5HHOE

Crystal structure of the jm22 tcr in complex with hla-a*0201 in complex with m1-g4e
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
240
structure length
240
Chain Sequence
b'GGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIRSSYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE02
2EE9A 4HKBA 4UDUB 3TEUA 1A6PA 3PHOA 3QUML 4NQXB 2D7MA 1GGUA 4R4FH 4EN3A 4Q74A 3RHWK 2OS7A 3VRLE 1NMCB 3KYOA 4JZNA 1HWGB 1INQA 2KQMA 5EDXA 1GXEA 1J05B 1EO8H 4P57B 4PJHB 1CI5A 4I48B 3GBLA 3X13B 3V5DA 3WL9A 1UXWA 2EXYD 4M6MH 1WQVT 2EDQA 2IQAA 3MRDB 5D70H 2ZOKA 4ZO7A 3QULB 3UTPE 5IMMB 5MP6L 2DIJA 3NAAL 1LP9A 5EO1B 1FZKA 4KTDL 5AZEL 4FFYH 2YPVH 3IDMA 5CHNB 1OWWA 5DT1L 4FQIL 3HR6A 5EFIB 1XF3B 3D3VB 5GIRA 4YX2H 3RVUC 3HR5A 3EHBC 4OM0H 4RFEB 5CEXB 4NCC1 2YPLD 2ICES 3BYYA 1KB9J 1CGXA 4JGMA 2JCCB 1NAMB 3ILQC 3FKUS 4OB5L 4LQFH 1YC8A 4PP1D 5CEYB 3C2SA 1GAFL 4N90D 4OGYH 3KGRA 3S98A 3MRKA 3QUYA 4XNQB 1YYML 1Z5LA 3PHQB 2G60L 1RZJC 1PLGL 1LP9F 4GQ9H 1LK2A 2GAZA 1YEJL 3C2AH 2C7UB 4QTIL 3T2NL 4BH8B 1IVLA 4Y5YB 3BW9B 4Y19E 4E9LA 1BZ7B 5J57B 3N9GH 1H3PH 5EU4A 1IGMH 4XX1E 3ROOB 4QRQA 4HJGA 2W07A 4F8QA 1AKJA 1GZQA 4ZNCD 3DWTA 4JO3L 4PGBA 1HNGA 5JXAL 5T33L 2NTSP 3SPVA 4TN9A 4MCZB 3O2DA 3UYOD 3GSQA 4UINH 4ODXA 4ELKB 1LE5B 1D5MB 3MBXH 3QDMD 4JFDE 4YH6A 1MCPL 1YEGH 4N0FA 5KVEL 1C5CH 1JGEB 3H42L 3AREB 2NZIA 5DJ0A 2AXHA 5TFSL 1JZ3A 1J5OL 5EIVA 4NJAH 3SCMD 1UB5B 1FVEB 4U1GB 4D0CA 4AIZB 2DIAA 4M02A 2YD8A 1ZLWH 3V6ZB 2IAMD 2Z35A 5IF0B 4GW4A 3FRPA 2UY6A 3O0RH 2A83B 1QUNA 3BGFC 4PJ9A 4X7DC 3K81A 2IH3A 3ARDD 1SYVB 3NCCB 4PRID 3O6FD 2H32H 3QEQB 4BQ8A 1YMMD 2LAAA 3DRQA 4C4KO 2EYSB 5CKAA 1UJ3A 2XA8H 5C08B 2AGJL 4O9HL 3U83A 3BHBA 3PGDB 3VJ6A 3QQ3A 5IJVB 5D2NB 3CFDB 1T89A 4HT1H 5BS0E 5TE7H 2ZSVA 2FD6H 3H2WA 4OLZL 3VWKA 4FXKA 3C5ZB 4B53A 1YPZA 5B38A 4PREB 4L8SB 2XACC 1P7KB 1NMBH 1QLFA 4H8WC 4LF3A 2CKNA 5GS2H 5F21B 4L8CA 3S96B 4GH7B 3VXSE 2D31B 4LVOB 2COQA 3LB6D 5IP4A 5K9JH 2OI9C 2JELH 5AG9A 3OKEA 1N5YL 3F8UB 4OZHB 3IFPB 1ETZB 3CDFA 4KKBC 4LARH 1J10A 4HW6A 1UKSA 2XNAB 1FNHA 4MQ7B 4OAWA 3EO1A 2GK0B 5CGTA 3OAYH 4OFYD 4M9PA 4K07A 1MPAL 3QNZB 4LPCA 4X7CC 3U48A 3U2SB 3BP4B 3MGOB 1WTLA 1E4KC 2ZG2A 3LV3A 4O02L 3QUKB 1MLBA 5ADOH 1RIHL 2QSCL 2PO6D 4ONFL 1CLCA 1DQDH 3T4YB 1AD9A 1AGFA 1FYTD 1KIPB 1LEKB 2YMXH 4PRDA 1QNZL 4XXDA 3GMMB 1FCCA 3C60D 4DKAA 3ZSSA 4D3CH 3Q5TA 5E9DA 3W0WE 1ZWIB 1HNFA 1S8DB 1G0DA 1JI2A 1Z9LA 4M6NL 3QBTB 4R96A 3GSVB 2HWZL 1BFTA 2R0KH 5C0DA 4LVEA 3RU8H 3BZDA 2WMPA 4UAOB 3WNPA 5JDSB 5T1DH 1N7MH 2DJSA 4I0PA 4P2OB 1OAXL 4U6HB 4Q6YA 3F7YA 4XPFL 1T1YA 4OZGB 5DMGD 5EUOF 4ZXBD 2HMID 1T22A 1XFPA 4N9GA 3GGWA 3M17B 5E5RB 1AD0B 1R5IA 3BWAB 3MFFB 3KYKH 5CEZH 4FMFA 3RZCC 4LPWA 4OFVA 3V4PH 3BH8A 2AV1A 4L4TD 3QDJD 3O3AA 4JM2A 2DD8H 1ZS8A 5CD3A 2IFGA 5FCUL 2OTWB 5IBTH 5IB2A 1MCOL 4M8VA 5IEKB 4IDJH 1BD2A 1A3RL 1A3LH 1EEYA 2YUXA 3OKMA 1U8LB 4JKKA 4KHTL 2EICA 3GHBH 3R8QA 3ZTJG 4HS8L 1KN4H 3WNOA 1LO3H 2XN9D 4IBLT 4NZRL 1T03H 2YR3A 3FT3A 5EBLB 1HYRC 4N0YH 43CAA 2R29H 5E8OA 1K85A 3DPBA 1C12A 3SDCD 3UTSD 5E4EC 4R97B 5C0AD 3GMQB 4Z0BH 3KPRB 5JOFB 1VFMA 4DAGL 4XWGL 1B0GA 4JM2F 5CD5C 1R3LA 2XG4A 3DHMA 3LH2H 3S5LB 2YC1A 3RWIA 3MNVB 4PRAA 1F45A 3LIZL 1DBAL 5I74B 5FKAA 3U4AA 2I60L 4QOKB 3RPKA 4X7TB 4K9EC 2GFBB 1F58H 1A9BA 2BRRL 1EGJL 4KPHH 1MCIA 3UO1L 1IC4L 2O61A 1NMCC 3WFDL 2HFFB 3K8LA 1UACL 3MXVH 4I8DA 3WXWH 3PDOA 5A3IC 2NY3B 2DQDH 4I18A 3ARUA 3SE3C 2RR3A 5HYQB 2X89D 4FQXA 3NFPA 1WC7B 3P30H 1A4KB 4PV8A 4R0LA 5FA4B 3JV4B 4XP6H 3O2WH 5F7NC 5T1LD 2GT9B 2EYTA 4PTTA 4RDQF 3JV6A 3K46A 4KJYB 4WU5B 3U9UA 3UEZA 4ONGL 3GMOA 1Q0XH 3PNWA 1CCZA 1A9EB 5EORH 4PUBH 3QB7C 3DUUB 4BFBD 1HQ4B 3SO3B 2BVEA 1IILE 4JFFB 4X7SH 1HHGA 4X4ZA 1INDL 4YGVA 7CGTA 1LE9B 3V4VL 5JHDA 2NY2D 3O6MH 5E2TH 2Y1VA 3AS1A 2IQ9H 3L95B 3KPOA 3LKNB 3FFDA 3T65A 2AJXL 3R4DA 3HNSH 1OL0A 3PDDA 2PUQT 5FUZH 1MFEL 3VFSA 5BW7A 1DLFH 4DCQA 2PW1A 3GI9H 4PD4K 4Y5YC 3VXMB 2PYFB 4KV5F 1KB5B 2X1QA 3QO1A 4HHAA 5KAQF 1VERA 1ZVSA 3VDCA 2H32A 1MVUA 1G7LB 4FG6D 5ICXB 1P7QD 3J8F7 3MLUH 4U1JA 4XVJL 4MXQC 4MD0A 2X4TA 5CIPB 3T8XA 4GLRI 5A2FA 2DTMH 5J9PA 5KVDL 2DM3A 4P46B 5IV2A 4FQJL 1H8OA 3F7QA 3Q2CA 3ZE1E 2FZ3A 3MX0A 2IPKB 3HKFA 4NUGH 5EZLB 1MLCA 1BVLB 5CUSL 3HG1B 3LRSA 2VL4A 4HKXA 3NA4A 4G43B 3M1BB 3AREC 1MCRA 3FO9B 1JRHL 2QSTA 4WW2F 2GIYA 3JWDL 3S8WA 4IM8A 1S7VB 3PGCA 1KTRL 2Z0BA 4U1GC 1MAMH 3MOBH 3OKKB 5GZOC 5LGJB 1B3JA 1SBSL 4Z5RA 1BZQK 3GJEA 3D87B 3WV0A 2P8LA 4OT1L 2G5BA 2HT2D 2VLRB 3BYTA 2OR9H 3RWFB 1QRKA 1YMHA 1T2XA 4U49A 2HFTA 1RZJH 3F6IA 3QDGB 1IC7H 3GK8L 2DAVA 5SWQA 3EYUL 1KEGH 1GYAA 1PAMA 1MREL 4LEOB 3HLAB 2VZ1A 3SKUD 5D2NC 1YYLL 3IGAA 3SY0A 3QI9A 3RVTD 2X4OA 3B2VL 1KGCD 3LVEA 2BOBA 1RUPL 3T4AA 3TC9A 3C5ZC 5ALCL 