5HHIA

Structure of human dna polymerase beta host-guest complexed with cbz-platinated n7-g
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Synthesis, structure, and biological evaluation of a platinum-carbazole conjugate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 98
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5hhiA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5hhiA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hhiA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hhiA03
1SKRA 3PNCA 4QZHA 4ATBB 2LYHA 5KG0A 4EYHB 1FA0A 1Z00B 5HRBA 5L1JA 3JPSA 4F8RA 4YN4A 1MQ3A 4DS5A 1UT8A 5KFKA 4DOBA 4X4TA 3C18A 5EWEA 2BPFA 4DSEA 4AT8B 4FHWA 4TUSA 1ZQVA 4Q43A 5DB7A 1XSLA 4I2GA 4TURA 2IMWP 2ASLA 4DQPA 5HHIA 2KZ3A 5KG1A 7ICKA 2AGQA 7ICVA 5KFMA 2ISPA 1QSLA 4K4IA 5EWGA 5DGBA 4Q44A 3RJGA 9ICUA 1ZQMA 4DF4A 4QZGA 7ICUA 8ICOA 1KTQA 4UB1A 4F50A 3Q8RB 4ECVA 3MBYA 4IRKA 3HJ4A 4MF8A 3H7IA 5KFCA 2Q66A 1LV5A 1BPZA 4O9MA 3UQ2A 5KG2A 3PO4A 4B9SA 3JPTA 4O3OA 3UXPA 3UPQA 3C1ZA 1ZQNA 3JYYA 3PMLA 4XQ8A 4PHPA 2C28A 1U48A 5HMMA 5KT7A 5J2DA 2F1HA 4RUAA 3ISBA 1L3UA 7ICPA 4QW8A 7ICIA 5J2BA 1NK9A 1PX5A 4S3NA 2KP7A 1S0NA 2ZUBA 4QZCA 1KEJA 1N56A 1ZQYA 1ZQDA 5J2FA 4UAWA 4O5CA 4GC7A 2ASDA 1XSNA 4TUQA 4IQTA 4DL4A 5KT2A 3E2EA 2ZJAA 3N4MB 3RRHA 2IBKA 1EXNA 4RNMA 3EPGA 3IHQB 3PX0A 4X4SA 4F5OA 3TANA 3RR7A 1SL2A 4YMOA 2ATLA 1MQ2A 3RAXA 4KLGA 2M2TA 1S0MA 4Z6EA 1B43A 1PZNA 4QZIA 1TVAA 4KLMA 1JIHA 9ICHA 5J0WA 4WC7A 3PR4A 1JXLA 1MSWD 2O1PA 4DLEA 5CP2A 7ICGA 3H39A 1UA0A 1NJYA 3RRGA 4QWDA 7ICLA 1Q78A 3TAPA 3BJYA 4RQ3A 4KLUA 2C2RA 3B0YA 5L9XA 3LDAA 4M04A 4G3IA 2KZMA 4YD1A 8ICPA 5KFBA 9ICTA 1NZPA 3H37A 5DQGA 2ZHAA 3JPOA 3OV7A 3GIJA 3V7JA 2BE3A 4HYKA 4ECYA 3UXOA 2ZTDA 4RWOA 1KDHA 1UEVA 1NJZA 1DOQA 4RQ5A 5F9LA 4NKUA 5KFSA 4RQ4A 4M9LA 3RBDA 1VJ7A 3Q8LA 9ICKA 9ICSA 3PW4A 3C5FA 5J2KA 4JUZA 2AGPA 2ZJ8A 2XY7A 4UAZA 2MUTA 1N48A 4DSLA 4RWQA 3AU6A 2R8GA 4DQRA 5KFEA 3KHLA 4ECXA 3SYZA 1R89A 2JZBA 5KFAA 1T3NA 4IRDA 4K4GA 3K75D 2BQRA 1ZYQA 4RZRA 5DDYA 4EYIB 4ED0A 4FHPA 3Q8SB 4RNNA 2I9GA 1L3TA 2FMSA 3H8WA 5DLFA 4DS4A 4C8OA 5DBBA 2I1QA 3ORYA 4JV1A 2AGOA 1ZQJA 4JV2A 8ICSA 2JEIA 3GDXA 3ISCA 3GV8B 5DG9A 4LZDA 4ECSA 1RYRA 3C1YA 2PFNA 4YMNA 1ZQWA 4RQ8A 4YVZA 5CR0A 1BNOA 5J2IA 2WTFA 1D9DA 2FPMA 2XC9A 1UA1A 3C2MA 2DRBA 3ZDEA 2VA3A 5HC9A 3JPPA 2BPCA 4TQSA 2O5AA 2MUTB 5J0UA 4YP3A 3MDAA 4EBEA 2BPGA 4X0BA 4F93B 3GILA 4YXMA 4DL3A 1KSPA 3ZDCA 2JZBB 9ICGA 4F3OA 3BQ2A 1B22A 4WC2A 1BPEA 5DEDA 3BQTA 4O3PA 4ED8A 1XS9D 4IRCA 5C5JA 4UB3A 5HRIA 2FPLA 2HHTA 3AQNA 4ED2A 1TFWA 4M6WA 4F4KA 4J9QA 4NXZA 4KMUA 5KG4A 3MABA 3ZD8A 1ZQIA 9ICEA 1L3SA 1QSYA 4DFKA 2BR0A 8ICEA 8ICNA 1XSPA 1TK5A 4ELVA 9ICXA 3HX0A 2VA8A 5KFGA 4QWEA 2AQ4A 2KTQA 4WC0A 9ICVA 4DO9A 2DR5A 2UVVA 5J0TA 8ICRA 3WFPA 2ZH3A 4M2YA 5JUMA 8ICZA 4X4QA 5HNKA 1BPYA 3H40A 3UQ0A 4UB5A 1DK2A 3EPIA 4UAYA 3V6KA 1CEZA 4I2JA 1K1SA 3G6YA 4QZFA 5J2CA 1ZQBA 4BDPA 4KLTA 3H3AA 2BCUA 3PW7A 3RJIA 2BHNA 3HPOA 1S9FA 3T5HA 1NO5A 4LVSA 4KN7A 4IQUA 1RPLA 2F1JA 3LWMA 2FMPA 7ICRA 3MR5A 4M6WB 5DBAA 4PHAA 2BQ3A 2M2UA 4GXJA 5DG7A 4ECWA 1JAJA 3SV3A 1Q79A 2HHSA 1BVSA 1RXWA 1H38A 1BPBA 4R66A 4J9SA 4DQQA 2M2WA 4RWNA 3C66A 2J6TA 3OSPA 1CUKA 4JK1A 3ZDBA 4J9NA 4I29A 5HRLA 4F91B 1ZQFA 4P4OA 1Z3EB 2IHMA 5KFZA 2W9BA 2W9CA 4BXOA 1IM4A 4DQSA 4O3NA 2C2DA 4O3RA 4Q8FA 8ICTA 4FBUA 2NRZA 3G6XA 4RNOA 5EWFA 4ECRA 3RBEA 5KG3A 4I2HA 4X0AA 3RAQA 4FS2A 4DFJA 5DBCA 4M9HA 3M9OB 4O3SA 4IG8A 4F2RA 5J0PA 4Z6CA 5CB1A 4F92B 1WCLA 2R8IA 3PMNA 3PV8A 1SL0A 3TARA 1D9FA 4QZEA 2F1IA 4J9MA 2V9WA 2BCVA 4E0DA 5J0XA 1R8AA 5KFJA 3JPQA 3V6HA 1RYSA 4WC5A 3WFOA 2MAXA 4YD2A 5DDMA 4F4WA 3T5KA 4JWMA 4MFFA 3HP6A 3SZ2A 1R8CA 3M8SA 1NKBA 4UB2A 2M9NA 8ICWA 4FO6A 4FBTA 4PGYA 2P6UA 5KFWA 4UBCA 3PR5B 2Y1JA 5HRDA 2W9BB 4XA5A 4BXOB 4O5EA 3M9NB 3AUOA 3RB0A 1UEUA 1SL1A 4QWAA 1TKDA 1WOTA 2DR8A 3NGDA 4WC3A 2HHWA 3C2LA 2HVIA 1KFTA 3H8SA 5L1LA 1U45A 3FYHA 9ICIA 1XU4A 5KT6A 5IIJA 4ECQA 4B9VA 1WCNA 7ICEA 4M47A 2AU0A 4MEYA 2HHUA 4DLGA 4XQ7A 5CJ7A 7ICQA 3GIMA 4DL5A 4DF8A 4DL7A 2J6UA 4KLIA 1L3VA 2HW3A 2FLPA 4GLXA 3KTQA 1L5UA 4QW9A 1ZJNA 3PW5A 3B0XA 5DB6A 4RT2A 3JPRA 3JZ0A 1KFDA 3OUYA 3PW2A 4RWPA 4X4PA 8ICQA 5L1IA 3T3FA 4RPZA 3ZDDA 4ECZA 2OWOA 2HHXA 1T8EA 5D49A 9ICBA 1SKSA 3K4GA 2XO7A 4LZGA 1S77D 2KZZA 9ICNA 3OGUA 4YG2A 5HR9A 3RH6A 5J0RA 4EP7A 1ZQAA 5KFIA 4I2CA 3Q8PB 5KG6A 1R8BA 3PW0A 1NOMA 2IHNA 4F2SA 4IQVA 1A76A 4FHYA 1LB2B 4MEXA 3T5LA 4ZH4A 3PX6A 3Q8KA 3V6JA 5J2AA 1QSSA 2VA2A 2HHVA 9ICPA 1T7PA 5D4BA 5HHHA 4JWNA 4O0IA 4RU9A 2BDPA 2C2EA 8ICAA 3GV7B 3HIYA 2DVIA 3OUYB 5KFRA 4B9TA 4EBKA 1C7YA 1ZQUA 3KHRA 2BQUA 4BWMA 1A77A 5DB8A 2PI4A 1ZQLA 1JXEA 9ICMA 1KFSA 5HREA 3EWAA 5DGAA 3C2KA 4EEYA 1UT5A 5KFVA 1UETA 2RDIA 4Z6DA 5BPCA 2ASJA 1TK8A 1U49A 1TAQA 4KLFA 5HRFA 4PGXA 1ZQEA 3H4BA 2PFPA 4TUPA 2NRTA 3TI0A 3BQ0A 4MFAA 3MDCA 7ICFA 3JPNA 4YXJA 3OJUA 4M0AA 4B9MA 1VFGA 4NKTA 4QZ9A 5KFDA 4PHDA 1COOA 9ICCA 3PY8A 4O5KA 5KFQA 3MGIA 1V9PA 1KLNA 1XO1A 5BOLA 2DPJA 4C8MA 4AT9A 4UD5A 4P4MA 2W9MA 4JV0A 5KFXA 1NJWA 4ELTA 5IINA 4QWBA 3QZ7A 1JQRA 3KHGA 4I2EA 5KFPA 9ICJA 4M9JA 4GXKA 5KFHA 5J2GA 3QZ8A 2FMQA 3RH4A 9ICOA 3GFKB 4ED1A 1U4BA 3AQLA 4WC1A 1MC8A 4DSKA 2P66A 2UVRA 4I2AA 9ICLA 4AT7A 4BWJA 1TV9A 4DL6A 4FH3A 3RTVA 1MIYA 4UB4A 1HUZA 3RB6A 4F5RA 2ZTCA 4RQ1A 2PI5A 1X9SA 3OVBA 1ZQSA 2ZH8A 1QTMA 2A1JA 5HP4A 1K1QA 5IIOA 1KRPA 4B9UA 1ZQOA 1S0OA 3ZD9A 3GV5B 4P4PA 4C8KA 2NRXA 3QE9Y 1X2IA 5KG7A 3RJHA 4AT9B 2KFZA 2DRAA 4X4UA 1TAUA 4QZBA 5KFOA 5J0QA 4RT3A 5CA7A 2W8LA 4RUCA 1SZPA 4KN4A 4RQ0A 2DR7A 3RJEA 4MFCA 4E7XA 4QZDA 3ISDA 4O3QA 2UVWA 3PO5A 1T4GA 2XGQA 4YMMA 2J6SA 5J2EA 3Q8QB 2H5XA 1S10A 1BGXT 4CCHA 3OHBA 1YLQA 4GXIA 4EZ9A 3M8RA 4UQGA 3V72A 4NY8A 4NLZA 8ICVA 8ICXA 4AT7B 4X5VA 2ZH4A 4X4VA 3ETLA 1ZQXA 4F5QA 8ICHA 4F4ZA 4ED6A 2DPIA 4M9GA 7ICJA 4YFKA 2A1JB 4I2DA 3HW8A 5L1KA 3WFRE 2XY5A 1BPXA 4RQ6A 1NJXA 4PH5A 1X9MA 1IXRA 1Y88A 4J9KA 7ICOA 1KNYA 2JEFA 5KFUA 4XUSA 1NKCA 2ZHBA 4DSJA 5IIMA 1JN3A 4IR9A 5HRHA 2ZTEA 4DOAA 3PVXA 2BKEA 3L9DA 4J9OA 4C8NA 5IILA 4ELUA 2BCQA 5DQHA 3G6VA 3MFIA 1NK5A 4E8FA 5KT5A 4KLOA 4X4OA 5DB9A 2Y1IA 5DG8A 1ZQQA 4R8UA 4RQ7A 4DL2A 2C22A 1NK7A 5J2HA 5IIKA 1RXVA 2BCSA 4M9NA 8ICYA 3EW9A 4R65A 2ZH6A 2ZH1A 5DKWA 2W9CB 1MIWA 3OJSA 2ZH5A 2ID1A 3TAQA 5KFTA 4NM2A 4P2HA 4BGDA 2KN7A 3OVSA 4PPXA 2RDJA 1HJPA 5EOZA 8ICKA 8ICLA 4J9LA 4KITB 2R8HA 2B21A 2FLLA 3RJKA 4Z6FA 3BDPA 3ZDAA 4NM1A 1V4AA 1TFYA 3V7KA 2HVHA 3T5JA 8ICCA 8ICUA 7ICSA 5J2JA 5KT4A 4C8LA 3WFSC 1ZQPA 8ICBA 1DK3A 3HJ1A 3PX4A 5J0YA 4FH5A 3RB3A 1HUOA 1MIVA 3OVAA 4KLSA 4EBCA 2PFQA 4B9LA 4FHXA 4WC4A 3N97B 2ISOA 4YR3A 9ICFA 2KFNA 2PBEA 3OSNA 4KLDA 4KLLA 3GIKA 2R8JA 4R8UB 3HWTA 5BOMA 5TZVA 3MR6A 3LWLA 4QZ8A 4KLEA 3IM1A 4I28A 1QLNA 2FPKA 5J0SA 3MGHA 4RPYA 1S97A 2BGWA 2AJQA 1BNPA 4MF2A 1XC9A 2JEJA 3C21A 4DEZA 4LT6A 3EYZA 1ZQCA 3C5GA 3TFSA 3Q8MA 4KLJA 7ICMA 1U47A 3AQKA 7ICTA 3QEBZ 1ZETA 4X4RA 4X4NA 4PGQA 3THVA 5DLGA 5CHGA 4IR1A 4FS1A 4YR2A 4TQRA 4R63A 4GC6A 1NK0A 4J9RA 3AQMA 4WBZA 3RJJA 4DSFA 1JX4A 5KFFA 4EBJA 3SI8A 4RPXA 2HHQA 3TQ1A 1TFRA 5HRGA 2VANA 4F5PA 1ZQGA 4DWIA 1XWLA 5HMLA 4WBYA 2JEGA 4DQIA 5KFYA 7ICHA 2XGPA 5J29A 4F4YA 2ZH9A 3RH5A 3MR3A 3SV4A 3MR2A 4YR0A 4XRHA 1ZQZA 8ICJA 3H38A 3OHAA 5CWRA 4FHVA 3NTUA 3TFRA 4NLGA 5KTQA 1ZQKA 3WFQE 4IQWA 1JMSA 1ZQHA 1TK0A 4NLKA 2ZH7A 3HT3A 3M9MB 2FLNA 9ICQA 3QEAZ 3H8JA 5KFNA 4F4XA 2UVUA 4Q8EA 8ICFA 1NK8A 3RB4A 9ICWA 5HRKA 3EZ5A 4E80A 3LQCB 2IA6A 5F9NA 2NRVA 4J9PA 4KLQA 2HHPA 2V4QA 1ZQTA 1D8YA 2BCRA 1X9WA 2M2VA 3C23A 5IIIA 2NRWA 4F5NA 1F5AA 3UXNA 4KLHA 4ED3A 4KTQA 2XCPA 2ZJ5A 3GQCA 4I2BA 1S0VA 2DR9A 4M5DA 4ECUA 2ZUCA 2PFOA 3RR8A 4WC6A 4I2FA 4ECTA 4R64A 3RJFA 1BPDA 2DFLA 7ICNA 3H4DA 4NLNA 1NK4A 4DFPA 4DOCA 1NKEA 1ZQRA 4DSIA 4Q45A 2V4RA 1OU5A 1D8LA 2PXIA 3UPSA 3LK9A 2XY6A 1ZJMA 2ALZA 5D46A 4EZ6A 3NYBA 4ATBA 2AQ0A 1Z00A 1SKWA 8ICMA 3AU2A 5DQIA 4YCXA 2Q0ZX 2XCAA 8ICGA 1AROP 4K4HA 4PHEA 2ZUDA 9ICAA 2R8KA 3V7LA 3KHHA 1RZTA 2GWSA 2RFFA 4AT8A 4UBBA 2NRKA 4I2IA 4WCWA 4YQWA 4UD4A 5J0OA 1U9LA 5KG5A 1NK6A 2W8KA 2ZH2A 3FDSA 4B9NA 5KT3A 5KFLA 2W9AA 1S76D 4EBDA 4DFMA 3MFHA 4ED7A 4QWCA 3BQ1A 3GIIA 2P6RA 5F2VO 8ICIA 4RQ2A 4QZAA 9ICRA 5DECA 1DGSA 4I27A
chains in the Genus database with same CATH superfamily
