5HHDG

Crystal structure of chemically synthesized heterochiral {rfx037 plus vegf-a} protein complex in space group p21
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
63
structure length
63
Chain Sequence
RRGGSTYKLILNGKTLKGETTTEAVDVFDAFDVFFVYAASNFSDFDDWTYDDATKTFTVTEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vascular endothelial growth factor A
publication title A Potent d-Protein Antagonist of VEGF-A is Nonimmunogenic, Metabolically Stable, and Longer-Circulating in Vivo.
pubmed doi rcsb
molecule tags De novo protein
total genus 16
structure length 63
sequence length 63
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hhdG00
5BMHA 2IGGA 2KACA 2JZPA 1EM7A 1ZXHA 2RMMA 2N9LA 3GB1A 1XCTL 1HEZE 1KH0A 2PW9A 2ON8A 2QMTA 1YMHE 2LUMA 5JXVA 2PLPA 4KGTA 2K0PA 2IGDA 2JWUA 4MACA 1P7EA 2N9KA 2GI9A 2N7JA 2I2YA 3V3XA 2KWDA 1GB1A 1C9FA 2I38A 1K51A 5HFYA 2EELA 1PGAA 3FILB 1K52A 1MHXA 2KQ4X 1F2RI 2ONQA 2NMQA 1HZ5A 2KN4A 5HG2A 2ZW0A 1FD6A 2GB1A 4KGSA 5HHDG 1IGCA 5BMGA 2LHDA 4HKZE 2JXTA 1P7FA 1FCLA 1PGXA 2PTLA 1MHHE 1MPEA 3FILA 1PGBA 1MVKA 2J52A 2QSDA 1K53A 4KGRA 1QKZA 1UWXA 4D2KA 2J53A 1IGDA 1GB4A 2KDMA 5BMIA 3UI3A 1D4BA 4WH4A 1Q10A 1YNTE 2LHEA 1IBXB 4HJGE 3MP9A 1K50A 1HZ6A 2RPVA 2ZW1A 4OZAA 1JMLA 4IKGA 4IOIE 1FCCC 4OZBA 2JU6X 2LGIA 4OZCA 2OEDA 1MI0A 4GLSC 2JSVX 1IBXA 2IGHA 5HI1A 1F2RC 1XCQL 1XF5L
chains in the Genus database with same CATH superfamily
3KWLA 1EU4A 2MJ3A 3O13A 5FKAC 4KIKB 2M4NA 1FIQA 3CSTA 2EKIA 1TY2A 2XEWA 3KQ4A 2MWSB 3ENEA 2PLPA 1SE9A 4FJZA 1WX8A 2LMCA 4ZYNA 1R7SA 4ZRPA 3L16A 3N30A 2D2QA 2C9WB 4EZJA 2Y5PA 3OLMD 2G1EA 5EE3A 3AEGB 1GOZA 1WYWB 2CKHB 2HTME 3AE9B 1VR9A 2BKFA 3ZQ4A 4W9JA 1FD6A 4XC2A 2VZKD 1Z2MA 4IWOA 5AZHA 5DPWA 4N58A 2Z59B 3AECB 3U8ZA 5BMGA 4GXBA 3GZNI 2ZPYA 2FCQA 2KTFA 3N9YC 2WXKA 3L10B 1PGBA 2AQ1B 4MJSA 4HRSA 2A5UA 2DZKA 2DBYA 3MC0B 2QSDA 3R3MA 1WXQA 3TMPB 1UBIA 4NAWB 1VCBA 3I57A 4PS3A 3DCGA 1I4XA 1IGDA 4YXDB 4YTMB 2FAZA 1S3SG 3RPFC 3TJPA 3VUXA 1JWSD 3WA0A 1PUTA 3MJ5A 1J0GA 1P3QU 1E0ZA 4X57B 2FCNA 2IY0B 5C2TB 1V1OA 4RFBA 1FXIA 3R8BA 2DX5B 2KMCA 4GDKA 1V5OA 1I42A 1SJED 2MSED 1R4MB 1MI0A 1C76A 3H8HA 4K3CA 2NS5A 2C7MB 5FK9C 1F2RC 2NBWB 3ABVB 1XCQL 1WYGA 3RYTA 1JWMD 1YJJA 1KOTA 2M56B 1C77A 4NJCA 2RMMA 3QX1A 3HHMA 2B76B 2I1JA 2PW9A 4K1RB 1FNWA 1OFFA 4RM9A 4RGTA 5LXIB 3AEEB 2K5PA 2LXAA 1YN3A 5AZGA 1GUAB 3DWGC 4F8CB 2CR5A 4C4VA 2QC8A 4BZAA 3AMZA 2KWDA 3EFCA 3NG0A 2BYFA 3DBSA 3PRMB 3U2SC 3Q3FA 1ZE3D 3OAWA 1KLVA 2PMVA 1X1MA 2GB1A 2RSUA 4HCPB 4IC7B 1WRIA 1HQRD 2W82A 1EO6A 4LDTB 3Q3OC 2QEJC 3ML8A 3WANA 5C23A 4ICUA 1E7PB 2KLCA 5T8IA 3NVYA 3W5UB 2KD0A 2UYZB 1I4HA 3VUYA 2N4FA 4DHZB 3UINB 4EUTA 3AULA 1C1YB 4GDLB 4NY0A 3URYA 4E3CA 2KWUB 1I35A 1SEBD 4HKQA 3RN9C 4NJ6A 3DPDA 1DOYA 2SEBD 1SE2A 3BWUD 1V8CA 2N7EA 5E6OA 1UGJA 2KJHB 1WXAA 2KFKA 4OZBA 4FJVB 2PE9A 3ETRA 3FAHA 2L00B 1I7HA 4A3OA 4FN2A 1IYFA 3A1QB 3AEDB 2UU7A 3ZLZA 4N9F4 3UGBB 4PK1A 2HTHA 3AEBB 4M02A 3MFGA 5TR5A 5IKCM 1CZPA 3RNFC 3GE3C 2MBHA 2KFJA 2SAKA 1ZXHA 3Q69A 4K7UA 2BS3B 3ZYYX 2GOWA 4JL9A 1UF0A 3SU8X 3R7RA 2D5GA 2MHJA 2LUMA 2V3PA 2K0PA 2BYEA 3Q3MC 4A3PA 3W5VB 2N7JA 3V3XA 1FRDA 3LJ3A 3CWIA 1GB1A 2BB5A 3VRBB 3TUOA 3H6NA 4OVVA 4BBNC 5GMVA 4RMAA 2REXA 4GU2A 1BT0A 1E10A 4W9FA 4XGAB 4ANUA 1OQQA 1ET6A 4ANWA 1J7BA 3PHXB 3V62A 1FFUA 2OJRA 1V97A 3VTWA 3Q8BA 3IG3A 2QCZA 1PGXA 1V1PA 2VZKB 3N32A 3Q8CA 4MH8A 2J52A 1YOVB 2AWTA 3SFEB 4LNKA 2M1MA 4MSQB 2TSSA 3O65B 1N60A 1GB4A 4XWWA 4KKJA 4LNNA 2W3SA 4OHJA 2DLBA 2W3RA 2W54A 3DQVA 2ZCCA 4ZDVA 2KO3A 1P98A 1JRPA 2WXHA 3KUZA 2B3AA 2W55A 4US9A 4AP4C 1KFYB 3I63C 3IAS1 5LLIA 2D3GA 1F0ZA 1TIFA 1GG3A 4WQMA 3W1SA 4DXFA 4PYZA 5KHQA 3PZDA 5G55A 4M00A 4DWFA 3HM3A 4BVUC 3P63A 5EE1A 4K3BA 3ONSA 4URKA 1YMHE 4PYUA 2YVCA 4P16A 1XEEA 4TQ0A 4AJYB 1J7AA 5D7GA 2IZVB 3EC8A 4S0RA 1LQBA 1VZ6A 1C9FA 2I38A 3H7SA 4ITKA 1PGAA 2VRRB 1MHXA 1UWMA 2ONQA 1QZEA 3S2AA 3PLVA 4A6QA 1XLNA 4IDIA 4WAAA 1WZ0A 3TBLD 1GC6A 3AXCA 2DNFA 4N59A 3H7PA 3Q8FA 2C60A 1YX6B 1R4NI 2G3QB 3OJ4B 3HIZA 2PJHA 1K53A 3QHTA 3X23A 2JF5A 4QAYA 2BW2A 2MJDA 3LB8C 3C8YA 1UELA 1TYGB 3ZVVA 4MGKE 2RPQA 3JSVB 2JRHA 1WGYA 1IBXB 4FBJB 4ARIA 2EMSA 1HZ6A 4HROA 2FIFA 3Q3JA 3A9JB 1RRBA 4OZAA 1UZXB 1H4RA 5G5GA 3DVGX 1L0XB 3R66C 2WYQA 2OEDA 1N5WA 4HPPA 2DWQA 3SR6A 3TCAA 1T0QC 5TSSA 3RNBC 2LVPA 1YD8U 3AE7B 2KN5A 5JHAA 3QARA 3C19A 4GB9A 3W2DA 1Z5SB 4LNOA 2LWPA 4J6IA 4W9HA 2DZMA 2ZZPB 4M0WA 4DDGD 1SJHD 2DZJA 1T0SC 2JWUA 2MCNB 3WALA 2PKOA 3ZTDA 3T9LA 2BBCA 3ZJTA 2MP2A 1T3QA 2L8JA 4E74A 3R7QA 1V5TA 1WE6A 3DBHI 3M63B 4P6VF 1YQBA 1K51A 3EGRA 2EELA 1Y8RC 3M62B 1JQ4A 1JRUA 4MT5A 4C80A 4JX1C 1E7UA 3RD2A 4WAFA 1S1QB 3DHIC 2H88B 2KYWA 3DHHC 1E7VA 2KWCA 3BYYB 1ZKHA 4DHJD 2CJOA 4FLHA 3DVNU 4FJYA 5MPOA 4AWJA 3P2BA 1VJKA 2WXRA 2K9XA 3WCQA 3BIID 4RNAA 4R3DA 2J53A 4WURA 4RGOS 3ZO5B 3HVDA 5BMIA 4WQOB 2O6VA 1WJ4A 2XK5B 2VH1A 2HE7A 4NAMA 2C7NB 4IKGA 3SD5A 3HK0A 1SIJA 2MA9B 2DZIA 3WIMA 2Y5CA 3GP7A 3V05A 1JALA 2WLBA 4RH6A 1SE3A 4DHZE 5JH5C 5HI1A 2LD9A 2MX2A 4YWGG 3PS6A 2L05A 1NENB 3K9PB 2BWES 4JWUC 2DAJA 2IO0B 2DYMA 4AQ7A 2BGFA 1E8YA 2M17A 3ZXVA 2KVRA 2Y5BB 5JXVA 1RFKA 1P7EA 3B2FA 3K9OB 3DBRI 1YQ4B 2O2VA 2HJ8A 3L54A 1L4DB 3EA6A 1L6UA 3RUIB 2FUHB 5H92C 5HFYA 2EKEC 3QK0A 2KTRA 2NMQA 1HZ5A 3NY5A 3PO0A 