0NB 4KSKC 4BOSC 2WXNA 1T3QA 1D5ZC 1P7FA 4P6VF 1J0GA 2ZPYA 3PZDA 2X38A 4XDDA 3SU8X 5JHAA 1FO4A 2ZCBA 1TKYA 4XWTA 1SIJA 3R2IA 2ONQA 4B0EA 2WP9B 1K52A 1EF5A 1T5XD 2DZJA 3VDZA 4C7YA 1WXAA 4C4VA 3ZNID 1JWUD 3DBLI 3U7DA 5I4DA 1B9RA 1XO3A 2FCNA 3V05A 4MH0E 3QC8B 4KDIC 4W9GA 3ALBA 2H88B 3A1QA 1P9DU 3MTNB 3ZYYX 2J0JA 5H92C 1GJZA 1LM8B 1FNVA 4WWOA 3Q14C 5C2TB 2QILA 3N30A 3ZJVA 4NQLB 2Z0DB 4P1CC 4KIKB 3H1UA 3R2TA 1KM7A 1WXVA 2N7EA 2NTSA 3QQ8B 1MFWA 4TQ1A 2J4XA 3SHQA 3I3TB 4TKNA 3I57A 4XYCA 3DVGX 3B2GA 1V6EA 2JZ3B 2BTEA 3FAHA 5AUIA 1I4XA 1D5MC 1ZE3D 1V1PA 2DBYA 3GS2A 2JQRB 2VZKB 3HHMA 1E8ZA 2E3TA 4US9A 2M4NA 2B3AA 4IWOA 5JHBA 3L0WB 3V61A 2IBIB 1KF6B 3RULA 1GUAB 1UWMA 1PGXA 4JIOU 3NG0A 3ZDTA 4URKA 3M62B 2RPQA 2LWPA 4LCDE 3V3XA 4KGTA 4YTPB 3DVNV 1KH0A 1UZXB 1UBIA 5C23A 1WGKA 2TSSA 1OTRB 1J19A 2JPHA 4N59A 3EUB2 1WM2A 4HRSA 2NVUI 4S17A 3R66C 4FJZA 1E0ZA 2SAKA 4X57B 5KHQA 3DBHI 3VTVA 2WDQB 3RI7C 1C1YB 5AZFA 5AZGA 1I4HA 4XX5A 1TS4A 3AEBB 4LNIA 2JVCA 4RMAA 3APDA 3NZUA 4ASWC 3QCAA 4BFRA 4TMAB 3N1YC 3PVLA 1SEBD 3GB1A 3H7SA 1R4MI 2VH1A 2L00B 1KFYB 1E7PB 1XLNA 1JWMD 3A33B 1FXAA 1K50A 3EGRA 1XCQL 1YD8U 2DYMA 2H89B 2M1MA 3N1ZC 4NPNA 5D3DA 1L0XB 1YX6B 2KKCA 1ENFA 2LGYA 1TZOA 3HVZA 3DWGC 3WA0A 1J8CA 2D3GA 3L13A 5EE3A 1PQSA 4DHJB 1VZ8A 2R2QA 1YQ3B 3LXFA 2JWUA 4HROA 5E6OA 3RZWC 1FIQA 1H8CA 1Y56A 5JH5C 2EELA 2DYOA 3K9OB 3MFGA 1NDDA 3TBLD 2L3ZA 4R3DA 2FIFA 2KJ6A 5IO9A 4FADA 1WMHB 4KSLC 2PE9A 3URYA 4PYZA 3BVZA 4RGMA 4USAA 1I42A 2O6VD 2BWFA 2PLPA 2MBEA 2KC1A 2IO3B 2AL3A 3TUOA 1WE7A 1C76A 1L4ZB 3ZJTA 2QSDA 1N6ZA 3NHEB 1JMLA 3DHGC 5CTRC 1GOZA 3GZNB 2BQQA 2MP2B 2ZZPB 3PS6A 4W9KA 3P4SB 1SXTA 4H2AA 2INPE 1IBXB 4LDTD 1WRDB 4A90A 2DZKA 2RDBC 4B0MA 1QKZA 2KXJA 4MM3A 2BYEA 4EE2A 1CJEA 3ZQ4A 2KO3A 1F2RC 3DQVA 2PEAA 3DOWA 4KV2A 5JXVA 3OLMD 2AQ3B 5IN7A 2DENB 2VRRB 4WH4A 5BMGA 3S2AA 4RM8A 3T3NA 3P2BA 2Z0EB 2WXHA 1L6UA 2MBBB 4GIVA 3BIID 2UYZB 2VH2A 2D3CA 2GBRA 1XEEA 3A9JA 4FN2A 3MJ5A 2XBBC 2JT4B 3TIXA 3RZFA 2KMCA 2PIAA 5J18A 4TQ0A 1V9JA 4EOYA 3P42A 3JW0X 1ESFA 4MSQB 2MH7A 2RPVA 1GB1A 3GE3C 1UD7A 4W9IA 4M0WA 5EE9A 2MQJA 4ICVA 1D4BA 1IP9A 2C5LC 1I4GA 2WXPA 1TTNA 1S3SG 4GDLB 2WDVB 1ISNA 1D3ZA
chains in the Genus database with same CATH topology
2YEPF 1ZDVA 1Q10A 3DWMA 1T6BX 2GB1A 2WXOA 4ITKA 4WWMA 1DYQA 4MM3B 1WXQA 1VZ6A 1ROEA 2V4IB 1V1OA 1PGAA 4ZRPA 2J53A 1BMLC 2XNAC 3LYYA 2LMCA 1UNSA 3GP7A 4AS1A 4ARIA 4C7ZA 5FK9C 4A6QA 2WQYB 2WU5B 3P4RB 1R7SA 4PT5A 2N9KA 2V0GA 2IGHA 1XLPA 4NAMA 1V8CA 1XLOA 1KTKA 4JWUC 5LNK1 1TY0A 3KWLA 2KACA 1ZOYB 1FCCC 4YT0B 2NTTA 3BK2A 2R61A 1LO5D 2AQ2B 1STEA 2K5PA 1FNWA 1XLQA 2CJOA 2WXGA 1I4PA 3MP9A 1TJEA 1FD6A 2WXFA 2QJLA 3B2FA 1JWSD 4ZRQA 2BS2B 2WU2B 1SJED 3R8BA 1A70A 2ICIA 2KN4A 1J7AA 2PTLA 2W55A 2DLBA 1J7CA 2WXIA 4OHJA 1TKEA 1K53A 3UI3A 1C77A 3AE4B 3Q8EA 2IGDA 2V3PA 1XCTL 1JROA 2WLBA 3FC4A 3AN1A 4N58A 4YSYB 3IT6B 3O13A 1YJJA 1MHHE 1I4RA 4HEA1 3VQIA 2BS3B 1SBBB 4D2KA 1FNUA 2LUMA 1SSNA 4JWSC 4YXDB 5E6JA 5D3IB 2JU6X 1VZ7A 4YWGG 1XF5L 3NVZA 1OQRA 4RCOA 1WWTA 2INNE 4TSSA 1L5PA 2BW2A 3C8YA 1JQ4A 2LEKA 1TYGB 3AE9B 2I2YA 1VR9A 1QLBB 1QOAA 2JYEA 3P4PB 4OW0A 5HI1A 1L0YB 5MPOA 3VR9B 3J9CA 2KMMA 4MACA 2BS4B 1HXYD 2LHEA 4REZA 5G5GA 3U2SC 1F2RI 3NVWA 2K9XA 3W5VB 3PZ8A 1QOFA 4US8A 3NVYA 1TKGA 1N63A 3FILA 1ET6A 2KQ4X 1FFVA 1EM7A 3AMZA 3SFDB 2ZW1A 2WXNA 1T3QA 3CIRB 1D5ZC 1P7FA 3N9YC 4P6VF 4HJGE 5BMHA 1VLBA 1AW7A 5TSSA 2B76B 2X38A 4XDDA 1FO4A 1JRPA 5EE1A 1C9FA 2QEJC 1FXIA 1HA5A 1RFKA 1CZPA 1TKYA 4XWTA 3BVMA 1DOYA 4LK0M 3OWEB 1SIJA 4JE3B 3R2IA 4NZLB 1IGCA 2ONQA 2ACZB 4B0EA 3PO0A 2KDMA 3SR6A 1IUEA 1QT9A 1HEZE 2WP9B 2MJDA 4RGOS 1K52A 5HFYA 1RYJA 2WXMA 3AE2B 3ABVB 1T5XD 2AX5A 1YNTE 3AEEB 3BZDB 3Q8FA 3I9V1 4C7YA 4ZHPA 3TEXA 4GDKB 1F0ZA 3P63A 1D6EC 1JWUD 2DWQA 3BYYB 1SE4A 1QQRA 1EWYC 1HZ5A 1P7EA 3HRDD 3Q8AA 4GLSC 4IDIA 5I4DA 1B9RA 1N5XA 1SF0A 4OZAA 1XO3A 3V05A 5BYQA 4YSXB 1UUPA 3WCQA 2N7JA 1PUTA 4A55A 1J7BA 3AE6B 2H88B 2LFIA 4IOIE 4RGNA 2KAJA 1YN5A 2OEDA 