5HRBA 1UT8A 3SR6A 1RG6A 4C4TA 4DSEA 2L5YA 3SENA 7ICKA 2Y9UA 7ICVA 5KFMA 4Q44A 1FFUA 4QZGA 1KTQA 4IRKA 4MF8A 1LV5A 1BPZA 3UQ2A 5D63A 3UXPA 2E8NA 4O3OA 2DF4B 3JYYA 2A19A 3PMLA 5AKGA 2C28A 1U48A 4KLGA 5HMMA 2F1HA 7ICPA 1L3UA 2H3IA 7ICIA 1NK9A 2K8AA 1Z19A 4FE3A 3UMCA 1ZQDA 5J2FA 2KSOA 1XSNA 5AK5A 5KT2A 2AXTU 4RNMA 3EPGA 3PX0A 3HKZF 4EGWA 4F5OA 3TANA 5ALLA 2ATLA 4Z6EA 1PZNA 3VCBA 1JIHA 1KL9A 5F3XB 5CP2A 3LDAA 1ZD5A 4K8VA 4YD1A 2FCLA 9ICTA 4PZOA 3K7DA 3JPOA 3UXOA 3M6KA 4RWOA 1UEVA 2KSOB 2XVTA 3NRWA 5F9LA 2EZZA 2KMDA 2EWRA 4JUZA 1N48A 4DSLA 4RWQA 3AU6A 2HCFA 5GTIU 1F44A 2EH9A 4IRDA 1UQVA 4K4GA 1ZYQA 1N2XA 2LPEA 2E8PA 2FMSA 2GA9D 2B0CA 5DBBA 3GDXA 3ISCA 5DG9A 2H3VA 1Z4OA 3PZPA 4YVZA 5ALVA 1D9DA 2XC9A 2VA3A 2BPCA 5TISU 4TQSA 4EBEA 4YXMA 4KX5A 4WC2A 2YQEA 4ED8A 1XS9D 4UB3A 2FPLA 4ED2A 4M6WA 4F4KA 4NXZA 4FO1A 1JALA 2G0AA 1XNSA 1AQ6A 8ICNA 4WC0A 3WKCA 3UQ0A 4UAYA 1K1SA 5AIBA 3HPOA 1S9FA 3T5HA 1COKA 1NO5A 4LVSA 4IQUA 3MR5A 4M6WB 5DBAA 4RQNA 2M2UA 1L7MA 2F8KA 4DQQA 3ETRA 3OSPA 4JK1A 4J9NA 4F91B 1Z3EB 3L4PA 2W9BA 3PSFA 2W9CA 4O3RA 8ICTA 5AM0A 4IG8A 3KOOA 4Z6CA 3PV8A 1SL0A 1WCLA 3PMNA 2F1IA 4J9MA 1R8AA 5KFJA 4WC5A 2KNJA 3N7RC 4F4WA 3T5KA 3HP6A 4U6PA 1R8CA 3M8SA 3CW2C 1NKBA 4C0ZA 4FBTA 2W9BB 3RB0A 5ALXA 2N1RA 3C2LA 1KFTA 5L1LA 3I1YA 3FYHA 4ECQA 1WCNA 3E0FA 2DGZA 5G5GA 2AU0A 3ZI4A 4NXWA 7ICQA 3GIMA 2HW3A 3CYMA 4QW9A 3D2QA 3B0XA 3PSIA 3JZ0A 1KFDA 4X4PA 2LM1A 4KB6A 1NNLA 3K4GA 2K4IA 4OJOA 4EP7A 5KL8B 5KFIA 3ALRA 3SAFA 4I2CA 5KG6A 3LYSA 4FHYA 1LB2B 2RHFA 4ZH4A 3PX6A 3CRXA 9ICPA 4JWNA 4O0IA 4RU9A 2F44A 5KFRA 1WWUA 5AM5A 2PI4A 2EQYA 5HREA 2ZIXA 1UT5A 4Z6DA 2ASJA 3TADC 2PFPA 1PK3A 3BQ0A 4K97A 2XIDA 5KFQA 1V9PA 5J8YA 5KFXA 1NJWA 4ELTA 5AI6A 2CPRA 4ED1A 1MC8A 3M6ZA 4DSKA 2ZIXB 3RTVA 1HUZA 5C0YA 2ZH8A 1QTMA 2A1JA 5IIOA 4B9UA 4BUGA 2P35A 3GV5B 2DKZA 4X4UA 1TAUA 2W8LA 2D8CA 4KN4A 3RJEA 2UVWA 1T4GA 2XGQA 2J6SA 2DUYA 1BGXT 4CCHA 3OHBA 2BBHA 4GXIA 4EZ9A 2KG5A 4NLZA 4U7CA 2MSNA 4EENA 1SXEA 1ZQXA 3BS7A 4F4ZA 4YFKA 2A1JB 3HW8A 5L1KA 4NXTA 4PH5A 1IXRA 1PVPA 3LVWA 3D6JA 2ZHBA 5KFUA 4OCZA 2ZTEA 2VJ5A 1X42A 3PVXA 2B4VA 2BCQA 4QJFB 3MFIA 4KLOA 5DB9A 2C22A 5J2HA 5IIKA 5JTIA 4LEVA 2ZXIA 1MIWA 2QARA 4NM2A 1HJPA 2CN1A 2FLLA 4KITB 2R8HA 2B21A 3RJKA 8ICCA 7ICSA 3WFSC 5KT4A 8ICBA 1DK3A 4NWIA 1HUOA 4O69A 1MIVA 2RLTA 4EBCA 4FHXA 4OAFA 2AHOB 4UB6U 3N97B 9ICFA 4YR3A 4KLLA 3HWTA 5TZVA 1V97A 1F0MA 3NVOA 4Y2UA 2QARB 2BGWA 4LT6A 4MF2A 3EYZA 1ZQCA 3Q8MA 7ICMA 3B9JA 4X4RA 5AHXA 7ICTA 4PGQA 3F2CA 4TQRA 1NK0A 4PL1A 3FC4A 5KFFA 2HN1A 1L8OA 3H0MB 4F5PA 4DWIA 4N7RA 2JEGA 2K89A 4F4YA 3RH5A 3MR3A 3SV4A 3WKEA 3H0LB 1JMSA 1TK0A 4NLKA 3AL0B 2FLNA 3DDHA 3H8JA 1JAJA 4E80A 1NK8A 3RB4A 3LQCB 5ALJA 2IA6A 2WAQC 5F9NA 2NRVA 4KLQA 3BZKA 1D8YA 2VKQA 1ZRNA 3C23A 3IG8A 3UXNA 4KLHA 2YB1A 3GQCA 4I2FA 1BPDA 3QNMA 4OJPA 1NK4A 1SGGA 1WG8A 1ZQRA 4Q45A 1N60A 3KKAA 2XY6A 1ZJMA 2ALZA 5D46A 3NYBA 1SKWA 3ED5A 4YCXA 4KMOB 9ICAA 3KHHA 1Q3UA 3RF9A 2NRKA 1C20A 4B9NA 5D62A 1HIWA 2IUBA 1F5SA 4ED7A 2CRXA 5F2VO 4RQ2A 5DECA 4I27A 2ESEA 4QZHA 4NLCA 4EYHB 5L1JA 3JPSA 4X4TA 4YN4A 1MQ3A 4DS5A 4DOBA 4MHVA 3TACB 4EEBA 4EX6A 3C18A 4WQKA 1L7NA 4TUSA 1ZQVA 4I2GA 3M7DA 4DQPA 5HHIA 4K4IA 5EWGA 9ICUA 4DF4A 8ICOA 4OJ6A 1SB3C 3Q8RB 3MBYA 1Q46A 3H7IA 2PKEA 1L7PA 5KG2A 2KOBA 2NV3A 4S3NA 2KD1A 5J2BA 2KP7A 1S0NA 2EANA 3KZIU 4UAWA 2A1AA 4TUQA 3E2EA 3RRHA 4X4SA 1YZ7A 1X66A 4YMOA 1MQ2A 9ICHA 5GTHU 1JXLA 2FJ6A 2W11A 1MSWD 2O1PA 7ICGA 3H39A 1UA0A 1NJYA 4KLUA 5L9XA 3SAHA 4M04A 4G3IA 1PVQA 3A0HU 2ZHAA 3N28A 3OV7A 3GIJA 3V7JA 2BE3A 3MCRA 1NJZA 1DOQA 3RBDA 3F5AA 3C5FA 3QUQA 2ZJ8A 2FDRA 2R8GA 5ALTA 4ECXA 3SYZA 2JZBA 1T3NA 3AMZA 2Z7JA 2I9GA 5DLFA 2HMXA 4C8OA 2K60A 3WK4A 4IC9A 4JV1A 4JV2A 1ZQJA 2JEIA 3GV8B 4LZDA 5ALIA 1RYRA 1QH9A 4YMNA 1ZQWA 4RQ8A 5J2IA 1KW4A 3QU9A 2WTFA 2E3TA 5HC9A 3JPPA 1ZXIA 3OPXA 4YP3A 3UMBA 3GILA 4DL3A 9ICGA 2JZBB 3F53A 1O08A 4F3OA 5CRXA 5AM3A 3BQ2A 1B22A 5DEDA 3EUB2 3AQNA 5C5JA 2LBOA 5G5HA 5KG4A 3ZD8A 9ICEA 3ICXA 4DFKA 3WK5A 2YX8A 3KBBA 4KX3A 4QWEA 1IV8A 9ICVA 4K96A 4UB5A 1FFVA 2QKQA 4I2JA 3CK6A 1DGJA 4QZFA 4BDPA 2BCUA 2H3QA 4PHAA 1PUZA 1BVSA 1RXWA 4R66A 2WB1F 3C66A 1Z1BA 1CUKA 3ZDBA 4I29A 4P4OA 2IHMA 5KFZA 2M0NA 5AICA 2XI9A 2C2DA 1TAMA 2NRZA 3RBEA 5DBCA 3M9OB 4O3SA 4F2RA 3QUTA 4F92B 2R8IA 2O5AA 3BZCA 3TARA 4QZEA 2CXYA 5J0XA 3JPQA 2DBYA 3V6HA 1ECWA 4DCCA 3WFOA 2MAXA 4YD2A 5DDMA 5AI4A 4KM5A 2W03A 3PR5B 5HRDA 2DR5A 4XA5A 4NKUA 4WQLA 5HR6A 2Y9TA 1A0PA 2HHUA 4XQ7A 2HN2A 2W7OA 1L3VA 2FLPA 1ZJNA 2ZIVA 3HILA 4Y2JA 3OUYA 2EZXA 4G9BA 4LEYA 8ICQA 4J03A 1T8EA 5D49A 1VDVA 1S77D 5HR9A 2MRLA 5ALYA 2B6GA 3WKAA 3Q8PB 1R8BA 3PW0A 1NOMA 2IHNA 4IQVA 1A76A 1TE2A 3LVVA 3T5LA 1QSSA 2ZIVB 2C2EA 2JXJA 3OUYB 4B9TA 4EBKA 3D2SA 4OAGA 4Y2VA 3EWAA 5DGAA 5KFVA 3NUQA 5HRFA 2ZXHA 4GFJA 4OAIZ 1UCVA 4MFAA 7ICFA 4UAUA 1XO0A 4B9MA 1VFGA 5KFDA 2LHTA 5ALSA 4OD0A 5A0LA 2DPJA 4Y2YA 2DWQA 2YTUA 5L1MA 3KHGA 4I2EA 9ICJA 4GXKA 3AQFA 5KFHA 3QZ8A 2YMLA 1GPJA 3QUBA 3AQLA 1RQLA 3N7SC 2LKYA 1JROA 1SWVA 3MC1A 3I76A 4UB4A 1FO4A 1T3QA 4RQ1A 1OUQA 1ZQSA 2IOHA 5HP4A 1K1QA 1ZQOA 2EAMA 4HAIA 3WU2U 1S0OA 1JI7A 4P0PA 4C8KA 3QE9Y 1X2IA 2DRAA 5KFOA 3NASA 3F5EA 5CA7A 4RUCA 1SZPA 1SV4A 5AKYA 4QZDA 3ISDA 3HKZC 3PO5A 4MKPA 5J2EA 3QXGA 1YLQA 4AP9A 3V72A 4UQGA 8ICXA 8ICVA 4XJEA 2ZH4A 1HEKA 3ETLA 4ED6A 4O6AA 2DPIA 7ICJA 4I2DA 1BPXA 4RQ6A 7ICOA 1Y88A 4J9KA 2KJ5A 2JEFA 4XUSA 4P0PB 4DSJA 5IIMA 4IR9A 5AK4A 3QYPA 4UB8U 3WK6A 4DOAA 1Q8KA 3CP8A 5DQHA 2ES6A 4X4OA 5AK3A 4RQ7A 4DL2A 1RXVA 2ODGA 8ICYA 2BCSA 3EW9A 4R65A 2W9CB 1SV0C 3OJSA 5KFTA 2HI0A 3JCFA 2KN7A 4JLXA 5AKKA 4K9AA 4J9LA 1TFYA 4OJLA 3ZDAA 5B3QA 2R18A 2HVHA 2OM6A 2A3VA 3MGVA 1ZQPA 3PX4A 5J0YA 2IOFA 3OVAA 2K4PA 1X9XA 1V85A 4B9LA 4WC4A 3ONNA 2KFNA 3OSNA 4KLDA 3GIKA 2R8JA 1L8LA 3T79A 4I28A 4I0UA 1CI4A 3IG5A 4WJ3B 2JEJA 1T94A 2IHOA 3C5GA 2D6FC 3S6JA 1KN5A 5KAFU 4GC6A 3AQMA 2HBLA 2PMZF 4WBZA 4EBJA 3SI8A 2HHQA 5EE1A 5HRGA 2NO4A 1ZQGA 2LYBA 4C4RA 4WBYA 5KFYA 1M6YA 3MR2A 4XRHA 8ICJA 2GO7A 3H38A 4FHVA 4NLGA 3WFQE 5KTQA 5AK6A 1MA7A 3HT3A 3M9MB 9ICQA 3QEAZ 5KFNA 8ICFA 1ZQ1C 2UVUA 3EZ5A 1QCKA 2WF6A 5KAIU 1ZQTA 2BCRA 1A6SA 3J81j 1F5AA 1LVHA 3F2BA 4EX7A 2B51A 1S0VA 4M5DA 4WC6A 3RR8A 3RJFA 2WF5A 2DFLA 3H4DA 1OU5A 2V4RA 1D8LA 2PXIA 3WK7A 1Z00A 1RYUA 4K4HA 1RZTA 2GWSA 4WCWA 3D2NA 5J0OA 4Y2RA 4CF4A 2ZH2A 3FDSA 5KT3A 2W9AA 2KK0A 1CRXA 4EBDA 4DFMA 3MFHA 4NV0A 3GIIA 1SKRA 3UM9A 2LYHA 1Z00B 4F8RA 5EWEA 2BPFA 2YMPA 2WAQF 1XSLA 5ALOA 5DB7A 2IMWP 2KZ3A 5KG1A 2AGQA 2ISPA 1QSLA 4ACOA 5DGBA 2HOQA 5ALMA 3AQEA 7ICUA 4F50A 4ECVA 3HJ4A 2JRZA 5KFCA 3IN5A 1ZQNA 5KT7A 5J2DA 5AIAA 1RM6C 4QW8A 1PX5A 2HBJA 2KKVA 3TADA 5ALEA 4GC7A 4PZNA 4IQTA 3N4MB 3QU2A 1EXNA 3IHQB 2HBKA 3SAGA 1SL2A 3RAXA 4KLMA 2QB1A 3NVWA 4K99A 3FAHA 4IS7A 4QWDA 1Q78A 1KBUA 3BJYA 4RQ3A 3B0YA 1X40A 2OH2A 2JR5A 3F2DA 2KZMA 8ICPA 3H37A 5DQGA 4HYKA 4ECYA 2ZTDA 1KDHA 4BJQA 4LJXA 2Y0SF 5KFSA 4Y2TA 4M9LA 3Q8LA 4FZMA 2HSZA 2NYVA 5J2KA 2XY7A 4DQRA 2YMQA 4NL9C 1R89A 1S5LU 3K75D 4CF3A 2BQRA 3ERCC 5DDYA 4ED0A 4RNNA 3H8WA 1PK1A 4NXVA 2I1QA 3ORYA 8ICSA 4ECSA 2PFNA 1BNOA 5CR0A 4BX9C 3HRDD 4EV6A 2DKXA 3MDAA 2BPGA 4O68A 3WK8A 4F93B 4QIWF 3ZDCA 2W43A 2HOFA 1Q3VA 4EEDA 2F2AB 4CRXA 4IRCA 5HRIA 2HHTA 1TFWA 1PK1B 2RQ5A 4KMUA 1JRPA 2BR0A 9ICXA 1TK5A 3SMVA 2VA8A 4DO9A 5J0TA 5JUMA 5AM2A 5HNKA 3H40A 1DK2A 3EPIA 1N62A 3G6YA 2I6XA 5J2CA 3H3AA 3RJIA 2BHNA 4USAA 3SEIA 3IDWA 5D61A 1RPLA 7ICRA 5DG7A 4ECWA 3SV3A 3C29A 2H3ZA 2M2WA 5AI8A 2J6TA 1D8BA 5HRLA 1ZQFA 2QLTA 1FIQA 4BXOA 5AKJA 5CFSA 4DQSA 4O3NA 4Q8FA 4FBUA 2W7PA 3G6XA 4ECRA 5KG3A 4I2HA 4AYBF 4X0AA 4M9HA 2W3SA 5CB1A 2BCVA 4E0DA 1RYSA 5JU5A 4JWMA 3SZ2A 3QU5A 2WF9A 1Z1VA 4UB2A 1URJA 2M9NA 8ICWA 3E58A 2P6UA 3PHZA 4Y2QA 4BXOB 4US8A 3AUOA 1UEUA 1SL1A 1WOTA 2DR8A 3NGDA 5AI5A 2HHWA 2HVIA 3H8SA 1U45A 2ZIWA 5KT6A 1WWVA 4B9VA 7ICEA 2LYAA 4DLGA 1YZ6A 4DF8A 2K4HA 2J6UA 1Z4NA 4GLXA 4A8EA 3KTQA 3JPRA 1YT3A 2W3RA 4RT2A 4RWPA 5AI9A 5FP0A 5L1IA 3ZDDA 2WFAA 4ECZA 2OWOA 2HHXA 5ALWA 9ICBA 9ICNA 5E79U 3OGUA 2W55A 4PL2A 4YG2A 4UASA 3RH6A 2FI1A 3O0FA 2ZIWB 5B66U 4PJ0U 3Q8KA 5D4BA 1IIPA 8ICAA 2DVIA 3GV7B 4Y2XA 2G09A 1ED1A 4IL6U 4BWMA 5DB8A 5ALPA 1ZQLA 1JXEA 3C2KA 2RP5A 2RDIA 1TK8A 1TAQA 4KLFA 4PGXA 2KKPA 3QU7A 4TUPA 2NRTA 2RRDA 1RQNA 4YXJA 3GU3A 4M0AA 4PHDA 3PY8A 4O5KA 1KLNA 5BOLA 4AT9A 2ZIUA 3NS1A 2W9MA 4JV0A 5ALFA 3UMGA 5IINA 4HX0A 4M9JA 5J2GA 1N5WA 3RH4A 9ICOA 4WC1A 2UVRA 9ICLA 1KKXA 4BWJA 1TV9A 4DL6A 4AT7A 1MIYA 1N61A 3RB6A 2PI5A 1VJ5A 1X9SA 2JMGA 2ZG6A 1KRPA 3ZD9A 2NRXA 5AM4A 3SD7A 2ZIUB 3RJHA 2KFZA 4AT9B 5J0QA 3N7PD 4E7XA 4MFCA 2IOFK 3Q8QB 2H5XA 1S10A 4AT7B 4X4VA 4X5VA 3QX7A 8ICHA 4M9GA 5HR7A 3VC8A 4F72A 1UHUA 1NJXA 5HRHA 2HBMA 2BKEA 2H3FA 4J9OA 4ELUA 3AM9A 2Y1IA 1ZQQA 2AH5A 2ZH1A 3TAQA 3OVSA 2G5HB 1J2NA 4P2HA 1WUDA 5ALQA 2RDJA 5ALUA 4CNQA 5EOZA 2KV2A 8ICLA 1V4AA 2E8MA 2MA1A 2W04A 3OTQA 4Z6FA 4NM1A 3V7KA 5J2JA 4C8LA 4B6JA 4UW9A 3I28A 4FH5A 4C80A 2B56A 3BQ7A 2KEYA 3NVZA 2PFQA 5ALDA 3L5KA 2BZFA 5BOMA 3MR6A 2F76X 4KLEA 2FPKA 1S97A 1BNPA 2JH1A 3C21A 2W54A 4DEZA 5AKZA 4KLJA 5ALHA 1U47A 4X4NA 4IR1A 4YR2A 4R63A 3RJJA 4DSFA 3TQ1A 4US9A 1PVRA 1TFRA 4UARA 2VANA 4OO1J 2HOIA 2G07A 5B3PA 4DQIA 2XGPA 2KICA 2K8BB 1ZQZA 1SIJA 3OHAA 5CWRA 3TFRA 1ZD4A 1ZQKA 2ZH7A 3NVVA 4FZNA 2KJ9A 1L7OA 2KVSA 2V4QA 2WB1C 3NRZA 2M2VA 5IIIA 1P7DA 2NRWA 4F5NA 4CGZA 2XCPA 3NKUA 1ZD2P 4ECUA 2ZUCA 2PFOA 3ER8C 4ECTA 4R64A 4NXXA 5ALGA 7ICNA 4NLNA 2I5HA 1NKEA 3QUCA 4GIBA 3LK9A 4ATBA 2AQ0A 5DQIA 2XCAA 2Q0ZX 8ICGA 1AROP 4PHEA 2ZUDA 2R8KA 3V7LA 5ALKA 4AT8A 3IP4B 4UBBA 4YQWA 1U9LA 1KQQA 5KG5A 2K4EA 2NO5A 2W8KA 4WOYA 2KE7A 