1D5MC 4XDCA 1WGKA 2AQ2B 1J8CA 2ZW0A 3X0WA 2M8SA 2K39A 1V6EA 3MHSD 4LNFA 1F1HA 3NS8A 4AOFA 1U4AA 4HKZE 1P7FA 3NZ3A 4TSSA 3L08A 2KJ6A 1SE4A 3KLSX 3SFDB 3MJWA 5IA7A 4W9DA 4G0NB 3UIPB 1WJUA 2W9NA 4PS7A 4BOZB 1Q10A 4HDQA 2WX1A 3PTFC 3DBHB 1A5RA 4MELA 3KWVA 3L13A 1TKEA 3TEZA 3RZFA 2KMMA 2BVCA 3Q2AC 3KH0A 3AU4A 2KC2A 4KSKC 4C7ZA 4TMAB 4N6EB 2MRPA 2WDTB 1XQQA 2INDC 1ENFA 4XE0A 5J17A 2CHXA 5CHFA 3APCA 1V86A 3PV1A 4ANXA 1F9JA 3EFUA 3V6CB 5G2NA 2J0KA 2IY1B 1ZPSA 2AL3A 2CU1A 3ZXRA 4WWMA 2RDHA 1MJDA 5KHOA 4O1NA 3U52E 1E8XA 2DENB 2ZPNA 2BB6A 4LCDE 1XCTL 3L4PA 3KW5B 1KH0A 1B9RA 4GIVA 2ON8A 1E6EB 2IO2B 3E56A 1E8ZA 1PDXA 4HVBA 4C00A 1QILA 1M94A 4HDOA 2GI9A 3AE1B 4WJPA 2I2YA 1AYFA 2MBOA 4K81A 2V4IB 3ZTCA 2ZCBA 3BVZA 3MTNB 4JPSA 4WJQA 3VTUA 4J3OD 3B08A 2NBVB 2WHIA 1NI3A 1ESFA 2LGYA 4KGSA 2CS4A 2NR2A 2WXGA 5BO4B 5CTRC 4G3XB 4W9KA 5DPSA 2KDFB 1WXVA 3FILA 3QWZB 4A55A 3BYTB 4KDIC 4HK2A 2WX0A 4DHJB 2CHZA 3DBRB 1VRAB 4P7IA 5DPTA 4TQ1A 1XO3A 3VR8B 4WIPA 4F7ZA 3PREA 3UIOB 2WGSA 1KLGD 1TS5A 3Q3NC 5H8YE 3PT2B 5D3DA 1Q0WB 2NPTA 1WR6E 1N63A 1N61A 4GGQA 3U4EG 1J7CA 3N1XC 2FE8A 2KJRA 2V3SA 1QOGA 1VLBA 1V81A 2L7RA 4B0EA 4Q2JA 5CHWA 5LNK1 3VR9B 2PPHA 4KKIA 2MH7A 2RGFA 2DYBA 2PE6B 3ZDTA 2K22A 1T5XD 1WSPA 3GZNB 3ECIA 4EOYA 3PSEB 1BXTA 4II2B 1EWCA 3W1YA 4HPLB 3H1UA 4KIKA 2E3TA 1WFYA 2IO3B 2VH2A 2LVQA 1PQSA 4I6PA 1KF6B 2INNE 4AS1A 5I4DA 2KN4A 3ZNZB 3VDZA 2DYOA 3RT3B 1WMHB 2L32A 2WP9B 2AL6A 4HCNB 4BOSC 3DVNV 2PTLA 5AUKA 2WS3B 2M19A 1JWUD 3Q6BA 4ZRQA 1SGHA 1UWXA 4EFOA 2BPSA 4ZRIA 5FR3A 3I3TB 1WXMA 4MGZE 3RULA 3RCZA 2BS4B 4OVUA 1KM7A 3NS1A 4FHKA 1QQRA 3A33B 4IWPA 5HKHA 1NEKB 2NBUA 4NAWA 4K7WA 2N1VA 4KVGB 4NQKE 2LGXA 2JU6X 1TS2A 2XN9C 3AH7A 4LJOB 2NCNA 4GLSC 2IJ0A 3PGEA 2KX3A 1TKGA 1LM8B 2AYOB 2MJEA 3BK1A 4FXCA 2I1KA 4YT0B 1WM2A 2KKCA 4YTNB 1WX9A 1HTQA 2JPHA 1NBFC 2D3AA 1HEZE 1FMAD 2Z0EB 3VHTC 3VUWA 1RWSA 3ZNGC 2ASQA 4E71A 1JWAD 5IO9A 3FKYA 3LYYA 2WXMA 3AE6B 3U7ZA 4BKSA 3B9JA 3B0AA 5CHVC 1I4GA 1OTRB 2K8BA 2N9XA 1C79A 4MDKE 1CK1A 4ICVA 1F2RI 2ZVNA 3BVGA 4NZLB 4GN1A 2KDEB 4MGYE 3ZGZA 3H9DA 5HHDG 2FCMA 4ZRKA 5AUIA 3AE5B 3APFA 5BYSA 2IPKD 1TS3A 1AARA 2GBRA 4IM0A 4EZLA 2G4SA 4IWQA 3A9KB 1I4QA 4G11A 3TEXA 5JZEB 3BK2A 3PRPB 3NVVA 4B0MA 4RGMA 1WH3A 5C3JB 2J42A 4II3B 4S17A 3PHWB 4ZHOA 1YNTE 1L2NA 3NJTA 4B6WA 1FPYA 5IAAC 1WX7A 4MM3B 1MFWA 4US8A 2O2VB 3TL5A 4JQWC 4YSZB 1YIWA 3LXFA 2JZZA 4DXAB 4OZCA 3DBLI 4GDLA 3EECA 4LLGM 3SEBA 4KDLB 1P9DU 1C4CA 3RMKC 4M01A 2ACZB 1E8WA 4L1BA 2FUG1 3EHVA 3RI7C 3R2TA 2KAJA 2D3BA 2KXJA 1QOFA 3Q14C 2N9LA 3GB1A 2N9PC 2JRIB 3OJ3A 4WWNA 2JYEA 3A1QA 3VVWB 3TEWA 3QJZA 1ZGUB 2NTSA 3UF8A 3B2GA 4IW0A 3UQAA 2WNMA 3IXSA 2KMAA 4PT5A 3AE3B 2MBBB 1CMXB 1KLUD 5D3IB 4BKTA 1TT5B 1UH6A 4MJSB 3RNCC 3WAMA 3PLUA 1QLBB 3IFWB 3TIXA 1XLPA 2JZ3B 4USAA 1FRRA 1GJZA 5GXGB 4HWIB 3AU5A 1D5ZC 1GAQB 4A9AA 4JLCA 2V9HA 1C4PA 3RNGC 1NYRA 3FC4A 3WAOA 2R61A 1KTKA 1ZUD2 2BWFA 4GMVA 3TEYA 1V9JA 4GDKB 1ZDVA 2GBKA 2ICIA 2CJNA 3P4PB 2ZVOA 5E6JA 2LRWA 4ACFA 1QOBA 2RPVA 4A8XC 2LI5A 2LZ6A 4XX5A 2LUEA 1DYQA 1F77A 1YN4A 2WXFA 1WE7A 2ZEQA 2IGHA 3U30A 2L1AA 1XF5L 3AEAB 1AW7A 2IGGA 4P1BC 3WAPA 2R2QA 3DVGY 2L0FA 3LDZE 2XBBC 4C4VB 2ZJDA 4HXDA 3BVMA 3VH3B 1B1ZA 3MHZA 1WRDB 2QMTA 3ZJVA 1WJ6A 1HA5A 2IGDA 3Q8AA 1R4NB 1R4MI 2FNJB 2V3NA 1NI2A 3AV8A 3BINA 1FM0D 3RNAC 1WWTA 2H89B 1MG4A 4XWTA 2NVUI 1ET9A 3CMMB 3JVZX 2JY6A 3ZNID 1DGJA 1OQYA 1UNSA 5LXHA 4RF0A 1TY0A 1NVID 2LGDA 5E6NA 4W9LA 1WJNA 1MG8A 1XT9B 4RCOA 1P1AA 1SB3C 4ANVA 2KOXA 4DK5A 3TSSA 3KYCD 1C3TA 2WXIA 1I4RA 2R2OA 4KGRA 1SIFA 2KFKB 3BY4B 2KDMA 3DOWA 1WGDA 2GLSA 2WU5B 4HJGE 1FXTB 3AE8B 1JROA 3DWMA 2MBQA 1TZOA 3IHPC 4FA6A 1V80A 3P4QB 5D6JB 3N3KB 3IT4B 4RM8A 5BYQA 2KX0A 1EU3A 2HJ1A 3JSVA 1IBXA 1OEYJ 2YEPF 1PFDA 2K8CA 1HE8A 5AEKB 3KYDD 2MLBA 3NOBA 1EF5A 3A9JA 4CQNA 5EE9A 3OG5A 2KVZA 2CHWA 2QJLA 2GBMA 1ISNA 4ZOHC 4HEA1 2KNBA 3NVWA 2RR9A 3Q8EA 2LRUA 1FEHA 1RFAA 2WDRB 1E5WA 3ZNHB 2INPE 3C0RB 2JWZA 5L95C 2GBJA 2GBNA 3QCAA 2KC1A 3GE8C 4FULA 3A4SC 1STEA 1V49A 4YSXB 2MEKA 5G5HA 3I9V1 5DPRA 1V1PB 2KQ4X 1HXYD 4BAXA 3SHQA 1N62A 2AEHA 2N0SB 1LXDA 2K25A 4REZA 1QT9A 5HG2A 4NQLB 2O6VD 4FHJA 1H8CA 2J0MA 4EE2A 4YL8A 2GMIC 4W9CA 1E90A 1IGCA 1EWYC 3MC9A 2EMTA 2Y3AA 2JXTA 3L0WB 2GRIA 3ALBA 3DDCB 4WJNA 4EZKA 2OJWA 4KZCA 2D3CA 1SBBB 2JT4B 2WDVB 2X8XX 1YJIA 4LK0M 3T3OA 4P1CC 1ZP0B 2E6XA 2PIAA 2BQQA 2M0XA 4OW0A 2IBIB 2L83A 3VRAB 3VFKA 3KVFB 1KRHA 3ZKJC 4IOIE 1FCCC 2N9EB 4BFRA 4C56C 5D2MB 2ZNVB 2WXNA 5EE0A 4C7YA 2WXLA 2JSVX 3ZRFA 3PZ7A 4ZHPA 3AM9A 2XK5A 1AN8A 1C78A 3T8MA 4IUMB 4JWSC 3V6EB 4DQOC 4LTUA 2HDEA 1K8RB 1I4PA 3P4SB 2KWVB 3U7DA 1XXGA 4TV3A 1T6BX 1M4VA 2RDGA 4YSYB 1Y56A 1L7YA 4DBGA 2N9KA 2QHOA 2K6DB 3HVZA 3ZRCA 2YLMA 1QF6A 4FADA 1ZDXA 3AI5A 2JUOA 3H7PB 4IM2A 1RYJA 4ZRJA 2LGSA 2DAFA 2INCC 2WXQA 4AUQC 1CQVA 2AX5A 2PVOD 1EF1A 1K52A 1A70A 3M3JA 1T0RC 3P1MA 1WGRA 5IN7A 4XZ4A 3HM6X 1CJEA 3NUHB 4LNIA 1N5XA 4A90A 4LJPB 4KX6B 2KDBA 1WXSA 2C5LC 2YEPB 2Z8LA 1SF0A 4IG7B 2LEKA 1QKZA 2DHZA 5JHBA 2FCSA 1WGHA 4G50A 2N1WA 3AE4B 4WH4A 2LHEA 1L4ZB 1WIAA 3VQIA 2K6QA 4TKNA 1YX5B 4HJKA 4M8NA 1WY8A 2D07B 2BKRB 4A20A 4JGHB 2KDIA 4OVZA 4WJOA 2UWQA 2QIEB 2D10A 4M0WB 4MH0E 3UQBA 1ZXIA 3IBEA 3PVLA 1L5PA 3NHEB 2FIDA 4K7SA 4L2YA 1TS4A 3AEFB 2MP2B 3R2IA 3JW0X 3CIRB 1YQ3B 2V0GA 1GNUA 