4JR9L 1K3IA 2F58H 3IFNH 4L8SC 4K71B 1F5WA 5T3ZH 4NCDA 1EFXB 2VISA 1UB6B 3CU1A 3VD4A 4U1NA 1JPTL 5KZCD 4LVOC 1CGVA 2ZCHH 2GTWA 4NQED 2YD4A 1H3GA 4D9LH 1ZT1A 3MOAL 3JTSB 4FQLL 1NBZA 2WBJB 1EVUA 1LEGA 2CRZA 3KDMA 1QFUL 3FONA 5AEAA 5TDOA 4K7PH 3NIGE 4PJXE 1PG7H 3MUHL 2H1PH 2CD0A 3SO5A 4RIRB 3EO0B 2J4WH 25C8L 5T1KA 3NH7H 3S4SG 1C1EL 1KG0B 5JQHC 2VLJE 3KYNA 5J1AB 5CLTA 2X4SB 2A9MH 3MBEB 1S9KC 2J6EL 4JFZH 1I7ZA 4GKZA 1VFUA 1DUYB 4PBXA 3VXPA 3VH8A 1QLRA 3TPUA 1UT9A 1MRCL 1RK1A 1OW0A 1NDMA 2AV7A 1TITA 4DTGL 2HLFD 3QDAA 2FEEI 1DQLL 1RV6X 3NCEB 4ETQB 4L9LA 2NY1B 2FATH 2YA1A 1V7NH 1XIWD 3BKJL 3IFOA 1DTUA 3LQZB 1G6RH 4UAOC 2VLLB 3OAZK 3FO0L 3WO3B 4H8WH 4P2OC 4YBQD 4KDTC 3QUYD 4ODBD 1AY1L 4YXHL 2P5ED 4YE4H 5KS9B 2BDNL 4MAUH 2X9XA 2AJZA 3NZ8B 4TSAL 4HV8B 4UQ2B 15C8L 2YBRA 4UI2A 4XP5L 1N3NB 4P4KB 4GUPB 4XC3H 3TYGL 4ZYKB 1NCAH 5DHVB 1IGFL 1AQKH 1CE1H 1BLNA 1EMTL 2MNUA 4KGJA 5E6ZA 5GRUL 1CGSH 1X5AA 4IEFB 4Q9CA 2GJ6E 1PZ5A 1AKJD 4MXWH 4C56B 1TZIA 5ENWB 4N0UB 4ZG1A 2R69H 3VXNA 3FOLB 5B8CA 4OD2B 4I9WD 5GZNC 5DJXB 2YD5A 2C3GA 2QL1A 3ZSTA 1WIUA 5KVFL 3HE6D 2PF6A 3EYQC 2R1YB 4KKCC 3UAJD 3BVNA 3BO8A 4NQVA 4F3FA 1WFTA 2P7TA 3TJEL 4YHIA 4ORGA 3CSYB 1IGJB 1ZHKA 4YK4B 5JTWA 5MEPA 1TVDA 1BP3B 2BNRA 2OZ4L 4EI5A 1JL8A 3O6KL 4M6OL 3OR7B 1CN4A 2UZXB 2WQRA 5A2KH 2AABH 4R97C 3MGAA 5DURD 3LPWA 2B1AL 4M7ZB 4MDIB 2EIDA 5HHOE 4GG8A 4M7KL 1HDMB 4FN0A 1C16A 4PJ9D 3FOMA 4K3HA 1JJUA 4HIHA 2NR6C 3MPCA 5BMFH 5D8JL 3DX9B 4NN6B 1AI1H 1IEBA 4LKCB 4R2GD 5I74C 3ZT5A 3DUSB 4OJFH 1JYNA 4OCSH 3MV7E 5H35A 1ORQA 5K9QG 2ADJA 1RZIA 1TJIL 3GHEH 3MLRL 4HXBL 4YDVB 5F1NB 2XTLA 4HIEB 3V0AC 1GJIA 4NBZB 5HTSA 1RHHA 5ACZA 3L7EB 1XGUB 4P9HL 1V7MH 3VWKD 1A7QH 4NRXA 1RZGB 2UY7A 5GRZA 2NY3C 4F9LA 5LWYH 5I76B 1MFDL 1NGXA 1CR9L 6FABH 3MRFB 1NJ9A 3OGOE 2OJEB 2FLRT 4OZFH 5ANMA 3V5HB 3ZKXB 3CX5J 3MACH 3B6SB 4HUMB 1N0XL 4XX1G 5CCKH 5DUPL 5JXED 5BRZA 1A7OL 4QHKJ 2QQKH 5I8EB 2Q7NA 5DEFA 4X6FB 3B83A 5LXGL 4WFED 5EOCJ 3S36X 3GIVB 3I50L 5EBGA 4YFEA 1XGYH 4XPGH 3IDXL 3SO3C 4HS3B 5ETUB 1KJVA 3BQUD 4PGEB 1PKQE 2NX5A 3PWLB 2JB5H 1X5KA 3RGVB 3JTTA 5C07E 4CVXA 2NW3B 4NC1E 3NMEA 4TQEL 4XZUA 7FABL 2Q86B 3LEXB 3Q5YA 1S78D 1F42A 3UTTA 1PGRB 5E9DD 5J89A 4I2XB 2BNQA 1IKFH 2CMRH 1QKZL 4HULB 4WDIB 1NGQH 5CILL 5H2BA 2B8OT 5L7XL 1VESA 3UC0H 3SDYH 3VA2C 1T1WB 3DSNA 3H9SE 4L8BB 5IK3A 4YBHA 4YEEA 3WNMA 2VLME 4YZFF 3UPAA 3V9FA 4P46C 4PJ7E 1SJXA 1FVDB 2DMCA 2F53B 3MRGA 5MHSE 3RPIA 1S5HA 4UU9A 5FV1L 4Z9KB 4LCWE 4PG2A 2C4FT 2EYRA 3NVQA 3L5WA 1NLBH 4JM2D 2V9QA 2VLKB 5J4MA 4KMLB 4BZYA 3MNWB 1E28B 3NCMA 1YDPA 4K8RC 2Y5TA 1BD2D 1MIEL 1ZA3B 5CFHA 2MQ0A 2YKLL 1MCDA 1JPGA 3F12A 5DJDB 4V1DB 4KJQC 4OM1L 2IAND 4LRNL 4OGAD 5DRNA 2Y06L 4HUWA 4KKAD 2WZPD 1I8IA 3V6OE 4GG6F 4BUHA 2Z92B 4BKLA 3OX8B 5CZVH 1ZLUH 5IVXA 1IEAB 1NBVL 5I16B 1NGYB 2FJGA 1WZLA 4X99A 1A47A 2GW5A 4WI6A 5D7KD 2HN7B 1LO5B 5TJWK 1I7TA 3I75B 1JMXA 4HLZG 4HWEH 3MO1B 1XGPA 4K71C 2P5WB 3QHTC 2PXYA 2ZG1A 2FX9L 5EUOE 2AQ1A 2WINA 4LAQL 1G6RA 1TTUA 1A6TB 3KXFB 5ERWB 2R9HC 3Q6FA 5DRXA 2WBJC 4Z18A 5F6HI 4HIIA 4GT7A 1DBBH 4TRPH 2X1PA 4NO3A 1B2WH 4U7MA 1ITCA 3EYVB 1UJTA 4XVSH 4Z0XA 3I9GL 4KK5D 5JW4N 4EIGB 3GMNB 4G9FB 4U2ZA 4YHLH 1G9NL 2CXKA 5IVXF 1CFTA 3TIEB 1LO2H 3GBMH 1Q94B 4FQXD 2H2PD 4ZD3H 4LHUA 1HCFX 4QTHA 4UV7H 4TVPH 3MBEC 2ZCKH 3WKNA 1ZT4A 3DUHA 2LVCA 3TCLA 1HHJB 1NCUA 4V2CB 1G7HB 1XCQB 1E4KA 2VITA 4M1GL 3ORJA 5FYKL 2WUCL 3QNYB 2LE9A 2R2BA 1QR4A 2AKRA 4H5SA 4DVBA 3N85H 1YA5A 2IADA 2NY1C 4YAQB 5MEQA 1EH9A 3JUYA 3KPNA 1CLZH 4LNRB 5JHDD 3QUZB 5FKPB 4UILL 4YXLH 5KSBE 3H9YA 2DLHA 4JO4L 32C2B 1UCTA 5KG9A 3CVIH 3A6BL 5TDNA 5T5NG 2VDQL 4P4KC 1FQ9C 3EW3B 4D0BB 3O81A 4X6CB 2IC2A 4OLYH 3SJVA 1P5VA 3MRQA 5JIHA 2J2ZA 2HTLD 1E6JH 4QRTA 2EDWA 2UWEA 2GCYA 4QHUA 3TT3H 2XKNB 5HHXL 3VMPA 2H2SD 2RFXA 5K59F 1NCTA 1I7RB 4MSWB 5JOPE 2VQ1B 2M8XA 4LSSH 1OGAE 2WAHA 5CP7A 5IROC 4NSKB 1XR8B 4H0GA 5B4MD 3MJ6A 4G6KH 4EI6A 3MQIA 1BOYA 1SJVA 3NABH 1U8IA 1C5DA 1OP3K 1WIOA 4OCXH 1GGBH 2XZCH 2V2WB 2F8XC 2C1OB 1KPRA 4PJIB 2R0LH 1BQSA 4Y16A 3DSFH 1JGUH 3HAEB 4FFVC 5CJQH 1G1YA 4LSRL 5GS2D 3CZFA 3IDIA 4M5ZL 5GHWL 1HHIA 3Q0HA 4YK4C 1DSFL 4MNGE 3QDHA 4OZFA 5GGVH 1MHEA 4L3EE 5I30H 1P4IL 2BHYA 1U2HA 2ITDB 2BJMH 2BSED 1A6ZB 4M7ZC 1UWGL 4RMVA 4UNUA 2ADIA 2UWEF 4AT6B 4NO0B 1G7MA 4ETYA 1VENA 3DXAA 2ZUUA 3O4LE 4H88L 4WUUA 3RFZC 2R23A 4E41B 3IDNB 3X14A 4NN6C 3MGTB 2D4FA 4MD5B 4GMTL 2XWTA 2CJUH 1HKLH 2V5YA 3BPOB 1QYGL 5LCVL 1H5BA 2MHAB 1CLYL 4UDUA 4XPTH 3QEGH 1M05B 4DGYL 1YUHA 4KV5E 5H37G 3QI9D 2YRZA 3WN5A 3P73B 4RZCB 1MJJA 3PE9A 4PLNC 3PWPD 4Z6AT 1KSRA 4XCEA 3LKSA 1VGEH 2V17L 4G8GA 1QSFE 1NSNH 4MJIE 3K1DA 1P2CA 4WO4B 5ESVB 5I8KL 4PJHA 1FL3A 3OB0H 3ZKXC 3X13A 1MQKH 5HHMB 1ZOXA 2EDRA 4FZ8H 4EOWL 4XC1L 4KTEL 