5KFLA 3DEEA 4OAHA 5ALZA 1VLBA 1OW5A 5JRTA 9ICRA 3PNCA 4ATBB 5KG0A 1FA0A 5KFKA 4OJ5A 5AKXA 4AT8B 4FHWA 2BDUA 4UAVA 4Q43A 4TURA 4C7ZA 2ASLA 2GLEA 3FM9A 2WHEA 4LEZA 3RJGA 4FFDA 1ZQMA 4UB1A 2JGAA 3C28A 4O67A 2Q66A 4O9MA 3PO4A 4B9SA 3JPTA 3UPQA 3C1ZA 4XQ8A 3IV6A 4PHPA 1JX4A 5J8YC 1B4FA 1JUDA 4RUAA 3ISBA 4NJ8A 2ZUBA 2DQNB 4QZCA 3U26A 2EAPA 1KEJA 1N56A 1ZQYA 4O5CA 2ASDA 3OWGA 4JLZA 4DL4A 3KD3A 2ZJAA 2IBKA 3RR7A 2M2TA 5EE0A 1S0MA 1B43A 1NI3A 4QZIA 1TVAA 3PSPA 4WC7A 5J0WA 3PR4A 3KFUF 4DLEA 7ICLA 3RRGA 3TAPA 3PSTA 2C2RA 2EDUA 2VIXA 2VJ4A 1NZPA 5KFBA 2F3NA 1DXSA 2EAOA 4RQ5A 4RQ4A 3L3FX 1VJ7A 9ICKA 9ICSA 3PW4A 1MN8A 2AGPA 4UAZA 2MUTA 2G5IB 5KFEA 3KHLA 5KFAA 3NVYA 4RZRA 4EYIB 5CFUA 4FHPA 3ER9B 3Q8SB 4RQMA 1SWWA 1L3TA 4DS4A 2AGOA 2G06A 3C1YA 4EEKA 5EE3A 2FPMA 1UA1A 3C2MA 2DRBA 3ZDEA 2MUTB 5J0UA 3QU4A 1DRGA 4X0BA 3R9KA 1KSPA 5AKLA 1FEZA 3H0RB 2KIWA 1ZD3A 1SV0A 1BPEA 3BQTA 4O3PA 4WH5A 4J9QA 3MABA 1ZQIA 1L3SA 1QSYA 8ICEA 1OXJA 3K1RB 1ZOLA 1XSPA 4ELVA 3HX0A 2AQ4A 5KFGA 2KTQA 5AKEA 3WKBA 2UVVA 5CEHA 2ZH3A 8ICRA 3WFPA 4M2YA 8ICZA 4FZLA 4X4QA 2YMMA 1BPYA 2Q4TA 3V6KA 1K5OA 1CEZA 3SQIA 1IG6A 1X6JA 1ZQBA 4KLTA 4ICAA 2KJ8A 3PW7A 2K8CB 4KN7A 2F1JA 3LWMA 2FMPA 4Y2SA 2OXOA 4K98A 2BQ3A 2KIVA 4GXJA 2E1FA 1Q79A 2HHSA 2LMRA 1H38A 1BPBA 4J9SA 4RWNA 1N63A 5KL1B 1J97A 2GOLA 4CDGA 1IM4A 4RNOA 5EWFA 4UATA 3RAQA 4FS2A 4DFJA 3IRUA 5J0PA 1D9FA 2PMZC 5B5EU 2V9WA 1ZRMA 2OHFA 4MFFA 3KKAC 4FO6A 4PGYA 5KFWA 4UBCA 2XICA 2Y1JA 4O5EA 3M9NB 4P0QA 4DFDA 3H8MA 4QWAA 1TKDA 2JH7A 4WC3A 3HJEA 9ICIA 1XU4A 5EE9A 5IIJA 4M47A 1B0XA 4MEYA 3WKDA 5CJ7A 4DL5A 4KLIA 4C4SA 4DL7A 1L5UA 3PW5A 5DB6A 3PW2A 1RDFA 2JV3A 4RPZA 3T3FA 2JHDA 2KHQA 1SKSA 4P0QB 1N5XA 2XO7A 4LZGA 2KZZA 5J0RA 1ZQAA 3AN1A 4F2SA 4MEXA 2VA2A 3V6JA 5J2AA 2HHVA 3WK9A 1T7PA 5HHHA 2BDPA 3HIYA 5H2FU 1C7YA 1QQ6A 1ZQUA 3KHRA 2BQUA 1NZBA 1A77A 9ICMA 1KFSA 4EEYA 5T14A 1UETA 5BPCA 1U49A 1ZQEA 3H4BA 4LEWA 3TI0A 3MDCA 3JPNA 3OJUA 2O6KA 4NKTA 5AKIA 4QZ9A 2GAFD 4NXUA 1COOA 9ICCA 2LI6A 2YY6A 3MGIA 1XO1A 4C8MA 4UD5A 4P4MA 2GH1A 1JQRA 4QWBA 2OCEA 3QZ7A 5KFPA 2FMQA 3GFKB 1U4BA 4Y2PA 2P66A 4I2AA 4FH3A 3M1YA 5AM1A 4F5RA 2ZTCA 3OVBA 2FE9A 1SZHA 4O3MA 1QQ7A 4C7YA 4P4PA 2DL0A 3NWIA 5CHEA 3TKAA 5KG7A 2HDOA 4QZBA 4RT3A 4RQ0A 2DR7A 4O3QA 1X6IA 4YMMA 5AKHA 3M8RA 4NY8A 4F5QA 3A0BU 2KHVA 3WFRE 2WF7A 2XY5A 2LM4A 1X9MA 2D3DA 1KNYA 4NL9A 1NKCA 1JN3A 2F77X 3L9DA 5IILA 2Y0SC 4C8NA 2QB0A 3BS5A 3G6VA 1NK5A 4E8FA 5KT5A 3GZFA 5DG8A 2F8LA 4R8UA 1NK7A 1WYGA 4M9NA 2ZH6A 5DKWA 2ZH5A 2ID1A 4QNLA 4BGDA 4PPXA 2OYYA 8ICKA 3BDPA 3DV9A 3T5JA 2OEHA 8ICUA 3K1ZA 1LKYA 1QQ5A 3HJ1A 2MU2A 3AEVA 3RB3A 4CE6A 4KLSA 2QB0B 3BS5B 4NLBA 2ISOA 4EELA 2PBEA 1J2MA 2E1EA 4R8UB 3LWLA 4QZ8A 3IM1A 4QIWC 4CF5A 5K4LA 1QLNA 5J0SA 3MGHA 4RPYA 2YN4A 4JMUA 2AJQA 1XC9A 1O03A 3RFAA 3TFSA 1UPHA 2E8OA 3AQKA 3QEBZ 1ZETA 3THVA 5DLGA 5CHGA 1LKYB 4FS1A 4J9RA 1GO3F 4F71A 4RPXA 2E5SA 1S8OA 3EF2A 1XWLA 5HMLA 7ICHA 5J29A 3KZXA 5AI0A 2ZH9A 5ALRA 4YR0A 5JTGA 2G08A 3NTUA 2EZYA 4IQWA 1ZQHA 4F4XA 4Q8EA 9ICWA 4K9BA 5HRKA 2BBJA 2HHPA 4J9PA 5ALNA 1X9WA 4ED3A 2YB4A 4KTQA 1V38A 2ZJ5A 2DR9A 4I2BA 2WF8A 4DFPA 4DOCA 4AYBC 4DSIA 4JB3A 2KVCA 3UPSA 4EZ6A 8ICMA 3AU2A 2RFFA 4I2IA 4UD4A 1NK6A 1L6NA 1S76D 5CFTA 4QWCA 1SXDA 3BQ1A 2P6RA 8ICIA 3CNHA 4QZAA 1DGSA 5KNIA 4ZOHC
chains in the Genus database with same CATH topology
1SKRA 3PNCA 4QZHA 4ATBB 2LYHA 5KG0A 4EYHB 1FA0A 1Z00B 5HRBA 5L1JA 3JPSA 4F8RA 4YN4A 1MQ3A 4DS5A 1UT8A 5KFKA 4DOBA 4X4TA 3C18A 5EWEA 2BPFA 4DSEA 4AT8B 4FHWA 4TUSA 1ZQVA 4Q43A 5DB7A 1XSLA 4I2GA 4TURA 2IMWP 2ASLA 4DQPA 5HHIA 2KZ3A 5KG1A 7ICKA 2AGQA 7ICVA 5KFMA 2ISPA 1QSLA 4K4IA 5EWGA 5DGBA 4Q44A 3RJGA 9ICUA 1ZQMA 4DF4A 4QZGA 7ICUA 8ICOA 1KTQA 4UB1A 4F50A 3Q8RB 4ECVA 3MBYA 4IRKA 3HJ4A 4MF8A 3H7IA 5KFCA 2Q66A 1LV5A 1BPZA 4O9MA 3UQ2A 5KG2A 3PO4A 4B9SA 3JPTA 4O3OA 3UXPA 3UPQA 3C1ZA 1ZQNA 3JYYA 3PMLA 4XQ8A 4PHPA 2C28A 1U48A 5HMMA 5KT7A 5J2DA 2F1HA 4RUAA 3ISBA 1L3UA 7ICPA 4QW8A 7ICIA 5J2BA 1NK9A 1PX5A 4S3NA 2KP7A 1S0NA 2ZUBA 4QZCA 1KEJA 1N56A 1ZQYA 1ZQDA 5J2FA 4UAWA 4O5CA 4GC7A 2ASDA 1XSNA 4TUQA 4IQTA 4DL4A 5KT2A 3E2EA 2ZJAA 3N4MB 3RRHA 2IBKA 1EXNA 4RNMA 3EPGA 3IHQB 3PX0A 4X4SA 4F5OA 3TANA 3RR7A 1SL2A 4YMOA 2ATLA 1MQ2A 3RAXA 4KLGA 2M2TA 1S0MA 4Z6EA 1B43A 1PZNA 4QZIA 1TVAA 4KLMA 1JIHA 9ICHA 5J0WA 4WC7A 3PR4A 1JXLA 1MSWD 2O1PA 4DLEA 5CP2A 7ICGA 3H39A 1UA0A 1NJYA 3RRGA 4QWDA 7ICLA 1Q78A 3TAPA 3BJYA 4RQ3A 4KLUA 2C2RA 3B0YA 5L9XA 3LDAA 4M04A 4G3IA 2KZMA 4YD1A 8ICPA 5KFBA 9ICTA 1NZPA 3H37A 5DQGA 2ZHAA 3JPOA 3OV7A 3GIJA 3V7JA 2BE3A 4HYKA 4ECYA 3UXOA 2ZTDA 4RWOA 1KDHA 1UEVA 1NJZA 1DOQA 4RQ5A 5F9LA 4NKUA 5KFSA 4RQ4A 4M9LA 3RBDA 1VJ7A 3Q8LA 9ICKA 9ICSA 3PW4A 3C5FA 5J2KA 4JUZA 2AGPA 2ZJ8A 2XY7A 4UAZA 2MUTA 1N48A 4DSLA 4RWQA 3AU6A 2R8GA 4DQRA 5KFEA 3KHLA 4ECXA 3SYZA 1R89A 2JZBA 5KFAA 1T3NA 4IRDA 4K4GA 3K75D 2BQRA 1ZYQA 4RZRA 5DDYA 4EYIB 4ED0A 4FHPA 3Q8SB 4RNNA 2I9GA 1L3TA 2FMSA 3H8WA 5DLFA 4DS4A 4C8OA 5DBBA 2I1QA 3ORYA 4JV1A 2AGOA 1ZQJA 4JV2A 8ICSA 2JEIA 3GDXA 3ISCA 3GV8B 5DG9A 4LZDA 4ECSA 1RYRA 3C1YA 2PFNA 4YMNA 1ZQWA 4RQ8A 4YVZA 5CR0A 1BNOA 5J2IA 2WTFA 1D9DA 2FPMA 2XC9A 1UA1A 3C2MA 2DRBA 3ZDEA 2VA3A 5HC9A 3JPPA 2BPCA 4TQSA 2O5AA 2MUTB 5J0UA 4YP3A 3MDAA 4EBEA 2BPGA 4X0BA 4F93B 3GILA 4YXMA 4DL3A 1KSPA 3ZDCA 2JZBB 9ICGA 4F3OA 3BQ2A 1B22A 4WC2A 1BPEA 5DEDA 3BQTA 4O3PA 4ED8A 1XS9D 4IRCA 5C5JA 4UB3A 5HRIA 2FPLA 2HHTA 3AQNA 4ED2A 1TFWA 4M6WA 4F4KA 4J9QA 4NXZA 4KMUA 5KG4A 3MABA 3ZD8A 1ZQIA 9ICEA 1L3SA 1QSYA 4DFKA 2BR0A 8ICEA 8ICNA 1XSPA 1TK5A 4ELVA 9ICXA 3HX0A 2VA8A 5KFGA 4QWEA 2AQ4A 2KTQA 4WC0A 9ICVA 4DO9A 2DR5A 2UVVA 5J0TA 8ICRA 3WFPA 2ZH3A 4M2YA 5JUMA 8ICZA 4X4QA 5HNKA 1BPYA 3H40A 3UQ0A 4UB5A 1DK2A 3EPIA 4UAYA 3V6KA 1CEZA 4I2JA 1K1SA 3G6YA 4QZFA 5J2CA 1ZQBA 4BDPA 4KLTA 3H3AA 2BCUA 3PW7A 3RJIA 2BHNA 3HPOA 1S9FA 3T5HA 1NO5A 4LVSA 4KN7A 4IQUA 1RPLA 2F1JA 3LWMA 2FMPA 7ICRA 3MR5A 4M6WB 5DBAA 4PHAA 2BQ3A 2M2UA 4GXJA 5DG7A 4ECWA 1JAJA 3SV3A 1Q79A 2HHSA 1BVSA 1RXWA 1H38A 1BPBA 4R66A 4J9SA 4DQQA 2M2WA 4RWNA 3C66A 2J6TA 3OSPA 1CUKA 4JK1A 3ZDBA 4J9NA 4I29A 5HRLA 4F91B 1ZQFA 4P4OA 1Z3EB 2IHMA 5KFZA 2W9BA 2W9CA 4BXOA 1IM4A 4DQSA 4O3NA 2C2DA 4O3RA 4Q8FA 8ICTA 4FBUA 2NRZA 3G6XA 4RNOA 5EWFA 4ECRA 3RBEA 5KG3A 4I2HA 4X0AA 3RAQA 4FS2A 4DFJA 5DBCA 4M9HA 3M9OB 4O3SA 4IG8A 4F2RA 5J0PA 4Z6CA 5CB1A 4F92B 1WCLA 2R8IA 3PMNA 3PV8A 1SL0A 3TARA 1D9FA 4QZEA 2F1IA 4J9MA 2V9WA 2BCVA 4E0DA 5J0XA 1R8AA 5KFJA 3JPQA 3V6HA 1RYSA 4WC5A 3WFOA 2MAXA 4YD2A 5DDMA 4F4WA 3T5KA 4JWMA 4MFFA 3HP6A 3SZ2A 1R8CA 3M8SA 1NKBA 4UB2A 2M9NA 8ICWA 4FO6A 4FBTA 4PGYA 2P6UA 5KFWA 4UBCA 3PR5B 2Y1JA 5HRDA 2W9BB 4XA5A 4BXOB 4O5EA 3M9NB 3AUOA 3RB0A 1UEUA 1SL1A 4QWAA 1TKDA 1WOTA 2DR8A 3NGDA 4WC3A 2HHWA 3C2LA 2HVIA 1KFTA 3H8SA 5L1LA 1U45A 3FYHA 9ICIA 1XU4A 5KT6A 5IIJA 4ECQA 4B9VA 1WCNA 7ICEA 4M47A 2AU0A 4MEYA 2HHUA 4DLGA 4XQ7A 5CJ7A 7ICQA 3GIMA 4DL5A 4DF8A 4DL7A 2J6UA 4KLIA 1L3VA 2HW3A 2FLPA 4GLXA 3KTQA 1L5UA 4QW9A 1ZJNA 3PW5A 3B0XA 5DB6A 4RT2A 3JPRA 3JZ0A 1KFDA 3OUYA 3PW2A 4RWPA 4X4PA 8ICQA 5L1IA 3T3FA 4RPZA 3ZDDA 4ECZA 2OWOA 2HHXA 1T8EA 5D49A 9ICBA 1SKSA 3K4GA 2XO7A 4LZGA 1S77D 2KZZA 9ICNA 3OGUA 4YG2A 5HR9A 3RH6A 5J0RA 4EP7A 1ZQAA 5KFIA 4I2CA 3Q8PB 5KG6A 1R8BA 3PW0A 1NOMA 2IHNA 4F2SA 4IQVA 1A76A 4FHYA 1LB2B 4MEXA 3T5LA 4ZH4A 3PX6A 3Q8KA 3V6JA 5J2AA 1QSSA 2VA2A 2HHVA 9ICPA 1T7PA 5D4BA 5HHHA 4JWNA 4O0IA 4RU9A 2BDPA 2C2EA 8ICAA 3GV7B 3HIYA 2DVIA 3OUYB 5KFRA 4B9TA 4EBKA 1C7YA 1ZQUA 3KHRA 2BQUA 4BWMA 1A77A 5DB8A 2PI4A 1ZQLA 1JXEA 9ICMA 1KFSA 5HREA 3EWAA 5DGAA 3C2KA 4EEYA 1UT5A 5KFVA 1UETA 2RDIA 4Z6DA 5BPCA 2ASJA 1TK8A 1U49A 1TAQA 4KLFA 5HRFA 4PGXA 1ZQEA 3H4BA 2PFPA 4TUPA 2NRTA 3TI0A 3BQ0A 4MFAA 3MDCA 7ICFA 3JPNA 4YXJA 3OJUA 4M0AA 4B9MA 1VFGA 4NKTA 4QZ9A 5KFDA 4PHDA 1COOA 9ICCA 3PY8A 4O5KA 5KFQA 3MGIA 1V9PA 1KLNA 1XO1A 5BOLA 2DPJA 4C8MA 4AT9A 4UD5A 4P4MA 2W9MA 4JV0A 5KFXA 1NJWA 4ELTA 5IINA 4QWBA 3QZ7A 1JQRA 3KHGA 4I2EA 5KFPA 9ICJA 4M9JA 4GXKA 5KFHA 5J2GA 3QZ8A 2FMQA 3RH4A 9ICOA 3GFKB 4ED1A 1U4BA 3AQLA 4WC1A 1MC8A 4DSKA 2P66A 2UVRA 4I2AA 9ICLA 4AT7A 4BWJA 1TV9A 4DL6A 4FH3A 3RTVA 1MIYA 4UB4A 1HUZA 3RB6A 4F5RA 2ZTCA 4RQ1A 2PI5A 1X9SA 3OVBA 1ZQSA 2ZH8A 1QTMA 2A1JA 5HP4A 1K1QA 5IIOA 1KRPA 4B9UA 1ZQOA 1S0OA 3ZD9A 3GV5B 4P4PA 4C8KA 2NRXA 3QE9Y 1X2IA 5KG7A 3RJHA 4AT9B 2KFZA 2DRAA 4X4UA 1TAUA 4QZBA 5KFOA 5J0QA 4RT3A 5CA7A 2W8LA 4RUCA 1SZPA 4KN4A 4RQ0A 2DR7A 3RJEA 4MFCA 4E7XA 4QZDA 3ISDA 4O3QA 2UVWA 3PO5A 1T4GA 2XGQA 4YMMA 2J6SA 5J2EA 3Q8QB 2H5XA 1S10A 1BGXT 4CCHA 3OHBA 1YLQA 4GXIA 4EZ9A 3M8RA 4UQGA 3V72A 4NY8A 4NLZA 8ICVA 8ICXA 4AT7B 4X5VA 2ZH4A 4X4VA 3ETLA 1ZQXA 4F5QA 8ICHA 4F4ZA 4ED6A 2DPIA 4M9GA 7ICJA 4YFKA 2A1JB 4I2DA 3HW8A 5L1KA 3WFRE 2XY5A 1BPXA 4RQ6A 1NJXA 4PH5A 1X9MA 1IXRA 1Y88A 4J9KA 7ICOA 1KNYA 2JEFA 5KFUA 4XUSA 1NKCA 2ZHBA 4DSJA 5IIMA 1JN3A 4IR9A 5HRHA 2ZTEA 4DOAA 3PVXA 2BKEA 3L9DA 4J9OA 4C8NA 5IILA 4ELUA 2BCQA 5DQHA 3G6VA 3MFIA 1NK5A 4E8FA 