3P42A 4RF1A 1AWDA 1V2YA 2K1FA 5CX3A 4F1SA 1WZ3A 4MACA 2N7DA 2BT6A 4TUUA 1OEYA 2XNAC 2J4XA 1BMLC 5EDSA 2BS2B 1XLQA 1UUPA 4CHKA 2KZRA 1WF9A 4B9KA 2V1YA 2LJIA 3GS2A 3KUCB 5IP4D 3VXWA 1TJEA 2FBWB 4CO7A 4EEWA 1HTOA 4WWOA 2LXCA 2LFIA 1ZOYB 1FO4A 3NZUA 1WGGA 2LHDA 2RD0A 2G4DB 2O6VB 2CU3A 2BTEA 3V60A 4MGIE 3P4RB 1RAXA 2WXJA 3BZDB 3RFZB 3NRZA 5J2RA 3VAWA 1T0YA 3W1SC 4D2KA 3ZW3A 4DDID 3N1ZC 2BF8B 1LGRA 1QOAA 1VZ7A 3AN1A 4NNJB 3QIJA 5FR6A 1ROEA 3MP9A 3QQ8B 2JYTA 2WDQB 2JVCA 2ZNVC 1F52A 4WWPA 3RNEC 4IM3A 1P0RA 2JXXA 1JMLA 1IPGA 1SSNA 2KQSA 1RM6C 4PS8A 2IYDB 2A4ZA 1BUIC 3L17A 2AQ3B 3OWEB 1TTNA 1OQRA 3N20C 2QILA 2G9HD 3QA8A 2JQRB 3ZIMA 4EKUA 2G45B 3DHGC 3ML9A 1YN5A 4UDUC 4ASWC 4ARCA 1PYWD 1UD7A 5IOIA 1TZ1A 2K3UA 2J7QB 3QAQA 1DOXA 1GPXA 1OGWA 2KTRB 2KLGA 3ZDMC 3IAM1 4YTPB 5BYRA 1Q5WB 3D32A 2J0JA 2KT7A 1KJTA 4M8MA 4NPNA 1YJ1A 3RZWC 1FFVA 1NYQA 5J18A 2WU2B 1RLFA 2OHFA 2LVOA 1L6VA 3QC8B 2IO1B 4KV2A 3VH4B 2IDYA 2Z0DB 1ACCA 1VZ8A 4I6LB 2PVGC 3CF6E 1WR1A 1FCLA 2WXOA 3VTVA 1MHHE 2V4LA 3A4RA 1Q1OA 4MEMA 2LJ5A 3T3NA 3PPAA 3NZSA 3AB5A 3J9CA 2D11A 4H2AA 1XD3B 1WMHA 1E9MA 3UI3A 1D4BA 2K8HA 3B1LX 4JIOU 1G6JA 2HD5B 2L76A 1WI0A 1XLOA 4JE3B 4HLEA 3KUDB 4BBNF 1FXAA 3APDA 4MSMB 5DCNA 3E9SA 3AE2B 3HUIA 2KHWB 1GC7A 2BYTA 1D5XC 3W9CB 3I5JC 4AJWA 4CYEA 4B95A 4BKSD 2MW5A 1SXTA 2KQ7A 1J19A 5BMHA 2KACA 3JYUA 4I6NB 2JZPA 1EM7A 2RDBC 4W9GA 1JWBD 5D94A 2M0AA 4DXGA 1NDDA 3SDLC 1WM3A 1C4AA 3EUB2 4HPMB 5E6PA 3IT6B 4KGTA 1L0VB 1JCKB 2C7HA 2KK8A 2MBEA 3V61A 4W9EA 2PEAA 1FNVA 5L83A 1D3ZA 3CSFA 3PRZA 4L23A 4GOCA 3M95A 3FILB 2JX5A 1TGZB 1LO5D 3ZJUA 3MC8A 1L0YB 3N1YC 2WQYB 2X38A 4GSWA 4LDTD 1TKYA 1IP9A 4ZYSA 3IVFA 1TBEA 2L52A 3PZ8A 4KZ0A 4KSLC 4XDDA 2BYVE 1DOIA 1MPEA 2Q5WD 1JW9D 3DBLB 2NTTA 1MVKA 1EUVB 2WWZA 2NPTB 2L0TA 1VDVA 1FNUA 5C1ZA 1LFDA 4XYCA 4BKGA 2WXPA 1IUEA 1K50A 2OOBB 3A9KA 5AZFA 2ZW1A 1UGMA 3HRDD 2LASA 3ZUNA 1D6EC 1N6ZA 1ZW7A 2LGIA 2MQJA 4W9IA 1VD2A 2QDFA 3NVZA 2KANA 4RGNA 1UBQA 2L3ZA 3GOEA 4NJ7A 4MM3A
chains in the Genus database with same CATH topology
5TSSA 1AN8A 1TKGA 1C78A 3KWLA 1EU4A 2MJEA 3AE7B 3BK1A 4FXCA 4JWSC 2MJ3A 4YT0B 4YTNB 4DQOC 4LTUA 2HDEA 3O13A 5FKAC 1FIQA 2EKIA 3W2DA 1I4PA 1TY2A 3KQ4A 1HEZE 3P4SB 1XXGA 1FMAD 1T6BX 1M4VA 1RWSA 2RDGA 4M0WA 1JWAD 2PLPA 4YSYB 1SJHD 1Y56A 2JWUA 2LMCA 2PKOA 1R7SA 2N9KA 3LYYA 2BBCA 3HVZA 3ZJTA 2WXMA 3AE6B 4ZRPA 1T3QA 3U7ZA 1QF6A 1ZDXA 3B9JA 1RYJA 2Y5PA 1I4GA 4P6VF 2G1EA 2WXQA 1K51A 3EGRA 2EELA 5EE3A 3AEGB 1C79A 1GOZA 1JQ4A 1CQVA 2AX5A 2PVOD 4MT5A 4C80A 1K52A 4JX1C 1A70A 1CK1A 1F2RI 2HTME 3BVGA 3AE9B 1VR9A 4NZLB 3P1MA 4WAFA 3ZQ4A 3ZGZA 1FD6A 1CJEA 2H88B 3NUHB 2VZKD 5HHDG 4N58A 3BYYB 5AUIA 3AE5B 5BYSA 3AECB 2IPKD 5BMGA 1TS3A 1N5XA 3N9YC 4A90A 2WXKA 2CJOA 4KX6B 1PGBA 1I4QA 2AQ1B 4HRSA 3TEXA 3BK2A 2YEPB 2DBYA 2Z8LA 5MPOA 1SF0A 3NVVA 3MC0B 1VJKA 2QSDA 2WXRA 2K9XA 2LEKA 1QKZA 1WXQA 3WCQA 3BIID 4RNAA 4NAWB 4B0MA 4RGMA 4R3DA 5C3JB 3I57A 2J53A 2J42A 4WURA 1I4XA 1IGDA 4RGOS 3HVDA 5BMIA 3AE4B 4YXDB 4ZHOA 4WH4A 4YTMB 3RPFC 1JWSD 1YNTE 1PUTA 2LHEA 1L4ZB 3MJ5A 3VQIA 4MM3B 1E0ZA 4US8A 4NAMA 5C2TB 1V1OA 4IKGA 4RFBA 4YSZB 1FXIA 3LXFA 3R8BA 1SIJA 4OZCA 1SJED 2Y5CA 3GP7A 4LLGM 3SEBA 3V05A 1JALA 1MI0A 2WLBA 4RH6A 1C76A 3H8HA 1C4CA 1SE3A 4OVZA 5FK9C 2QIEB 5HI1A 1F2RC 3ABVB 1ZXIA 1XCQL 1L5PA 1WYGA 4YWGG 2ACZB 4L1BA 1JWMD 1YJJA 1NENB 4L2YA 1TS4A 2FUG1 3AEFB 2M56B 3R2IA 3R2TA 2KAJA 4JWUC 1C77A 4NJCA 2DYMA 2RMMA 3CIRB 4AQ7A 1QOFA 1YQ3B 2N9LA 3GB1A 3P42A 2B76B 4RF1A 2V0GA 1AWDA 2PW9A 1FNWA 1OFFA 2JYEA 4RGTA 3TEWA 5JXVA 3AEEB 2NTSA 2K5PA 3B2GA 4MACA 1YN3A 1RFKA 1P7EA 2WNMA 3B2FA 3IXSA 4PT5A 3AE3B 2BT6A 3DWGC 2XNAC 2J4XA 1BMLC 1YQ4B 2BS2B 1KLUD 1XLQA 5D3IB 1UUPA 3AMZA 2KWDA 1L4DB 3EA6A 1L6UA 5HFYA 5H92C 2LJIA 1QLBB 3GS2A 3U2SC 1ZE3D 2NMQA 1TJEA 1HZ5A 1XLPA 2FBWB 3PO0A 1D5MC 1FRRA 1WGKA 2AQ2B 4XDCA 4USAA 2ZW0A 2PMVA 5GXGB 2GB1A 2LFIA 1D5ZC 1WRIA 1ZOYB 1GAQB 1HQRD 2W82A 4A9AA 1FO4A 2LHDA 4HKZE 1P7FA 1C4PA 2CU3A 2QEJC 3NZ3A 4TSSA 2BTEA 1NYRA 3FC4A 1E7PB 5T8IA 3P4RB 2R61A 3NVYA 1KTKA 3W5UB 2WXJA 1I4HA 1SE4A 1ZUD2 3BZDB 3NRZA 3RFZB 3KLSX 3SFDB 3TEYA 4GDKB 4D2KA 1ZDVA 2ICIA 2CJNA 3P4PB 1QOAA 4GDLB 3URYA 1VZ7A 3AN1A 1Q10A 5E6JA 1SEBD 1ROEA 3MP9A 2JYTA 4HKQA 1QOBA 2WDQB 1DOYA 2SEBD 2RPVA 3KWVA 1TKEA 1SE2A 3BWUD 1V8CA 3TEZA 2KMMA 1UGJA 4A8XC 1JMLA 1SSNA 4OZBA 1RM6C 3ETRA 3FAHA 4C7ZA 4TMAB 1DYQA 1BUIC 4N6EB 2AQ3B 3OWEB 1F77A 1OQRA 1ENFA 1YN4A 1I7HA 2WXFA 4XE0A 2QILA 2IGHA 3AEDB 2G9HD 2L1AA 2JQRB 1ZPSA 1XF5L 3AEBB 3MFGA 3AEAB 4WWMA 2RDHA 1AW7A 1CZPA 2IGGA 1YN5A 2SAKA 1ZXHA 3Q69A 4O1NA 3U52E 4UDUC 2BB6A 2BS3B 3ZYYX 1XCTL 3BVMA 3L4PA 4ARCA 1KH0A 1PYWD 1B1ZA 1B9RA 2ON8A 3MHZA 2D5GA 2QMTA 3ZJVA 2K3UA 1HA5A 2LUMA 1DOXA 1GPXA 2V3PA 1E6EB 3E56A 2K0PA 1PDXA 2IGDA 3Q8AA 1QILA 3IAM1 2V3NA 3AV8A 3W5VB 1FM0D 4YTPB 5BYRA 2GI9A 3AE1B 2N7JA 2I2YA 3V3XA 1AYFA 1FRDA 1WWTA 2H89B 3CWIA 4XWTA 1GB1A 2BB5A 2V4IB 3VRBB 1ET9A 3BVZA 4JPSA 3TUOA 4J3OD 1DGJA 1UNSA 1FFVA 1NYQA 4RF0A 1NI3A 1TY0A 1E10A 2WU2B 1NVID 2OHFA 1ESFA 1OQQA 1ET6A 1L6VA 2IDYA 4KGSA 1J7BA 4RCOA 2WXGA 1FFUA 1ACCA 1SB3C 1VZ8A 1V97A 3Q8BA 2PVGC 1FCLA 2WXOA 3TSSA 1PGXA 1V1PA 1MHHE 3FILA 2WXIA 2VZKB 3Q8CA 1I4RA 4MH8A 4A55A 2J52A 3BYTB 3SFEB 4KGRA 3T3NA 3AB5A 3J9CA 2TSSA 4H2AA 1N60A 1GB4A 2KDMA 4XWWA 1VRAB 