3H3PL 3SE3A 1J0KA 1CXFA 3MRDA 5C0ND 4FFZH 4XCFL 2HRPH 2GJZB 5IMMA 5HHPA 1RUAH 1GCFA 3UZVB 2QADD 1N64L 5HDQH 3NN8B 3WHE1 3GI8L 1FZMA 1TVHB 1F90L 5CEZD 4PJDB 5CHNA 1T83C 4QF1A 5E56A 3VGAB 2KZ1B 4J6RL 3ETBF 3P9WB 5EFIA 2YD3A 4HGWB 2UVEA 3D3VA 1RURH 5ILTH 1X3DA 2FH6A 3S3JA 3RGVC 3PP4H 5CEXA 1J8HA 4WY7L 2WIIA 5DD5L 1UYWH 5DWUL 3NCFB 2O5ZH 1CBVL 1UCBL 3P4MB 4MLIA 1WF5A 3HHRB 1LHZA 2ARJA 4XGZB 4FS0A 4NBXB 4GMSL 4G9DA 4TULH 3U9PL 5E6YA 3WD5H 3KYAA 3HPLA 4UTAH 4WEBH 1RMFH 5IR1A 4KDVA 2CDEB 4JDTL 3FB5B 3TZVD 3AU1A 3CFCH 4WI2A 4MQXC 3D0LB 4XMPL 3GO1H 4P5MB 1O7VA 4BH8A 3BW9A 2ATPA 3ABZA 4UZGA 1MWAL 5FOJA 1MFAH 3H7BB 1U6AL 2FECI 4GRLB 4QRPE 5GRJH 1CLOH 1TJGH 3TA3D 3S4SB 1T5WB 3BX7C 2VWEC 1JTTA 2CIIB 4OCYL 2AK1H 3D25B 4HPOH 2I5YL 4MCZA 4NUJB 1XH3B 1OTSC 3SDXF 1B0WA 1HH9B 5KJRH 2VE6B 3LPGA 5EC1B 4LL9A 4CADA 3OL2A 1UM5H 3CH1A 1HXMB 5ITFA 4JDZB 5B39G 3EO9L 2OXHA 3BUTA 5FYJH 3BSZL 4PLKD 5D1XB 1MAKA 4AIZA 5FYKE 4LSUH 3TN0D 3V6ZA 1SEQH 4HCRL 5IF0A 4DW2H 4UV4L 3BIKB 1S7UB 4TNVK 4DUVA 1V3JA 4WFGE 1N4XH 5D1QB 3LPFA 5CBEA 3OR6B 5IB5A 3VFOB 1KB5H 4OLXL 1BFVL 1F4HA 3QEQA 4P2RA 3KPSA 4K23L 4R8WH 3V0WL 4N68A 4XAKD 2Z8SA 5C08A 5E70A 1VEMA 3OF6A 3T0EB 5CIPH 3T2OA 4QRRA 5CAYB 4YUEL 3T77A 3GSOB 2JK5B 2XPGA 5D2NA 2MKLC 3K3QA 1T20B 3WFBH 2AW2A 5DUML 1A6UL 3MV11 1RUKL 4PREA 4MX7B 4UUJA 1EEUA 2W0KA 3WIHL 1IFHH 2GY5A 2YEZB 5E1HB 2YUVA 1C8PA 5E1AB 3LKQA 1A1OA 3QNXA 3QCVH 4ACPA 4PJEE 5AAMA 4Y8DC 1P4BL 4JFQB 4LDOB 2DBLH 1QZ1A 1JGLL 2K1MA 4MA7H 5IMKB 2R2HA 3ZL4H 4QRUB 3RRQA 2A6IB 2XNAA 1U8HB 3V5KA 2FIRT 3GMLB 2GK0A 4Y2DA 2XZQL 3AM8A 5BRZD 4FXLA 4XB8A 3U2SA 3ZHLA 1CD8A 4D0DB 5CJOH 2VN7A 4A2MA 5JQ6H 2I26N 4GAJH 2DLFH 3QUKA 1ZLSH 5C7XL 4RWYH 2Z91B 4OLUL 3U6RB 5E00B 4NZUL 1LEKA 3NFNB 3LEYH 3DHJA 3GMMA 5C0JB 3OKLB 1J1XL 2EC9T 5IHZA 2NX5D 3QUZC 1ZWIA 2CDFB 3MLZH 1R3HA 5DD0L 4DWHA 3QRGH 1WISA 3RVUD 3EHBD 4XHJC 5D5MA 1OAKL 2R4SL 1NEZA 2CDGA 4R26L 3NCJH 3ILQD 2EC8A 3KVQA 2BNQD 1TDQA 4Y19B 4TYUA 4KDTA 4U6HA 3KHOA 5HYIA 1F4YL 2OK0L 2FRGP 1UVQB 3RIFK 5C2BH 3FMGL 4BSVB 3MV9A 5AYUH 1FPTH 1RZKC 3T2PA 1UM6L 2P45B 3M17A 3BUYA 1Z3GL 3MFFA 1INEL 3N1QC 5DTFB 4BQBA 3CVHB 3I6LE 2JB6A 2W9DL 3F7VB 2EH7H 1G0XA 4JFDB 2A6DA 3O2VL 4U6XA 5D5MF 5I1JH 4MAYA 4N5EC 3PWVB 5SWZD 4PGJA 3CFKB 5T3ZD 1T2JA 2N56A 1UA6L 2EDNA 2NTFB 1F02I 2VERN 3NTCL 5EWIL 1YEEL 3L3JB 5F44A 2CK2A 3MLVL 4YR6A 1GGIH 5DF0A 4S1QH 2AJVH 1D9KA 4HUNB 5DEGB 4CW1B 1RVFH 3OG4B 4PR5A 5L88L 2AJYL 5I19H 1SJEB 5HHQA 5DVNA 2IFFH 4NQDA 2BC4B 5CP3H 3GMQA 2BSSB 4OFIA 2YZ1A 4HXAL 2DYPD 4LGPB 2DI8A 3TLRA 2E8ZA 3L3DB 3E8UL 1DEEB 3BPOC 3NCYS 3MNVA 5C70A 3MJ7B 1CXKA 2FJFB 5TQ2H 4U33A 1LK3L 3VFRB 5IWLC 1QACA 2DQFA 4TVSa 3QXVA 1BQUA 1FGNL 3O9WB 2VDOH 5BS0B 5D4QA 4ZS7L 4X8JA 4N8VA 2DF3A 1LQSR 2XG5A 3TWCH 1KN2H 4G6JH 3VXRA 4P5TB 4NKDB 5GGQH 1SEBA 3G6DH 4WO4C 4OIBA 4LASH 2ATKA 4M93B 2JKXA 5BVJB 2X4PB 2VZSA 2EO9A 4YIQB 3OJ2C 1A1NB 1YEHL 3DO7B 4BFIB 1JPFA 2A38A 4G7YL 2NY6D 1WC7A 4OLWL 2R15A 3UTTE 1EV2E 1FIEA 1UH3A 1XEDA 4M7LT 4YDKH 5FA4A 1BM3H 1NLDL 2GT9A 4KKBD 2DJUA 5KW9H 3CH8A 3VGAC 4WU5A 4V2BA 4IOFC 3HC3L 3X3FL 3QXDB 4JY4B 4LHUD 1FGVH 2ITCB 3F58H 4JFFA 2XFXA 4Q9BA 4ISVB 3T3MF 2LFGA 1JGVH 1SMOA 5D9SB 5FEBA 4IOIA 5FGBC 4LLYB 3VCLA 3W0WB 2PW2B 4GG6E 4NWUH 1WWCA 4JG0H 4NFBA 5C0BB 5IGXL 4AEHH 6CGTA 3SKOA 1KELL 4I77H 5GGSA 3GJFB 3IU3B 4HIXH 1PX4A 2WWKO 4EUPB 1LO4L 2KUTA 1GC1L 5D7LD 2PYFA 4TUOA 1F6AB 1KB5A 4AH2A 1S9XA 4GRLC 2Q8AL 1FIGH 2G2RB 3LQAL 3LKPB 4P9MH 4KRLB 4Z7NE 5EU5B 5ICXA 4XNUH 4PJAB 2W9LA 4RGND 3C08L 2YN5A 3EDEA 3RJQB 3VXQA 1A14H 1FFOA 4P0DA 5AYQA 3UYRH 3W2DL 3O3DA 2IPKA 2OL3H 4OCRL 1ACYH 1JGDB 3RL2B 3EJJX 4R90L 3QFDB 2HKHL 3UDWA 3RZCD 3CLFH 2CQVA 3MFGB 3GSWA 4RMRA 2OM5A 1QLEH 3DRTB 4HK0B 3ULUF 2BNUA 3U7WL 1NC2D 4MZ2A 1S7VA 4UOW0 3MUGB 5D1XC 4I4WB 5I0ZA 4ELMB 2EZ0C 3JWNC 2H26A 1JHKH 1ADQH 4B50A 1NMAH 2XQBH 1YQVH 3BEWB 2O93L 2R4RL 1NC4B 2R0ZL 5D1QC 4ODUB 3K4DA 3FB6A 1XF5A 1YEIL 2A74A 3RX5A 1FVCA 3F5WB 4RFOH 4X98A 1E4XL 3I84A 2AEIT 4NWTH 4P5KB 3T0EC 3DXAD 4BSWA 4IMLB 1GPOH 5ICZB 5IT2L 5E4IA 3Q1SL 3HLAA 1OAYL 2VDRL 5JNYB 1FFPB 1Q8MA 5CD5D 4K2UL 2CKBL 4U2YA 1AGBA 4OSUH 2A1WL 1UB6A 2EDXA 4FP8L 5FK9A 8CGTA 4B41A 2GKIA 5A2IH 1MCBA 1KTKE 1T66C 1CU4L 1W72B 3HUJB 5EIIB 1D6EB 4JFYB 3JTSA 4P3CL 5BV7L 2VXQL 4GRWB 5FIEA 2C9AA 4JRXE 2NLJB 4LCYB 3O6LL 3VW3L 5MI0B 5C0AE 5A3ID 3MLSH 3QEHA 5FO7B 5HHVL 5F7HA 3EO0A 5C71A 4JHAH 1KG0A 2NPLX 5DI8B 4ZFGL 1EK3A 2O5XH 4X6BA 4OZIE 3PL6A 3FTGB 2FYYB 4KAQH 3BXNA 3WFHB 4LSPL 2C4FU 1BQLL 1YEDB 5ACMA 4LLDA 2DDQL 1WIPA 4IMKA 3MRNB 3CU7A 1MF2H 1BFOA 3SJVE 2VL5A 4KRPB 4QWWC 1SM3L 3TNNB 3V7MA 3KPQA 1VB9A 1EZVX 5INCA 4RFNB 3QDJB 5DUBB 3D3VD 1EBAA 3WMSA 1JZ5A 4PIRF 1DVFB 1IM9B 3A67L 4RDQG 1XGRB 3STZA 3VG0L 