5KT5A 4KLOA 4X4OA 5DB9A 2Y1IA 5DG8A 1ZQQA 4R8UA 4RQ7A 4DL2A 2C22A 1NK7A 5J2HA 5IIKA 1RXVA 2BCSA 4M9NA 8ICYA 3EW9A 4R65A 2ZH6A 2ZH1A 5DKWA 2W9CB 1MIWA 3OJSA 2ZH5A 2ID1A 3TAQA 5KFTA 4NM2A 4P2HA 4BGDA 2KN7A 3OVSA 4PPXA 2RDJA 1HJPA 5EOZA 8ICKA 8ICLA 4J9LA 4KITB 2R8HA 2B21A 2FLLA 3RJKA 4Z6FA 3BDPA 3ZDAA 4NM1A 1V4AA 1TFYA 3V7KA 2HVHA 3T5JA 8ICCA 8ICUA 7ICSA 5J2JA 5KT4A 4C8LA 3WFSC 1ZQPA 8ICBA 1DK3A 3HJ1A 3PX4A 5J0YA 4FH5A 3RB3A 1HUOA 1MIVA 3OVAA 4KLSA 4EBCA 2PFQA 4B9LA 4FHXA 4WC4A 3N97B 2ISOA 4YR3A 9ICFA 2KFNA 2PBEA 3OSNA 4KLDA 4KLLA 3GIKA 2R8JA 4R8UB 3HWTA 5BOMA 5TZVA 3MR6A 3LWLA 4QZ8A 4KLEA 3IM1A 4I28A 1QLNA 2FPKA 5J0SA 3MGHA 4RPYA 1S97A 2BGWA 2AJQA 1BNPA 4MF2A 1XC9A 2JEJA 3C21A 4DEZA 4LT6A 3EYZA 1ZQCA 3C5GA 3TFSA 3Q8MA 4KLJA 7ICMA 1U47A 3AQKA 7ICTA 3QEBZ 1ZETA 4X4RA 4X4NA 4PGQA 3THVA 5DLGA 5CHGA 4IR1A 4FS1A 4YR2A 4TQRA 4R63A 4GC6A 1NK0A 4J9RA 3AQMA 4WBZA 3RJJA 4DSFA 1JX4A 5KFFA 4EBJA 3SI8A 4RPXA 2HHQA 3TQ1A 1TFRA 5HRGA 2VANA 4F5PA 1ZQGA 4DWIA 1XWLA 5HMLA 4WBYA 2JEGA 4DQIA 5KFYA 7ICHA 2XGPA 5J29A 4F4YA 2ZH9A 3RH5A 3MR3A 3SV4A 3MR2A 4YR0A 4XRHA 1ZQZA 8ICJA 3H38A 3OHAA 5CWRA 4FHVA 3NTUA 3TFRA 4NLGA 5KTQA 1ZQKA 3WFQE 4IQWA 1JMSA 1ZQHA 1TK0A 4NLKA 2ZH7A 3HT3A 3M9MB 2FLNA 9ICQA 3QEAZ 3H8JA 5KFNA 4F4XA 2UVUA 4Q8EA 8ICFA 1NK8A 3RB4A 9ICWA 5HRKA 3EZ5A 4E80A 3LQCB 2IA6A 5F9NA 2NRVA 4J9PA 4KLQA 2HHPA 2V4QA 1ZQTA 1D8YA 2BCRA 1X9WA 2M2VA 3C23A 5IIIA 2NRWA 4F5NA 1F5AA 3UXNA 4KLHA 4ED3A 4KTQA 2XCPA 2ZJ5A 3GQCA 4I2BA 1S0VA 2DR9A 4M5DA 4ECUA 2ZUCA 2PFOA 3RR8A 4WC6A 4I2FA 4ECTA 4R64A 3RJFA 1BPDA 2DFLA 7ICNA 3H4DA 4NLNA 1NK4A 4DFPA 4DOCA 1NKEA 1ZQRA 4DSIA 4Q45A 2V4RA 1OU5A 1D8LA 2PXIA 3UPSA 3LK9A 2XY6A 1ZJMA 2ALZA 5D46A 4EZ6A 3NYBA 4ATBA 2AQ0A 1Z00A 1SKWA 8ICMA 3AU2A 5DQIA 4YCXA 2Q0ZX 2XCAA 8ICGA 1AROP 4K4HA 4PHEA 2ZUDA 9ICAA 2R8KA 3V7LA 3KHHA 1RZTA 2GWSA 2RFFA 4AT8A 4UBBA 2NRKA 4I2IA 4WCWA 4YQWA 4UD4A 5J0OA 1U9LA 5KG5A 1NK6A 2W8KA 2ZH2A 3FDSA 4B9NA 5KT3A 5KFLA 2W9AA 1S76D 4EBDA 4DFMA 3MFHA 4ED7A 4QWCA 3BQ1A 3GIIA 2P6RA 5F2VO 8ICIA 4RQ2A 4QZAA 9ICRA 5DECA 1DGSA 4I27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKR A;  3PNC A;  4QZH A;  4ATB B;  2LYH A;  5KG0 A;  4EYH B;  1FA0 A;  1Z00 B;  5HRB A;  5L1J A;  3JPS A;  4F8R A;  4YN4 A;  1MQ3 A;  4DS5 A;  1UT8 A;  5KFK A;  4DOB A;  4X4T A;  3C18 A;  5EWE A;  2BPF A;  4DSE A;  4AT8 B;  4FHW A;  4TUS A;  1ZQV A;  4Q43 A;  5DB7 A;  1XSL A;  4I2G A;  4TUR A;  2IMW P;  2ASL A;  4DQP A;  5HHI A;  2KZ3 A;  5KG1 A;  7ICK A;  2AGQ A;  7ICV A;  5KFM A;  2ISP A;  1QSL A;  4K4I A;  5EWG A;  5DGB A;  4Q44 A;  3RJG A;  9ICU A;  1ZQM A;  4DF4 A;  4QZG A;  7ICU A;  8ICO A;  1KTQ A;  4UB1 A;  4F50 A;  3Q8R B;  4ECV A;  3MBY A;  4IRK A;  3HJ4 A;  4MF8 A;  3H7I A;  5KFC A;  2Q66 A;  1LV5 A;  1BPZ A;  4O9M A;  3UQ2 A;  5KG2 A;  3PO4 A;  4B9S A;  3JPT A;  4O3O A;  3UXP A;  3UPQ A;  3C1Z A;  1ZQN A;  3JYY A;  3PML A;  4XQ8 A;  4PHP A;  2C28 A;  1U48 A;  5HMM A;  5KT7 A;  5J2D A;  2F1H A;  4RUA A;  3ISB A;  1L3U A;  7ICP A;  4QW8 A;  7ICI A;  5J2B A;  1NK9 A;  1PX5 A;  4S3N A;  2KP7 A;  1S0N A;  2ZUB A;  4QZC A;  1KEJ A;  1N56 A;  1ZQY A;  1ZQD A;  5J2F A;  4UAW A;  4O5C A;  4GC7 A;  2ASD A;  1XSN A;  4TUQ A;  4IQT A;  4DL4 A;  5KT2 A;  3E2E A;  2ZJA A;  3N4M B;  3RRH A;  2IBK A;  1EXN A;  4RNM A;  3EPG A;  3IHQ B;  3PX0 A;  4X4S A;  4F5O A;  3TAN A;  3RR7 A;  1SL2 A;  4YMO A;  2ATL A;  1MQ2 A;  3RAX A;  4KLG A;  2M2T A;  1S0M A;  4Z6E A;  1B43 A;  1PZN A;  4QZI A;  1TVA A;  4KLM A;  1JIH A;  9ICH A;  5J0W A;  4WC7 A;  3PR4 A;  1JXL A;  1MSW D;  2O1P A;  4DLE A;  5CP2 A;  7ICG A;  3H39 A;  1UA0 A;  1NJY A;  3RRG A;  4QWD A;  7ICL A;  1Q78 A;  3TAP A;  3BJY A;  4RQ3 A;  4KLU A;  2C2R A;  3B0Y A;  5L9X A;  3LDA A;  4M04 A;  4G3I A;  2KZM A;  4YD1 A;  8ICP A;  5KFB A;  9ICT A;  1NZP A;  3H37 A;  5DQG A;  2ZHA A;  3JPO A;  3OV7 A;  3GIJ A;  3V7J A;  2BE3 A;  4HYK A;  4ECY A;  3UXO A;  2ZTD A;  4RWO A;  1KDH A;  1UEV A;  1NJZ A;  1DOQ A;  4RQ5 A;  5F9L A;  4NKU A;  5KFS A;  4RQ4 A;  4M9L A;  3RBD A;  1VJ7 A;  3Q8L A;  9ICK A;  9ICS A;  3PW4 A;  3C5F A;  5J2K A;  4JUZ A;  2AGP A;  2ZJ8 A;  2XY7 A;  4UAZ A;  2MUT A;  1N48 A;  4DSL A;  4RWQ A;  3AU6 A;  2R8G A;  4DQR A;  5KFE A;  3KHL A;  4ECX A;  3SYZ A;  1R89 A;  2JZB A;  5KFA A;  1T3N A;  4IRD A;  4K4G A;  3K75 D;  2BQR A;  1ZYQ A;  4RZR A;  5DDY A;  4EYI B;  4ED0 A;  4FHP A;  3Q8S B;  4RNN A;  2I9G A;  1L3T A;  2FMS A;  3H8W A;  5DLF A;  4DS4 A;  4C8O A;  5DBB A;  2I1Q A;  3ORY A;  4JV1 A;  2AGO A;  1ZQJ A;  4JV2 A;  8ICS A;  2JEI A;  3GDX A;  3ISC A;  3GV8 B;  5DG9 A;  4LZD A;  4ECS A;  1RYR A;  3C1Y A;  2PFN A;  4YMN A;  1ZQW A;  4RQ8 A;  4YVZ A;  5CR0 A;  1BNO A;  5J2I A;  2WTF A;  1D9D A;  2FPM A;  2XC9 A;  1UA1 A;  3C2M A;  2DRB A;  3ZDE A;  2VA3 A;  5HC9 A;  3JPP A;  2BPC A;  4TQS A;  2O5A A;  2MUT B;  5J0U A;  4YP3 A;  3MDA A;  4EBE A;  2BPG A;  4X0B A;  4F93 B;  3GIL A;  4YXM A;  4DL3 A;  1KSP A;  3ZDC A;  2JZB B;  9ICG A;  4F3O A;  3BQ2 A;  1B22 A;  4WC2 A;  1BPE A;  5DED A;  3BQT A;  4O3P A;  4ED8 A;  1XS9 D;  4IRC A;  5C5J A;  4UB3 A;  5HRI A;  2FPL A;  2HHT A;  3AQN A;  4ED2 A;  1TFW A;  4M6W A;  4F4K A;  4J9Q A;  4NXZ A;  4KMU A;  5KG4 A;  3MAB A;  3ZD8 A;  1ZQI A;  9ICE A;  1L3S A;  1QSY A;  4DFK A;  2BR0 A;  8ICE A;  8ICN A;  1XSP A;  1TK5 A;  4ELV A;  9ICX A;  3HX0 A;  2VA8 A;  5KFG A;  4QWE A;  2AQ4 A;  2KTQ A;  4WC0 A;  9ICV A;  4DO9 A;  2DR5 A;  2UVV A;  5J0T A;  8ICR A;  3WFP A;  2ZH3 A;  4M2Y A;  5JUM A;  8ICZ A;  4X4Q A;  5HNK A;  1BPY A;  3H40 A;  3UQ0 A;  4UB5 A;  1DK2 A;  3EPI A;  4UAY A;  3V6K A;  1CEZ A;  4I2J A;  1K1S A;  3G6Y A;  4QZF A;  5J2C A;  1ZQB A;  4BDP A;  4KLT A;  3H3A A;  2BCU A;  3PW7 A;  3RJI A;  2BHN A;  3HPO A;  1S9F A;  3T5H A;  1NO5 A;  4LVS A;  4KN7 A;  4IQU A;  1RPL A;  2F1J A;  3LWM A;  2FMP A;  7ICR A;  3MR5 A;  4M6W B;  5DBA A;  4PHA A;  2BQ3 A;  2M2U A;  4GXJ A;  5DG7 A;  4ECW A;  1JAJ A;  3SV3 A;  1Q79 A;  2HHS A;  1BVS A;  1RXW A;  1H38 A;  1BPB A;  4R66 A;  4J9S A;  4DQQ A;  2M2W A;  4RWN A;  3C66 A;  2J6T A;  3OSP A;  1CUK A;  4JK1 A;  3ZDB A;  4J9N A;  4I29 A;  5HRL A;  4F91 B;  1ZQF A;  4P4O A;  1Z3E B;  2IHM A;  5KFZ A;  2W9B A;  2W9C A;  4BXO A;  1IM4 A;  4DQS A;  4O3N A;  2C2D A;  4O3R A;  4Q8F A;  8ICT A;  4FBU A;  2NRZ A;  3G6X A;  4RNO A;  5EWF A;  4ECR A;  3RBE A;  5KG3 A;  4I2H A;  4X0A A;  3RAQ A;  4FS2 A;  4DFJ A;  5DBC A;  4M9H A;  3M9O B;  4O3S A;  4IG8 A;  4F2R A;  5J0P A;  4Z6C A;  5CB1 A;  4F92 B;  1WCL A;  2R8I A;  3PMN A;  3PV8 A;  1SL0 A;  3TAR A;  1D9F A;  4QZE A;  2F1I A;  4J9M A;  2V9W A;  2BCV A;  4E0D A;  5J0X A;  1R8A A;  5KFJ A;  3JPQ A;  3V6H A;  1RYS A;  4WC5 A;  3WFO A;  2MAX A;  4YD2 A;  5DDM A;  4F4W A;  3T5K A;  4JWM A;  4MFF A;  3HP6 A;  3SZ2 A;  1R8C A;  3M8S A;  1NKB A;  4UB2 A;  2M9N A;  8ICW A;  4FO6 A;  4FBT A;  4PGY A;  2P6U A;  5KFW A;  4UBC A;  3PR5 B;  2Y1J A;  5HRD A;  2W9B B;  4XA5 A;  4BXO B;  4O5E A;  3M9N B;  3AUO A;  3RB0 A;  1UEU A;  1SL1 A;  4QWA A;  1TKD A;  1WOT A;  2DR8 A;  3NGD A;  4WC3 A;  2HHW A;  3C2L A;  2HVI A;  1KFT A;  3H8S A;  5L1L A;  1U45 A;  3FYH A;  9ICI A;  1XU4 A;  5KT6 A;  5IIJ A;  4ECQ A;  4B9V A;  1WCN A;  7ICE A;  4M47 A;  2AU0 A;  4MEY A;  2HHU A;  4DLG A;  4XQ7 A;  5CJ7 A;  7ICQ A;  3GIM A;  4DL5 A;  4DF8 A;  4DL7 A;  2J6U A;  4KLI A;  1L3V A;  2HW3 A;  2FLP A;  4GLX A;  3KTQ A;  1L5U A;  4QW9 A;  1ZJN A;  3PW5 A;  3B0X A;  5DB6 A;  4RT2 A;  3JPR A;  3JZ0 A;  1KFD A;  3OUY A;  3PW2 A;  4RWP A;  4X4P A;  8ICQ A;  5L1I A;  3T3F A;  4RPZ A;  3ZDD A;  4ECZ A;  2OWO A;  2HHX A;  1T8E A;  5D49 A;  9ICB A;  1SKS A;  3K4G A;  2XO7 A;  4LZG A;  1S77 D;  2KZZ A;  9ICN A;  3OGU A;  4YG2 A;  5HR9 A;  3RH6 A;  5J0R A;  4EP7 A;  1ZQA A;  5KFI A;  4I2C A;  3Q8P B;  5KG6 A;  1R8B A;  3PW0 A;  1NOM A;  2IHN A;  4F2S A;  4IQV A;  1A76 A;  4FHY A;  1LB2 B;  4MEX A;  3T5L A;  4ZH4 A;  3PX6 A;  3Q8K A;  3V6J A;  5J2A A;  1QSS A;  2VA2 A;  2HHV A;  9ICP A;  1T7P A;  5D4B A;  5HHH A;  4JWN A;  4O0I A;  4RU9 A;  2BDP A;  2C2E A;  8ICA A;  3GV7 B;  3HIY A;  2DVI A;  3OUY B;  5KFR A;  4B9T A;  4EBK A;  1C7Y A;  1ZQU A;  3KHR A;  2BQU A;  4BWM A;  1A77 A;  5DB8 A;  2PI4 A;  1ZQL A;  1JXE A;  9ICM A;  1KFS A;  5HRE A;  3EWA A;  5DGA A;  3C2K A;  4EEY A;  1UT5 A;  5KFV A;  1UET A;  2RDI A;  4Z6D A;  5BPC A;  2ASJ A;  1TK8 A;  1U49 A;  1TAQ A;  4KLF A;  5HRF A;  4PGX A;  1ZQE A;  3H4B A;  2PFP A;  4TUP A;  2NRT A;  3TI0 A;  3BQ0 A;  4MFA A;  3MDC A;  7ICF A;  3JPN A;  4YXJ A;  3OJU A;  4M0A A;  4B9M A;  1VFG A;  4NKT A;  4QZ9 A;  5KFD A;  4PHD A;  1COO A;  9ICC A;  3PY8 A;  4O5K A;  5KFQ A;  3MGI A;  1V9P A;  1KLN A;  1XO1 A;  5BOL A;  2DPJ A;  4C8M A;  4AT9 A;  4UD5 A;  4P4M A;  2W9M A;  4JV0 A;  5KFX A;  1NJW A;  4ELT A;  