2WXKA 3ZYYX 1ZDXA 3AV8A 5H92C 3AEAB 4DQOC 2N9LA 1FNVA 5C2TB 2QILA 3Q69A 3ZJVA 1EU3A 1MPEA 4AQ7A 1JWBD 3R2TA 1I4QA 4WAFA 1YJIA 2NTSA 4DXGA 1TS5A 3AE7B 2Z8LA 3AEDB 3NVVA 4TQ1A 3NUHB 2J4XA 3MC0B 3P1MA 1UWXA 1ZXIA 4RF1A 1ET9A 4RNAA 3I57A 1SB3C 2KWDA 2M56B 1JWAD 1KRHA 2LGIA 2MEKA 3B2GA 1EWCA 2BB5A 3AE3B 3Q8CA 2BTEA 3BYTB 3FAHA 5AUIA 1I4XA 1D5MC 2WXQA 1YN4A 3Q8BA 1ZE3D 3AH7A 3H8HA 1V1PA 2DBYA 1JW9D 2JQRB 3GS2A 3IT4B 4OVZA 2VZKB 1N62A 5H8YE 2E3TA 2GI9A 4US9A 2NMQA 3E9SA 4XWWA 3TEZA 2G9HD 4YTNB 2PKOA 4C80A 4CQNA 3AB5A 4IKGA 1L6VA 1KF6B 2PW9A 1UWMA 1PGXA 2J52A 1PGBA 4C56C 5FKAC 2WXRA 2W54A 2PVGC 5T8IA 3V3XA 4KGTA 4RH6A 4YTPB 1FEHA 2XN9C 2ZW0A 3BVGA 1C79A 1WYGA 3NZ3A 1KH0A 2W3SA 2JYTA 4LTUA 2CU3A 1WGKA 1TS2A 2TSSA 4FXCA 3NRZA 1AN8A 4N59A 3EUB2 1ZXHA 3ZGZA 1FMAD 4HRSA 1FRRA 4MT5A 1BUIC 4NAWB 4P16A 1E0ZA 2JSVX 3L4PA 2SAKA 2IPKD 1AWDA 4WQMA 1EU4A 5G5HA 2BYTA 3AM9A 2WDQB 1F77A 1CK1A 1SE3A 1MI0A 1GB4A 1KLGD 1PYWD 1CQVA 1I4HA 1NENB 2QIEB 3KWVA 3LB8C 5C3JB 1TS4A 3AEBB 4KX6B 4JX1C 1V97A 2Y5CA 3MHZA 4N6EB 4HKZE 1D5XC 2QMTA 1BXTA 2MJEA 1TS3A 1GPXA 2CJNA 1PFDA 2D5GA 4TMAB 2Y3AA 1I7HA 1QOGA 4RF0A 1FFUA 1HZ6A 1SEBD 1ZUD2 3GB1A 1MVKA 1KFYB 4YTMB 3W5UB 1E7PB 2Y5PA 4WIPA 1B1ZA 1C4AA 1XLNA 2K3UA 1JWMD 2HDEA 2W3RA 3U7ZA 1FXAA 1K50A 1L0VB 3EGRA 4ZHOA 1SJHD 1XCQL 5FR3A 1UGJA 2WXJA 2RDHA 2J42A 1NYQA 2DYMA 2H89B 2FE8A 2HTME 4L2YA 4KGRA 4NJCA 5D3DA 1C4CA 3RPFC 1L0XB 3BWUD 1FRDA 1YMHE 2V3NA 2M0AA 4ARCA 1KLUD 1ENFA 5D7GA 4A8XC 1TZOA 3FILB 3HVZA 2IGGA 2RDGA 3DWGC 1IBXA 5BYSA 3AEFB 5EE3A 1VZ8A 1VRAB 1AYFA 4XDCA 1YQ3B 3LXFA 4HKQA 2JWUA 2L32A 2LJIA 2SEBD 4HROA 2IDYA 1DOIA 1N5WA 2BB6A 2Q5WD 2BT6A 1FIQA 1Y56A 1JCKB 2EELA 2DYOA 4J3OD 3MFGA 4UDUC 1WRIA 2K0PA 4R3DA 1N61A 2PVOD 3W2DA 4A9AA 2MJ3A 1FM0D 2M19A 3AE8B 4OZBA 2FUG1 4OZCA 3URYA 3VR8B 3BVZA 4LLGM 3VRAB 1ACCA 3BK1A 4RGMA 4USAA 1ZPSA 4Q2JA 4XE0A 2WXLA 2PLPA 1TY2A 3AE1B 4ZYSA 3T3OA 2ON8A 1NYRA 3TUOA 3HVDA 1NVID 1C76A 1L4ZB 3U52E 5BYRA 3W9CB 3ZJTA 2QSDA 2JX5A 2K22A 2YEPB 4KKJA 2N0SB 2JXTA 4MH8A 3VRBB 1JMLA 3TEYA 1OQQA 3AEGB 1QF6A 1GOZA 3NS1A 4KKIA 3AECB 3IXSA 4RGTA 2RMMA 1QOBA 2AQ1B 3EA6A 1MHXA 2L83A 1K51A 1NI3A 3P4SB 3E56A 3ZJUA 4O1NA 1SXTA 2IJ0A 1DOXA 3TEWA 4H2AA 4YSZB 2INPE 1IBXB 4A90A 1C78A 2W82A 3KQ4A 2G1EA 3CWIA 1HQRD 1PDXA 3RFZB 2PMVA 4B0MA 1IGDA 1QKZA 2WNMA 4RFBA 1YQ4B 4L1BA 1VJKA 1ZP0B 2GRIA 5BMIA 3AE5B 4EE2A 3TSSA 1CJEA 3ZQ4A 1E10A 1F2RC 2VZKD 1C4PA 3HUIA 5JXVA 2AQ3B 2JZPA 1RWSA 1WSPA 3IAM1 1NEKB 4WH4A 2L52A 5BMGA 2OHFA 3SEBA 3T3NA 1QILA 2WXHA 1L6UA 2L1AA 1DGJA 4KGSA 3BIID 1OFFA 5HHDG 2WS3B 2WDRB 2I38A 4JPSA 1XEEA 1V1PB 3MJ5A 2EKIA 1E6EB 2LHDA 4WURA 2PIAA 5GXGB 4TQ0A 1N60A 1RM6C 1VDVA 4L23A 3PZ7A 3KLSX 1GAQB 4ZOHC 3P42A 1JALA 2FBWB 1ESFA 3ETRA 3SFEB 2BBCA 1M4VA 1E9MA 2MH7A 5HG2A 2RPVA 3IAS1 3P4QB 1GB1A 1L4DB 2E6XA 1XXGA 4M0WA 1YN3A 5EE9A 5EE0A 1D4BA 5AUKA 4DXFA 1SE2A 3U4EG 1I4GA 2WXPA 1FCLA 3B9JA 4GDLB 2WDVB 3W1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZC A;  1Q10 A;  2GB1 A;  1C9F A;  3V3X A;  4KGT A;  2ZW0 A;  2PLP A;  1PGA A;  1IGC A;  2J53 A;  2ON8 A;  2ONQ A;  1KH0 A;  2KDM A;  1HEZ E;  1K52 A;  5HFY A;  2QSD A;  2N9K A;  2IGH A;  1YNT E;  1ZXH A;  2JXT A;  1JML A;  2KAC A;  1FCC C;  2JSV X;  2RMM A;  1HZ5 A;  1P7E A;  1MHX A;  4GLS C;  1K51 A;  3MP9 A;  1MI0 A;  1FD6 A;  4OZA A;  1GB4 A;  1IBX B;  2N7J A;  2KN4 A;  2PTL A;  4HKZ E;  1IGD A;  1QKZ A;  2QMT A;  4IOI E;  1K53 A;  3UI3 A;  5BMI A;  2OED A;  2IGD A;  2N9L A;  1HZ6 A;  1XCT L;  1F2R C;  3GB1 A;  1MVK A;  5JXV A;  2JZP A;  1MPE A;  1MHH E;  4WH4 A;  5BMG A;  4D2K A;  1K50 A;  2LUM A;  1XCQ L;  2JU6 X;  4KGS A;  1XF5 L;  5HHD G;  2I38 A;  1UWX A;  4KGR A;  2I2Y A;  1YMH E;  2KWD A;  2LGI A;  2LHD A;  5HI1 A;  3FIL B;  2IGG A;  1IBX A;  4MAC A;  2LHE A;  1F2R I;  2JWU A;  5HG2 A;  2RPV A;  2GI9 A;  1GB1 A;  2NMQ A;  3FIL A;  2KQ4 X;  2EEL A;  1EM7 A;  2ZW1 A;  2K0P A;  1D4B A;  1FCL A;  1P7F A;  4IKG A;  4HJG E;  5BMH A;  2PW9 A;  2J52 A;  1PGX A;  4OZB A;  1PGB A; 