3UI3A 1E9MA 1D4BA 4TQ1A 1XO3A 4KKJA 2WU5B 4HJGE 3VR8B 2W3SA 3AE8B 1JROA 2DLBA 3DWMA 4OHJA 1TZOA 1XLOA 4JE3B 2W3RA 4WIPA 3P4QB 2W54A 3IT4B 1FXAA 1KLGD 1TS5A 3E9SA 1JRPA 2WXHA 5D3DA 3AE2B 5H8YE 3HUIA 2W55A 5BYQA 4US9A 1N63A 1KFYB 1N61A 1EU3A 3IAS1 1IBXA 2YEPF 1F0ZA 1PFDA 3U4EG 1D5XC 1J7CA 2BYTA 2FE8A 4WQMA 3W1SA 3W9CB 4DXFA 1QOGA 1SXTA 4CQNA 1VLBA 5EE9A 2QJLA 5BMHA 4B0EA 2KACA 4ZOHC 2JZPA 4Q2JA 1EM7A 4HEA1 3NVWA 5LNK1 3Q8EA 1JWBD 1FEHA 4KKIA 3VR9B 2WDRB 3P63A 2MH7A 2M0AA 4DXGA 1C4AA 5EE1A 3EUB2 2K22A 1YMHE 1T5XD 3IT6B 1WSPA 2INPE 1L0VB 4KGTA 1JCKB 4P16A 1XEEA 4TQ0A 1J7AA 5D7GA 1BXTA 1EWCA 1STEA 2E3TA 1FNVA 4YSXB 2MEKA 4L23A 1VZ6A 5G5HA 1C9FA 2I38A 3I9V1 4ITKA 1PGAA 1V1PB 3FILB 2JX5A 1LO5D 1MHXA 1UWMA 2KQ4X 3ZJUA 1HXYD 1N62A 2ONQA 1KF6B 1L0YB 2N0SB 2INNE 2WQYB 4AS1A 4REZA 5I4DA 1QT9A 2KN4A 5HG2A 4A6QA 2DYOA 2X38A 1XLNA 4IDIA 1TKYA 4EE2A 4ZYSA 4N59A 3Q8FA 2L32A 1IGCA 1EWYC 2L52A 2WP9B 2Y3AA 2JXTA 3PZ8A 4XDDA 2GRIA 1DOIA 2PTLA 1MPEA 2Q5WD 5AUKA 1JW9D 2WS3B 2M19A 2NTTA 1MVKA 1JWUD 1K53A 1SBBB 2BW2A 2WDVB 1YJIA 2MJDA 4ZRQA 1UWXA 4LK0M 3LB8C 3C8YA 3T3OA 1VDVA 1FNUA 5FR3A 1TYGB 1ZP0B 2WXPA 1IBXB 2E6XA 2PIAA 1IUEA 2BS4B 1K50A 4ARIA 1HZ6A 3NS1A 4HROA 4OW0A 1QQRA 2L83A 2ZW1A 3VRAB 4OZAA 1KRHA 3HRDD 1NEKB 5G5GA 4IOIE 1FCCC 1D6EC 1L0XB 4C56C 2JU6X 2LGIA 1TS2A 2XN9C 3AH7A 2WXNA 5EE0A 4C7YA 2WXLA 2OEDA 4GLSC 2JSVX 1N5WA 2IJ0A 3NVZA 3PZ7A 2DWQA 4ZHPA 4RGNA 3AM9A 3SR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMH A;  2IGG A;  2KAC A;  2JZP A;  1EM7 A;  1ZXH A;  2RMM A;  2N9L A;  3GB1 A;  1XCT L;  1HEZ E;  1KH0 A;  2PW9 A;  2ON8 A;  2QMT A;  1YMH E;  2LUM A;  5JXV A;  2PLP A;  4KGT A;  2K0P A;  2IGD A;  2JWU A;  4MAC A;  1P7E A;  2N9K A;  2GI9 A;  2N7J A;  2I2Y A;  3V3X A;  2KWD A;  1GB1 A;  1C9F A;  2I38 A;  1K51 A;  5HFY A;  2EEL A;  1PGA A;  3FIL B;  1K52 A;  1MHX A;  2KQ4 X;  1F2R I;  2ONQ A;  2NMQ A;  1HZ5 A;  2KN4 A;  5HG2 A;  2ZW0 A;  1FD6 A;  2GB1 A;  4KGS A;  5HHD G;  1IGC A;  5BMG A;  2LHD A;  4HKZ E;  2JXT A;  1P7F A;  1FCL A;  1PGX A;  2PTL A;  1MHH E;  1MPE A;  3FIL A;  1PGB A;  1MVK A;  2J52 A;  2QSD A;  1K53 A;  4KGR A;  1QKZ A;  1UWX A;  4D2K A;  2J53 A;  1IGD A;  1GB4 A;  2KDM A;  5BMI A;  3UI3 A;  1D4B A;  4WH4 A;  1Q10 A;  1YNT E;  2LHE A;  1IBX B;  4HJG E;  3MP9 A;  1K50 A;  1HZ6 A;  2RPV A;  2ZW1 A;  4OZA A;  1JML A;  4IKG A;  4IOI E;  1FCC C;  4OZB A;  2JU6 X;  2LGI A;  4OZC A;  2OED A;  1MI0 A;  4GLS C;  2JSV X;  1IBX A;  2IGH A;  5HI1 A;  1F2R C;  1XCQ L;  1XF5 L; 
#chains in the Genus database with same CATH topology
 3KWL A;  1EU4 A;  2MJ3 A;  3O13 A;  5FKA C;  4KIK B;  2M4N A;  1FIQ A;  3CST A;  2EKI A;  1TY2 A;  2XEW A;  3KQ4 A;  2MWS B;  3ENE A;  2PLP A;  1SE9 A;  4FJZ A;  1WX8 A;  2LMC A;  4ZYN A;  1R7S A;  4ZRP A;  3L16 A;  3N30 A;  2D2Q A;  2C9W B;  4EZJ A;  2Y5P A;  3OLM D;  2G1E A;  5EE3 A;  3AEG B;  1GOZ A;  1WYW B;  2CKH B;  2HTM E;  3AE9 B;  1VR9 A;  2BKF A;  3ZQ4 A;  4W9J A;  1FD6 A;  4XC2 A;  2VZK D;  1Z2M A;  4IWO A;  5AZH A;  5DPW A;  4N58 A;  2Z59 B;  3AEC B;  3U8Z A;  5BMG A;  4GXB A;  3GZN I;  2ZPY A;  2FCQ A;  2KTF A;  3N9Y C;  2WXK A;  3L10 B;  1PGB A;  2AQ1 B;  4MJS A;  4HRS A;  2A5U A;  2DZK A;  2DBY A;  3MC0 B;  2QSD A;  3R3M A;  1WXQ A;  3TMP B;  1UBI A;  4NAW B;  1VCB A;  3I57 A;  4PS3 A;  3DCG A;  1I4X A;  1IGD A;  4YXD B;  4YTM B;  2FAZ A;  1S3S G;  3RPF C;  3TJP A;  3VUX A;  1JWS D;  3WA0 A;  1PUT A;  3MJ5 A;  1J0G A;  1P3Q U;  1E0Z A;  4X57 B;  2FCN A;  2IY0 B;  5C2T B;  1V1O A;  4RFB A;  1FXI A;  3R8B A;  2DX5 B;  2KMC A;  4GDK A;  1V5O A;  1I42 A;  1SJE D;  2MSE D;  1R4M B;  1MI0 A;  1C76 A;  3H8H A;  4K3C A;  2NS5 A;  2C7M B;  5FK9 C;  1F2R C;  2NBW B;  3ABV B;  1XCQ L;  1WYG A;  3RYT A;  1JWM D;  1YJJ A;  1KOT A;  2M56 B;  1C77 A;  4NJC A;  2RMM A;  3QX1 A;  3HHM A;  2B76 B;  2I1J A;  2PW9 A;  4K1R B;  1FNW A;  1OFF A;  4RM9 A;  4RGT A;  5LXI B;  3AEE B;  2K5P A;  2LXA A;  1YN3 A;  5AZG A;  1GUA B;  3DWG C;  4F8C B;  2CR5 A;  4C4V A;  2QC8 A;  4BZA A;  3AMZ A;  2KWD A;  3EFC A;  3NG0 A;  2BYF A;  3DBS A;  3PRM B;  3U2S C;  3Q3F A;  1ZE3 D;  3OAW A;  1KLV A;  2PMV A;  1X1M A;  2GB1 A;  2RSU A;  4HCP B;  4IC7 B;  1WRI A;  1HQR D;  2W82 A;  1EO6 A;  4LDT B;  3Q3O C;  2QEJ C;  3ML8 A;  3WAN A;  5C23 A;  4ICU A;  1E7P B;  2KLC A;  5T8I A;  3NVY A;  3W5U B;  2KD0 A;  2UYZ B;  1I4H A;  3VUY A;  2N4F A;  4DHZ B;  3UIN B;  4EUT A;  3AUL A;  1C1Y B;  4GDL B;  4NY0 A;  3URY A;  4E3C A;  2KWU B;  1I35 A;  1SEB D;  4HKQ A;  3RN9 C;  4NJ6 A;  3DPD A;  1DOY A;  2SEB D;  1SE2 A;  3BWU D;  1V8C A;  2N7E A;  5E6O A;  1UGJ A;  2KJH B;  1WXA A;  2KFK A;  4OZB A;  4FJV B;  2PE9 A;  3ETR A;  3FAH A;  2L00 B;  1I7H A;  4A3O A;  4FN2 A;  1IYF A;  3A1Q B;  3AED B;  2UU7 A;  3ZLZ A;  4N9F 4;  3UGB B;  4PK1 A;  2HTH A;  3AEB B;  4M02 A;  3MFG A;  5TR5 A;  5IKC M;  1CZP A;  3RNF C;  3GE3 C;  2MBH A;  2KFJ A;  2SAK A;  1ZXH A;  3Q69 A;  4K7U A;  2BS3 B;  3ZYY X;  2GOW A;  4JL9 A;  1UF0 A;  3SU8 X;  3R7R A;  2D5G A;  2MHJ A;  2LUM A;  2V3P A;  2K0P A;  2BYE A;  3Q3M C;  4A3P A;  3W5V B;  2N7J A;  3V3X A;  1FRD A;  3LJ3 A;  3CWI A;  1GB1 A;  2BB5 A;  3VRB B;  3TUO A;  3H6N A;  4OVV A;  4BBN