5IIN A;  4QWB A;  3QZ7 A;  1JQR A;  3KHG A;  4I2E A;  5KFP A;  9ICJ A;  4M9J A;  4GXK A;  5KFH A;  5J2G A;  3QZ8 A;  2FMQ A;  3RH4 A;  9ICO A;  3GFK B;  4ED1 A;  1U4B A;  3AQL A;  4WC1 A;  1MC8 A;  4DSK A;  2P66 A;  2UVR A;  4I2A A;  9ICL A;  4AT7 A;  4BWJ A;  1TV9 A;  4DL6 A;  4FH3 A;  3RTV A;  1MIY A;  4UB4 A;  1HUZ A;  3RB6 A;  4F5R A;  2ZTC A;  4RQ1 A;  2PI5 A;  1X9S A;  3OVB A;  1ZQS A;  2ZH8 A;  1QTM A;  2A1J A;  5HP4 A;  1K1Q A;  5IIO A;  1KRP A;  4B9U A;  1ZQO A;  1S0O A;  3ZD9 A;  3GV5 B;  4P4P A;  4C8K A;  2NRX A;  3QE9 Y;  1X2I A;  5KG7 A;  3RJH A;  4AT9 B;  2KFZ A;  2DRA A;  4X4U A;  1TAU A;  4QZB A;  5KFO A;  5J0Q A;  4RT3 A;  5CA7 A;  2W8L A;  4RUC A;  1SZP A;  4KN4 A;  4RQ0 A;  2DR7 A;  3RJE A;  4MFC A;  4E7X A;  4QZD A;  3ISD A;  4O3Q A;  2UVW A;  3PO5 A;  1T4G A;  2XGQ A;  4YMM A;  2J6S A;  5J2E A;  3Q8Q B;  2H5X A;  1S10 A;  1BGX T;  4CCH A;  3OHB A;  1YLQ A;  4GXI A;  4EZ9 A;  3M8R A;  4UQG A;  3V72 A;  4NY8 A;  4NLZ A;  8ICV A;  8ICX A;  4AT7 B;  4X5V A;  2ZH4 A;  4X4V A;  3ETL A;  1ZQX A;  4F5Q A;  8ICH A;  4F4Z A;  4ED6 A;  2DPI A;  4M9G A;  7ICJ A;  4YFK A;  2A1J B;  4I2D A;  3HW8 A;  5L1K A;  3WFR E;  2XY5 A;  1BPX A;  4RQ6 A;  1NJX A;  4PH5 A;  1X9M A;  1IXR A;  1Y88 A;  4J9K A;  7ICO A;  1KNY A;  2JEF A;  5KFU A;  4XUS A;  1NKC A;  2ZHB A;  4DSJ A;  5IIM A;  1JN3 A;  4IR9 A;  5HRH A;  2ZTE A;  4DOA A;  3PVX A;  2BKE A;  3L9D A;  4J9O A;  4C8N A;  5IIL A;  4ELU A;  2BCQ A;  5DQH A;  3G6V A;  3MFI A;  1NK5 A;  4E8F A;  5KT5 A;  4KLO A;  4X4O A;  5DB9 A;  2Y1I A;  5DG8 A;  1ZQQ A;  4R8U A;  4RQ7 A;  4DL2 A;  2C22 A;  1NK7 A;  5J2H A;  5IIK A;  1RXV A;  2BCS A;  4M9N A;  8ICY A;  3EW9 A;  4R65 A;  2ZH6 A;  2ZH1 A;  5DKW A;  2W9C B;  1MIW A;  3OJS A;  2ZH5 A;  2ID1 A;  3TAQ A;  5KFT A;  4NM2 A;  4P2H A;  4BGD A;  2KN7 A;  3OVS A;  4PPX A;  2RDJ A;  1HJP A;  5EOZ A;  8ICK A;  8ICL A;  4J9L A;  4KIT B;  2R8H A;  2B21 A;  2FLL A;  3RJK A;  4Z6F A;  3BDP A;  3ZDA A;  4NM1 A;  1V4A A;  1TFY A;  3V7K A;  2HVH A;  3T5J A;  8ICC A;  8ICU A;  7ICS A;  5J2J A;  5KT4 A;  4C8L A;  3WFS C;  1ZQP A;  8ICB A;  1DK3 A;  3HJ1 A;  3PX4 A;  5J0Y A;  4FH5 A;  3RB3 A;  1HUO A;  1MIV A;  3OVA A;  4KLS A;  4EBC A;  2PFQ A;  4B9L A;  4FHX A;  4WC4 A;  3N97 B;  2ISO A;  4YR3 A;  9ICF A;  2KFN A;  2PBE A;  3OSN A;  4KLD A;  4KLL A;  3GIK A;  2R8J A;  4R8U B;  3HWT A;  5BOM A;  5TZV A;  3MR6 A;  3LWL A;  4QZ8 A;  4KLE A;  3IM1 A;  4I28 A;  1QLN A;  2FPK A;  5J0S A;  3MGH A;  4RPY A;  1S97 A;  2BGW A;  2AJQ A;  1BNP A;  4MF2 A;  1XC9 A;  2JEJ A;  3C21 A;  4DEZ A;  4LT6 A;  3EYZ A;  1ZQC A;  3C5G A;  3TFS A;  3Q8M A;  4KLJ A;  7ICM A;  1U47 A;  3AQK A;  7ICT A;  3QEB Z;  1ZET A;  4X4R A;  4X4N A;  4PGQ A;  3THV A;  5DLG A;  5CHG A;  4IR1 A;  4FS1 A;  4YR2 A;  4TQR A;  4R63 A;  4GC6 A;  1NK0 A;  4J9R A;  3AQM A;  4WBZ A;  3RJJ A;  4DSF A;  1JX4 A;  5KFF A;  4EBJ A;  3SI8 A;  4RPX A;  2HHQ A;  3TQ1 A;  1TFR A;  5HRG A;  2VAN A;  4F5P A;  1ZQG A;  4DWI A;  1XWL A;  5HML A;  4WBY A;  2JEG A;  4DQI A;  5KFY A;  7ICH A;  2XGP A;  5J29 A;  4F4Y A;  2ZH9 A;  3RH5 A;  3MR3 A;  3SV4 A;  3MR2 A;  4YR0 A;  4XRH A;  1ZQZ A;  8ICJ A;  3H38 A;  3OHA A;  5CWR A;  4FHV A;  3NTU A;  3TFR A;  4NLG A;  5KTQ A;  1ZQK A;  3WFQ E;  4IQW A;  1JMS A;  1ZQH A;  1TK0 A;  4NLK A;  2ZH7 A;  3HT3 A;  3M9M B;  2FLN A;  9ICQ A;  3QEA Z;  3H8J A;  5KFN A;  4F4X A;  2UVU A;  4Q8E A;  8ICF A;  1NK8 A;  3RB4 A;  9ICW A;  5HRK A;  3EZ5 A;  4E80 A;  3LQC B;  2IA6 A;  5F9N A;  2NRV A;  4J9P A;  4KLQ A;  2HHP A;  2V4Q A;  1ZQT A;  1D8Y A;  2BCR A;  1X9W A;  2M2V A;  3C23 A;  5III A;  2NRW A;  4F5N A;  1F5A A;  3UXN A;  4KLH A;  4ED3 A;  4KTQ A;  2XCP A;  2ZJ5 A;  3GQC A;  4I2B A;  1S0V A;  2DR9 A;  4M5D A;  4ECU A;  2ZUC A;  2PFO A;  3RR8 A;  4WC6 A;  4I2F A;  4ECT A;  4R64 A;  3RJF A;  1BPD A;  2DFL A;  7ICN A;  3H4D A;  4NLN A;  1NK4 A;  4DFP A;  4DOC A;  1NKE A;  1ZQR A;  4DSI A;  4Q45 A;  2V4R A;  1OU5 A;  1D8L A;  2PXI A;  3UPS A;  3LK9 A;  2XY6 A;  1ZJM A;  2ALZ A;  5D46 A;  4EZ6 A;  3NYB A;  4ATB A;  2AQ0 A;  1Z00 A;  1SKW A;  8ICM A;  3AU2 A;  5DQI A;  4YCX A;  2Q0Z X;  2XCA A;  8ICG A;  1ARO P;  4K4H A;  4PHE A;  2ZUD A;  9ICA A;  2R8K A;  3V7L A;  3KHH A;  1RZT A;  2GWS A;  2RFF A;  4AT8 A;  4UBB A;  2NRK A;  4I2I A;  4WCW A;  4YQW A;  4UD4 A;  5J0O A;  1U9L A;  5KG5 A;  1NK6 A;  2W8K A;  2ZH2 A;  3FDS A;  4B9N A;  5KT3 A;  5KFL A;  2W9A A;  1S76 D;  4EBD A;  4DFM A;  3MFH A;  4ED7 A;  4QWC A;  3BQ1 A;  3GII A;  2P6R A;  5F2V O;  8ICI A;  4RQ2 A;  4QZA A;  9ICR A;  5DEC A;  1DGS A;  4I27 A; 
#chains in the Genus database with same CATH topology
 5HRB A;  1UT8 A;  3SR6 A;  1RG6 A;  4C4T A;  4DSE A;  2L5Y A;  3SEN A;  7ICK A;  2Y9U A;  7ICV A;  5KFM A;  4Q44 A;  1FFU A;  4QZG A;  1KTQ A;  4IRK A;  4MF8 A;  1LV5 A;  1BPZ A;  3UQ2 A;  5D63 A;  3UXP A;  2E8N A;  4O3O A;  2DF4 B;  3JYY A;  2A19 A;  3PML A;  5AKG A;  2C28 A;  1U48 A;  4KLG A;  5HMM A;  2F1H A;  7ICP A;  1L3U A;  2H3I A;  7ICI A;  1NK9 A;  2K8A A;  1Z19 A;  4FE3 A;  3UMC A;  1ZQD A;  5J2F A;  2KSO A;  1XSN A;  5AK5 A;  5KT2 A;  2AXT U;  4RNM A;  3EPG A;  3PX0 A;  3HKZ F;  4EGW A;  4F5O A;  3TAN A;  5ALL A;  2ATL A;  4Z6E A;  1PZN A;  3VCB A;  1JIH A;  1KL9 A;  5F3X B;  5CP2 A;  3LDA A;  1ZD5 A;  4K8V A;  4YD1 A;  2FCL A;  9ICT A;  4PZO A;  3K7D A;  3JPO A;  3UXO A;  3M6K A;  4RWO A;  1UEV A;  2KSO B;  2XVT A;  3NRW A;  5F9L A;  2EZZ A;  2KMD A;  2EWR A;  4JUZ A;  1N48 A;  4DSL A;  4RWQ A;  3AU6 A;  2HCF A;  5GTI U;  1F44 A;  2EH9 A;  4IRD A;  1UQV A;  4K4G A;  1ZYQ A;  1N2X A;  2LPE A;  2E8P A;  2FMS A;  2GA9 D;  2B0C A;  5DBB A;  3GDX A;  3ISC A;  5DG9 A;  2H3V A;  1Z4O A;  3PZP A;  4YVZ A;  5ALV A;  1D9D A;  2XC9 A;  2VA3 A;  2BPC A;  5TIS U;  4TQS A;  4EBE A;  4YXM A;  4KX5 A;  4WC2 A;  2YQE A;  4ED8 A;  1XS9 D;  4UB3 A;  2FPL A;  4ED2 A;  4M6W A;  4F4K A;  4NXZ A;  4FO1 A;  1JAL A;  2G0A A;  1XNS A;  1AQ6 A;  8ICN A;  4WC0 A;  3WKC A;  3UQ0 A;  4UAY A;  1K1S A;  5AIB A;  3HPO A;  1S9F A;  3T5H A;  1COK A;  1NO5 A;  4LVS A;  4IQU A;  3MR5 A;  4M6W B;  5DBA A;  4RQN A;  2M2U A;  1L7M A;  2F8K A;  4DQQ A;  3ETR A;  3OSP A;  4JK1 A;  4J9N A;  4F91 B;  1Z3E B;  3L4P A;  2W9B A;  3PSF A;  2W9C A;  4O3R A;  8ICT A;  5AM0 A;  4IG8 A;  3KOO A;  4Z6C A;  3PV8 A;  1SL0 A;  1WCL A;  3PMN A;  2F1I A;  4J9M A;  1R8A A;  5KFJ A;  4WC5 A;  2KNJ A;  3N7R C;  4F4W A;  3T5K A;  3HP6 A;  4U6P A;  1R8C A;  3M8S A;  3CW2 C;  1NKB A;  4C0Z A;  4FBT A;  2W9B B;  3RB0 A;  5ALX A;  2N1R A;  3C2L A;  1KFT A;  5L1L A;  3I1Y A;  3FYH A;  4ECQ A;  1WCN A;  3E0F A;  2DGZ A;  5G5G A;  2AU0 A;  3ZI4 A;  4NXW A;  7ICQ A;  3GIM A;  2HW3 A;  3CYM A;  4QW9 A;  3D2Q A;  3B0X A;  3PSI A;  3JZ0 A;  1KFD A;  4X4P A;  2LM1 A;  4KB6 A;  1NNL A;  3K4G A;  2K4I A;  4OJO A;  4EP7 A;  5KL8 B;  5KFI A;  3ALR A;  3SAF A;  4I2C A;  5KG6 A;  3LYS A;  4FHY A;  1LB2 B;  2RHF A;  4ZH4 A;  3PX6 A;  3CRX A;  9ICP A;  4JWN A;  4O0I A;  4RU9 A;  2F44 A;  5KFR A;  1WWU A;  5AM5 A;  2PI4 A;  2EQY A;  5HRE A;  2ZIX A;  1UT5 A;  4Z6D A;  2ASJ A;  3TAD C;  2PFP A;  1PK3 A;  3BQ0 A;  4K97 A;  2XID A;  5KFQ A;  1V9P A;  5J8Y A;  5KFX A;  1NJW A;  4ELT A;  5AI6 A;  2CPR A;  4ED1 A;  1MC8 A;  3M6Z A;  4DSK A;  2ZIX B;  3RTV A;  1HUZ A;  5C0Y A;  2ZH8 A;  1QTM A;  2A1J A;  5IIO A;  4B9U A;  4BUG A;  2P35 A;  3GV5 B;  2DKZ A;  4X4U A;  1TAU A;  2W8L A;  2D8C A;  4KN4 A;  3RJE A;  2UVW A;  1T4G A;  2XGQ A;  2J6S A;  2DUY A;  1BGX T;  4CCH A;  3OHB A;  2BBH A;  4GXI A;  4EZ9 A;  2KG5 A;  4NLZ A;  4U7C A;  2MSN A;  4EEN A;  1SXE A;  1ZQX A;  3BS7 A;  4F4Z A;  4YFK A;  2A1J B;  3HW8 A;  5L1K A;  4NXT A;  4PH5 A;  1IXR A;  1PVP A;  3LVW A;  3D6J A;  2ZHB A;  5KFU A;  4OCZ A;  2ZTE A;  2VJ5 A;  1X42 A;  3PVX A;  2B4V A;  2BCQ A;  4QJF B;  3MFI A;  4KLO A;  5DB9 A;  2C22 A;  5J2H A;  5IIK A;  5JTI A;  4LEV A;  2ZXI A;  1MIW A;  2QAR A;  4NM2 A;  1HJP A;  2CN1 A;  2FLL A;  4KIT B;  2R8H A;  2B21 A;  3RJK A;  8ICC A;  7ICS A;  3WFS C;  5KT4 A;  8ICB A;  1DK3 A;  4NWI A;  1HUO A;  4O69 A;  1MIV A;  2RLT A;  4EBC A;  4FHX A;  4OAF A;  2AHO B;  4UB6 U;  3N97 B;  9ICF A;  4YR3 A;  4KLL A;  3HWT A;  5TZV A;  1V97 A;  1F0M A;  3NVO A;  4Y2U A;  2QAR B;  2BGW A;  4LT6 A;  4MF2 A;  3EYZ A;  1ZQC A;  3Q8M A;  7ICM A;  3B9J A;  4X4R A;  5AHX A;  7ICT A;  4PGQ A;  3F2C A;  4TQR A;  1NK0 A;  4PL1 A;  3FC4 A;  5KFF A;  2HN1 A;  1L8O A;  3H0M B;  4F5P A;  4DWI A;  4N7R A;  2JEG A;  2K89 A;  4F4Y A;  3RH5 A;  3MR3 A;  3SV4 A;  3WKE A;  3H0L B;  1JMS A;  1TK0 A;  4NLK A;  3AL0 B;  2FLN A;  3DDH A;  3H8J A;  1JAJ A;  4E80 A;  1NK8 A;  3RB4 A;  3LQC B;  5ALJ A;  2IA6 A;  2WAQ C;  5F9N A;  2NRV A;  4KLQ A;  3BZK A;  1D8Y A;  2VKQ A;  1ZRN