1CZ8L 1LGVA 1PYWA 3J7HA 2VSCA 1FLRH 1YECL 4NZTL 1NCDH 3LQZA 5F7YC 5K9QI 4YXKH 1DP0A 4S1DC 2R39A 3SQOL 3EOAA 4Z78B 1F3RB 5GSRB 5BZWA 4QO1A 3W5NA 2Y25A 1U8OB 3FQUB 1E0OB 2V2TA 3GB7B 5TE6H 5CP3A 5KS9A 2GK2A 1N8ZB 2K9UA 3NZ8A 4MA8L 4IDLA 4HV8A 1GOHA 1S7RA 4UQ2A 3CFBB 4M8QB 5TDPA 4P23B 3ZTJH 2ZKHH 1N3NA 4LMQI 4GUPA 4XMKL 1OPGL 4ZYKA 3HI1B 5BVPH 5FF6A 4WCYH 1J0JA 1FCGA 4NPYA 5IHLB 2XICA 5DJ6B 2YD9A 4NM8H 5KAQG 1CXHA 4ONHA 3BDYH 4WUUE 1JBJA 4N0UA 5IROA 5JUEH 4YHOH 4MJ4A 3L3KA 2XRAL 5FHAH 1MCSA 2XTJE 5F96H 3QHZL 1J88A 2LTQB 1KJ2H 4O51A 4PJCB 2AXJA 1IGYB 3WJJC 4F9PA 2NY7L 5E24E 5KS9F 1CFNB 3ARED 4XPHH 1J1PH 4XMLL 3CSYA 5L2KA 4JRYA 2J88L 1MNUH 2DQUH 3LKRB 1KF9B 4Y4KA 1BEYL 4JY6A 2DQEL 4G8FA 1AXSB 1UZ6E 1TZHB 5GZOD 3EYSH 4PB9H 3FB7A 3CSPA 3D69B 5EU6A 4G8GE 3LMJH 2YSSB 2VDNL 4K3JH 3MR9B 4NNPH 4D2NA 5I1CH 3KLDA 1HDMA 1YNLH 4OZ4B 2HAZA 1A7RL 5TGBA 5T1LB 4PBWD 1RULH 1MFBH 2PCPA 3IXTB 3DX9A 5K9KA 3QEQD 1UQSB 1IGCH 4AMKL 5FB8A 4ZDHB 2OP4H 5DJCB 3O9WC 5F3HB 5GISL 3RAJH 3BDBA 5C08D 5EN2B 1FRGL 1WJ3A 4QGTA 5KSAB 2OJZH 4HIEA 3ZE2E 4FTVA 3HC0B 1UEYA 3D39A 4P5TC 2Q76A 4JZJB 1CFVL 2NY2B 3L7EA 4Z95L 4ZOCA 5J6GB 2IBZX 3HC4H 4M93C 3SOBH 4BK4A 1J8HE 4JB9L 1W0WB 5B39B 2VXTL 1FC1A 5EBWB 3MRFA 4XP4H 2DQTL 3V5HA 3SDXE 4PJXB 3LRGA 1S5IL 3B6SA 2EDHA 3REWB 5I8EA 2WQ8A 4KJPC 1ZT7B 2FGWH 2VLJB 3UJIL 2FX7H 3MRPB 4PY7B 3DTXA 3GIVA 3Q6GL 1U3HB 4CNIB 2MOVA 2VR5A 2YXMA 3FO2B 2OL3A 3U0WH 3OXRB 1T83A 4PGEA 3MSPA 1JF5A 1QQDB 4AL8L 4CL7A 4LCCB 3GMPB 1HSBA 3PWLA 2HYMA 1JNJA 4QXUH 2DQGL 3BP5B 1A4JB 1SY6H 3C5JB 1WGOA 5DR5L 5F9JA 5EO9B 1M71A 4XNXL 3W39A 1PBYA 4WV1B 5F6IB 4NQEE 4HC1H 2X7LB 4JDVA 3TO4B 4M62H 4MWFB 2K7PA 2ZUSA 4HKJB 1WTGT 4JPWL 1SJHB 4YEFA 1DQTA 2JJTC 5AG8A 4MD4A 1BQHG 2CK0H 5C6TH 3MA9L 3UROR 1N6UA 1IZJA 3KLHC 5IBLC 3FN0H 4JQXA 1QSVA 4YHZL 3MRRB 4P2OD 2I07B 2E7MA 1RJYA 2HFEB 3T0BA 2DQJH 4QXWA 3MV9D 4ZMAT 2YRLA 1P53A 1WAAA 4WNQA 2Y23A 1CVSC 3DMMB 5TQ0H 2GJ6B 3MV8A 2BP3A 4NOFA 5HDLA 3WSQH 4BQ6A 4JFEE 1ZK9A 1P5UA 1U3JA 5E08H 4U4BA 5E8PA 2E7BA 3RBGA 1S9WB 2Y4SA 1PVHA 3KPSE 5JPMB 3K7UA 5EOQH 4ODWA 4OIAA 4NOBA 2CPCA 4HKBB 4WJ5A 1E28A 1TMCB 3ULUL 4LPXA 5GZND 5FUOL 4Y89A 4EN3B 3ARTA 3EYQD 4JEGB 1ZE3C 4KKCD 2P5EE 1MJUH 4LRIC 4UOJA 1C5BL 3KYOB 4OM0L 1D9KD 1WAAF 4YDJB 1RZ7H 3RL1A 1FC2D 5HHOB 2QQNL 2ZCLH 2D7TH 4P3WA 3V5DB 3WL9B 4AIOA 1UXWB 1IQWL 3OX8A 2YN3A 4UTBL 4MMZC 5IBUG 4UT6L 3KPRD 4F58L 3CMOH 4TNWF 4M1CC 1IEAA 3VD7A 2EXWC 1NGYA 1LP9B 3MV7B 5CSZA 4AG4L 4WHYG 3S35X 2W92A 2A9NH 1G7QB 3IDGA 5BOPA 3ULVL 2DBJA 1FZKB 1I1RA 3X11A 3I75A 3HZVB 5I73B 1RUQH 2NR6D 3MO1A 1XGQA 1MCQA 4U6VL 5JW5B 5I15H 4QOKD 3ME0A 5HD8C 2B4CC 5GIRB 4KHXL 3KXFA 1KLUA 1CG9B 3UP1A 3HR5B 3ARQA 1NCWH 4WENB 2R1XA 1FH5L 3OQ3B 3EGSA 1KYOK 1C08B 3WHXA 4RAUB 3EYVA 3GSNL 4XCCH 5MI0C 1A6AB 2GJJA 4DFIA 2BY2A 2NY3D 4L29B 4MHHG 3MRKB 4U1KA 5GS0H 4WUKL 3TIEA 1PFCA 3QSKB 5DMGC 1Q94A 2HMIC 5DRZA 3L1OL 4PJFE 1C5CL 1LK2B 2GAZB 3TYFA 3V8CA 4HAGA 4J4PC 3CD4A 3A6CL 2L0DA 1W0YT 3BJLA 1HHJA 1T1XA 5EU4B 4KRPC 1JTPA 1XCQA 3MCKA 2ESVA 4C59B 4QRQB 3BMWA 1RUMH 4HJGB 4O58H 4RFNC 4ZQKA 3CLEL 1AKJB 1GZQB 2J1KA 3GKWL 1EO7A 1ONQA 1DVFC 5C07B 3WBDA 1ZHBA 5ID1A 4JFFD 1KJ2A 3IT8D 3ARVA 1HKFA 5DVLA 2WBKA 2P8PB 2XIDA 4HK3J 3WUWG 4E0RA 1NH6A 1AJ7L 4ODXB 1OAUL 5HVWA 1YJDL 4ZFOL 4KKNA 4N0FB 4PJ5A 1J1OH 2E6QA 3BDXA 3QQ9C 3O45A 1MHPL 3E0GA 3VD9A 3ZDXE 4LPVA 4P23C 1IGIH 4D0CB 2FD6L 5AWNL 3VXMD 2OLDA 1JN6A 1MFCH 1FZJB 2WIMA 1KJ3L 4OGXH 4GW4B 4TUJA 3N0PB 1MY7A 2IPTH 4NQDE 3BGMB 2VXUH 2DICA 4MSWA 2IH3B 3RTQB 1WZKA 1YEFH 4NSKA 1XR8A 5HYJE 3WS6C 3PQYE 4KRMB 4P46D 3GIZH 4MMXC 2XYCA 1IAIH 4DFHA 4XHQA 1QFWL 4GXUN 2LTQC 3VJ6B 3HG1D 4GS7B 5IVNA 2NXYB 4Z7WA 1HHHA 4RQQA 4DOHB 4YFDB 4Q58C 2ZSVB 5GRVL 3VWKB 1AE6H 3DX8B 2J8UE 4JCLA 1P4LB 4Y1AA 1U8PA 5LKNA 3E3QE 1WZ1H 1QLFB 4IJ3B 4LF3B 4K8RD 4RISH 3VXRE 1DFBH 2ITDA 3OKNB 3CDCA 1CDYA 5DGRA 5EZOH 1ROWA 1T2QH 4DVRL 2VLRD 2P24A 3OKEB 2P44B 3G5VA 4KJQD 5L8KB 5HHNB 4E41A 5I1HL 1CVRA 1ZANH 3QDGD 2ZUXA 1JWUA 3CUPB 1A21A 4MD5A 2B20A 5SX5K 3O3UN 1I9IH 3EO1B 3TVMB 4Z7WF 3IRPX 5T1DL 1SY6A 1WVZA 1WBZB 1CDGA 5KSAC 4ESKA 3UYPA 3MXWL 3CVHH 3QCUH 4JZJC 3ZHDA 5EUOB 2NY2C 1MLBB 1ZGLP 1NUGA 5B3NA 3ZKSD 1AD9B 1AGFB 4GXVH 3MJ8B 3KPLA 1EFXD 2AQ2A 4XXDB 5IG7A 1F8TL 2X5PA 5C09E 1FE8L 2A0LC 2VDKL 3BE1H 3EDJA 2IANE 3C5SB 1YC7A 3H8NA 1KC5L 4RGOH 3W82A 2R9HD 2HKFL 4FNLH 3SE8L 1QBMH 3V4UH 2I9TB 1DLHA 2J8HA 4XH2A 1TETL 2AK4A 5C8JB 1I3GH 2GJZA 1U3HC 4HBCH 1KEML 4FG6C 1OP3H 3ULUE 4I0PB 2HVKA 3S3PA 5IJKA 4WTZG 3HZKA 4NCC2 3F7YB 3VFTB 3HI5L 1X5JA 1MY5A 1R24B 4I13B 1T22B 4LCCC 3BPLB 4HGWA 4TSCL 4KZDL 2WM0A 1LDPL 3TJHC 3EJZC 4LSDA 2CR3A 2J5LB 2KPNA 3SGJA 5T5FH 3HI6L 4WV1C 1BREA 3O3AB 4JM2B 4FQ1L 4XGZA 1ZS8B 3RIAK 3TO4C 