C;  5GMV A;  4RMA A;  2REX A;  4GU2 A;  1BT0 A;  1E10 A;  4W9F A;  4XGA B;  4ANU A;  1OQQ A;  1ET6 A;  4ANW A;  1J7B A;  3PHX B;  3V62 A;  1FFU A;  2OJR A;  1V97 A;  3VTW A;  3Q8B A;  3IG3 A;  2QCZ A;  1PGX A;  1V1P A;  2VZK B;  3N32 A;  3Q8C A;  4MH8 A;  2J52 A;  1YOV B;  2AWT A;  3SFE B;  4LNK A;  2M1M A;  4MSQ B;  2TSS A;  3O65 B;  1N60 A;  1GB4 A;  4XWW A;  4KKJ A;  4LNN A;  2W3S A;  4OHJ A;  2DLB A;  2W3R A;  2W54 A;  3DQV A;  2ZCC A;  4ZDV A;  2KO3 A;  1P98 A;  1JRP A;  2WXH A;  3KUZ A;  2B3A A;  2W55 A;  4US9 A;  4AP4 C;  1KFY B;  3I63 C;  3IAS 1;  5LLI A;  2D3G A;  1F0Z A;  1TIF A;  1GG3 A;  4WQM A;  3W1S A;  4DXF A;  4PYZ A;  5KHQ A;  3PZD A;  5G55 A;  4M00 A;  4DWF A;  3HM3 A;  4BVU C;  3P63 A;  5EE1 A;  4K3B A;  3ONS A;  4URK A;  1YMH E;  4PYU A;  2YVC A;  4P16 A;  1XEE A;  4TQ0 A;  4AJY B;  1J7A A;  5D7G A;  2IZV B;  3EC8 A;  4S0R A;  1LQB A;  1VZ6 A;  1C9F A;  2I38 A;  3H7S A;  4ITK A;  1PGA A;  2VRR B;  1MHX A;  1UWM A;  2ONQ A;  1QZE A;  3S2A A;  3PLV A;  4A6Q A;  1XLN A;  4IDI A;  4WAA A;  1WZ0 A;  3TBL D;  1GC6 A;  3AXC A;  2DNF A;  4N59 A;  3H7P A;  3Q8F A;  2C60 A;  1YX6 B;  1R4N I;  2G3Q B;  3OJ4 B;  3HIZ A;  2PJH A;  1K53 A;  3QHT A;  3X23 A;  2JF5 A;  4QAY A;  2BW2 A;  2MJD A;  3LB8 C;  3C8Y A;  1UEL A;  1TYG B;  3ZVV A;  4MGK E;  2RPQ A;  3JSV B;  2JRH A;  1WGY A;  1IBX B;  4FBJ B;  4ARI A;  2EMS A;  1HZ6 A;  4HRO A;  2FIF A;  3Q3J A;  3A9J B;  1RRB A;  4OZA A;  1UZX B;  1H4R A;  5G5G A;  3DVG X;  1L0X B;  3R66 C;  2WYQ A;  2OED A;  1N5W A;  4HPP A;  2DWQ A;  3SR6 A;  3TCA A;  1T0Q C;  5TSS A;  3RNB C;  2LVP A;  1YD8 U;  3AE7 B;  2KN5 A;  5JHA A;  3QAR A;  3C19 A;  4GB9 A;  3W2D A;  1Z5S B;  4LNO A;  2LWP A;  4J6I A;  4W9H A;  2DZM A;  2ZZP B;  4M0W A;  4DDG D;  1SJH D;  2DZJ A;  1T0S C;  2JWU A;  2MCN B;  3WAL A;  2PKO A;  3ZTD A;  3T9L A;  2BBC A;  3ZJT A;  2MP2 A;  1T3Q A;  2L8J A;  4E74 A;  3R7Q A;  1V5T A;  1WE6 A;  3DBH I;  3M63 B;  4P6V F;  1YQB A;  1K51 A;  3EGR A;  2EEL A;  1Y8R C;  3M62 B;  1JQ4 A;  1JRU A;  4MT5 A;  4C80 A;  4JX1 C;  1E7U A;  3RD2 A;  4WAF A;  1S1Q B;  3DHI C;  2H88 B;  2KYW A;  3DHH C;  1E7V A;  2KWC A;  3BYY B;  1ZKH A;  4DHJ D;  2CJO A;  4FLH A;  3DVN U;  4FJY A;  5MPO A;  4AWJ A;  3P2B A;  1VJK A;  2WXR A;  2K9X A;  3WCQ A;  3BII D;  4RNA A;  4R3D A;  2J53 A;  4WUR A;  4RGO S;  3ZO5 B;  3HVD A;  5BMI A;  4WQO B;  2O6V A;  1WJ4 A;  2XK5 B;  2VH1 A;  2HE7 A;  4NAM A;  2C7N B;  4IKG A;  3SD5 A;  3HK0 A;  1SIJ A;  2MA9 B;  2DZI A;  3WIM A;  2Y5C A;  3GP7 A;  3V05 A;  1JAL A;  2WLB A;  4RH6 A;  1SE3 A;  4DHZ E;  5JH5 C;  5HI1 A;  2LD9 A;  2MX2 A;  4YWG G;  3PS6 A;  2L05 A;  1NEN B;  3K9P B;  2BWE S;  4JWU C;  2DAJ A;  2IO0 B;  2DYM A;  4AQ7 A;  2BGF A;  1E8Y A;  2M17 A;  3ZXV A;  2KVR A;  2Y5B B;  5JXV A;  1RFK A;  1P7E A;  3B2F A;  3K9O B;  3DBR I;  1YQ4 B;  2O2V A;  2HJ8 A;  3L54 A;  1L4D B;  3EA6 A;  1L6U A;  3RUI B;  2FUH B;  5H92 C;  5HFY A;  2EKE C;  3QK0 A;  2KTR A;  2NMQ A;  1HZ5 A;  3NY5 A;  3PO0 A;  1D5M C;  4XDC A;  1WGK A;  2AQ2 B;  1J8C A;  2ZW0 A;  3X0W A;  2M8S A;  2K39 A;  1V6E A;  3MHS D;  4LNF A;  1F1H A;  3NS8 A;  4AOF A;  1U4A A;  4HKZ E;  1P7F A;  3NZ3 A;  4TSS A;  3L08 A;  2KJ6 A;  1SE4 A;  3KLS X;  3SFD B;  3MJW A;  5IA7 A;  4W9D A;  4G0N B;  3UIP B;  1WJU A;  2W9N A;  4PS7 A;  4BOZ B;  1Q10 A;  4HDQ A;  2WX1 A;  3PTF C;  3DBH B;  1A5R A;  4MEL A;  3KWV A;  3L13 A;  1TKE A;  3TEZ A;  3RZF A;  2KMM A;  2BVC A;  3Q2A C;  3KH0 A;  3AU4 A;  2KC2 A;  4KSK C;  4C7Z A;  4TMA B;  4N6E B;  2MRP A;  2WDT B;  1XQQ A;  2IND C;  1ENF A;  4XE0 A;  5J17 A;  2CHX A;  5CHF A;  3APC A;  1V86 A;  3PV1 A;  4ANX A;  1F9J A;  3EFU A;  3V6C B;  5G2N A;  2J0K A;  2IY1 B;  1ZPS A;  2AL3 A;  2CU1 A;  3ZXR A;  4WWM A;  2RDH A;  1MJD A;  5KHO A;  4O1N A;  3U52 E;  1E8X A;  2DEN B;  2ZPN A;  2BB6 A;  4LCD E;  1XCT L;  3L4P A;  3KW5 B;  1KH0 A;  1B9R A;  4GIV A;  2ON8 A;  1E6E B;  2IO2 B;  3E56 A;  1E8Z A;  1PDX A;  4HVB A;  4C00 A;  1QIL A;  1M94 A;  4HDO A;  2GI9 A;  3AE1 B;  4WJP A;  2I2Y A;  1AYF A;  2MBO A;  4K81 A;  2V4I B;  3ZTC A;  2ZCB A;  3BVZ A;  3MTN B;  4JPS A;  4WJQ A;  3VTU A;  4J3O D;  3B08 A;  2NBV B;  2WHI A;  1NI3 A;  1ESF A;  2LGY A;  4KGS A;  2CS4 A;  2NR2 A;  2WXG A;  5BO4 B;  5CTR C;  4G3X B;  4W9K A;  5DPS A;  2KDF B;  1WXV A;  3FIL A;  3QWZ B;  4A55 A;  3BYT B;  4KDI C;  4HK2 A;  2WX0 A;  4DHJ B;  2CHZ A;  3DBR B;  1VRA B;  4P7I A;  5DPT A;  4TQ1 A;  1XO3 A;  3VR8 B;  4WIP A;  4F7Z A;  3PRE A;  3UIO B;  2WGS A;  1KLG D;  1TS5 A;  3Q3N C;  5H8Y E;  3PT2 B;  5D3D A;  1Q0W B;  2NPT A;  1WR6 E;  1N63 A;  1N61 A;  4GGQ A;  3U4E G;  1J7C A;  3N1X C;  2FE8 A;  2KJR A;  2V3S A;  1QOG A;  1VLB A;  1V81 A;  2L7R A;  4B0E A;  4Q2J A;  5CHW A;  5LNK 1;  3VR9 B;  2PPH A;  4KKI A;  2MH7 A;  2RGF A;  2DYB A;  2PE6 B;  3ZDT A;  2K22 A;  1T5X D;  1WSP A;  3GZN B;  3ECI A;  4EOY A;  3PSE B;  1BXT A;  4II2 B;  1EWC A;  3W1Y A;  4HPL B;  3H1U A;  4KIK A;  2E3T A;  1WFY A;  2IO3 B;  2VH2 A;  2LVQ A;  1PQS A;  4I6P A;  1KF6 B;  2INN E;  4AS1 A;  5I4D A;  2KN4 A;  3ZNZ B;  3VDZ A;  2DYO A;  3RT3 B;  1WMH B;  2L32 A;  2WP9 B;  2AL6 A;  4HCN B;  4BOS C;  3DVN V;  2PTL