#chains in the Genus database with same CATH topology
 3PRE A;  2GBK A;  1T6B X;  4E74 A;  1DYQ A;  1UH6 A;  1WXQ A;  2D11 A;  1V1O A;  2PE6 B;  3BIN A;  4DK5 A;  2WX0 A;  4A6Q A;  2V0G A;  1XLP A;  4NAM A;  4CO7 A;  5LNK 1;  2L7R A;  1UBQ A;  3BK2 A;  2R61 A;  1LO5 D;  1WFY A;  2LGS A;  1GC7 A;  1I4P A;  3RNE C;  1FD6 A;  1YIW A;  3B2F A;  1JWS D;  3ENE A;  4PS3 A;  2ICI A;  3Q3N C;  1K8R B;  4BKT A;  5EDS A;  2K6Q A;  1A5R A;  1J7C A;  1V2Y A;  4BAX A;  3VTW A;  4IWP A;  3SD5 A;  3AE4 B;  3QX1 A;  2CHW A;  3FC4 A;  2CU1 A;  4N58 A;  3O13 A;  1NI2 A;  3ZRC A;  2L76 A;  2KTF A;  1P1A A;  1SBB B;  1FNU A;  4JWS C;  2MX2 A;  2JU6 X;  3N20 C;  2FCM A;  4RCO A;  4TSS A;  2BW2 A;  1TYG B;  3AE9 B;  2G45 B;  3EFU A;  2JYE A;  3DDC B;  4OW0 A;  5MPO A;  2KMM A;  4K7S A;  1HXY D;  2KFK B;  3U2S C;  4BBN C;  4QAY A;  2WGS A;  2KQ4 X;  4LJO B;  3IVF A;  1EM7 A;  3M3J A;  3SFD B;  2N9X A;  3N9Y C;  1YOV B;  3EFC A;  2JZZ A;  4LNF A;  5TSS A;  4I6P A;  2INC C;  1C9F A;  4MDK E;  3NJT A;  3ZO5 B;  1HA5 A;  1RFK A;  4BKS A;  2JF5 A;  3ZNH B;  3D32 A;  1IGC A;  3PO0 A;  1WMH A;  2KDM A;  3RD2 A;  1QT9 A;  4IM3 A;  4RGO S;  5HFY A;  2MBO A;  1YNT E;  3Q8F A;  5GMV A;  2MRP A;  4JL9 A;  4ZHP A;  1D6E C;  2DWQ A;  1R4N B;  1QQR A;  3KVF B;  1HZ5 A;  2X8X X;  3Q8A A;  4IDI A;  4JGH B;  1N5X A;  1SF0 A;  4OZA A;  5BYQ A;  3W1S C;  1UUP A;  3WCQ A;  3LJ3 A;  1PUT A;  1J7B A;  1IPG A;  2O6V B;  5AZH A;  2KVZ A;  3B0A A;  4IOI E;  4RGN A;  3HM3 A;  2OED A;  1P0R A;  2N9L A;  2ZPN A;  4GB9 A;  2I1J A;  2J0K A;  1EU3 A;  1Q1O A;  2LXA A;  4GU2 A;  3I63 C;  1JWB D;  1YJI A;  3AE7 B;  2AWT A;  2BKF A;  4S0R A;  4AJY B;  2EKE C;  3NVV A;  2K6D B;  2LUE A;  1UWX A;  1ZXI A;  1ET9 A;  4KDL B;  2JXX A;  3H9D A;  1SB3 C;  2M56 B;  4LDT B;  1JWA D;  2LGI A;  4PK1 A;  4A3O A;  3RNG C;  3AE3 B;  3TJP A;  3N32 A;  3BYT B;  3AH7 A;  3H8H A;  4W9F A;  3MHS D;  1JW9 D;  4MEM A;  2QC8 A;  5H8Y E;  2MWS B;  2NBV B;  4LNO A;  2NMQ A;  4XWW A;  1V49 A;  2PKO A;  2KLG A;  4FHJ A;  1L6V A;  3VUW A;  4HXD A;  2W54 A;  2PVG C;  4RH6 A;  1FEH A;  2ZW0 A;  3CST A;  4GSW A;  5HKH A;  4GDL A;  3VH4 B;  1WYG A;  1UGM A;  4LTU A;  1CMX B;  3L08 A;  2NR2 A;  2LGX A;  3VTU A;  3ZGZ A;  1SIF A;  1WZ0 A;  3DVN U;  4HDQ A;  4MT5 A;  4P16 A;  2JSV X;  3L4P A;  2BKR B;  1AWD A;  3PLU A;  4HK2 A;  3AM9 A;  2BF8 B;  4IM2 A;  1WJU A;  1OEY J;  1GB4 A;  2QIE B;  1PYW D;  3KWV A;  4JX1 C;  2Y5C A;  2C60 A;  4N6E B;  1D5X C;  3UIN B;  3HK0 A;  1BXT A;  2MBH A;  1GPX A;  1PFD A;  1I7H A;  1QOG A;  4RF0 A;  1HZ6 A;  3VVW B;  3T9L A;  2MHJ A;  4YTM B;  2IYD B;  1HE8 A;  1B1Z A;  3WAL A;  3N1X C;  2HDE A;  3U7Z A;  5DPS A;  4TV3 A;  3L54 A;  2JY6 A;  1L0V B;  5CHW A;  5FR3 A;  3TMP B;  1UGJ A;  2WXJ A;  3ZXR A;  2RDH A;  2J42 A;  2N1W A;  2UWQ A;  1E90 A;  2FE8 A;  2IY0 B;  2EMT A;  2V9H A;  4KGR A;  4L2Y A;  3RPF C;  1FRD A;  3WAN A;  4DXA B;  3CMM B;  3Q3F A;  5D7G A;  4JQW C;  2IGG A;  4WJO A;  1X1M A;  3H7P B;  2SEB D;  3RNA C;  3AXC A;  2L8J A;  4WQO B;  4EZK A;  3RUI B;  1JCK B;  2LZ6 A;  3QAR A;  2DZM A;  3UIP B;  3W2D A;  1T0S C;  4FA6 A;  3C0R B;  2MJ3 A;  1E5W A;  2M19 A;  2V4L A;  1F52 A;  4OZB A;  2WHI A;  5DPT A;  2D10 A;  3VRA B;  4MGZ E;  1ACC A;  3BK1 A;  2LVO A;  1ZPS A;  4MJS A;  4MGK E;  1T0Y A;  2CS4 A;  4FJY A;  4ZYS A;  2ON8 A;  4W9H A;  1NYR A;  2KHW B;  3U52 E;  2UU7 A;  2DHZ A;  2CHZ A;  1WH3 A;  2JX5 A;  3NZS A;  3V6E B;  1G6J A;  2N0S B;  4MH8 A;  3TEY A;  3QHT A;  1QF6 A;  2HTH A;  2ZVO A;  4DHZ E;  1M94 A;  4PYU A;  4W9C A;  1LQB A;  1QOB A;  1MHX A;  3RYT A;  3E56 A;  2L05 A;  2IJ0 A;  2ZEQ A;  3PTF C;  2W82 A;  3RCZ A;  2G1E A;  3VHT C;  1HTO A;  4AOF A;  4RFB A;  1NBF C;  1VJK A;  1ZP0 B;  2GRI A;  5BMI A;  1TZ1 A;  3HUI A;  2XEW A;  2DNF A;  2LD9 A;  5IA7 A;  1RWS A;  1WSP A;  2BGF