4D9QE 2WK2A 4PJ8B 4XPBL 2ICEA 3M8OH 5T1MA 3NIDE 5BXFA 2NY1D 1TZGH 3ULVE 3CK0H 1WCBB 5ITBL 3D0LA 3OKMB 4G6AC 2HT2C 3T3PF 4L8DA 3V0VA 1U8MB 3FB8B 3BAEL 5J56B 3EFFA 3P4NA 4XPAH 1FBIH 5ESQB 5LBSL 5I8OH 3G04B 4AM0A 3EFDL 5L9DH 5DHXB 3FT3B 3DMMC 3VFUB 3K0WA 4FQCH 5IFAH 2EEAA 2DTSA 4P4KD 5E8OB 1C12B 3L5HA 5I18H 4LAJH 1H3UA 4HWBL 4JPVH 4D9RD 3D25A 2FJHB 5CMAA 1VGKB 1B0GB 3KLSA 3MCLH 5DQ9A 4BA8A 1HH9A 1R3LB 2Z9TA 4FZEH 2AQ3A 5KSVB 2YC1B 4C56D 2ZG3A 4PRAB 1IAOB 3P30L 3QXAA 2X44D 5GGVY 4MQTB 1HXMA 5FKAB 4HLZH 4OF8A 4EN3C 2WWKT 3HTLX 1X4XA 2KBGA 4JVPA 1K6QL 1KCVH 4MNGB 1A9BB 2YA0A 3V2AR 3I3EA 5CZKA 2O61B 3W9DA 12E8L 2AEQL 4FFVD 3FQNA 4IS6B 3QUMH 5L2KD 3RBSA 5D1QA 3O4LB 3S97C 3RUGE 4I18B 3VFOA 3B2UC 1E6OL 2ENYA 5HGDB 3QIWA 4YNYA 2HFGL 5EU6D 3NFSL 2D2OA 3NFPB 5HYFA 2CLVA 2OQJB 2YS4A 3T0EA 4PV8B 4R0LB 5L2JA 5IB1A 5JHLL 2YD2A 5I73C 5JMOC 5HBBA 2EYTB 1F3DJ 4PTTB 1QSZA 2QHRL 3U9UB 4AEEA 1CL7I 3GMOB 1X44A 2IGFL 1YNKL 4BM7A 1KULA 5MP6H 5J1TC 2Q8BL 3GRWA 4KTDH 2YEZA 4YGVB 5AZEH 4A6YL 3D39D 5JHDB 1U8JA 4YHNB 1OSPL 3GZKA 5E03A 5DT1H 4FQIH 4XBPA 2X4UB 1P84K 3KPOB 4PRHE 4YDLB 5JO5A 5M7QA 4NZDA 2A6IA 3DVNA 1RFDL 4X9IA 4RWHA 1U8HA 2XQYK 1H3VA 4Y4HB 3NBNA 4WW2B 4OB5H 2PW1B 4BZ2L 5F89A 3ZDYE 4BFGA 2GYSA 4ZTPH 3HZYB 1GAFH 3THMH 4KQ4L 3QO1B 4HHAB 4FRWA 2KKQA 1YYMH 1MVUB 3HRZA 4MQSB 2G60H 3VGHA 1PLGH 4HJJL 4U1JB 1I1YB 4MD0B 2Z91A 2OYPA 1YEJH 3VRLF 1Z9SA 3DVFA 4M7LH 4NC1C 4QTIH 1T80A 3T2NH 2BZDA 4G8IB 3IJYA 4HWZA 5JR1L 4DQOL 2YXFA 5IV2B 3H3KA 5HYSG 1ZKAA 2CDFA 3GMRA 5JDJA 2J3SA 5EPMB 3RGVD 1MLCB 3DGCR 2W9EL 2Y72A 3KJ6L 3LRSB 1IT9L 4JO3H 5CSBA 5JXAH 5T33H 2NYYC 3RKPA 2DKUA 1XR9A 1IKNC 2ORBL 1U3YA 4HIJB 1JK8B 3PGCB 5EZIH 4JKWA 3HPJB 1UXSA 3BD3A 2R2EA 3QZWG 1MCPH 1UVQA 1GL4B 4Z5RB 4QRPB 4TTGA 4X9BA 3ALXA 4MYWB 5KVEH 1IC1A 3GJEB 3MRMB 3H42H 4JRYE 2P8LB 4MQXD 4UT9L 5TFSH 2A6JB 3S7GA 1J5OH 1YMHB 5I75B 3RTQC 5DRWA 4M03A 2DQCL 5DTFA 1BVZA 5D7SH 3BKYH 3VU2A 2XXCB 3CVHA 2F5AL 5FFLA 5SWQB 1VFAB 3F7VA 4JFDA 3QQ4A 3WFZA 4Y88A 2F53D 3D5OF 3PWVA 3VGEA 4GS7C 2NXYC 3SY0B 2HG5A 4LIQE 1T89C 1OTSD 5I1AA 2X4OB 1OT2A 2GITA 5H37H 3VWKC 3T4AB 3QPQC 2G75A 3WJJA 2VLKD 2AGJH 3SKJL 4O9HH 5GGSY 1AGDA 1JV5B 2VISB 1X5GA 3P0VL 5DEGA 4CW1A 3LRHA 2LAGB 4U1NB 1WCQA 2PTUA 3LAFA 1QOKA 1ZT1B 4V1DD 1F3JB 3WYRA 5SWSE 2BSSA 1LEGB 2BOCB 3KDMB 1NBYB 5TDOB 2E6PA 3L3DA 3TVMC 4JZOB 1P6AB 3KS0J 3WIFB 3B3IA 1JTOA 3WLWC 3SHSA 2FJFA 3VFRA 3HMWL 5T1KB 1N5YH 1G9MC 4H8WL 2FL5B 1JFQL 2FX8L 3U1SL 4JFHE 5DZLA 1Q0YL 4HDIA 1EAPB 2EKSA 1I7ZB 4GKZB 4KWUA 4R7NA 2P5WD 4P5TA 1MPAH 1FZOA 3ZYIA 3VH8B 1QLRB 3TPUB 5DZOA 3VXSA 1RK1B 2D4DA 3IYLW 2AV7B 5BVJA 3FQRB 4O02H 2E27L 3KXFD 1RIHH 4NIKB 1A1NA 2QSCH 4ONFH 3ZYOA 3DO7A 2KH2B 3WDJA 1B4JL 3IFOB 1HHKA 2R69L 1QNZH 4X4ME 4CAGA 3WLBB 1G84A 1OCWL 2E7CA 4I0PC 4G9FD 4M6NH 2HWZH 5TF1L 4W4NA 2AJZB 3BPLC 2YBRB 1AXTL 3QXDA 1ZMYA 4NHCL 3DURA 3VD5A 2J5LC 2WUBL 3RWGA 4TPRL 4X80L 1OAXH 2GUOA 1BLNB 3VFGL 3P9MA 3ZLQC 4XPFH 4LLYA 3W0WA 4QXGL 4JM2C 1PZ5B 4ODTL 3S36L 5EUKB 4PJ8C 1LDSA 3RWCB 3DX6A 4QHLB 4X0KA 5B8CB 5DMYA 1RJZB 4JVWA 3QUZD 1TIUA 3QUMA 3S9DB 4JRWA 1U8NB 3BVNB 4XHJD 1MVFA 5KN5A 3BO8B 2WW8A 4P9HC 1TTGA 4OGAC 4F3FB 5FCUH 3VWJA 3MRJA 1MCOH 4YHIB 4ORGB 4F7EA 5IESL 4G80A 2B7DT 5EU5A 4ODHL 1KPUA 1A3RH 1OGTA 5MEPB 2BNRB 4EI5B 1MI5E 2VUYA 2IPUK 3LN5B 4KHTH 3UBXG 3MLPA 4FHBD 3EOYG 3RNQB 1I8LC 3DYPA 3EZJB 3ZYJA 4OCNC 4HS8H 3L5JA 5C0IB 4WEUD 4NZRH 1JGDA 3FOMB 3RL2A 1VPOH 3VXUA 4HIHB 2QKIA 3QFDA 3QG7L 1IAKA 1NFDE 2E3VA 4TOYL 1IEBB 4ZUUA 3DRTA 5L6YL 4DAGH 4XWGH 3MA7A 1HN1A 1M7DB 2AAVA 1KCKA 4I4WA 4N5ED 1JP5A 1KT2A 3WUWB 3MODH 3LIZH 1DBAH 2BHZA 4LFHD 3BEWA 4XRCA 2I60H 1ND0A 5E0QA 4NRXB 2VAAB 4KU1A 4ODUA 4I18C 5F97E 4LRIA 3QIBA 2BRRH 3C6SA 1EGJH 4JG1L 5E5UB 1NGXB 3NIFE 1NJ9B 3UO1H 1IC4H 4NO0D 5ANMB 3BKCL 2JJSC 1T7XA 3WFDH 2UVFA 4K9EL 4QHNA 4R0LC 1UACH 5BRZB 3TFKC 4P2QE 4ZUSA 4R4BB 3S88L 4E41D 5AD0A 5JNYA 1CD0A 1FFPA 3MRLB 5IB3B 5C6WH 3INUL 1KJMB 1A6VL 1XT5A 2CRYA 3JBG7 5SWZE 5E94A 1MFNA 4S1SL 4HGKC 4ZO6A 4J1UA 5EC2A 2OXGA 3QUXA 1QG3A 4JE4B 1L7IL 2O5YL 1WUNT 3BZEA 5CJ5A 1EJ6A 4DN3L 3ZHKA 3JTTB 4WI9A 4ONGH 4CVXB 2AEPL 3CXDH 4YDLC 4XZUB 1L6XA 2NLJA 4LCYA 1INDH 43C9A 3UTTB 4WO4D 5E7BA 3V4VH 2WV3A 3IETA 4Y4HC 5BW7C 4WW2C 3VMNA 1BJ8A 2C5DC 5H2BB 5HHMD 5H94B 2EDEA 5D2LA 4TNVF 4MNQA 2HTLC 1NAML 2AJXH 4J4PA 4BK5A 1YEDA 3BD4A 1L9MA 1MFEH 1RHFA 4F7CA 5IK3B 3MRNA 4J23A 3RY4A 4N0CC 1KCUL 3VFWA 4TTDC 1RIUH 1A5FH 4CJ1A 1YN6A 1DVFA 1IM9A 4GG6B 2N4IA 3MRGB 4XVJH 3RPIB 4K3DL 4XBGB 3PGFL 1S5HB 4UU9B 4OKDA 4F8TA 1JYVA 2APBA 3CXHK 4H20L 2NY4B 2EYRB 2UUDH 4OD1L 5KVDH 5F8RC 4WFFE 1K8DB 4ONOA 4FQJH 1B9ZA 4O2EB 4OKVA 4MCYB 4Z7WE 1U8OA 4PRBB 3FQUA 5D2LF 1OM3L 5CUSH 1YDPB 4MNHA 4HWEL 5HDOA 3MJGX 