A;  5AUK A;  2WS3 B;  2M19 A;  1JWU D;  3Q6B A;  4ZRQ A;  1SGH A;  1UWX A;  4EFO A;  2BPS A;  4ZRI A;  5FR3 A;  3I3T B;  1WXM A;  4MGZ E;  3RUL A;  3RCZ A;  2BS4 B;  4OVU A;  1KM7 A;  3NS1 A;  4FHK A;  1QQR A;  3A33 B;  4IWP A;  5HKH A;  1NEK B;  2NBU A;  4NAW A;  4K7W A;  2N1V A;  4KVG B;  4NQK E;  2LGX A;  2JU6 X;  1TS2 A;  2XN9 C;  3AH7 A;  4LJO B;  2NCN A;  4GLS C;  2IJ0 A;  3PGE A;  2KX3 A;  1TKG A;  1LM8 B;  2AYO B;  2MJE A;  3BK1 A;  4FXC A;  2I1K A;  4YT0 B;  1WM2 A;  2KKC A;  4YTN B;  1WX9 A;  1HTQ A;  2JPH A;  1NBF C;  2D3A A;  1HEZ E;  1FMA D;  2Z0E B;  3VHT C;  3VUW A;  1RWS A;  3ZNG C;  2ASQ A;  4E71 A;  1JWA D;  5IO9 A;  3FKY A;  3LYY A;  2WXM A;  3AE6 B;  3U7Z A;  4BKS A;  3B9J A;  3B0A A;  5CHV C;  1I4G A;  1OTR B;  2K8B A;  2N9X A;  1C79 A;  4MDK E;  1CK1 A;  4ICV A;  1F2R I;  2ZVN A;  3BVG A;  4NZL B;  4GN1 A;  2KDE B;  4MGY E;  3ZGZ A;  3H9D A;  5HHD G;  2FCM A;  4ZRK A;  5AUI A;  3AE5 B;  3APF A;  5BYS A;  2IPK D;  1TS3 A;  1AAR A;  2GBR A;  4IM0 A;  4EZL A;  2G4S A;  4IWQ A;  3A9K B;  1I4Q A;  4G11 A;  3TEX A;  5JZE B;  3BK2 A;  3PRP B;  3NVV A;  4B0M A;  4RGM A;  1WH3 A;  5C3J B;  2J42 A;  4II3 B;  4S17 A;  3PHW B;  4ZHO A;  1YNT E;  1L2N A;  3NJT A;  4B6W A;  1FPY A;  5IAA C;  1WX7 A;  4MM3 B;  1MFW A;  4US8 A;  2O2V B;  3TL5 A;  4JQW C;  4YSZ B;  1YIW A;  3LXF A;  2JZZ A;  4DXA B;  4OZC A;  3DBL I;  4GDL A;  3EEC A;  4LLG M;  3SEB A;  4KDL B;  1P9D U;  1C4C A;  3RMK C;  4M01 A;  2ACZ B;  1E8W A;  4L1B A;  2FUG 1;  3EHV A;  3RI7 C;  3R2T A;  2KAJ A;  2D3B A;  2KXJ A;  1QOF A;  3Q14 C;  2N9L A;  3GB1 A;  2N9P C;  2JRI B;  3OJ3 A;  4WWN A;  2JYE A;  3A1Q A;  3VVW B;  3TEW A;  3QJZ A;  1ZGU B;  2NTS A;  3UF8 A;  3B2G A;  4IW0 A;  3UQA A;  2WNM A;  3IXS A;  2KMA A;  4PT5 A;  3AE3 B;  2MBB B;  1CMX B;  1KLU D;  5D3I B;  4BKT A;  1TT5 B;  1UH6 A;  4MJS B;  3RNC C;  3WAM A;  3PLU A;  1QLB B;  3IFW B;  3TIX A;  1XLP A;  2JZ3 B;  4USA A;  1FRR A;  1GJZ A;  5GXG B;  4HWI B;  3AU5 A;  1D5Z C;  1GAQ B;  4A9A A;  4JLC A;  2V9H A;  1C4P A;  3RNG C;  1NYR A;  3FC4 A;  3WAO A;  2R61 A;  1KTK A;  1ZUD 2;  2BWF A;  4GMV A;  3TEY A;  1V9J A;  4GDK B;  1ZDV A;  2GBK A;  2ICI A;  2CJN A;  3P4P B;  2ZVO A;  5E6J A;  2LRW A;  4ACF A;  1QOB A;  2RPV A;  4A8X C;  2LI5 A;  2LZ6 A;  4XX5 A;  2LUE A;  1DYQ A;  1F77 A;  1YN4 A;  2WXF A;  1WE7 A;  2ZEQ A;  2IGH A;  3U30 A;  2L1A A;  1XF5 L;  3AEA B;  1AW7 A;  2IGG A;  4P1B C;  3WAP A;  2R2Q A;  3DVG Y;  2L0F A;  3LDZ E;  2XBB C;  4C4V B;  2ZJD A;  4HXD A;  3BVM A;  3VH3 B;  1B1Z A;  3MHZ A;  1WRD B;  2QMT A;  3ZJV A;  1WJ6 A;  1HA5 A;  2IGD A;  3Q8A A;  1R4N B;  1R4M I;  2FNJ B;  2V3N A;  1NI2 A;  3AV8 A;  3BIN A;  1FM0 D;  3RNA C;  1WWT A;  2H89 B;  1MG4 A;  4XWT A;  2NVU I;  1ET9 A;  3CMM B;  3JVZ X;  2JY6 A;  3ZNI D;  1DGJ A;  1OQY A;  1UNS A;  5LXH A;  4RF0 A;  1TY0 A;  1NVI D;  2LGD A;  5E6N A;  4W9L A;  1WJN A;  1MG8 A;  1XT9 B;  4RCO A;  1P1A A;  1SB3 C;  4ANV A;  2KOX A;  4DK5 A;  3TSS A;  3KYC D;  1C3T A;  2WXI A;  1I4R A;  2R2O A;  4KGR A;  1SIF A;  2KFK B;  3BY4 B;  2KDM A;  3DOW A;  1WGD A;  2GLS A;  2WU5 B;  4HJG E;  1FXT B;  3AE8 B;  1JRO A;  3DWM A;  2MBQ A;  1TZO A;  3IHP C;  4FA6 A;  1V80 A;  3P4Q B;  5D6J B;  3N3K B;  3IT4 B;  4RM8 A;  5BYQ A;  2KX0 A;  1EU3 A;  2HJ1 A;  3JSV A;  1IBX A;  1OEY J;  2YEP F;  1PFD A;  2K8C A;  1HE8 A;  5AEK B;  3KYD D;  2MLB A;  3NOB A;  1EF5 A;  3A9J A;  4CQN A;  5EE9 A;  3OG5 A;  2KVZ A;  2CHW A;  2QJL A;  2GBM A;  1ISN A;  4ZOH C;  4HEA 1;  2KNB A;  3NVW A;  2RR9 A;  3Q8E A;  2LRU A;  1FEH A;  1RFA A;  2WDR B;  1E5W A;  3ZNH B;  2INP E;  3C0R B;  2JWZ A;  5L95 C;  2GBJ A;  2GBN A;  3QCA A;  2KC1 A;  3GE8 C;  4FUL A;  3A4S C;  1STE A;  1V49 A;  4YSX B;  2MEK A;  5G5H A;  3I9V 1;  5DPR A;  1V1P B;  2KQ4 X;  1HXY D;  4BAX A;  3SHQ A;  1N62 A;  2AEH A;  2N0S B;  1LXD A;  2K25 A;  4REZ A;  1QT9 A;  5HG2 A;  4NQL B;  2O6V D;  4FHJ A;  1H8C A;  2J0M A;  4EE2 A;  4YL8 A;  2GMI C;  4W9C A;  1E90 A;  1IGC A;  1EWY C;  3MC9 A;  2EMT A;  2Y3A A;  2JXT A;  3L0W B;  2GRI A;  3ALB A;  3DDC B;  4WJN A;  4EZK A;  2OJW A;  4KZC A;  2D3C A;  1SBB B;  2JT4 B;  2WDV B;  2X8X X;  1YJI A;  4LK0 M;  3T3O A;  4P1C C;  1ZP0 B;  2E6X A;  2PIA A;  2BQQ A;  2M0X A;  4OW0 A;  2IBI B;  2L83 A;  3VRA B;  3VFK A;  3KVF B;  1KRH A;  3ZKJ C;  4IOI E;  1FCC C;  2N9E B;  4BFR A;  4C56 C;  5D2M B;  2ZNV B;  2WXN A;  5EE0 A;  4C7Y A;  2WXL A;  2JSV X;  3ZRF A;  3PZ7 A;  4ZHP A;  3AM9 A;  2XK5 A;  1AN8 A;  1C78 A;  3T8M A;  4IUM B;  4JWS C;  3V6E B;  4DQO C;  4LTU A;  2HDE A;  1K8R B;  1I4P A;  3P4S B;  2KWV B;  3U7D A;  1XXG A;  4TV3 A;  1T6B X;  1M4V A;  2RDG A;  4YSY B;  1Y56 A;  1L7Y A;  4DBG A;  2N9K A;  2QHO A;  2K6D B;  3HVZ A;  3ZRC A;  2YLM A;  1QF6 A;  4FAD A;  1ZDX A;  3AI5 A;  2JUO A;  3H7P B;  4IM2 A;  1RYJ A;  4ZRJ A;  2LGS A;  2DAF A;  2INC C;  2WXQ A;  4AUQ C;  1CQV A;  2AX5 A;  2PVO D;  1EF1 A;  1K52 A;  1A70 A;  3M3J A;  1T0R C;  3P1M A;  1WGR A;  5IN7 A;  4XZ4 A;  3HM6 X;  1CJE A;  3NUH B;  4LNI A;  1N5X A;  4A90 A;  4LJP B;  4KX6 B;  2KDB A;  1WXS A;  2C5L C;  2YEP B;  2Z8L A;  1SF0 A;  4IG7 B;  2LEK A;  1QKZ A;  2DHZ A;  5JHB A;  