A;  3IAM 1;  3OG5 A;  1ZGU B;  2ZJD A;  2A5U A;  1DGJ A;  2NCN A;  2HJ8 A;  1E8W A;  2WDT B;  5HHD G;  2WS3 B;  1OQY A;  4FBJ B;  2G4S A;  3JYU A;  2KFJ A;  2KX0 A;  1E6E B;  4WUR A;  3RNC C;  2KDE B;  4L23 A;  2ZNV C;  3ZKJ C;  4WWP A;  1GAQ B;  5TR5 A;  2BYV E;  2BBC A;  1M4V A;  3Q6B A;  2IO1 B;  3IAS 1;  3P4Q B;  1L4D B;  2E6X A;  4LJP B;  1T0Q C;  5AUK A;  4AUQ C;  4DXF A;  1SE2 A;  3U4E G;  1FCL A;  3A9K B;  2LVP A;  2PJH A;  2C7H A;  3L10 B;  2LAS A;  1ZDV A;  1YJ1 A;  3K9P B;  3GZN I;  4B6W A;  1UF0 A;  1ROE A;  3PRP B;  2FCS A;  2D07 B;  4ZRP A;  4EZJ A;  3GP7 A;  4ARI A;  2MSE D;  1Q0W B;  2NPT B;  3ZTD A;  2WQY B;  2WU5 B;  3P4R B;  1R7S A;  2D3A A;  2GBN A;  2LJ5 A;  1XLO A;  1KTK A;  4JWU C;  1TY0 A;  1ZOY B;  5CHV C;  4YT0 B;  2NTT A;  2AQ2 B;  3LDZ E;  1WYW B;  2J7Q B;  2WXF A;  1SJE D;  1A70 A;  1WX7 A;  2KN4 A;  4A20 A;  2O2V B;  1TKE A;  1OEY A;  1C77 A;  3Q8E A;  3KH0 A;  3U30 A;  2WLB A;  1SGH A;  4YSY B;  4F1S A;  1MHH E;  1I4R A;  4D2K A;  4YXD B;  1XD3 B;  3PGE A;  3UQA A;  4YWG G;  4C00 A;  1OQR A;  3B1L X;  1JQ4 A;  4XZ4 A;  1T0R C;  3UF8 A;  1GNU A;  3WAP A;  3JSV B;  2BS4 B;  4W9L A;  2KQ7 A;  5G5G A;  3DHI C;  1WGY A;  4KZ0 A;  4GOC A;  3SDL C;  2K9X A;  5DPR A;  1QOF A;  3NVY A;  2KOX A;  1FFV A;  4BBN F;  3AMZ A;  2ZW1 A;  1MG8 A;  4KIK A;  4HJG E;  1VLB A;  2KAN A;  3APF A;  3QWZ B;  2B76 B;  3WIM A;  1JRP A;  5EE1 A;  2QEJ C;  3V60 A;  3UIO B;  3OWE B;  4DHZ B;  4JE3 B;  1IUE A;  1HEZ E;  3AI5 A;  1ZKH A;  1TIF A;  3AE2 B;  4EEW A;  2AX5 A;  3AEE B;  3VUX A;  1P98 A;  3BZD B;  2D3B A;  3I9V 1;  2FCQ A;  2AYO B;  2KDF B;  3Q3M C;  4GDK B;  4BKG A;  1P7E A;  5IOI A;  1OGW A;  4GLS C;  3KYD D;  2GBJ A;  1EUV B;  3L16 A;  3AE6 B;  4I6L B;  2KAJ A;  4CHK A;  3AV8 A;  3RT3 B;  3AEA B;  4DQO C;  1KLV A;  2XK5 B;  4HDO A;  3VAW A;  3Q69 A;  2KTR B;  4N9F 4;  1I4Q A;  1TS5 A;  2Z8L A;  1BT0 A;  2BYF A;  3MC0 B;  2K8C A;  3P1M A;  2BVC A;  4OVU A;  2L0T A;  3IHP C;  2KWD A;  1EWC A;  4F8C B;  2J0M A;  2BB5 A;  3Q8B A;  5CHF A;  3IT4 B;  1V5O A;  4OVZ A;  2BWE S;  4C4V B;  1N62 A;  2GI9 A;  4ZDV A;  4C80 A;  2BPS A;  2PW9 A;  4M01 A;  1PGB A;  4C56 C;  3A1Q B;  1R4N I;  4IW0 A;  2XN9 C;  3BVG A;  2OJR A;  3NZ3 A;  2W3S A;  2FNJ B;  4HJK A;  3IFW B;  3T8M A;  4FXC A;  2KDB A;  3NRZ A;  4XGA B;  1AN8 A;  4E71 A;  1ZXH A;  3MC9 A;  1FMA D;  2KC2 A;  1FRR A;  2C9W B;  1BUI C;  3QK0 A;  4OVV A;  1WF9 A;  3BY4 B;  4ANX A;  1RRB A;  2IPK D;  4WQM A;  2BYT A;  1CK1 A;  1EF1 A;  3LB8 C;  2DZI A;  5C3J B;  4ZYN A;  5J2R A;  4KX6 B;  2KMA A;  1V97 A;  3MHZ A;  4HKZ E;  2QMT A;  3IG3 A;  2MJE A;  3KW5 B;  2FUH B;  3PLV A;  2CJN A;  2Y3A A;  4MEL A;  2RGF A;  2KK8 A;  2N9P C;  3W5U B;  1C4A A;  1VCB A;  4DDI D;  2W3R A;  2KQS A;  4ZHO A;  1SJH D;  4IUM B;  1E7V A;  2LRU A;  3ECI A;  2MP2 A;  2JUO A;  4DDG D;  2HTM E;  1RAX A;  4NJC A;  4AWJ A;  1C4C A;  4HCN B;  5IP4 D;  1V5T A;  2M0A A;  2V3N A;  4ARC A;  1KLU D;  4FHK A;  3KUZ A;  4KZC A;  4A8X C;  3FIL B;  1IBX A;  3V62 A;  5BYS A;  5FR6 A;  3X0W A;  1P3Q U;  2LJI A;  3R3M A;  1N5W A;  2BB6 A;  4PS8 A;  2BT6 A;  2KN5 A;  5G2N A;  2V3S A;  4UDU C;  3DBS A;  1N61 A;  2PVO D;  4A9A A;  2GOW A;  3R7Q A;  2KZR A;  1FM0 D;  2DAJ A;  2K39 A;  4BVU C;  3DBR B;  2FUG 1;  3VR8 B;  3CF6 E;  2ZNV B;  3L17 A;  2FID A;  2WXL A;  2ASQ A;  2KJR A;  1TY2 A;  2NS5 A;  3TCA A;  1WIA A;  3W9C B;  1L2N A;  2WYQ A;  2K22 A;  2YEP B;  4KKJ A;  2DAF A;  5LLI A;  3VRB B;  1OQQ A;  3NS1 A;  4K3C A;  2RMM A;  2LRW A;  4KVG B;  2AQ1 B;  1WGD A;  1F1H A;  2I1K A;  2L83 A;  1K51 A;  2EMS A;  1S1Q B;  3ZJU A;  4O1N A;  2R2O A;  3IBE A;  3Q3J A;  5JZE B;  3TEW A;  1DOX A;  4YSZ B;  1V81 A;  3EEC A;  1C78 A;  1PDX A;  2MLB A;  4WWN A;  2PMV A;  4WAA A;  3NOB A;  4EKU A;  2HD5 B;  1C4P A;  4BZA A;  2JZP A;  4CYE A;  3I5J C;  2QDF A;  2OHF A;  1V86 A;  1QIL A;  2XK5 A;  3HIZ A;  