3CFBA 4I5BA 4QHMB 4P23A 5FHBL 1KENL 3F12B 4Y1AE 2PTVA 3JWDH 4YHKL 1U8KA 5I75C 2CXGA 5DRNB 3PIQA 4GRLD 5FO8A 3K8MA 1OP5K 1G9NC 1I8IB 1SBSH 3TT1H 5DJ6A 5L8JB 1PKOA 4OT1H 4WWKB 2FB4L 1JWMA 5IVXB 3PABB 3ALWA 3AS0A 2FJGB 3GK8H 3MCG1 1I7TB 3EYUH 1XGPB 5HDBE 1MREH 4KUCF 1CFNA 2PXYB 3WE6A 1YYLH 2BX5A 1K8IA 1DDHA 5D7LE 1G6RB 1J0IA 5D1XD 3B2VH 3Q6FB 1RUPH 4EDXA 1TZHA 2EZ0D 5DRXB 4J12A 5ALCH 4JR9H 1CTOA 2E9WA 4HIIB 4JQVA 3ZE1F 2NY6B 2YSSA 4C58B 2VDPL 3FQWA 2IALB 4XCNA 5D1QD 4Z0XB 1JPTH 1A02N 5I1GL 1EZVY 5DO2C 4OI9A 1CFTB 2M26A 3CFIC 5ACLA 4FQLH 4EXPX 1KTDB 2O26U 1WBYA 4I3SL 2NZ9C 2X09A 3AXLB 1MCEA 3FFCE 3T0ED 1QFUH 4QTHB 1U8QB 1NQBA 3L7FA 5KSAA 1ZT4B 5F1OB 4EKXA 4DZ8A 3TCLB 2UZIL 3HC0A 4JJHA 4RAVB 1R3IL 8FABB 1G9EA 25C8H 2VITB 3LSOB 3TBTB 4ERSL 1C1EH 1HYSC 5J6GA 1OW0C 2EDTA 2QJDA 3DVGB 2AKRB 4PTUB 4H5SB 4KY1L 4DVBB 1W0WA 2J6EH 1OD7A 5B39A 5MEQB 3KPNB 1I9RL 3D9AL 4X6DE 1T66D 4PJXA 5FAAA 2LQRA 1L9NA 1MRCH 5E6IB 3TH3T 5AAWA 4JJ5A 4DTGH 4LQ1A 2Y7QB 2VC2L 4PGCA 5KG9B 1S7TB 1DQLH 2XZCL 4JY5L 4PY7A 3BKJH 3UTPD 1FFNA 4L9DA 4N1HB 4RGNB 1MIML 2C3VA 1KCRL 4Q97A 3FO0H 1T4KA 3SJVB 5FGSA 4DGVL 1MCNA 2V7NB 3GMPA 1AY1H 4YXHH 2UWEB 2BDNH 2GCYB 4QHUB 3IVKA 4LU5L 4D94A 2RFXB 4TSAH 1JHTA 4MA3A 15C8H 4XP5H 1M7IA 5EO9A 5CP7B 4QWWD 1RZFH 5B8CC 1TQBB 2MKWA 4GKSB 5FM5O 1U41A 1T3FA 4PJXF 1IGFH 5DQDL 4EI6B 1NL0L 3ZMRA 3TO4A 1EMTH 1F11B 4WI8A 3RP1A 3GBNL 1C5DB 5GRUH 5HGAB 2CO7B 3HMXL 5SV3A 1HKLL 3R1GL 4Y16B 3E1F1 4EQ3A 1EGJA 2VRAA 3IDIB 1HHIB 4S1DD 2QHLA 4EI5C 4AEIL 5KVFH 1D5XA 4Y19D 4GKNA 5DZNA 1U95B 2HFEA 4KXZH 2EDLA 1ZXQA 4WI5A 2ADIB 4QKXB 4DKFH 4M61B 3TJEH 3DMMA 2GJ6A 2CLZA 2OTUA 3DXAB 5F8QC 2VH5L 5CWSB 2E6JA 3SE9L 4WUUB 2OZ4H 1QPPA 3O6KH 2IBZY 4M6OH 1S9WA 3HA0A 1BAFL 5JPMA 2XTJB 2B1AH 1S3KL 2XWTB 3MC0A 4FFZL 5CGYC 1V5JA 2IMMA 4JFDD 4KGLA 4M7KH 4U6TA 1H5BB 3WFEL 3K74B 4NP4H 4ZUVB 3L3GA 1QFHA 1YUHB 5HYSB 3EKCA 3NGBB 3PXJA 1HI6A 4HG4J 3WN5B 3MRBA 1GHFL 4F15B 2KDGA 1EA9C 1KBGL 1MJJB 3EZ8A 4HKZB 1KUMA 1RURL 4YQXL 1TJIH 4XCEB 3G5XA 4HXBH 4F9LC 4WIQA 3LKSB 1Q9OA 4Q9RL 4G8GB 3C9NB 4YDJA 3Q5OA 1P2CB 5HHOA 1UYWL 4JM4L 1FL3B 3B9VA 4P9HH 2D7PA 4B0MM 1N59A 3TV3L 5FA3A 5HHPB 1MFDH 3OBAA 1CR9H 3MV7A 3C6LA 1G7QA 3HZVA 1ZTXL 5J6HB 1FZMB 1N0XH 4CBPA 5DUPH 4QF1B 1A7OH 2H3NA 5JW5A 3O9WD 5LXGH 1OOAA 5BS0D 1CFBA 2HH0H 4Y2OA 3I50H 1FAIL 2DRUA 1CG9A 1TJGL 4JKPH 3GSUB 1J8HB 3MLXL 1FNGB 4Y5XB 2WIIB 2ADFL 3GNML 4L1DA 4P5TD 4PLJC 4NT6A 1K9TA 3D85A 1C08A 4HF5H 3D48R 4ZS6C 4LSVL 4HPOL 4RAUA 2ARJB 3SDXB 1A6AA 1T0PB 2FGZA 4L29A 2HLAA 3C8HA 4HX1B 4GRMA 4G9DB 4LLMA 5KJRL 3HPLB 3K4AA 2GSIA 5IR1B 1K4CA 1BJ1J 1X5IA 3QJFA 4TQEH 2NXZB 7FABH 1TNNA 3AU1B 3RI5K 3PJSA 5DDHB 2F8VA 5F7MC 4L5FL 4P2CG 4TSBL 1B4RA 3JWOL 2ATPB 1RIVL 3T1FB 4KJPD 4M43L 1QKZH 3FCTB 2VZOA 3FHQA 5CILH 1CDBA 5DJZA 3KLAA 3HFML 1PKQA 5L7XH 3UJJL 4OF5A 1FAKT 1KACB 5C07A 1N4XL 5DMKB 5IMLB 3EYFA 2P8PA 4PG2C 5IM7A 1CICA 1AHWB 2NY4C 4KZEL 5J1SC 4F7PA 5GRWA 3W0WD 1QSEA 4JN2A 3L3IA 1FNSL 4CADB 2W60A 1QTYT 1HZHL 3I6KB 3K2UL 4H25A 3CH1B 4OUUA 2CKBB 4F33B 1IKNA 5C0BD 4X5WA 5ITFB 1UKQA 4OZHE 5D93B 1P1ZA 2Y5EA 4OLEA 3H9SA 4HWNA 4WRLA 1FZJA 3VWJD 4GAFB 4PJ7A 1KFAL 2V5MA 1IFHL 1MIEH 4PP2B 5D1ZC 5IBLD 3KLHD 2P48B 4JHZA 2YKLH 5CBEB 3CDGA 5IB5B 4E5XA 3BGMA 4JFEB 1QFPA 4RAHA 3RTQA 4WWKC 1ZLWK 5IQ7L 4KROD 3BRFA 4LCWA 4OUOA 4K8RL 4OM1H 3KPSB 4P2RB 5FM8A 5F7FA 2C3HA 2XZAL 4LRNH 4BUGA 4M5YL 2Y06H 1ACZA 4RMWA 4QRRB 3T77B 1TTFA 3EJYC 5EU7C 2XPGB 1X5LA 1A7PL 2J6EA 5IOPA 2PXYC 4ZTOL 1TVBA 4XNZB 1MCHA 3P3YA 4TUKH 1NBVH 3DX8A 3LKOA 1KIRA 1P4LA 4UUJB 3NACL 1K4DA 3OWEA 4HBQA 4PJ7F 3OKNA 2NY6C 3VFVA 5CZXC 3LEYL 3I6GB 4D8PA 3LKQB 1A1OB 3QNXB 3V6OA 2FX9H 4IRJB 3SDAB 3SGEI 1NC4D 1TCRB 5K9OA 2XI9A 4X5XA 1B6UA 4LAQH 5J06A 4OZGE 2VR9A 4CU8A 5HHNA 2R2HB 2X70A 4JAMA 3CUPA 3V5KB 4HEPG 3TVMA 4M48H 3UBXB 4Y2DB 3BKML 3WEXA 1JZ4A 1WBZA 3FO1A 5F71A 1MUJB 3FQTB 4M1CD 1G9NH 2RIKA 2EXWD 3MYJA 1I8MB 5EUOA 1L0XA 4HZLB 3OAYK 1BZ9B 5INDA 3MJ8A 5GRVK 4GSDL 5IQ9A 2Y36L 5IHZB 4FQQA 2H8PA 3WXVL 4WFHD 5HD8D 3C5SA 5CJXA 1R3HB 4M1GH 5FYKH 1RK0A 2WUCH 4C57C 5E6IC 3V52L 5D5MB 3VI3E 5J3HC 2I9TA 4XBEL 1NEZB 2CDGB 3IU4L 3VFNA 5C8JA 1TXKA 2QQLL 1A1MA 4O00A 2JIXA 5HY9A 2IH1A 2X42A 1AP2A 4UILH 2LV4A 4RGNC 1FG9C 4PV9B 4HSQA 1AGCB 1GGCL 2OZ4A 3VFTA 4JO4H 2DM2A 1R24A 3MV9B 2ZP0T 4Q2ZA 4S1QL 3A6BH 2OBGA 3CZJA 3GSXB 4J4PD 3BUYB 1X5HA 1UH4A 2RCSL 1F2XK 2VDQH 5I0DA 1QRNE 4QOKE 3ELAT 5E2UL 2ZPKL 4KRPD 2QBWA 3HCVA 1TQBC 3VFPB 2F54E 4WGWB 1ZVHA 4RX4A 2BMKA 2JB6B 5KSBA 5E8EA 2PYEE 4G6ML 3QA3A 4PGZA 2A6DB 4PJ8A 1DVFD 1IM9D 1OQXA 4U6XB 4MAYB 3VXUE 5HHXH 2DI7A 5DVOA 4AY0A 4Y16C 2XT1B 2MCPH 4S1RL 1JIBA 3B8SA 5ALBL 1WCBA 1HILA 1FNFA 3ZDZF 3GDBA 5D6CA 1U8MA 3LZFL 3FB8A 2GY7B 4JFXA 4YR6B 