2FCS A;  1WGH A;  4G50 A;  2N1W A;  3AE4 B;  4WH4 A;  2LHE A;  1L4Z B;  1WIA A;  3VQI A;  2K6Q A;  4TKN A;  1YX5 B;  4HJK A;  4M8N A;  1WY8 A;  2D07 B;  2BKR B;  4A20 A;  4JGH B;  2KDI A;  4OVZ A;  4WJO A;  2UWQ A;  2QIE B;  2D10 A;  4M0W B;  4MH0 E;  3UQB A;  1ZXI A;  3IBE A;  3PVL A;  1L5P A;  3NHE B;  2FID A;  4K7S A;  4L2Y A;  1TS4 A;  3AEF B;  2MP2 B;  3R2I A;  3JW0 X;  3CIR B;  1YQ3 B;  2V0G A;  1GNU A;  3P42 A;  4RF1 A;  1AWD A;  1V2Y A;  2K1F A;  5CX3 A;  4F1S A;  1WZ3 A;  4MAC A;  2N7D A;  2BT6 A;  4TUU A;  1OEY A;  2XNA C;  2J4X A;  1BML C;  5EDS A;  2BS2 B;  1XLQ A;  1UUP A;  4CHK A;  2KZR A;  1WF9 A;  4B9K A;  2V1Y A;  2LJI A;  3GS2 A;  3KUC B;  5IP4 D;  3VXW A;  1TJE A;  2FBW B;  4CO7 A;  4EEW A;  1HTO A;  4WWO A;  2LXC A;  2LFI A;  1ZOY B;  1FO4 A;  3NZU A;  1WGG A;  2LHD A;  2RD0 A;  2G4D B;  2O6V B;  2CU3 A;  2BTE A;  3V60 A;  4MGI E;  3P4R B;  1RAX A;  2WXJ A;  3BZD B;  3RFZ B;  3NRZ A;  5J2R A;  3VAW A;  1T0Y A;  3W1S C;  4D2K A;  3ZW3 A;  4DDI D;  3N1Z C;  2BF8 B;  1LGR A;  1QOA A;  1VZ7 A;  3AN1 A;  4NNJ B;  3QIJ A;  5FR6 A;  1ROE A;  3MP9 A;  3QQ8 B;  2JYT A;  2WDQ B;  2JVC A;  2ZNV C;  1F52 A;  4WWP A;  3RNE C;  4IM3 A;  1P0R A;  2JXX A;  1JML A;  1IPG A;  1SSN A;  2KQS A;  1RM6 C;  4PS8 A;  2IYD B;  2A4Z A;  1BUI C;  3L17 A;  2AQ3 B;  3OWE B;  1TTN A;  1OQR A;  3N20 C;  2QIL A;  2G9H D;  3QA8 A;  2JQR B;  3ZIM A;  4EKU A;  2G45 B;  3DHG C;  3ML9 A;  1YN5 A;  4UDU C;  4ASW C;  4ARC A;  1PYW D;  1UD7 A;  5IOI A;  1TZ1 A;  2K3U A;  2J7Q B;  3QAQ A;  1DOX A;  1GPX A;  1OGW A;  2KTR B;  2KLG A;  3ZDM C;  3IAM 1;  4YTP B;  5BYR A;  1Q5W B;  3D32 A;  2J0J A;  2KT7 A;  1KJT A;  4M8M A;  4NPN A;  1YJ1 A;  3RZW C;  1FFV A;  1NYQ A;  5J18 A;  2WU2 B;  1RLF A;  2OHF A;  2LVO A;  1L6V A;  3QC8 B;  2IO1 B;  4KV2 A;  3VH4 B;  2IDY A;  2Z0D B;  1ACC A;  1VZ8 A;  4I6L B;  2PVG C;  3CF6 E;  1WR1 A;  1FCL A;  2WXO A;  3VTV A;  1MHH E;  2V4L A;  3A4R A;  1Q1O A;  4MEM A;  2LJ5 A;  3T3N A;  3PPA A;  3NZS A;  3AB5 A;  3J9C A;  2D11 A;  4H2A A;  1XD3 B;  1WMH A;  1E9M A;  3UI3 A;  1D4B A;  2K8H A;  3B1L X;  4JIO U;  1G6J A;  2HD5 B;  2L76 A;  1WI0 A;  1XLO A;  4JE3 B;  4HLE A;  3KUD B;  4BBN F;  1FXA A;  3APD A;  4MSM B;  5DCN A;  3E9S A;  3AE2 B;  3HUI A;  2KHW B;  1GC7 A;  2BYT A;  1D5X C;  3W9C B;  3I5J C;  4AJW A;  4CYE A;  4B95 A;  4BKS D;  2MW5 A;  1SXT A;  2KQ7 A;  1J19 A;  5BMH A;  2KAC A;  3JYU A;  4I6N B;  2JZP A;  1EM7 A;  2RDB C;  4W9G A;  1JWB D;  5D94 A;  2M0A A;  4DXG A;  1NDD A;  3SDL C;  1WM3 A;  1C4A A;  3EUB 2;  4HPM B;  5E6P A;  3IT6 B;  4KGT A;  1L0V B;  1JCK B;  2C7H A;  2KK8 A;  2MBE A;  3V61 A;  4W9E A;  2PEA A;  1FNV A;  5L83 A;  1D3Z A;  3CSF A;  3PRZ A;  4L23 A;  4GOC A;  3M95 A;  3FIL B;  2JX5 A;  1TGZ B;  1LO5 D;  3ZJU A;  3MC8 A;  1L0Y B;  3N1Y C;  2WQY B;  2X38 A;  4GSW A;  4LDT D;  1TKY A;  1IP9 A;  4ZYS A;  3IVF A;  1TBE A;  2L52 A;  3PZ8 A;  4KZ0 A;  4KSL C;  4XDD A;  2BYV E;  1DOI A;  1MPE A;  2Q5W D;  1JW9 D;  3DBL B;  2NTT A;  1MVK A;  1EUV B;  2WWZ A;  2NPT B;  2L0T A;  1VDV A;  1FNU A;  5C1Z A;  1LFD A;  4XYC A;  4BKG A;  2WXP A;  1IUE A;  1K50 A;  2OOB B;  3A9K A;  5AZF A;  2ZW1 A;  1UGM A;  3HRD D;  2LAS A;  3ZUN A;  1D6E C;  1N6Z A;  1ZW7 A;  2LGI A;  2MQJ A;  4W9I A;  1VD2 A;  2QDF A;  3NVZ A;  2KAN A;  4RGN A;  1UBQ A;  2L3Z A;  3GOE A;  4NJ7 A;  4MM3 A; 
#chains in the Genus database with same CATH homology
 5TSS A;  1AN8 A;  1TKG A;  1C78 A;  3KWL A;  1EU4 A;  2MJE A;  3AE7 B;  3BK1 A;  4FXC A;  4JWS C;  2MJ3 A;  4YT0 B;  4YTN B;  4DQO C;  4LTU A;  2HDE A;  3O13 A;  5FKA C;  1FIQ A;  2EKI A;  3W2D A;  1I4P A;  1TY2 A;  3KQ4 A;  1HEZ E;  3P4S B;  1XXG A;  1FMA D;  1T6B X;  1M4V A;  1RWS A;  2RDG A;  4M0W A;  1JWA D;  2PLP A;  4YSY B;  1SJH D;  1Y56 A;  2JWU A;  2LMC A;  2PKO A;  1R7S A;  2N9K A;  3LYY A;  2BBC A;  3HVZ A;  3ZJT A;  2WXM A;  3AE6 B;  4ZRP A;  1T3Q A;  3U7Z A;  1QF6 A;  1ZDX A;  3B9J A;  1RYJ A;  2Y5P A;  1I4G A;  4P6V F;  2G1E A;  2WXQ A;  1K51 A;  3EGR A;  2EEL A;  5EE3 A;  3AEG B;  1C79 A;  1GOZ A;  1JQ4 A;  1CQV A;  2AX5 A;  2PVO D;  4MT5 A;  4C80 A;  1K52 A;  4JX1 C;  1A70 A;  1CK1 A;  1F2R I;  2HTM E;  3BVG A;  3AE9 B;  1VR9 A;  4NZL B;  3P1M A;  4WAF A;  3ZQ4 A;  3ZGZ A;  1FD6 A;  1CJE A;  2H88 B;  3NUH B;  2VZK D;  5HHD G;  4N58 A;  3BYY B;  5AUI A;  3AE5 B;  5BYS A;  3AEC B;  2IPK D;  5BMG A;  1TS3 A;  1N5X A;  3N9Y C;  4A90 A;  2WXK A;  2CJO A;  4KX6 B;  1PGB A;  1I4Q A;  2AQ1 B;  4HRS A;  3TEX A;  3BK2 A;  2YEP B;  2DBY A;  2Z8L A;  5MPO A;  1SF0 A;  3NVV A;  3MC0 B;  1VJK A;  2QSD A;  2WXR A;  2K9X A;  2LEK A;  1QKZ A;  1WXQ A;  3WCQ A;  3BII D;  4RNA A;  4NAW B;  4B0M A;  4RGM A;  4R3D A;  5C3J B;  3I57 A;  2J53 A;  2J42 A;  4WUR A;  1I4X A;  1IGD A;  4RGO S;  3HVD A;  5BMI A;  3AE4 B;  4YXD B;  4ZHO A;  4WH4 A;  4YTM B;  3RPF C;  1JWS D;  1YNT E;  1PUT A;  2LHE A;  1L4Z B;  3MJ5 A;  3VQI A;  4MM3 B;  1E0Z A;  4US8 A;  4NAM A;  5C2T B;  1V1O A;  4IKG A;  4RFB A;  4YSZ B;  1FXI A;  3LXF A;  3R8B A;  1SIJ A;  4OZC A;  1SJE D;  2Y5C A;  3GP7 A;  4LLG M;  3SEB A;  3V05 A;  1JAL A;  1MI0 A;  2WLB A;  4RH6 A;  1C76 A;  3H8H A;  1C4C A;  1SE3 