1OFF A;  2WDR B;  5KHO A;  2WWZ A;  4JPS A;  1WZ3 A;  2KTR A;  2EKI A;  2QHO A;  4P1B C;  3EC8 A;  2HJ1 A;  4WJN A;  3W1Y A;  1VDV A;  1JAL A;  2FBW B;  2IO2 B;  3SFE B;  3FKY A;  2DX5 B;  1F9J A;  1E9M A;  4W9E A;  5L95 C;  1H4R A;  1WI0 A;  2RD0 A;  1XXG A;  2V1Y A;  1TBE A;  2Y5B B;  2KYW A;  2JWZ A;  2YEP F;  3ZIM A;  1Q10 A;  3DWM A;  4MSM B;  1WY8 A;  4AP4 C;  4MM3 B;  3ZRF A;  2M0X A;  2V4I B;  3DHH C;  1GG3 A;  1PGA A;  2YVC A;  3ZNZ B;  4ANV A;  4DBG A;  1BML C;  2XNA C;  3LYY A;  1UNS A;  1GC6 A;  1E8X A;  4ZRJ A;  2L0F A;  3VUY A;  2N9K A;  1E7U A;  2KFK A;  1V8C A;  2OOB B;  3KWL A;  2KAC A;  2K5P A;  1IYF A;  3WAO A;  3A9J B;  4IM0 A;  3MP9 A;  1TJE A;  4NJ7 A;  4WJP A;  3U8Z A;  2REX A;  2QJL A;  4ZRQ A;  2BS2 B;  2IZV B;  2RR9 A;  1Z5S B;  1J7A A;  2DLB A;  2WXI A;  3A4R A;  1K53 A;  2MCN B;  3UI3 A;  3DBL B;  2JRI B;  2IGD A;  2V3P A;  1JRO A;  4M0W B;  3KUD B;  3AN1 A;  5IAA C;  1E8Y A;  2G4D B;  3IT6 B;  1YJJ A;  4LNN A;  4A3P A;  4HEA 1;  2BS3 B;  4W9J A;  1SSN A;  3UQB A;  5D3I B;  1VZ7 A;  2IND C;  2LI5 A;  1XF5 L;  2N4F A;  3NVZ A;  2INN E;  1L5P A;  1V80 A;  2I2Y A;  1VR9 A;  4IG7 B;  4MGI E;  1L0Y B;  2GMI C;  4MAC A;  4NJ6 A;  2O6V A;  4II2 B;  3WAM A;  3W5V B;  3QJZ A;  2CKH B;  3FIL A;  3CIR B;  4ZRK A;  1WX8 A;  3VXW A;  4HLE A;  5BMH A;  4NY0 A;  1AW7 A;  3OJ3 A;  3ZNG C;  1FXI A;  3M63 B;  4ZRI A;  1CZP A;  3BVM A;  1DOY A;  4LK0 M;  3ZDM C;  4NZL B;  2ACZ B;  3SR6 A;  4W9D A;  4B9K A;  1L7Y A;  2MJD A;  1RYJ A;  2WXM A;  3QIJ A;  3ABV B;  2KD0 A;  3AU4 A;  1LFD A;  3RN9 C;  3TEX A;  1F0Z A;  2Z59 B;  3P63 A;  3BYY B;  1U4A A;  1SE4 A;  1EWY C;  1WX9 A;  3HRD D;  2AEH A;  5DCN A;  4YSX B;  2N7J A;  4A55 A;  3DPD A;  2YLM A;  2LFI A;  4JLC A;  3QA8 A;  1YN5 A;  2WXK A;  1ZDX A;  4E3C A;  4HPM B;  2CR5 A;  3RMK C;  3DBH B;  4IWQ A;  1YX5 B;  2GBM A;  1MPE A;  4AQ7 A;  4IC7 B;  4PS7 A;  4WAF A;  4K3B A;  3TL5 A;  4DXG A;  3AED B;  3NUH B;  4G50 A;  4RF1 A;  4RNA A;  3V6C B;  1WM3 A;  2MW5 A;  1KRH A;  2MEK A;  1R4M B;  5DPW A;  4WJQ A;  3Q8C A;  2WX1 A;  4ANW A;  3B08 A;  2WXQ A;  2M8S A;  1YN4 A;  3EHV A;  3NS8 A;  3AUL A;  4GGQ A;  1EO6 A;  2LXC A;  5E6N A;  1WJN A;  3HM6 X;  3E9S A;  3TEZ A;  4M00 A;  2G9H D;  4YTN B;  1WXS A;  3ML8 A;  4CQN A;  5C1Z A;  3AB5 A;  4IKG A;  2J52 A;  3UGB B;  3PT2 B;  2NBU A;  4M8N A;  5FKA C;  2WXR A;  5T8I A;  2A4Z A;  2N7D A;  4M8M A;  2KWV B;  3OAW A;  1C79 A;  2C7M B;  2AL6 A;  4J6I A;  1TGZ B;  2JYT A;  2CU3 A;  1TS2 A;  4MGY E;  4YL8 A;  2KJH B;  3H7P A;  1SE9 A;  1Y8R C;  2K25 A;  4NAW B;  3RNB C;  4HPP A;  1EU4 A;  5G5H A;  2K8H A;  3M95 A;  1F77 A;  1SE3 A;  1AAR A;  1MG4 A;  1MI0 A;  2JRH A;  1KLG D;  1CQV A;  1NEN B;  4F7Z A;  1C3T A;  1TS3 A;  2IY1 B;  2D5G A;  2C7N B;  1FFU A;  1ZUD 2;  3GOE A;  1MVK A;  4I6N B;  3RNF C;  3O65 B;  2Y5P A;  4WIP A;  3ZLZ A;  5D2M B;  2K3U A;  3DVG Y;  4G11 A;  1WE6 A;  1XQQ A;  1NYQ A;  4HWI B;  1FPY A;  1WJ4 A;  3BWU D;  1YMH E;  4B95 A;  1Q5W B;  3ZXV A;  2RDG A;  3AEF B;  4RM9 A;  1VRA B;  1AYF A;  3PHW B;  3OJ4 B;  4XDC A;  4HKQ A;  3AU5 A;  2L32 A;  1RFA A;  2IDY A;  1RLF A;  1DOI A;  1WGR A;  5E6P A;  2LVQ A;  2KLC A;  4M02 A;  2Q5W D;  5LXH A;  4ICU A;  2OJW A;  4J3O D;  3ZW3 A;  2KDI A;  3DCG A;  1WRI A;  2K0P A;  1WR6 E;  5AEK B;  5G55 A;  3ONS A;  2M17 A;  3AE8 B;  4OZC A;  3Q3O C;  4LLG M;  3KUC B;  4BOZ B;  2G3Q B;  1KJT A;  4Q2J A;  4XE0 A;  3AE1 B;  2RSU A;  3T3O A;  3HVD A;  1NVI D;  3ML9 A;  5BYR A;  2KWU B;  5LXI B;  2FAZ A;  3NY5 A;  4AJW A;  2JXT A;  4ANU A;  3AEG B;  5J17 A;  4NQK E;  2D2Q A;  4KKI A;  3AEC B;  3IXS A;  1LXD A;  4RGT A;  4EUT A;  5CX3 A;  4K7W A;  3EA6 A;  1NI3 A;  2DYB A;  5D6J B;  4HVB A;  5D94 A;  3QAQ A;  1LGR A;  1WR1 A;  3A9K A;  3KQ4 A;  1TT5 B;  3ZTC A;  3CWI A;  1HQR D;  3RFZ B;  1IGD A;  2WNM A;  3PRM B;  4ACF A;  1YQ4 B;  3Q2A C;  4L1B A;  4P7I A;  3AE5 