1JNHA 1A22B 1KNOA 1D9KB 3QQ9D 5ESQA 3QHFL 4PR5B 1KN2L 4KUCD 3G04A 4WI3A 5HHQB 3VFUA 4LSRH 4P23D 4P4RA 1E27A 1WWWX 2BY0A 1R5WA 2AXGA 2VKXA 1I75A 3LDBB 4J3UA 3OG6B 4M5ZH 4NQDB 5GHWH 1DSFH 2VN4A 4L4VE 5KSUA 1UWEL 1OGAA 3DECA 1L6ZA 2FJHA 5HYJB 1I8LA 3PQYB 1VGKA 2ERJB 3CFEA 1P4IH 5KSBF 2XTJC 1UWGH 4OBRA 5F9DC 5KSVA 3HRPA 3L6FA 3KPTA 4PJBA 1IAOA 1H5BC 4H88H 1U93B 4WHYH 4PB0L 2DQFB 2OCFD 3NGBC 4NKMA 2BFVH 3WN5C 4F15C 4MNGA 3OHXB 4X8JB 4N8VB 1RU9L 4GMTH 1ZGLM 1FYHB 4O5LL 4KI5E 1QYGH 4L3EA 5LCVH 3VXRB 1CLYH 5GQBA 1SEBB 2E7LC 4DGYH 1ZHNA 4IS6A 1YEKL 4OQTL 3VXME 3WDIA 2ATKB 3O4LA 4RGMB 5DFVC 4CJ0A 3RVWC 3RWJA 2JJWA 5HGDA 5B22A 1JPFB 1AO7E 4ZOBA 2V17H 2OQJA 2JJSA 5IW6A 2WWMC 4PJBF 5I8KH 2Q6WA 3OXSA 4I77L 1FORL 4CU6A 5D2LE 5I8CB 1FHGA 4EOWH 4XC1H 4KTEH 2Q3AA 4MNQE 2EDDA 4EVNA 2YD6A 4ENEC 3HG1E 4XCFH 3QWRD 4G3YL 3FT4A 5TH2A 5E2WL 1WT5C 2NMSA 4QCIA 2XFXB 4Y5XC 5KSAD 4XNUL 4IRZL 1Q9LB 1N64H 2VDLL 3GI8H 1F90H 1QSFA 4KVNL 4MJIA 4YHNA 5C09B 4IOIB 3WHE0 1EFQA 3VCLB 1MHHB 4LLAA 4J6RH 3EOTL 1F97A 2X4UA 3KJ4B 3QISA 3PDGA 4J2XA 1ACYL 3R06A 2GTZB 5E8DL 2VLRE 4WY7H 2NXZC 5DD5H 1NAKH 2A0LD 2C1PB 4PYHA 4M00A 5DWUH 3SKOB 1CK0L 4PD4J 4Y4HA 1CBVH 5GGSB 4WW2A 3QDGE 1QLEL 5A2JH 3HZYA 4TUOB 4AH2B 1S9XB 4GMSH 1I85A 2F19L 4HWUA 4XVTL 3U9PH 3I02B 2VLJD 1U3HD 4JDTH 3IF1A 1I1YA 1ADQL 3U79A 3K4ZA 4XMPH 1GGYA 1IARB 2YK1L 4QY8A 3VXQB 1RI8A 4G8IA 5D71L 5B3JE 1MWAH 4Q7DA 2FECL 4JO1L 4AIXA 1FFOB 1AHWC 1U6AH 4JO2L 3O3DB 5EPMA 3TJHD 3EJZD 1YNTB 5DEZA 5M95B 2AVGA 1GPOL 5TE4L 5ADPL 2HJLB 4OCYH 3GSWB 1ZHLB 3DLQR 4HIJA 4EJ1C 5DLMH 3NZHL 4GAGL 4QXTB 1JK8A 2BNUB 3TO4D 5D93C 2VZVA 3HPJA 3RKDD 2H26B 1F3DH 4LVHB 4QRPA 3MRMA 1J0ZA 3W9EA 2CIKB 4G6AD 3DJ9A 3EO9H 2A6JA 3BSZH 3FB6B 1XF5B 3GSNB 1PX3A 2CGRL 2A74B 1FVCB 1VEOA 4X98B 2H45A 4HCRH 4FQPA 1VFAA 4R6UA 5J7CC 4UV4H 3DMMD 1I1AA 2GJ6D 1BGXL 3VGDA 1U3ZA 4BSWB 5E2VL 5HVGB 5GRYA 4F57L 4UIKL 3GUTA 1ZGLB 4OLXH 1BFVH 2VXSH 4XNZC 4K23H 3UMTA 5D7IE 3V0WH 2DL2A 4NO5A 4LGSB 1AGBB 2A2QT 5FO9B 2VJXA 3L9RB 2APFA 1JV5A 4YUEH 3QRFM 5T3XL 4B7IA 2BSRA 5GJSL 1OARL 2FEDC 4ZNEE 4EN3D 1HIML 5FK9B 3Q3GA 1JCKA 3MLYL 1X4YA 2X1XR 4IRJC 3SDAC 3PV7A 1CT8B 1A6UH 1F3JA 3OPZL 1BQHA 5BO1L 1RUKH 2F9BT 5HPOA 4PFEA 1QR1A 5IFJA 2BOCA 3IFLL 3WIHH 1NBYA 4ZFOB 5HHOD 4X5LA 3HNTH 3B9AA 4D9RE 3KR3L 4JZOA 3QEHB 4Y2DC 3B2UD 3WIFA 3AM8C 2B39A 2BXYA 1P4BH 1H8SA 1JGLH 2A77L 2FL5A 4X6BB 3JVGA 3PL6B 2BVOB 3BXNB 3MV7D 5IHUL 1NFIA 4LLDB 4LLUA 1EAPA 4N1CA 1BFOB 2N1KA 4I0KA 2VL5B 1I3RB 2XZQH 3F6LA 2X4QB 3KPQB 5INCB 4XWOC 1N2RA 1WWBX 2KL6A 4OCWL 4PJEA 4LSTL 1W8OA 3FQRA 3RWEB 3KG5A 1KPVB 1T6VN 3T0XA 3B8YA 3MOQA 1VFOA 3STZB 1CWVA 1PYWB 4OLUH 2EIZB 4NZUH 5A16B 1FNAA 1VACB 4PRPE 3SGEH 3WLBA 1JHLL 1DANU 1J1XH 3EOAB 5F9OL 1G7IB 5BZWB 1SHMA 5F96L 5KTEL 5DD0H 1G7PB 3DVIA 3IJSA 3U0PA 2V2TB 1OAKH 2R4SH 4LEXL 4K7PX 3SE4C 1S7RB 4R26H 5TDPB 1PG7X 2W65A 1I1FB 5C9KA 4G7VH 4MGXA 5FF6B 1WEJH 3PWJA 1F4YH 2LU7A 5F7KC 5FECA 2OK0H 4PJEF 4NPYB 3LMJL 5EUKA 4K3JL 2X9WA 1D5ZA 4ONHB 5C07D 1UM6H 4MAYC 5FUCE 3RWCA 4QHLA 1Z3GH 4RA0C 3L3KB 4MDJA 1RJZA 1INEH 1FP5A 2DWEA 2V9TA 2ZSWB 3D6GA 1CICD 4Z8FL 4DKEL 1RZKL 1XF4A 1IL1B 2AS5M 1U8NA 4O51B 1DQML 3KS0H 3O2VH 5FM5M 4Z7UA 2DOCA 2NYYD 5GJTL 1D9KC 1JF1A 3VMOA 3B4NA 4S0SD 5L2KB 3I2CL 4JRYB 1URLA 2OMBA 3NTCH 3LDBC 4Y4KB 5C0CE 3O11A 2UYLA 4NGHL 4JY6B 5EWIH 4G8FB 3H9SD 3LN5A 4W6WB 5FYLL 1YEEH 3L5XL 3FB7B 1F4XL 3MLVH 5EU6B 3RNQA 2DQHL 3TPKA 3VGBA 4CMMB 2ERJC 4FMKA 3DIFB 4PJGA 4JPIB 5C0IA 1N26A 1I3UA 2AJUL 2YPLA 5L88H 2AJYH 3P77B 5TGBB 5I1EL 2BXZA 3RTQD 5MHSD 4NNXA 2PCPB 1NUFA 5K9KB 2D0FA 3KPMB 5FB8B 4HXAH 1V3MA 3EAKA 1M7DA 3VXTB 5EH1A 4FQ2L 1UWXK 2A73A 3E2HB 4Z7UF 3E8UH 3E3QC 4KQ3L 2NXYD 3WUWA 4FTVB 3D39B 4I2XE 4FXGB 2Q76B 1LK3H 2Q3ZA 3LEVL 4QRSB 1FGNH 3QPQD 2VAAA 1UEMA 4RGMC 4DK6A 2X10A 3QH3B 4ZS7H 3FAXA 1A0QL 4FOMA 4PJGF 2ZOLA 2Z93A 1IBGL 4HFWB 2VMFA 4NC2B 2NNAA 2YRPA 3S34L 3A6OA 4HC1L 1IQDA 4XNYL 5LQBL 4R4BA 4RMTA 3OZ9L 2EE3A 5IB3A 3MRLA 1DBML 1YEHH 5EU3A 5A1AA 1MWAA 3DTXB 1KJMA 2W91A 1EEQA 4QNPE 2YD7A 4G7YH 4OLWH 3TVMD 4GW1A 2OL3B 4K3EL 3WLWD 4UB0L 5CINL 4KMQA 1NLDH 4WVRA 5HGGS 1WK0A 3U0TB 2VLKE 3PG2A 1HSBB 3O8XB 3H6JA 2IAMA 3HC3H 3PUCA 3X3FH 3KJ4C 1ORSB 2C4XA 4PBVC 3S35L 2XWBA 5F9JB 4OIIL 3T0VA 1M71B 3W39B 2FIKB 4JDVB 1KLFA 1QSEE 5ICYA 4ZPTA 4PRIA 3ULUC 3ALPA 5H94A 1J12A 4XTRC 2NY5L 1QVOA 3E6FA 4MD4B 1CE6A 2VQUA 3QJHB 2DN7A 2JIXD 4HCRA 5T3XE 4NBYB 4I0PD 4XXCA 5EOCL 5IGXH 1KELH 1OT1A 1OAZL 3DROA 1OF2B 1LO4H 1RJYB 3ARBB 3CGTA 3MUJA 4WNQB 2Q8AH 2R2CA 3MV8B 3ZE0E 3LQAH 2P5WE 2DMKA 3S37L 4GG6A 5A2LH 2EECA 2FHBA 4XBGA 5E8PB 3U30B 4PY8J 3UDWC 3IDUA 3VRJA 3ULVC 2X4RA 2ICCA 2X1OA 1K8DA 4ODWB 1DN0B 1DN2A 3W2DH 1CGTA 4PJ8D 1EX0A 2FH8A 4O2EA 4OCRH 3PXHA 