A;  3C23 A;  3IG8 A;  3UXN A;  4KLH A;  2YB1 A;  3GQC A;  4I2F A;  1BPD A;  3QNM A;  4OJP A;  1NK4 A;  1SGG A;  1WG8 A;  1ZQR A;  4Q45 A;  1N60 A;  3KKA A;  2XY6 A;  1ZJM A;  2ALZ A;  5D46 A;  3NYB A;  1SKW A;  3ED5 A;  4YCX A;  4KMO B;  9ICA A;  3KHH A;  1Q3U A;  3RF9 A;  2NRK A;  1C20 A;  4B9N A;  5D62 A;  1HIW A;  2IUB A;  1F5S A;  4ED7 A;  2CRX A;  5F2V O;  4RQ2 A;  5DEC A;  4I27 A;  2ESE A;  4QZH A;  4NLC A;  4EYH B;  5L1J A;  3JPS A;  4X4T A;  4YN4 A;  1MQ3 A;  4DS5 A;  4DOB A;  4MHV A;  3TAC B;  4EEB A;  4EX6 A;  3C18 A;  4WQK A;  1L7N A;  4TUS A;  1ZQV A;  4I2G A;  3M7D A;  4DQP A;  5HHI A;  4K4I A;  5EWG A;  9ICU A;  4DF4 A;  8ICO A;  4OJ6 A;  1SB3 C;  3Q8R B;  3MBY A;  1Q46 A;  3H7I A;  2PKE A;  1L7P A;  5KG2 A;  2KOB A;  2NV3 A;  4S3N A;  2KD1 A;  5J2B A;  2KP7 A;  1S0N A;  2EAN A;  3KZI U;  4UAW A;  2A1A A;  4TUQ A;  3E2E A;  3RRH A;  4X4S A;  1YZ7 A;  1X66 A;  4YMO A;  1MQ2 A;  9ICH A;  5GTH U;  1JXL A;  2FJ6 A;  2W11 A;  1MSW D;  2O1P A;  7ICG A;  3H39 A;  1UA0 A;  1NJY A;  4KLU A;  5L9X A;  3SAH A;  4M04 A;  4G3I A;  1PVQ A;  3A0H U;  2ZHA A;  3N28 A;  3OV7 A;  3GIJ A;  3V7J A;  2BE3 A;  3MCR A;  1NJZ A;  1DOQ A;  3RBD A;  3F5A A;  3C5F A;  3QUQ A;  2ZJ8 A;  2FDR A;  2R8G A;  5ALT A;  4ECX A;  3SYZ A;  2JZB A;  1T3N A;  3AMZ A;  2Z7J A;  2I9G A;  5DLF A;  2HMX A;  4C8O A;  2K60 A;  3WK4 A;  4IC9 A;  4JV1 A;  4JV2 A;  1ZQJ A;  2JEI A;  3GV8 B;  4LZD A;  5ALI A;  1RYR A;  1QH9 A;  4YMN A;  1ZQW A;  4RQ8 A;  5J2I A;  1KW4 A;  3QU9 A;  2WTF A;  2E3T A;  5HC9 A;  3JPP A;  1ZXI A;  3OPX A;  4YP3 A;  3UMB A;  3GIL A;  4DL3 A;  9ICG A;  2JZB B;  3F53 A;  1O08 A;  4F3O A;  5CRX A;  5AM3 A;  3BQ2 A;  1B22 A;  5DED A;  3EUB 2;  3AQN A;  5C5J A;  2LBO A;  5G5H A;  5KG4 A;  3ZD8 A;  9ICE A;  3ICX A;  4DFK A;  3WK5 A;  2YX8 A;  3KBB A;  4KX3 A;  4QWE A;  1IV8 A;  9ICV A;  4K96 A;  4UB5 A;  1FFV A;  2QKQ A;  4I2J A;  3CK6 A;  1DGJ A;  4QZF A;  4BDP A;  2BCU A;  2H3Q A;  4PHA A;  1PUZ A;  1BVS A;  1RXW A;  4R66 A;  2WB1 F;  3C66 A;  1Z1B A;  1CUK A;  3ZDB A;  4I29 A;  4P4O A;  2IHM A;  5KFZ A;  2M0N A;  5AIC A;  2XI9 A;  2C2D A;  1TAM A;  2NRZ A;  3RBE A;  5DBC A;  3M9O B;  4O3S A;  4F2R A;  3QUT A;  4F92 B;  2R8I A;  2O5A A;  3BZC A;  3TAR A;  4QZE A;  2CXY A;  5J0X A;  3JPQ A;  2DBY A;  3V6H A;  1ECW A;  4DCC A;  3WFO A;  2MAX A;  4YD2 A;  5DDM A;  5AI4 A;  4KM5 A;  2W03 A;  3PR5 B;  5HRD A;  2DR5 A;  4XA5 A;  4NKU A;  4WQL A;  5HR6 A;  2Y9T A;  1A0P A;  2HHU A;  4XQ7 A;  2HN2 A;  2W7O A;  1L3V A;  2FLP A;  1ZJN A;  2ZIV A;  3HIL A;  4Y2J A;  3OUY A;  2EZX A;  4G9B A;  4LEY A;  8ICQ A;  4J03 A;  1T8E A;  5D49 A;  1VDV A;  1S77 D;  5HR9 A;  2MRL A;  5ALY A;  2B6G A;  3WKA A;  3Q8P B;  1R8B A;  3PW0 A;  1NOM A;  2IHN A;  4IQV A;  1A76 A;  1TE2 A;  3LVV A;  3T5L A;  1QSS A;  2ZIV B;  2C2E A;  2JXJ A;  3OUY B;  4B9T A;  4EBK A;  3D2S A;  4OAG A;  4Y2V A;  3EWA A;  5DGA A;  5KFV A;  3NUQ A;  5HRF A;  2ZXH A;  4GFJ A;  4OAI Z;  1UCV A;  4MFA A;  7ICF A;  4UAU A;  1XO0 A;  4B9M A;  1VFG A;  5KFD A;  2LHT A;  5ALS A;  4OD0 A;  5A0L A;  2DPJ A;  4Y2Y A;  2DWQ A;  2YTU A;  5L1M A;  3KHG A;  4I2E A;  9ICJ A;  4GXK A;  3AQF A;  5KFH A;  3QZ8 A;  2YML A;  1GPJ A;  3QUB A;  3AQL A;  1RQL A;  3N7S C;  2LKY A;  1JRO A;  1SWV A;  3MC1 A;  3I76 A;  4UB4 A;  1FO4 A;  1T3Q A;  4RQ1 A;  1OUQ A;  1ZQS A;  2IOH A;  5HP4 A;  1K1Q A;  1ZQO A;  2EAM A;  4HAI A;  3WU2 U;  1S0O A;  1JI7 A;  4P0P A;  4C8K A;  3QE9 Y;  1X2I A;  2DRA A;  5KFO A;  3NAS A;  3F5E A;  5CA7 A;  4RUC A;  1SZP A;  1SV4 A;  5AKY A;  4QZD A;  3ISD A;  3HKZ C;  3PO5 A;  4MKP A;  5J2E A;  3QXG A;  1YLQ A;  4AP9 A;  3V72 A;  4UQG A;  8ICX A;  8ICV A;  4XJE A;  2ZH4 A;  1HEK A;  3ETL A;  4ED6 A;  4O6A A;  2DPI A;  7ICJ A;  4I2D A;  1BPX A;  4RQ6 A;  7ICO A;  1Y88 A;  4J9K A;  2KJ5 A;  2JEF A;  4XUS A;  4P0P B;  4DSJ A;  5IIM A;  4IR9 A;  5AK4 A;  3QYP A;  4UB8 U;  3WK6 A;  4DOA A;  1Q8K A;  3CP8 A;  5DQH A;  2ES6 A;  4X4O A;  5AK3 A;  4RQ7 A;  4DL2 A;  1RXV A;  2ODG A;  8ICY A;  2BCS A;  3EW9 A;  4R65 A;  2W9C B;  1SV0 C;  3OJS A;  5KFT A;  2HI0 A;  3JCF A;  2KN7 A;  4JLX A;  5AKK A;  4K9A A;  4J9L A;  1TFY A;  4OJL A;  3ZDA A;  5B3Q A;  2R18 A;  2HVH A;  2OM6 A;  2A3V A;  3MGV A;  1ZQP A;  3PX4 A;  5J0Y A;  2IOF A;  3OVA A;  2K4P A;  1X9X A;  1V85 A;  4B9L A;  4WC4 A;  3ONN A;  2KFN A;  3OSN A;  4KLD A;  3GIK A;  2R8J A;  1L8L A;  3T79 A;  4I28 A;  4I0U A;  1CI4 A;  3IG5 A;  4WJ3 B;  2JEJ A;  1T94 A;  2IHO A;  3C5G A;  2D6F C;  3S6J A;  1KN5 A;  5KAF U;  4GC6 A;  3AQM A;  2HBL A;  2PMZ F;  4WBZ A;  4EBJ A;  3SI8 A;  2HHQ A;  5EE1 A;  5HRG A;  2NO4 A;  1ZQG A;  2LYB A;  4C4R A;  4WBY A;  5KFY A;  1M6Y A;  3MR2 A;  4XRH A;  8ICJ A;  2GO7 A;  3H38 A;  4FHV A;  4NLG A;  3WFQ E;  5KTQ A;  5AK6 A;  1MA7 A;  3HT3 A;  3M9M B;  9ICQ A;  3QEA Z;  5KFN A;  8ICF A;  1ZQ1 C;  2UVU A;  3EZ5 A;  1QCK A;  2WF6 A;  5KAI U;  1ZQT A;  2BCR A;  1A6S A;  3J81 j;  1F5A A;  1LVH A;  3F2B A;  4EX7 A;  2B51 A;  1S0V A;  4M5D A;  4WC6 A;  3RR8 A;  3RJF A;  2WF5 A;  2DFL A;  3H4D A;  1OU5 A;  2V4R A;  1D8L A;  2PXI A;  3WK7 A;  1Z00 A;  1RYU A;  4K4H A;  1RZT A;  2GWS A;  4WCW A;  3D2N A;  5J0O A;  4Y2R A;  4CF4 A;  2ZH2 A;  3FDS A;  5KT3 A;  2W9A A;  2KK0 A;  1CRX A;  4EBD A;  4DFM A;  3MFH A;  4NV0 A;  3GII A;  1SKR A;  3UM9 A;  2LYH A;  1Z00 B;  4F8R A;  5EWE A;  2BPF A;  2YMP A;  2WAQ F;  1XSL A;  5ALO A;  5DB7 A;  2IMW P;  2KZ3 A;  5KG1 A;  2AGQ A;  2ISP A;  1QSL A;  4ACO A;  5DGB A;  2HOQ A;  5ALM A;  3AQE A;  7ICU A;  4F50 A;  4ECV A;  3HJ4 A;  2JRZ A;  5KFC A;  3IN5 A;  1ZQN A;  5KT7 A;  5J2D A;  5AIA A;  1RM6 C;  4QW8 A;  1PX5 A;  2HBJ A;  2KKV A;  3TAD A;  5ALE A;  4GC7 A;  4PZN A;  4IQT A;  3N4M B;  3QU2 A;  1EXN A;  3IHQ B;  2HBK A;  3SAG A;  1SL2 A;  3RAX A;  4KLM A;  2QB1 A;  3NVW A;  4K99 A;  3FAH A;  4IS7 A;  4QWD A;  1Q78 A;  1KBU A;  3BJY A;  4RQ3 A;  3B0Y A;  1X40 A;  2OH2 A;  2JR5 A;  3F2D A;  2KZM A;  8ICP A;  3H37 A;  5DQG A;  4HYK A;  4ECY A;  2ZTD A;  1KDH A;  4BJQ A;  4LJX A;  2Y0S F;  5KFS A;  4Y2T A;  4M9L A;  3Q8L A;  4FZM A;  2HSZ A;  2NYV A;  5J2K A;  2XY7 A;  4DQR A;  2YMQ A;  4NL9 C;  1R89 A;  1S5L U;  3K75 D;  4CF3 A;  2BQR A;  3ERC C;  5DDY A;  4ED0 A;  4RNN A;  3H8W A;  1PK1 A;  4NXV A;  2I1Q A;  3ORY A;  8ICS A;  4ECS A;  2PFN A;  1BNO A;  5CR0 A;  4BX9 C;  3HRD D;  4EV6 A;  2DKX A;  3MDA A;  2BPG A;  4O68 A;  3WK8 A;  4F93 B;  4QIW F;  3ZDC A;  2W43 A;  2HOF A;  1Q3V A;  4EED A;  2F2A B;  4CRX A;  4IRC A;  5HRI A;  2HHT A;  1TFW A;  1PK1 B;  2RQ5 A;  4KMU A;  1JRP A;  2BR0 A;  9ICX A;  1TK5 A;  3SMV A;  2VA8 A;  4DO9 A;  5J0T A;  5JUM A;  5AM2 A;  5HNK A;  3H40 A;  1DK2 A;  3EPI A;  1N62 A;  3G6Y A;  2I6X A;  5J2C A;  3H3A A;  3RJI A;  2BHN A;  4USA A;  3SEI A;  3IDW A;  5D61 A;  1RPL A;  7ICR A;  5DG7 A;  4ECW A;  3SV3 A;  3C29 A;  2H3Z A;  2M2W A;  5AI8 A;  2J6T A;  1D8B A;  5HRL A;  1ZQF A;  2QLT A;  1FIQ A;  4BXO A;  5AKJ A;  5CFS A;  4DQS A;  4O3N A;  4Q8F A;  4FBU A;  2W7P A;  3G6X A;  4ECR A;  5KG3 A;  4I2H A;  4AYB F;  4X0A A;  4M9H A;  2W3S A;  5CB1 A;  2BCV A;  4E0D A;  1RYS A;  5JU5 A;  4JWM A;  3SZ2 A;  3QU5 A;  2WF9 A;  1Z1V A;  4UB2 A;  1URJ A;  2M9N A;  8ICW A;  3E58 A;  2P6U A;  3PHZ A;  4Y2Q A;  4BXO B;  4US8 A;  3AUO A;  1UEU A;  1SL1 A;  1WOT A;  2DR8 A;  3NGD A;  5AI5 A;  2HHW A;  2HVI A;  3H8S A;  1U45 A;  2ZIW A;  5KT6 A;  1WWV A;  4B9V A;  7ICE A;  2LYA A;  4DLG A;  1YZ6 A;  4DF8 A;  2K4H A;  2J6U A;  1Z4N A;  4GLX A;  4A8E A;  3KTQ A;  3JPR A;  1YT3 A;  2W3R A;  4RT2 A;  4RWP A;  5AI9 A;  5FP0 A;  5L1I A;  3ZDD A;  2WFA A;  4ECZ A;  2OWO A;  2HHX A;  5ALW A;  9ICB A;  9ICN A;  5E79 U;  3OGU A;  2W55 A;  4PL2 A;  4YG2 A;  4UAS A;  3RH6 A;  2FI1 A;  3O0F A;  2ZIW B;  5B66 U;  4PJ0 U;  3Q8K A;  5D4B A;  1IIP A;  8ICA A;  2DVI A;  3GV7 B;  4Y2X A;  2G09 A;  1ED1 A;  4IL6 U;  4BWM A;  5DB8 A;  5ALP A;  1ZQL A;  1JXE A;  3C2K A;  2RP5 A;  2RDI A;  1TK8 A;  1TAQ A;  4KLF A;  4PGX A;  2KKP A;  3QU7 A;  4TUP A;  2NRT A;  2RRD A;  1RQN A;  4YXJ A;  3GU3 A;  4M0A A;  4PHD A;  3PY8 A;  4O5K A;  1KLN A;  5BOL A;  4AT9 A;  2ZIU A;  3NS1 A;  2W9M A;  4JV0 A;  5ALF A;  3UMG A;  5IIN A;  4HX0 A;  4M9J A;  5J2G A;  1N5W A;  3RH4 A;  9ICO A;  4WC1 A;  2UVR A;  9ICL A;  1KKX A;  4BWJ A;  1TV9 A;  4DL6 A;  4AT7 A;  1MIY A;  1N61 A;  3RB6 A;  2PI5 A;  1VJ5 A;  1X9S A;  2JMG A;  2ZG6 A;  1KRP A;  3ZD9 A;  2NRX A;  5AM4 A;  3SD7 A;  2ZIU B;  3RJH A;  2KFZ A;  4AT9 B;  5J0Q A;  3N7P D;  4E7X A;  4MFC A;  2IOF K;  3Q8Q B;  2H5X A;  1S10 A;  4AT7 B;  4X4V A;  4X5V A;  3QX7 A;  8ICH A;  4M9G A;  5HR7 A;  3VC8 A;  4F72 A;  1UHU A;  1NJX A;  5HRH A;  2HBM A;  2BKE A;  2H3F A;  4J9O A;  4ELU A;  3AM9 A;  2Y1I A;  1ZQQ A;  2AH5 