B;  3PRZ A;  4HPL B;  3TSS A;  3MC8 A;  1E10 A;  2W9N A;  2NBW B;  5IKC M;  2VZK D;  2NPT A;  2ZVN A;  1NEK B;  2L52 A;  3SEB A;  2L1A A;  4KGS A;  2I38 A;  1KOT A;  4MJS B;  1V1P B;  2HE7 A;  2KT7 A;  1UEL A;  4K1R B;  4G3X B;  1JRU A;  2LHD A;  3R7R A;  5GXG B;  4NNJ B;  1N60 A;  1RM6 C;  3DBR I;  3PZ7 A;  2O2V A;  3KLS X;  4ZOH C;  4FLH A;  3ETR A;  3VH3 B;  2KWC A;  4GN1 A;  5HG2 A;  4EZL A;  5L83 A;  1YN3 A;  5EE0 A;  4GXB A;  3CSF A;  2MBQ A;  3B9J A;  3X23 A;  4K7U A;  1WGH A;  2QCZ A;  3MJW A;  3W1S A;  2KVR A;  3APC A;  2GB1 A;  2WXO A;  4ITK A;  3VFK A;  4WWM A;  3PSE B;  1VZ6 A;  3JVZ X;  2J53 A;  1WJ6 A;  4K81 A;  2LMC A;  2ZCC A;  4AS1 A;  4C7Z A;  5FK9 C;  1VD2 A;  4PT5 A;  3JSV A;  2IGH A;  3ZVV A;  3ZUN A;  1WGG A;  4II3 B;  1FCC C;  2LGD A;  1FXT B;  1STE A;  1HTQ A;  1FNW A;  1XLQ A;  1WXM A;  3H6N A;  3PHX B;  2CJO A;  4FJV B;  2WXG A;  2N9E B;  2KNB A;  1ZW7 A;  2K8B A;  4DWF A;  4NAW A;  2WU2 B;  3N3K B;  3R8B A;  4HCP B;  2PTL A;  2W55 A;  3GE8 C;  4OHJ A;  1QZE A;  4XC2 A;  2K1F A;  4FUL A;  2KX3 A;  4DHJ D;  2CHX A;  1XCT L;  1I35 A;  2N1V A;  3C19 A;  2MA9 B;  3VQI A;  2LUM A;  2GLS A;  2PPH A;  4BKS D;  3PV1 A;  5E6J A;  4GDK A;  3A4S C;  4GMV A;  1WWT A;  3PPA A;  3KYC D;  5BO4 B;  3C8Y A;  2LEK A;  1QLB B;  1QOA A;  1XT9 B;  3P4P B;  5HI1 A;  4TUU A;  3VR9 B;  3J9C A;  4LNK A;  4EFO A;  2LHE A;  4REZ A;  1F2R I;  1Z2M A;  3NVW A;  2IO0 B;  1YQB A;  3PZ8 A;  4US8 A;  1TKG A;  1MJD A;  1N63 A;  1ET6 A;  4G0N B;  4KSK C;  4BOS C;  2WXN A;  1T3Q A;  1D5Z C;  1P7F A;  4P6V F;  1J0G A;  2ZPY A;  3PZD A;  2X38 A;  4XDD A;  3SU8 X;  5JHA A;  1FO4 A;  2ZCB A;  1TKY A;  4XWT A;  1SIJ A;  3R2I A;  2ONQ A;  4B0E A;  2WP9 B;  1K52 A;  1EF5 A;  1T5X D;  2DZJ A;  3VDZ A;  4C7Y A;  1WXA A;  4C4V A;  3ZNI D;  1JWU D;  3DBL I;  3U7D A;  5I4D A;  1B9R A;  1XO3 A;  2FCN A;  3V05 A;  4MH0 E;  3QC8 B;  4KDI C;  4W9G A;  3ALB A;  2H88 B;  3A1Q A;  1P9D U;  3MTN B;  3ZYY X;  2J0J A;  5H92 C;  1GJZ A;  1LM8 B;  1FNV A;  4WWO A;  3Q14 C;  5C2T B;  2QIL A;  3N30 A;  3ZJV A;  4NQL B;  2Z0D B;  4P1C C;  4KIK B;  3H1U A;  3R2T A;  1KM7 A;  1WXV A;  2N7E A;  2NTS A;  3QQ8 B;  1MFW A;  4TQ1 A;  2J4X A;  3SHQ A;  3I3T B;  4TKN A;  3I57 A;  4XYC A;  3DVG X;  3B2G A;  1V6E A;  2JZ3 B;  2BTE A;  3FAH A;  5AUI A;  1I4X A;  1D5M C;  1ZE3 D;  1V1P A;  2DBY A;  3GS2 A;  2JQR B;  2VZK B;  3HHM A;  1E8Z A;  2E3T A;  4US9 A;  2M4N A;  2B3A A;  4IWO A;  5JHB A;  3L0W B;  3V61 A;  2IBI B;  1KF6 B;  3RUL A;  1GUA B;  1UWM A;  1PGX A;  4JIO U;  3NG0 A;  3ZDT A;  4URK A;  3M62 B;  2RPQ A;  2LWP A;  4LCD E;  3V3X A;  4KGT A;  4YTP B;  3DVN V;  1KH0 A;  1UZX B;  1UBI A;  5C23 A;  1WGK A;  2TSS A;  1OTR B;  1J19 A;  2JPH A;  4N59 A;  3EUB 2;  1WM2 A;  4HRS A;  2NVU I;  4S17 A;  3R66 C;  4FJZ A;  1E0Z A;  2SAK A;  4X57 B;  5KHQ A;  3DBH I;  3VTV A;  2WDQ B;  3RI7 C;  1C1Y B;  5AZF A;  5AZG A;  1I4H A;  4XX5 A;  1TS4 A;  3AEB B;  4LNI A;  2JVC A;  4RMA A;  3APD A;  3NZU A;  4ASW C;  3QCA A;  4BFR A;  4TMA B;  3N1Y C;  3PVL A;  1SEB D;  3GB1 A;  3H7S A;  1R4M I;  2VH1 A;  2L00 B;  1KFY B;  1E7P B;  1XLN A;  1JWM D;  3A33 B;  1FXA A;  1K50 A;  3EGR A;  1XCQ L;  1YD8 U;  2DYM A;  2H89 B;  2M1M A;  3N1Z C;  4NPN A;  5D3D A;  1L0X B;  1YX6 B;  2KKC A;  1ENF A;  2LGY A;  1TZO A;  3HVZ A;  3DWG C;  3WA0 A;  1J8C A;  2D3G A;  3L13 A;  5EE3 A;  1PQS A;  4DHJ B;  1VZ8 A;  2R2Q A;  1YQ3 B;  3LXF A;  2JWU A;  4HRO A;  5E6O A;  3RZW C;  1FIQ A;  1H8C A;  1Y56 A;  5JH5 C;  2EEL A;  2DYO A;  3K9O B;  3MFG A;  1NDD A;  3TBL D;  2L3Z A;  4R3D A;  2FIF A;  2KJ6 A;  5IO9 A;  4FAD A;  1WMH B;  4KSL C;  2PE9 A;  3URY A;  4PYZ A;  3BVZ A;  4RGM A;  4USA A;  1I42 A;  2O6V D;  2BWF A;  2PLP A;  2MBE A;  2KC1 A;  2IO3 B;  2AL3 A;  3TUO A;  1WE7 A;  1C76 A;  1L4Z B;  3ZJT A;  2QSD A;  1N6Z A;  3NHE B;  1JML A;  3DHG C;  5CTR C;  1GOZ A;  3GZN B;  2BQQ A;  