A;  4OVZ A;  5FK9 C;  2QIE B;  5HI1 A;  1F2R C;  3ABV B;  1ZXI A;  1XCQ L;  1L5P A;  1WYG A;  4YWG G;  2ACZ B;  4L1B A;  1JWM D;  1YJJ A;  1NEN B;  4L2Y A;  1TS4 A;  2FUG 1;  3AEF B;  2M56 B;  3R2I A;  3R2T A;  2KAJ A;  4JWU C;  1C77 A;  4NJC A;  2DYM A;  2RMM A;  3CIR B;  4AQ7 A;  1QOF A;  1YQ3 B;  2N9L A;  3GB1 A;  3P42 A;  2B76 B;  4RF1 A;  2V0G A;  1AWD A;  2PW9 A;  1FNW A;  1OFF A;  2JYE A;  4RGT A;  3TEW A;  5JXV A;  3AEE B;  2NTS A;  2K5P A;  3B2G A;  4MAC A;  1YN3 A;  1RFK A;  1P7E A;  2WNM A;  3B2F A;  3IXS A;  4PT5 A;  3AE3 B;  2BT6 A;  3DWG C;  2XNA C;  2J4X A;  1BML C;  1YQ4 B;  2BS2 B;  1KLU D;  1XLQ A;  5D3I B;  1UUP A;  3AMZ A;  2KWD A;  1L4D B;  3EA6 A;  1L6U A;  5HFY A;  5H92 C;  2LJI A;  1QLB B;  3GS2 A;  3U2S C;  1ZE3 D;  2NMQ A;  1TJE A;  1HZ5 A;  1XLP A;  2FBW B;  3PO0 A;  1D5M C;  1FRR A;  1WGK A;  2AQ2 B;  4XDC A;  4USA A;  2ZW0 A;  2PMV A;  5GXG B;  2GB1 A;  2LFI A;  1D5Z C;  1WRI A;  1ZOY B;  1GAQ B;  1HQR D;  2W82 A;  4A9A A;  1FO4 A;  2LHD A;  4HKZ E;  1P7F A;  1C4P A;  2CU3 A;  2QEJ C;  3NZ3 A;  4TSS A;  2BTE A;  1NYR A;  3FC4 A;  1E7P B;  5T8I A;  3P4R B;  2R61 A;  3NVY A;  1KTK A;  3W5U B;  2WXJ A;  1I4H A;  1SE4 A;  1ZUD 2;  3BZD B;  3NRZ A;  3RFZ B;  3KLS X;  3SFD B;  3TEY A;  4GDK B;  4D2K A;  1ZDV A;  2ICI A;  2CJN A;  3P4P B;  1QOA A;  4GDL B;  3URY A;  1VZ7 A;  3AN1 A;  1Q10 A;  5E6J A;  1SEB D;  1ROE A;  3MP9 A;  2JYT A;  4HKQ A;  1QOB A;  2WDQ B;  1DOY A;  2SEB D;  2RPV A;  3KWV A;  1TKE A;  1SE2 A;  3BWU D;  1V8C A;  3TEZ A;  2KMM A;  1UGJ A;  4A8X C;  1JML A;  1SSN A;  4OZB A;  1RM6 C;  3ETR A;  3FAH A;  4C7Z A;  4TMA B;  1DYQ A;  1BUI C;  4N6E B;  2AQ3 B;  3OWE B;  1F77 A;  1OQR A;  1ENF A;  1YN4 A;  1I7H A;  2WXF A;  4XE0 A;  2QIL A;  2IGH A;  3AED B;  2G9H D;  2L1A A;  2JQR B;  1ZPS A;  1XF5 L;  3AEB B;  3MFG A;  3AEA B;  4WWM A;  2RDH A;  1AW7 A;  1CZP A;  2IGG A;  1YN5 A;  2SAK A;  1ZXH A;  3Q69 A;  4O1N A;  3U52 E;  4UDU C;  2BB6 A;  2BS3 B;  3ZYY X;  1XCT L;  3BVM A;  3L4P A;  4ARC A;  1KH0 A;  1PYW D;  1B1Z A;  1B9R A;  2ON8 A;  3MHZ A;  2D5G A;  2QMT A;  3ZJV A;  2K3U A;  1HA5 A;  2LUM A;  1DOX A;  1GPX A;  2V3P A;  1E6E B;  3E56 A;  2K0P A;  1PDX A;  2IGD A;  3Q8A A;  1QIL A;  3IAM 1;  2V3N A;  3AV8 A;  3W5V B;  1FM0 D;  4YTP B;  5BYR A;  2GI9 A;  3AE1 B;  2N7J A;  2I2Y A;  3V3X A;  1AYF A;  1FRD A;  1WWT A;  2H89 B;  3CWI A;  4XWT A;  1GB1 A;  2BB5 A;  2V4I B;  3VRB B;  1ET9 A;  3BVZ A;  4JPS A;  3TUO A;  4J3O D;  1DGJ A;  1UNS A;  1FFV A;  1NYQ A;  4RF0 A;  1NI3 A;  1TY0 A;  1E10 A;  2WU2 B;  1NVI D;  2OHF A;  1ESF A;  1OQQ A;  1ET6 A;  1L6V A;  2IDY A;  4KGS A;  1J7B A;  4RCO A;  2WXG A;  1FFU A;  1ACC A;  1SB3 C;  1VZ8 A;  1V97 A;  3Q8B A;  2PVG C;  1FCL A;  2WXO A;  3TSS A;  1PGX A;  1V1P A;  1MHH E;  3FIL A;  2WXI A;  2VZK B;  3Q8C A;  1I4R A;  4MH8 A;  4A55 A;  2J52 A;  3BYT B;  3SFE B;  4KGR A;  3T3N A;  3AB5 A;  3J9C A;  2TSS A;  4H2A A;  1N60 A;  1GB4 A;  2KDM A;  4XWW A;  1VRA B;  3UI3 A;  1E9M A;  1D4B A;  4TQ1 A;  1XO3 A;  4KKJ A;  2WU5 B;  4HJG E;  3VR8 B;  2W3S A;  3AE8 B;  1JRO A;  2DLB A;  3DWM A;  4OHJ A;  1TZO A;  1XLO A;  4JE3 B;  2W3R A;  4WIP A;  3P4Q B;  2W54 A;  3IT4 B;  1FXA A;  1KLG D;  1TS5 A;  3E9S A;  1JRP A;  2WXH A;  5D3D A;  3AE2 B;  5H8Y E;  3HUI A;  2W55 A;  5BYQ A;  4US9 A;  1N63 A;  1KFY B;  1N61 A;  1EU3 A;  3IAS 1;  1IBX A;  2YEP F;  1F0Z A;  1PFD A;  3U4E G;  1D5X C;  1J7C A;  2BYT A;  2FE8 A;  4WQM A;  3W1S A;  3W9C B;  4DXF A;  1QOG A;  1SXT A;  4CQN A;  1VLB A;  5EE9 A;  2QJL A;  5BMH A;  4B0E A;  2KAC A;  4ZOH C;  2JZP A;  4Q2J A;  1EM7 A;  4HEA 1;  3NVW A;  5LNK 1;  3Q8E A;  1JWB D;  1FEH A;  4KKI A;  3VR9 B;  2WDR B;  3P63 A;  2MH7 A;  2M0A A;  4DXG A;  1C4A A;  5EE1 A;  3EUB 2;  2K22 A;  1YMH E;  1T5X D;  3IT6 B;  1WSP A;  2INP E;  1L0V B;  4KGT A;  1JCK B;  4P16 A;  1XEE A;  4TQ0 A;  1J7A A;  5D7G A;  1BXT A;  1EWC A;  1STE A;  2E3T A;  1FNV A;  4YSX B;  2MEK A;  4L23 A;  1VZ6 A;  5G5H A;  1C9F A;  2I38 A;  3I9V 1;  4ITK A;  1PGA A;  1V1P B;  3FIL B;  2JX5 A;  1LO5 D;  1MHX A;  1UWM A;  2KQ4 X;  3ZJU A;  1HXY D;  1N62 A;  2ONQ A;  1KF6 B;  1L0Y B;  2N0S B;  2INN E;  2WQY B;  4AS1 A;  4REZ A;  5I4D A;  1QT9 A;  2KN4 A;  5HG2 A;  4A6Q A;  2DYO A;  2X38 A;  1XLN A;  4IDI A;  1TKY A;  4EE2 A;  4ZYS A;  4N59 A;  3Q8F A;  2L32 A;  1IGC A;  1EWY C;  2L52 A;  2WP9 B;  2Y3A A;  2JXT A;  3PZ8 A;  4XDD A;  2GRI A;  1DOI A;  2PTL A;  1MPE A;  2Q5W D;  5AUK A;  1JW9 D;  2WS3 B;  2M19 A;  2NTT A;  1MVK A;  1JWU D;  1K53 A;  1SBB B;  2BW2 A;  2WDV B;  1YJI A;  2MJD A;  4ZRQ A;  1UWX A;  4LK0 M;  3LB8 C;  3C8Y A;  3T3O A;  1VDV A;  1FNU A;  5FR3 A;  1TYG B;  1ZP0 B;  2WXP A;  1IBX B;  2E6X A;  2PIA A;  1IUE A;  2BS4 B;  1K50 A;  4ARI A;  1HZ6 A;  3NS1 A;  4HRO A;  4OW0 A;  1QQR A;  2L83 A;  2ZW1 A;  3VRA B;  4OZA A;  1KRH A;  3HRD D;  1NEK B;  5G5G A;  4IOI E;  1FCC C;  1D6E C;  1L0X B;  4C56 C;  2JU6 X;  2LGI A;  1TS2 A;  2XN9 C;  3AH7 A;  2WXN A;  5EE0 A;  4C7Y A;  2WXL A;  2OED A;  4GLS C;  2JSV X;  1N5W A;  2IJ0 A;  3NVZ A;  3PZ7 A;  2DWQ A;  4ZHP A;  4RGN A;  3AM9 A;  3SR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...