A;  2ZH1 A;  3TAQ A;  3OVS A;  2G5H B;  1J2N A;  4P2H A;  1WUD A;  5ALQ A;  2RDJ A;  5ALU A;  4CNQ A;  5EOZ A;  2KV2 A;  8ICL A;  1V4A A;  2E8M A;  2MA1 A;  2W04 A;  3OTQ A;  4Z6F A;  4NM1 A;  3V7K A;  5J2J A;  4C8L A;  4B6J A;  4UW9 A;  3I28 A;  4FH5 A;  4C80 A;  2B56 A;  3BQ7 A;  2KEY A;  3NVZ A;  2PFQ A;  5ALD A;  3L5K A;  2BZF A;  5BOM A;  3MR6 A;  2F76 X;  4KLE A;  2FPK A;  1S97 A;  1BNP A;  2JH1 A;  3C21 A;  2W54 A;  4DEZ A;  5AKZ A;  4KLJ A;  5ALH A;  1U47 A;  4X4N A;  4IR1 A;  4YR2 A;  4R63 A;  3RJJ A;  4DSF A;  3TQ1 A;  4US9 A;  1PVR A;  1TFR A;  4UAR A;  2VAN A;  4OO1 J;  2HOI A;  2G07 A;  5B3P A;  4DQI A;  2XGP A;  2KIC A;  2K8B B;  1ZQZ A;  1SIJ A;  3OHA A;  5CWR A;  3TFR A;  1ZD4 A;  1ZQK A;  2ZH7 A;  3NVV A;  4FZN A;  2KJ9 A;  1L7O A;  2KVS A;  2V4Q A;  2WB1 C;  3NRZ A;  2M2V A;  5III A;  1P7D A;  2NRW A;  4F5N A;  4CGZ A;  2XCP A;  3NKU A;  1ZD2 P;  4ECU A;  2ZUC A;  2PFO A;  3ER8 C;  4ECT A;  4R64 A;  4NXX A;  5ALG A;  7ICN A;  4NLN A;  2I5H A;  1NKE A;  3QUC A;  4GIB A;  3LK9 A;  4ATB A;  2AQ0 A;  5DQI A;  2XCA A;  2Q0Z X;  8ICG A;  1ARO P;  4PHE A;  2ZUD A;  2R8K A;  3V7L A;  5ALK A;  4AT8 A;  3IP4 B;  4UBB A;  4YQW A;  1U9L A;  1KQQ A;  5KG5 A;  2K4E A;  2NO5 A;  2W8K A;  4WOY A;  2KE7 A;  5KFL A;  3DEE A;  4OAH A;  5ALZ A;  1VLB A;  1OW5 A;  5JRT A;  9ICR A;  3PNC A;  4ATB B;  5KG0 A;  1FA0 A;  5KFK A;  4OJ5 A;  5AKX A;  4AT8 B;  4FHW A;  2BDU A;  4UAV A;  4Q43 A;  4TUR A;  4C7Z A;  2ASL A;  2GLE A;  3FM9 A;  2WHE A;  4LEZ A;  3RJG A;  4FFD A;  1ZQM A;  4UB1 A;  2JGA A;  3C28 A;  4O67 A;  2Q66 A;  4O9M A;  3PO4 A;  4B9S A;  3JPT A;  3UPQ A;  3C1Z A;  4XQ8 A;  3IV6 A;  4PHP A;  1JX4 A;  5J8Y C;  1B4F A;  1JUD A;  4RUA A;  3ISB A;  4NJ8 A;  2ZUB A;  2DQN B;  4QZC A;  3U26 A;  2EAP A;  1KEJ A;  1N56 A;  1ZQY A;  4O5C A;  2ASD A;  3OWG A;  4JLZ A;  4DL4 A;  3KD3 A;  2ZJA A;  2IBK A;  3RR7 A;  2M2T A;  5EE0 A;  1S0M A;  1B43 A;  1NI3 A;  4QZI A;  1TVA A;  3PSP A;  4WC7 A;  5J0W A;  3PR4 A;  3KFU F;  4DLE A;  7ICL A;  3RRG A;  3TAP A;  3PST A;  2C2R A;  2EDU A;  2VIX A;  2VJ4 A;  1NZP A;  5KFB A;  2F3N A;  1DXS A;  2EAO A;  4RQ5 A;  4RQ4 A;  3L3F X;  1VJ7 A;  9ICK A;  9ICS A;  3PW4 A;  1MN8 A;  2AGP A;  4UAZ A;  2MUT A;  2G5I B;  5KFE A;  3KHL A;  5KFA A;  3NVY A;  4RZR A;  4EYI B;  5CFU A;  4FHP A;  3ER9 B;  3Q8S B;  4RQM A;  1SWW A;  1L3T A;  4DS4 A;  2AGO A;  2G06 A;  3C1Y A;  4EEK A;  5EE3 A;  2FPM A;  1UA1 A;  3C2M A;  2DRB A;  3ZDE A;  2MUT B;  5J0U A;  3QU4 A;  1DRG A;  4X0B A;  3R9K A;  1KSP A;  5AKL A;  1FEZ A;  3H0R B;  2KIW A;  1ZD3 A;  1SV0 A;  1BPE A;  3BQT A;  4O3P A;  4WH5 A;  4J9Q A;  3MAB A;  1ZQI A;  1L3S A;  1QSY A;  8ICE A;  1OXJ A;  3K1R B;  1ZOL A;  1XSP A;  4ELV A;  3HX0 A;  2AQ4 A;  5KFG A;  2KTQ A;  5AKE A;  3WKB A;  2UVV A;  5CEH A;  2ZH3 A;  8ICR A;  3WFP A;  4M2Y A;  8ICZ A;  4FZL A;  4X4Q A;  2YMM A;  1BPY A;  2Q4T A;  3V6K A;  1K5O A;  1CEZ A;  3SQI A;  1IG6 A;  1X6J A;  1ZQB A;  4KLT A;  4ICA A;  2KJ8 A;  3PW7 A;  2K8C B;  4KN7 A;  2F1J A;  3LWM A;  2FMP A;  4Y2S A;  2OXO A;  4K98 A;  2BQ3 A;  2KIV A;  4GXJ A;  2E1F A;  1Q79 A;  2HHS A;  2LMR A;  1H38 A;  1BPB A;  4J9S A;  4RWN A;  1N63 A;  5KL1 B;  1J97 A;  2GOL A;  4CDG A;  1IM4 A;  4RNO A;  5EWF A;  4UAT A;  3RAQ A;  4FS2 A;  4DFJ A;  3IRU A;  5J0P A;  1D9F A;  2PMZ C;  5B5E U;  2V9W A;  1ZRM A;  2OHF A;  4MFF A;  3KKA C;  4FO6 A;  4PGY A;  5KFW A;  4UBC A;  2XIC A;  2Y1J A;  4O5E A;  3M9N B;  4P0Q A;  4DFD A;  3H8M A;  4QWA A;  1TKD A;  2JH7 A;  4WC3 A;  3HJE A;  9ICI A;  1XU4 A;  5EE9 A;  5IIJ A;  4M47 A;  1B0X A;  4MEY A;  3WKD A;  5CJ7 A;  4DL5 A;  4KLI A;  4C4S A;  4DL7 A;  1L5U A;  3PW5 A;  5DB6 A;  3PW2 A;  1RDF A;  2JV3 A;  4RPZ A;  3T3F A;  2JHD A;  2KHQ A;  1SKS A;  4P0Q B;  1N5X A;  2XO7 A;  4LZG A;  2KZZ A;  5J0R A;  1ZQA A;  3AN1 A;  4F2S A;  4MEX A;  2VA2 A;  3V6J A;  5J2A A;  2HHV A;  3WK9 A;  1T7P A;  5HHH A;  2BDP A;  3HIY A;  5H2F U;  1C7Y A;  1QQ6 A;  1ZQU A;  3KHR A;  2BQU A;  1NZB A;  1A77 A;  9ICM A;  1KFS A;  4EEY A;  5T14 A;  1UET A;  5BPC A;  1U49 A;  1ZQE A;  3H4B A;  4LEW A;  3TI0 A;  3MDC A;  3JPN A;  3OJU A;  2O6K A;  4NKT A;  5AKI A;  4QZ9 A;  2GAF D;  4NXU A;  1COO A;  9ICC A;  2LI6 A;  2YY6 A;  3MGI A;  1XO1 A;  4C8M A;  4UD5 A;  4P4M A;  2GH1 A;  1JQR A;  4QWB A;  2OCE A;  3QZ7 A;  5KFP A;  2FMQ A;  3GFK B;  1U4B A;  4Y2P A;  2P66 A;  4I2A A;  4FH3 A;  3M1Y A;  5AM1 A;  4F5R A;  2ZTC A;  3OVB A;  2FE9 A;  1SZH A;  4O3M A;  1QQ7 A;  4C7Y A;  4P4P A;  2DL0 A;  3NWI A;  5CHE A;  3TKA A;  5KG7 A;  2HDO A;  4QZB A;  4RT3 A;  4RQ0 A;  2DR7 A;  4O3Q A;  1X6I A;  4YMM A;  5AKH A;  3M8R A;  4NY8 A;  4F5Q A;  3A0B U;  2KHV A;  3WFR E;  2WF7 A;  2XY5 A;  2LM4 A;  1X9M A;  2D3D A;  1KNY A;  4NL9 A;  1NKC A;  1JN3 A;  2F77 X;  3L9D A;  5IIL A;  2Y0S C;  4C8N A;  2QB0 A;  3BS5 A;  3G6V A;  1NK5 A;  4E8F A;  5KT5 A;  3GZF A;  5DG8 A;  2F8L A;  4R8U A;  1NK7 A;  1WYG A;  4M9N A;  2ZH6 A;  5DKW A;  2ZH5 A;  2ID1 A;  4QNL A;  4BGD A;  4PPX A;  2OYY A;  8ICK A;  3BDP A;  3DV9 A;  3T5J A;  2OEH A;  8ICU A;  3K1Z A;  1LKY A;  1QQ5 A;  3HJ1 A;  2MU2 A;  3AEV A;  3RB3 A;  4CE6 A;  4KLS A;  2QB0 B;  3BS5 B;  4NLB A;  2ISO A;  4EEL A;  2PBE A;  1J2M A;  2E1E A;  4R8U B;  3LWL A;  4QZ8 A;  3IM1 A;  4QIW C;  4CF5 A;  5K4L A;  1QLN A;  5J0S A;  3MGH A;  4RPY A;  2YN4 A;  4JMU A;  2AJQ A;  1XC9 A;  1O03 A;  3RFA A;  3TFS A;  1UPH A;  2E8O A;  3AQK A;  3QEB Z;  1ZET A;  3THV A;  5DLG A;  5CHG A;  1LKY B;  4FS1 A;  4J9R A;  1GO3 F;  4F71 A;  4RPX A;  2E5S A;  1S8O A;  3EF2 A;  1XWL A;  5HML A;  7ICH A;  5J29 A;  3KZX A;  5AI0 A;  2ZH9 A;  5ALR A;  4YR0 A;  5JTG A;  2G08 A;  3NTU A;  2EZY A;  4IQW A;  1ZQH A;  4F4X A;  4Q8E A;  9ICW A;  4K9B A;  5HRK A;  2BBJ A;  2HHP A;  4J9P A;  5ALN A;  1X9W A;  4ED3 A;  2YB4 A;  4KTQ A;  1V38 A;  2ZJ5 A;  2DR9 A;  4I2B A;  2WF8 A;  4DFP A;  4DOC A;  4AYB C;  4DSI A;  4JB3 A;  2KVC A;  3UPS A;  4EZ6 A;  8ICM A;  3AU2 A;  2RFF A;  4I2I A;  4UD4 A;  1NK6 A;  1L6N A;  1S76 D;  5CFT A;  4QWC A;  1SXD A;  3BQ1 A;  2P6R A;  8ICI A;  3CNH A;  4QZA A;  1DGS A;  5KNI A;  4ZOH C; 
#chains in the Genus database with same CATH homology
 1SKR A;  3PNC A;  4QZH A;  4ATB B;  2LYH A;  5KG0 A;  4EYH B;  1FA0 A;  1Z00 B;  5HRB A;  5L1J A;  3JPS A;  4F8R A;  4YN4 A;  1MQ3 A;  4DS5 A;  1UT8 A;  5KFK A;  4DOB A;  4X4T A;  3C18 A;  5EWE A;  2BPF A;  4DSE A;  4AT8 B;  4FHW A;  4TUS A;  1ZQV A;  4Q43 A;  5DB7 A;  1XSL A;  4I2G A;  4TUR A;  2IMW P;  2ASL A;  4DQP A;  5HHI A;  2KZ3 A;  5KG1 A;  7ICK A;  2AGQ A;  7ICV A;  5KFM A;  2ISP A;  1QSL A;  4K4I A;  5EWG A;  5DGB A;  4Q44 A;  3RJG A;  9ICU A;  1ZQM A;  4DF4 A;  4QZG A;  7ICU A;  8ICO A;  1KTQ A;  4UB1 A;  4F50 A;  3Q8R B;  4ECV A;  3MBY A;  4IRK A;  3HJ4 A;  4MF8 A;  3H7I A;  5KFC A;  2Q66 A;  1LV5 A;  1BPZ A;  4O9M A;  3UQ2 A;  5KG2 A;  3PO4 A;  4B9S A;  3JPT A;  4O3O A;  3UXP A;  3UPQ A;  3C1Z A;  1ZQN A;  3JYY A;  3PML A;  4XQ8 A;  4PHP A;  2C28 A;  1U48 A;  5HMM A;  5KT7 A;  5J2D A;  2F1H A;  4RUA A;  3ISB A;  1L3U A;  7ICP A;  4QW8 A;  7ICI A;  5J2B A;  1NK9 A;  1PX5 A;  4S3N A;  2KP7 A;  1S0N A;  2ZUB A;  4QZC A;  1KEJ A;  1N56 A;  1ZQY A;  1ZQD A;  5J2F A;  4UAW A;  4O5C A;  4GC7 A;  2ASD A;  1XSN A;  4TUQ A;  4IQT A;  4DL4 A;  5KT2 A;  3E2E A;  2ZJA A;  3N4M B;  3RRH A;  2IBK A;  1EXN A;  4RNM A;  3EPG A;  3IHQ B;  3PX0 A;  4X4S A;  4F5O A;  3TAN A;  3RR7 A;  1SL2 A;  4YMO A;  2ATL A;  1MQ2 A;  3RAX A;  4KLG A;  2M2T A;  1S0M A;  4Z6E A;  1B43 A;  1PZN A;  4QZI A;  1TVA A;  4KLM A;  1JIH A;  9ICH A;  5J0W A;  4WC7 A;  3PR4 A;  1JXL A;  1MSW D;  2O1P A;  4DLE A;  5CP2 A;  7ICG A;  3H39 A;  1UA0 A;  1NJY A;  3RRG A;  4QWD A;  7ICL A;  1Q78 A;  3TAP A;  3BJY A;  4RQ3 A;  4KLU A;  2C2R A;  3B0Y A;  5L9X A;  3LDA A;  4M04 A;  4G3I A;  2KZM A;  4YD1 A;  8ICP A;  5KFB A;  9ICT A;  1NZP A;  3H37 A;  5DQG A;  2ZHA A;  3JPO A;  3OV7 A;  3GIJ A;  3V7J A;  2BE3 A;  4HYK A;  4ECY A;  3UXO A;  2ZTD A;  4RWO A;  1KDH A;  1UEV A;  1NJZ A;  1DOQ A;  4RQ5 A;  5F9L A;  4NKU A;  5KFS A;  4RQ4 A;  4M9L A;  3RBD A;  1VJ7 A;  3Q8L A;  9ICK A;  9ICS A;  3PW4 A;  3C5F A;  5J2K A;  4JUZ A;  2AGP A;  2ZJ8 A;  2XY7 A;  4UAZ A;  2MUT A;  1N48 A;  4DSL A;  4RWQ A;  3AU6 A;  2R8G A;  4DQR A;  5KFE A;  3KHL A;  4ECX A;  3SYZ A;  1R89 A;  2JZB A;  5KFA A;  1T3N A;  4IRD A;  4K4G A;  3K75 D;  2BQR A;  1ZYQ A;  4RZR A;  5DDY A;  4EYI B;  4ED0 A;  4FHP A;  3Q8S B;  4RNN A;  2I9G A;  1L3T A;  2FMS A;  3H8W A;  5DLF A;  4DS4 A;  4C8O A;  5DBB A;  2I1Q A;  3ORY A;  4JV1 A;  2AGO A;  1ZQJ A;  4JV2 A;  8ICS A;  2JEI A;  3GDX A;  3ISC A;  3GV8 B;  5DG9 A;  4LZD A;  4ECS A;  1RYR A;  3C1Y A;  2PFN A;  4YMN A;  1ZQW A;  4RQ8 A;  4YVZ A;  5CR0 