2MP2 B;  2ZZP B;  3PS6 A;  4W9K A;  3P4S B;  1SXT A;  4H2A A;  2INP E;  1IBX B;  4LDT D;  1WRD B;  4A90 A;  2DZK A;  2RDB C;  4B0M A;  1QKZ A;  2KXJ A;  4MM3 A;  2BYE A;  4EE2 A;  1CJE A;  3ZQ4 A;  2KO3 A;  1F2R C;  3DQV A;  2PEA A;  3DOW A;  4KV2 A;  5JXV A;  3OLM D;  2AQ3 B;  5IN7 A;  2DEN B;  2VRR B;  4WH4 A;  5BMG A;  3S2A A;  4RM8 A;  3T3N A;  3P2B A;  2Z0E B;  2WXH A;  1L6U A;  2MBB B;  4GIV A;  3BII D;  2UYZ B;  2VH2 A;  2D3C A;  2GBR A;  1XEE A;  3A9J A;  4FN2 A;  3MJ5 A;  2XBB C;  2JT4 B;  3TIX A;  3RZF A;  2KMC A;  2PIA A;  5J18 A;  4TQ0 A;  1V9J A;  4EOY A;  3P42 A;  3JW0 X;  1ESF A;  4MSQ B;  2MH7 A;  2RPV A;  1GB1 A;  3GE3 C;  1UD7 A;  4W9I A;  4M0W A;  5EE9 A;  2MQJ A;  4ICV A;  1D4B A;  1IP9 A;  2C5L C;  1I4G A;  2WXP A;  1TTN A;  1S3S G;  4GDL B;  2WDV B;  1ISN A;  1D3Z A; 
#chains in the Genus database with same CATH homology
 2YEP F;  1ZDV A;  1Q10 A;  3DWM A;  1T6B X;  2GB1 A;  2WXO A;  4ITK A;  4WWM A;  1DYQ A;  4MM3 B;  1WXQ A;  1VZ6 A;  1ROE A;  2V4I B;  1V1O A;  1PGA A;  4ZRP A;  2J53 A;  1BML C;  2XNA C;  3LYY A;  2LMC A;  1UNS A;  3GP7 A;  4AS1 A;  4ARI A;  4C7Z A;  5FK9 C;  4A6Q A;  2WQY B;  2WU5 B;  3P4R B;  1R7S A;  4PT5 A;  2N9K A;  2V0G A;  2IGH A;  1XLP A;  4NAM A;  1V8C A;  1XLO A;  1KTK A;  4JWU C;  5LNK 1;  1TY0 A;  3KWL A;  2KAC A;  1ZOY B;  1FCC C;  4YT0 B;  2NTT A;  3BK2 A;  2R61 A;  1LO5 D;  2AQ2 B;  1STE A;  2K5P A;  1FNW A;  1XLQ A;  2CJO A;  2WXG A;  1I4P A;  3MP9 A;  1TJE A;  1FD6 A;  2WXF A;  2QJL A;  3B2F A;  1JWS D;  4ZRQ A;  2BS2 B;  2WU2 B;  1SJE D;  3R8B A;  1A70 A;  2ICI A;  2KN4 A;  1J7A A;  2PTL A;  2W55 A;  2DLB A;  1J7C A;  2WXI A;  4OHJ A;  1TKE A;  1K53 A;  3UI3 A;  1C77 A;  3AE4 B;  3Q8E A;  2IGD A;  2V3P A;  1XCT L;  1JRO A;  2WLB A;  3FC4 A;  3AN1 A;  4N58 A;  4YSY B;  3IT6 B;  3O13 A;  1YJJ A;  1MHH E;  1I4R A;  4HEA 1;  3VQI A;  2BS3 B;  1SBB B;  4D2K A;  1FNU A;  2LUM A;  1SSN A;  4JWS C;  4YXD B;  5E6J A;  5D3I B;  2JU6 X;  1VZ7 A;  4YWG G;  1XF5 L;  3NVZ A;  1OQR A;  4RCO A;  1WWT A;  2INN E;  4TSS A;  1L5P A;  2BW2 A;  3C8Y A;  1JQ4 A;  2LEK A;  1TYG B;  3AE9 B;  2I2Y A;  1VR9 A;  1QLB B;  1QOA A;  2JYE A;  3P4P B;  4OW0 A;  5HI1 A;  1L0Y B;  5MPO A;  3VR9 B;  3J9C A;  2KMM A;  4MAC A;  2BS4 B;  1HXY D;  2LHE A;  4REZ A;  5G5G A;  3U2S C;  1F2R I;  3NVW A;  2K9X A;  3W5V B;  3PZ8 A;  1QOF A;  4US8 A;  3NVY A;  1TKG A;  1N63 A;  3FIL A;  1ET6 A;  2KQ4 X;  1FFV A;  1EM7 A;  3AMZ A;  3SFD B;  2ZW1 A;  2WXN A;  1T3Q A;  3CIR B;  1D5Z C;  1P7F A;  3N9Y C;  4P6V F;  4HJG E;  5BMH A;  1VLB A;  1AW7 A;  5TSS A;  2B76 B;  2X38 A;  4XDD A;  1FO4 A;  1JRP A;  5EE1 A;  1C9F A;  2QEJ C;  1FXI A;  1HA5 A;  1RFK A;  1CZP A;  1TKY A;  4XWT A;  3BVM A;  1DOY A;  4LK0 M;  3OWE B;  1SIJ A;  4JE3 B;  3R2I A;  4NZL B;  1IGC A;  2ONQ A;  2ACZ B;  4B0E A;  3PO0 A;  2KDM A;  3SR6 A;  1IUE A;  1QT9 A;  1HEZ E;  2WP9 B;  2MJD A;  4RGO S;  1K52 A;  5HFY A;  1RYJ A;  2WXM A;  3AE2 B;  3ABV B;  1T5X D;  2AX5 A;  1YNT E;  3AEE B;  3BZD B;  3Q8F A;  3I9V 1;  4C7Y A;  4ZHP A;  3TEX A;  4GDK B;  1F0Z A;  3P63 A;  1D6E C;  1JWU D;  2DWQ A;  3BYY B;  1SE4 A;  1QQR A;  1EWY C;  1HZ5 A;  1P7E A;  3HRD D;  3Q8A A;  4GLS C;  4IDI A;  5I4D A;  1B9R A;  1N5X A;  1SF0 A;  4OZA A;  1XO3 A;  3V05 A;  5BYQ A;  4YSX B;  1UUP A;  3WCQ A;  2N7J A;  1PUT A;  4A55 A;  1J7B A;  3AE6 B;  2H88 B;  2LFI A;  4IOI E;  4RGN A;  2KAJ A;  1YN5 A;  2OED A;  2WXK A;  3ZYY X;  1ZDX A;  3AV8 A;  5H92 C;  3AEA B;  4DQO C;  2N9L A;  1FNV A;  5C2T B;  2QIL A;  3Q69 A;  3ZJV A;  1EU3 A;  1MPE A;  4AQ7 A;  1JWB D;  3R2T A;  1I4Q A;  4WAF A;  1YJI A;  2NTS A;  4DXG A;  1TS5 A;  3AE7 B;  2Z8L A;  3AED B;  3NVV A;  4TQ1 A;  3NUH B;  2J4X A;  3MC0 B;  3P1M A;  1UWX A;  1ZXI A;  4RF1 A;  1ET9 A;  4RNA A;  3I57 A;  1SB3 C;  2KWD A;  2M56 B;  1JWA D;  1KRH A;  2LGI A;  2MEK A;  3B2G A;  1EWC A;  2BB5 A;  3AE3 B;  