A;  1BNO A;  5J2I A;  2WTF A;  1D9D A;  2FPM A;  2XC9 A;  1UA1 A;  3C2M A;  2DRB A;  3ZDE A;  2VA3 A;  5HC9 A;  3JPP A;  2BPC A;  4TQS A;  2O5A A;  2MUT B;  5J0U A;  4YP3 A;  3MDA A;  4EBE A;  2BPG A;  4X0B A;  4F93 B;  3GIL A;  4YXM A;  4DL3 A;  1KSP A;  3ZDC A;  2JZB B;  9ICG A;  4F3O A;  3BQ2 A;  1B22 A;  4WC2 A;  1BPE A;  5DED A;  3BQT A;  4O3P A;  4ED8 A;  1XS9 D;  4IRC A;  5C5J A;  4UB3 A;  5HRI A;  2FPL A;  2HHT A;  3AQN A;  4ED2 A;  1TFW A;  4M6W A;  4F4K A;  4J9Q A;  4NXZ A;  4KMU A;  5KG4 A;  3MAB A;  3ZD8 A;  1ZQI A;  9ICE A;  1L3S A;  1QSY A;  4DFK A;  2BR0 A;  8ICE A;  8ICN A;  1XSP A;  1TK5 A;  4ELV A;  9ICX A;  3HX0 A;  2VA8 A;  5KFG A;  4QWE A;  2AQ4 A;  2KTQ A;  4WC0 A;  9ICV A;  4DO9 A;  2DR5 A;  2UVV A;  5J0T A;  8ICR A;  3WFP A;  2ZH3 A;  4M2Y A;  5JUM A;  8ICZ A;  4X4Q A;  5HNK A;  1BPY A;  3H40 A;  3UQ0 A;  4UB5 A;  1DK2 A;  3EPI A;  4UAY A;  3V6K A;  1CEZ A;  4I2J A;  1K1S A;  3G6Y A;  4QZF A;  5J2C A;  1ZQB A;  4BDP A;  4KLT A;  3H3A A;  2BCU A;  3PW7 A;  3RJI A;  2BHN A;  3HPO A;  1S9F A;  3T5H A;  1NO5 A;  4LVS A;  4KN7 A;  4IQU A;  1RPL A;  2F1J A;  3LWM A;  2FMP A;  7ICR A;  3MR5 A;  4M6W B;  5DBA A;  4PHA A;  2BQ3 A;  2M2U A;  4GXJ A;  5DG7 A;  4ECW A;  1JAJ A;  3SV3 A;  1Q79 A;  2HHS A;  1BVS A;  1RXW A;  1H38 A;  1BPB A;  4R66 A;  4J9S A;  4DQQ A;  2M2W A;  4RWN A;  3C66 A;  2J6T A;  3OSP A;  1CUK A;  4JK1 A;  3ZDB A;  4J9N A;  4I29 A;  5HRL A;  4F91 B;  1ZQF A;  4P4O A;  1Z3E B;  2IHM A;  5KFZ A;  2W9B A;  2W9C A;  4BXO A;  1IM4 A;  4DQS A;  4O3N A;  2C2D A;  4O3R A;  4Q8F A;  8ICT A;  4FBU A;  2NRZ A;  3G6X A;  4RNO A;  5EWF A;  4ECR A;  3RBE A;  5KG3 A;  4I2H A;  4X0A A;  3RAQ A;  4FS2 A;  4DFJ A;  5DBC A;  4M9H A;  3M9O B;  4O3S A;  4IG8 A;  4F2R A;  5J0P A;  4Z6C A;  5CB1 A;  4F92 B;  1WCL A;  2R8I A;  3PMN A;  3PV8 A;  1SL0 A;  3TAR A;  1D9F A;  4QZE A;  2F1I A;  4J9M A;  2V9W A;  2BCV A;  4E0D A;  5J0X A;  1R8A A;  5KFJ A;  3JPQ A;  3V6H A;  1RYS A;  4WC5 A;  3WFO A;  2MAX A;  4YD2 A;  5DDM A;  4F4W A;  3T5K A;  4JWM A;  4MFF A;  3HP6 A;  3SZ2 A;  1R8C A;  3M8S A;  1NKB A;  4UB2 A;  2M9N A;  8ICW A;  4FO6 A;  4FBT A;  4PGY A;  2P6U A;  5KFW A;  4UBC A;  3PR5 B;  2Y1J A;  5HRD A;  2W9B B;  4XA5 A;  4BXO B;  4O5E A;  3M9N B;  3AUO A;  3RB0 A;  1UEU A;  1SL1 A;  4QWA A;  1TKD A;  1WOT A;  2DR8 A;  3NGD A;  4WC3 A;  2HHW A;  3C2L A;  2HVI A;  1KFT A;  3H8S A;  5L1L A;  1U45 A;  3FYH A;  9ICI A;  1XU4 A;  5KT6 A;  5IIJ A;  4ECQ A;  4B9V A;  1WCN A;  7ICE A;  4M47 A;  2AU0 A;  4MEY A;  2HHU A;  4DLG A;  4XQ7 A;  5CJ7 A;  7ICQ A;  3GIM A;  4DL5 A;  4DF8 A;  4DL7 A;  2J6U A;  4KLI A;  1L3V A;  2HW3 A;  2FLP A;  4GLX A;  3KTQ A;  1L5U A;  4QW9 A;  1ZJN A;  3PW5 A;  3B0X A;  5DB6 A;  4RT2 A;  3JPR A;  3JZ0 A;  1KFD A;  3OUY A;  3PW2 A;  4RWP A;  4X4P A;  8ICQ A;  5L1I A;  3T3F A;  4RPZ A;  3ZDD A;  4ECZ A;  2OWO A;  2HHX A;  1T8E A;  5D49 A;  9ICB A;  1SKS A;  3K4G A;  2XO7 A;  4LZG A;  1S77 D;  2KZZ A;  9ICN A;  3OGU A;  4YG2 A;  5HR9 A;  3RH6 A;  5J0R A;  4EP7 A;  1ZQA A;  5KFI A;  4I2C A;  3Q8P B;  5KG6 A;  1R8B A;  3PW0 A;  1NOM A;  2IHN A;  4F2S A;  4IQV A;  1A76 A;  4FHY A;  1LB2 B;  4MEX A;  3T5L A;  4ZH4 A;  3PX6 A;  3Q8K A;  3V6J A;  5J2A A;  1QSS A;  2VA2 A;  2HHV A;  9ICP A;  1T7P A;  5D4B A;  5HHH A;  4JWN A;  4O0I A;  4RU9 A;  2BDP A;  2C2E A;  8ICA A;  3GV7 B;  3HIY A;  2DVI A;  3OUY B;  5KFR A;  4B9T A;  4EBK A;  1C7Y A;  1ZQU A;  3KHR A;  2BQU A;  4BWM A;  1A77 A;  5DB8 A;  2PI4 A;  1ZQL A;  1JXE A;  9ICM A;  1KFS A;  5HRE A;  3EWA A;  5DGA A;  3C2K A;  4EEY A;  1UT5 A;  5KFV A;  1UET A;  2RDI A;  4Z6D A;  5BPC A;  2ASJ A;  1TK8 A;  1U49 A;  1TAQ A;  4KLF A;  5HRF A;  4PGX A;  1ZQE A;  3H4B A;  2PFP A;  4TUP A;  2NRT A;  3TI0 A;  3BQ0 A;  4MFA A;  3MDC A;  7ICF A;  3JPN A;  4YXJ A;  3OJU A;  4M0A A;  4B9M A;  1VFG A;  4NKT A;  4QZ9 A;  5KFD A;  4PHD A;  1COO A;  9ICC A;  3PY8 A;  4O5K A;  5KFQ A;  3MGI A;  1V9P A;  1KLN A;  1XO1 A;  5BOL A;  2DPJ A;  4C8M A;  4AT9 A;  4UD5 A;  4P4M A;  2W9M A;  4JV0 A;  5KFX A;  1NJW A;  4ELT A;  5IIN A;  4QWB A;  3QZ7 A;  1JQR A;  3KHG A;  4I2E A;  5KFP A;  9ICJ A;  4M9J A;  4GXK A;  5KFH A;  5J2G A;  3QZ8 A;  2FMQ A;  3RH4 A;  9ICO A;  3GFK B;  4ED1 A;  1U4B A;  3AQL A;  4WC1 A;  1MC8 A;  4DSK A;  2P66 A;  2UVR A;  4I2A A;  9ICL A;  4AT7 A;  4BWJ A;  1TV9 A;  4DL6 A;  4FH3 A;  3RTV A;  1MIY A;  4UB4 A;  1HUZ A;  3RB6 A;  4F5R A;  2ZTC A;  4RQ1 A;  2PI5 A;  1X9S A;  3OVB A;  1ZQS A;  2ZH8 A;  1QTM A;  2A1J A;  5HP4 A;  1K1Q A;  5IIO A;  1KRP A;  4B9U A;  1ZQO A;  1S0O A;  3ZD9 A;  3GV5 B;  4P4P A;  4C8K A;  2NRX A;  3QE9 Y;  1X2I A;  5KG7 A;  3RJH A;  4AT9 B;  2KFZ A;  2DRA A;  4X4U A;  1TAU A;  4QZB A;  5KFO A;  5J0Q A;  4RT3 A;  5CA7 A;  2W8L A;  4RUC A;  1SZP A;  4KN4 A;  4RQ0 A;  2DR7 A;  3RJE A;  4MFC A;  4E7X A;  4QZD A;  3ISD A;  4O3Q A;  2UVW A;  3PO5 A;  1T4G A;  2XGQ A;  4YMM A;  2J6S A;  5J2E A;  3Q8Q B;  2H5X A;  1S10 A;  1BGX T;  4CCH A;  3OHB A;  1YLQ A;  4GXI A;  4EZ9 A;  3M8R A;  4UQG A;  3V72 A;  4NY8 A;  4NLZ A;  8ICV A;  8ICX A;  4AT7 B;  4X5V A;  2ZH4 A;  4X4V A;  3ETL A;  1ZQX A;  4F5Q A;  8ICH A;  4F4Z A;  4ED6 A;  2DPI A;  4M9G A;  7ICJ A;  4YFK A;  2A1J B;  4I2D A;  3HW8 A;  5L1K A;  3WFR E;  2XY5 A;  1BPX A;  4RQ6 A;  1NJX A;  4PH5 A;  1X9M A;  1IXR A;  1Y88 A;  4J9K A;  7ICO A;  1KNY A;  2JEF A;  5KFU A;  4XUS A;  1NKC A;  2ZHB A;  4DSJ A;  5IIM A;  1JN3 A;  4IR9 A;  5HRH A;  2ZTE A;  4DOA A;  3PVX A;  2BKE A;  3L9D A;  4J9O A;  4C8N A;  5IIL A;  4ELU A;  2BCQ A;  5DQH A;  3G6V A;  3MFI A;  1NK5 A;  4E8F A;  5KT5 A;  4KLO A;  4X4O A;  5DB9 A;  2Y1I A;  5DG8 A;  1ZQQ A;  4R8U A;  4RQ7 A;  4DL2 A;  2C22 A;  1NK7 A;  5J2H A;  5IIK A;  1RXV A;  2BCS A;  4M9N A;  8ICY A;  3EW9 A;  4R65 A;  2ZH6 A;  2ZH1 A;  5DKW A;  2W9C B;  1MIW A;  3OJS A;  2ZH5 A;  2ID1 A;  3TAQ A;  5KFT A;  4NM2 A;  4P2H A;  4BGD A;  2KN7 A;  3OVS A;  4PPX A;  2RDJ A;  1HJP A;  5EOZ A;  8ICK A;  8ICL A;  4J9L A;  4KIT B;  2R8H A;  2B21 A;  2FLL A;  3RJK A;  4Z6F A;  3BDP A;  3ZDA A;  4NM1 A;  1V4A A;  1TFY A;  3V7K A;  2HVH A;  3T5J A;  8ICC A;  8ICU A;  7ICS A;  5J2J A;  5KT4 A;  4C8L A;  3WFS C;  1ZQP A;  8ICB A;  1DK3 A;  3HJ1 A;  3PX4 A;  5J0Y A;  4FH5 A;  3RB3 A;  1HUO A;  1MIV A;  3OVA A;  4KLS A;  4EBC A;  2PFQ A;  4B9L A;  4FHX A;  4WC4 A;  3N97 B;  2ISO A;  4YR3 A;  9ICF A;  2KFN A;  2PBE A;  3OSN A;  4KLD A;  4KLL A;  3GIK A;  2R8J A;  4R8U B;  3HWT A;  5BOM A;  5TZV A;  3MR6 A;  3LWL A;  4QZ8 A;  4KLE A;  3IM1 A;  4I28 A;  1QLN A;  2FPK A;  5J0S A;  3MGH A;  4RPY A;  1S97 A;  2BGW A;  2AJQ A;  1BNP A;  4MF2 A;  1XC9 A;  2JEJ A;  3C21 A;  4DEZ A;  4LT6 A;  3EYZ A;  1ZQC A;  3C5G A;  3TFS A;  3Q8M A;  4KLJ A;  7ICM A;  1U47 A;  3AQK A;  7ICT A;  3QEB Z;  1ZET A;  4X4R A;  4X4N A;  4PGQ A;  3THV A;  5DLG A;  5CHG A;  4IR1 A;  4FS1 A;  4YR2 A;  4TQR A;  4R63 A;  4GC6 A;  1NK0 A;  4J9R A;  3AQM A;  4WBZ A;  3RJJ A;  4DSF A;  1JX4 A;  5KFF A;  4EBJ A;  3SI8 A;  4RPX A;  2HHQ A;  3TQ1 A;  1TFR A;  5HRG A;  2VAN A;  4F5P A;  1ZQG A;  4DWI A;  1XWL A;  5HML A;  4WBY A;  2JEG A;  4DQI A;  5KFY A;  7ICH A;  2XGP A;  5J29 A;  4F4Y A;  2ZH9 A;  3RH5 A;  3MR3 A;  3SV4 A;  3MR2 A;  4YR0 A;  4XRH A;  1ZQZ A;  8ICJ A;  3H38 A;  3OHA A;  5CWR A;  4FHV A;  3NTU A;  3TFR A;  4NLG A;  5KTQ A;  1ZQK A;  3WFQ E;  4IQW A;  1JMS A;  1ZQH A;  1TK0 A;  4NLK A;  2ZH7 A;  3HT3 A;  3M9M B;  2FLN A;  9ICQ A;  3QEA Z;  3H8J A;  5KFN A;  4F4X A;  2UVU A;  4Q8E A;  8ICF A;  1NK8 A;  3RB4 A;  9ICW A;  5HRK A;  3EZ5 A;  4E80 A;  3LQC B;  2IA6 A;  5F9N A;  2NRV A;  4J9P A;  4KLQ A;  2HHP A;  2V4Q A;  1ZQT A;  1D8Y A;  2BCR A;  1X9W A;  2M2V A;  3C23 A;  5III A;  2NRW A;  4F5N A;  1F5A A;  3UXN A;  4KLH A;  4ED3 A;  4KTQ A;  2XCP A;  2ZJ5 A;  3GQC A;  4I2B A;  1S0V A;  2DR9 A;  4M5D A;  4ECU A;  2ZUC A;  2PFO A;  3RR8 A;  4WC6 A;  4I2F A;  4ECT A;  4R64 A;  3RJF A;  1BPD A;  2DFL A;  7ICN A;  3H4D A;  4NLN A;  1NK4 A;  4DFP A;  4DOC A;  1NKE A;  1ZQR A;  4DSI A;  4Q45 A;  2V4R A;  1OU5 A;  1D8L A;  2PXI A;  3UPS A;  3LK9 A;  2XY6 A;  1ZJM A;  2ALZ A;  5D46 A;  4EZ6 A;  3NYB A;  4ATB A;  2AQ0 A;  1Z00 A;  1SKW A;  8ICM A;  3AU2 A;  5DQI A;  4YCX A;  2Q0Z X;  2XCA A;  8ICG A;  1ARO P;  4K4H A;  4PHE A;  2ZUD A;  9ICA A;  2R8K A;  3V7L A;  3KHH A;  1RZT A;  2GWS A;  2RFF A;  4AT8 A;  4UBB A;  2NRK A;  4I2I A;  4WCW A;  4YQW A;  4UD4 A;  5J0O A;  1U9L A;  5KG5 A;  1NK6 A;  2W8K A;  2ZH2 A;  3FDS A;  4B9N A;  5KT3 A;  5KFL A;  2W9A A;  1S76 D;  4EBD A;  4DFM A;  3MFH A;  4ED7 A;  4QWC A;  3BQ1 A;  3GII A;  2P6R A;  5F2V O;  8ICI A;  4RQ2 A;  4QZA A;  9ICR A;  5DEC A;  1DGS A;  4I27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...