3Q8C A;  2BTE A;  3BYT B;  3FAH A;  5AUI A;  1I4X A;  1D5M C;  2WXQ A;  1YN4 A;  3Q8B A;  1ZE3 D;  3AH7 A;  3H8H A;  1V1P A;  2DBY A;  1JW9 D;  2JQR B;  3GS2 A;  3IT4 B;  4OVZ A;  2VZK B;  1N62 A;  5H8Y E;  2E3T A;  2GI9 A;  4US9 A;  2NMQ A;  3E9S A;  4XWW A;  3TEZ A;  2G9H D;  4YTN B;  2PKO A;  4C80 A;  4CQN A;  3AB5 A;  4IKG A;  1L6V A;  1KF6 B;  2PW9 A;  1UWM A;  1PGX A;  2J52 A;  1PGB A;  4C56 C;  5FKA C;  2WXR A;  2W54 A;  2PVG C;  5T8I A;  3V3X A;  4KGT A;  4RH6 A;  4YTP B;  1FEH A;  2XN9 C;  2ZW0 A;  3BVG A;  1C79 A;  1WYG A;  3NZ3 A;  1KH0 A;  2W3S A;  2JYT A;  4LTU A;  2CU3 A;  1WGK A;  1TS2 A;  2TSS A;  4FXC A;  3NRZ A;  1AN8 A;  4N59 A;  3EUB 2;  1ZXH A;  3ZGZ A;  1FMA D;  4HRS A;  1FRR A;  4MT5 A;  1BUI C;  4NAW B;  4P16 A;  1E0Z A;  2JSV X;  3L4P A;  2SAK A;  2IPK D;  1AWD A;  4WQM A;  1EU4 A;  5G5H A;  2BYT A;  3AM9 A;  2WDQ B;  1F77 A;  1CK1 A;  1SE3 A;  1MI0 A;  1GB4 A;  1KLG D;  1PYW D;  1CQV A;  1I4H A;  1NEN B;  2QIE B;  3KWV A;  3LB8 C;  5C3J B;  1TS4 A;  3AEB B;  4KX6 B;  4JX1 C;  1V97 A;  2Y5C A;  3MHZ A;  4N6E B;  4HKZ E;  1D5X C;  2QMT A;  1BXT A;  2MJE A;  1TS3 A;  1GPX A;  2CJN A;  1PFD A;  2D5G A;  4TMA B;  2Y3A A;  1I7H A;  1QOG A;  4RF0 A;  1FFU A;  1HZ6 A;  1SEB D;  1ZUD 2;  3GB1 A;  1MVK A;  1KFY B;  4YTM B;  3W5U B;  1E7P B;  2Y5P A;  4WIP A;  1B1Z A;  1C4A A;  1XLN A;  2K3U A;  1JWM D;  2HDE A;  2W3R A;  3U7Z A;  1FXA A;  1K50 A;  1L0V B;  3EGR A;  4ZHO A;  1SJH D;  1XCQ L;  5FR3 A;  1UGJ A;  2WXJ A;  2RDH A;  2J42 A;  1NYQ A;  2DYM A;  2H89 B;  2FE8 A;  2HTM E;  4L2Y A;  4KGR A;  4NJC A;  5D3D A;  1C4C A;  3RPF C;  1L0X B;  3BWU D;  1FRD A;  1YMH E;  2V3N A;  2M0A A;  4ARC A;  1KLU D;  1ENF A;  5D7G A;  4A8X C;  1TZO A;  3FIL B;  3HVZ A;  2IGG A;  2RDG A;  3DWG C;  1IBX A;  5BYS A;  3AEF B;  5EE3 A;  1VZ8 A;  1VRA B;  1AYF A;  4XDC A;  1YQ3 B;  3LXF A;  4HKQ A;  2JWU A;  2L32 A;  2LJI A;  2SEB D;  4HRO A;  2IDY A;  1DOI A;  1N5W A;  2BB6 A;  2Q5W D;  2BT6 A;  1FIQ A;  1Y56 A;  1JCK B;  2EEL A;  2DYO A;  4J3O D;  3MFG A;  4UDU C;  1WRI A;  2K0P A;  4R3D A;  1N61 A;  2PVO D;  3W2D A;  4A9A A;  2MJ3 A;  1FM0 D;  2M19 A;  3AE8 B;  4OZB A;  2FUG 1;  4OZC A;  3URY A;  3VR8 B;  3BVZ A;  4LLG M;  3VRA B;  1ACC A;  3BK1 A;  4RGM A;  4USA A;  1ZPS A;  4Q2J A;  4XE0 A;  2WXL A;  2PLP A;  1TY2 A;  3AE1 B;  4ZYS A;  3T3O A;  2ON8 A;  1NYR A;  3TUO A;  3HVD A;  1NVI D;  1C76 A;  1L4Z B;  3U52 E;  5BYR A;  3W9C B;  3ZJT A;  2QSD A;  2JX5 A;  2K22 A;  2YEP B;  4KKJ A;  2N0S B;  2JXT A;  4MH8 A;  3VRB B;  1JML A;  3TEY A;  1OQQ A;  3AEG B;  1QF6 A;  1GOZ A;  3NS1 A;  4KKI A;  3AEC B;  3IXS A;  4RGT A;  2RMM A;  1QOB A;  2AQ1 B;  3EA6 A;  1MHX A;  2L83 A;  1K51 A;  1NI3 A;  3P4S B;  3E56 A;  3ZJU A;  4O1N A;  1SXT A;  2IJ0 A;  1DOX A;  3TEW A;  4H2A A;  4YSZ B;  2INP E;  1IBX B;  4A90 A;  1C78 A;  2W82 A;  3KQ4 A;  2G1E A;  3CWI A;  1HQR D;  1PDX A;  3RFZ B;  2PMV A;  4B0M A;  1IGD A;  1QKZ A;  2WNM A;  4RFB A;  1YQ4 B;  4L1B A;  1VJK A;  1ZP0 B;  2GRI A;  5BMI A;  3AE5 B;  4EE2 A;  3TSS A;  1CJE A;  3ZQ4 A;  1E10 A;  1F2R C;  2VZK D;  1C4P A;  3HUI A;  5JXV A;  2AQ3 B;  2JZP A;  1RWS A;  1WSP A;  3IAM 1;  1NEK B;  4WH4 A;  2L52 A;  5BMG A;  2OHF A;  3SEB A;  3T3N A;  1QIL A;  2WXH A;  1L6U A;  2L1A A;  1DGJ A;  4KGS A;  3BII D;  1OFF A;  5HHD G;  2WS3 B;  2WDR B;  2I38 A;  4JPS A;  1XEE A;  1V1P B;  3MJ5 A;  2EKI A;  1E6E B;  2LHD A;  4WUR A;  2PIA A;  5GXG B;  4TQ0 A;  1N60 A;  1RM6 C;  1VDV A;  4L23 A;  3PZ7 A;  3KLS X;  1GAQ B;  4ZOH C;  3P42 A;  1JAL A;  2FBW B;  1ESF A;  3ETR A;  3SFE B;  2BBC A;  1M4V A;  1E9M A;  2MH7 A;  5HG2 A;  2RPV A;  3IAS 1;  3P4Q B;  1GB1 A;  1L4D B;  2E6X A;  1XXG A;  4M0W A;  1YN3 A;  5EE9 A;  5EE0 A;  1D4B A;  5AUK A;  4DXF A;  1SE2 A;  3U4E G;  1I4G A;  2WXP A;  1FCL A;  3B9J A;  4GDL B;  2WDV B;  3W1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...