4MCYA 4PRBA 4WJ5B 1GOFA 4HMEA 1IM3B 4LVHC 4R90H 5GSVB 2W0FA 2X2YA 2HKHH 3WIHA 4G9FE 1O7SA 4QHMA 3ET9F 4A6YB 3I85A 1MI5B 3U7WH 2R1WB 1KIQB 4KTYA 4N0RA 4WI4A 2EKJA 4KMTL 5FGCE 2PO6A 3I3DA 3JZ7A 3RL1B 4WTZA 5D1ZA 1FYTA 4DK3A 4YHYB 4HAFA 4WWKA 4ALAL 2DLTA 2R0ZH 5CSGA 5JOPD 4GFTB 4MJ6A 2ICWJ 3PABA 1YEIH 3T0AA 5CSZB 1XZ0A 3WNLA 3IDGB 1E4XH 1NDGA 3X11B 4RMQA 5IW1B 1RJLA 1REIA 1XGQB 4IOSD 4HUUA 2APWA 4K94L 1ZLUK 5IT2H 3Q1SH 2D03L 4APQB 3BRDA 1OAYH 2VDRH 4Z7NF 2V5TA 3HN3A 4CN6A 4O58L 1KLUB 4HH9A 5DQJA 5F1IB 1KXTB 4K2UH 3DX7B 2CKBH 2R1XB 1M7XA 3EGSB 3ZKQD 4AENA 1JI1A 3U36A 2A1WH 4G6FB 2IALA 4WHTA 3WHXB 5CLWA 4FP8H 2K3TA 3S5LG 3O4LD 1MH5B 4OFDA 4U1KB 1GRWA 1HINL 4L4TA 4P2QB 4P3CH 5BV7H 1KTDA 5DRZB 2VXQH 3AXLA 3UPRA 3PL6C 1TCMA 3TYFB 4JHBA 1U8QA 2IEPA 2SEBA 2FWOA 3O6LH 3ZDZE 3TFKD 2IG2L 1SBBA 4NKIL 4ORZC 4IMKC 3MRHB 1N6QL 1T1XB 4YLQT 1JPST 3TH2T 5HHVH 3CMGA 4RAVA 3MCKB 8FABA 2ESVB 3LSOA 3TBTA 35C8H 5FYLE 4NQCE 4ZQKB 4ZFGH 1H3WM 2CR6A 2D7OA 3DVGA 4PTUA 4PJIE 1ONQB 5HYEA 4LSPH 1ZHBB 5ID1B 2XN9A 1KJ2B 1BQLH 3ARXA 4GQPH 2DDQH 3PP3H 3TP4A 4JRXA 4XT1C 2R56L 1N5AA 5L0QB 4E0RB 1CFSB 4NM4H 1SM3H 4FA8A 3UTSA 5C0AA 1RQ5A 4U3XA 5E6IA 3GSRA 2Y7QA 4PJ5B 1R6VA 3BOVA 4O4YL 3OGCB 1S7TA 3VG0H 1D3CA 4OZIA 3O45B 1XF2A 4DN4L 3K2MC 3RY6A 5ID0B 1YECH 4NZTH 4NQUA 4Y4HD 3V8OA 3HE7A 4Q0XL 5DFTA 1FV1A 3SQOH 3WKML 1JN6B 5D7JB 4NFCA 2IMNA 4TUJB 2V7NA 3QEUB 2AI0L 5I1KL 5DD1H 1W0VA 4MA8H 5MENE 4N0CD 1OLZA 4XMKH 5IEHA 4GKSA 4TTDD 3U4BL 1OPGH 4LCIL 4MLSA 1ZANL 3T0WA 1F11A 5HGAA 4PJBE 1XGTB 4F9PC 4R3SA 4Z7WB 1HQRA 3WJLC 1HHHB 4OZIF 4RQQB 3QR2A 1J87A 5I66A 2XRAH 3FZUD 3RQ3A 3B9KB 5EA0L 4EBQL 4Y1AB 4Y4KC 1U8PB 1A6WH 3QHZH 1P7HL 1U95A 1PY9A 2JLLA 2NY7H 1KLGB 4QRPD 2B1HL 4NN5B 4M61A 1CTNA 3QAZB 4PJDE 4XMLH 2J88H 2P24B 5CWSA 4XAWL 1IGTB 4NZJA 3G5VB 4XI5C 4RGOL 5GPRA 4WEMB 2DQEH 1JWUB 3NOIA 1ES0B 5BQ7A 1DBJL 2IWGA 2VDNH 3WFCL 5FOBB 1I1AD 3PWNA 3ULSA 3E2HC 4ZUVA 1VFBB 3QWOA 1A7RH 1IC5L 5HYSA 1ZSDA 2GEEA 4Y7MA 1T1ZA 4AMKH 1ZV5A 4ZFZB 1CF8L 1N6VA 4HKZA 4K55A 5GISH 5AZ2L 5FYKD 1FRGH 3W81A 3KPLB 4YHML 5IG7B 1P7QA 1R3JB 2E7LA 3C9NA 5C9JA 5DJYA 1QP1A 3QZWA 5IKCB 1CFVH 1KXQE 3ARWA 3ES6A 4ODVL 3X3GH 4HJ0C 4N8CL 5JLZA 5LGKA 1K3ZA 2ZUYA 1DLHB 1DCLA 4XH2B 4JFOB 2AK4B 5DFWH 2VXTH 3OB0K 1UG9A 5FYJU 1IJ9A 3FFCB 2DQTH 2HVKB 1JNNL 5DO2D 3HZKB 5J6HA 1H0DB 1S5IH 2MCG1 2Y07L 5T1KD 1CXIA 4KFZC 2HVJA 2NZ9D 5HGBA 3UJIH 4JFPB 1FBIL 3O8XC 3NCYP 1WT5A 1UZ6F 3DETC 3Q6GH 4GO6B 3GSUA 4Y5XA 3RA7L 1FNGA 1G7JB 3EDFA 2HT4C 4EEEA 1IAIM 3MYZA 3U46A 1HYSD 1TJHL 1M6OB 2L7JA 4AL8H 3SDXA 4LPUA 1YZZA 4U0QB 3MTRA 2ICEB 2DQGH 4HX1A 5T1MB 2V2XA 3QFJE 4YHPA 1A7BA 5BXFB 4PGDB 4YO0B 5DR5H 2N7BA 4WW1B 3EDDA 5IVZB 1NUDA 4X6EB 2YOCA 5DDHA 4L8DB 4JQXC 3V0VB 2QEJA 4AK1A 1RY7B 3T1FA 3ZE2F 1OQOA 3AY4A 3EFFB 4KJWD 4AJ0A 3P4NB 3X12A 3FCTA 1CFQB 4JPWH 2MPAL 3ARBC 2YPKB 4AM0B 1LO0L 1CIUA 3MA9H 5LG1A 1OD9A 3U30C 5DMKA 4YHZH 5IMLA 1AGEB 5CMAB 4HG4K 1AHWA 1BJMA 4NQEA 2P43B 5DQ9B 4U1LA 3NA9L 1OSZA 3P4OB 5DS8A 4CKVX 3ECBB 3I6KA 3QXAB 5TPWL 5FV2A 5C0RL 2CKBA 1LNUB 3BGAA 4F33A 3MJ9L 4ZSOE 1VADA 2QR0B 4JN1L 3QCTL 1Y6KR 5ESAA 2HJKA 3W9DB 3IDJA 1L7TL 1Q72H 1JZ6A 3FQNB 5MERA 3ULUH 4PP2A 5FUOH 4YHYC 2B5IC 2BNRD 4EI5D 4JFEA 3BEVA 4P59L 3VD3A 4GBXB 3QIWB 4YNYB 4O2FB 2ADGA 1C5BH 2CLVB 4J8RA 1EUTA 3I6LD 3VRIB 5L2JB 1XIWA 2QQNH 5IB1B 1T0MA 4AYFA 1KB9K 1IQWH 5F3BB 2D0HA 1BJ1H 4UTBH 4ZTPL 4APQC 2CSPA 4U05A 5ISZE 2L4OA 4NQSA 4F58H 4UT6H 1CDHA 1MRDL 3THML 4XNMA 3VGFA 1BWWA 5CGYD 1NCBL 1EJOH 3FRUA 5CGMA 2P5EA 4AG4H 3ARFC 3ULVH 2FO1A 1DEDA 4LMQE 2VQTA 2X6MA 2HJFB 4M7LL 3I6GA 1U8JB 2ICWB 2H6PA 4U6VH 2EE6A 4IRJA 3SDAA 4BZ1H 1TCRA 4YPJA 4XBPB 1PSKL 4YPGA 5JO5B 4KHXH 4OD3H 4OLVH 3ISWA 4YDIL 3N50A 2Z4QA 1FH5H 3DVNB 2A6KA 2JF1A 3UBXA 2B4CL 5HPMB 3GSNH 1T7VA 1W72L 5F89B 4NRZA 1F00I 2K7QA 1RZ8A 4J3OC 3HE6A 1MUJA 5EZIL 1CDCA 3FQTA 3KWWB 2B2XL 4WUKH 5HI3C 3SGDI 1I8MA 4GW5B 3HRZB 1OAQL 3L1OH 4HZLA 4J3WA 4CDHA 1NGPL 2R0WL 2Z8WC 3G08B 1BZ9A 1NEUA 3EBAA 3ARRA 1MRFL 1Y0LA 3A6CH 1CD1B 5AUMA 3IJYB 4HWZB 3H9ZA 1U92B 3G6JE 5L0QC 5D7SL 3GMRB 1SYSA 3TH4T 3BKYL 3BP6A 2VZUA 3CLEH 3GKWH 4X7EC 1UH2A 1OTTC 1XR9B 4PLJD 5DJAB 1V3KA 5DHYB 4UNVA 4ZS6D 5F6HJ 3UTTD 4PJFA 1AIFB 1AJ7H 1R3KB 2FDBP 4CN4A 4PV9A 1OAUH 1UXSB 2R2EB 4K7FB 4Z7UE 2AEWA 1AGCA 5D7JC 3VE0A 1YJDH 1W8NA 3IRZA 1F4AA 4FQHA 3SE4A 3UCRA 1VKXB 1MHPH 4Z7VE 3GSXA 4EZMA 4NRYB 3RJDA 1DUZB 2X9YA 4BSJA 1NPUA 5DRWB 2LU4A 5AWNH 2EH8L 3RDTB 5JW3L 3VFPA 2R8SL 4PJGE 1KJ3H 2YPLE 3QQ4B 3TBYA 2P8MA 1S9VA 4NDMA 1S7WA 4NO2B 2HG5B 2ZJSL 4N90E 2NY4D 4PJFF 5JXEA 4XP1L 3B5HA 5I1AB 1Z0NA 2GITB 2PR4L 4LLQA 3HB3C 3DO3A 2G75B 3B9KC 1GSMA 3TESA 1I1CA 1QFWH 1AGDB 4X4XB 2FBJL 3TGXA 1KCSH 4NN5C 5E7FA 5JORB 2Z31B 3QAZC 3BQUA 3DNKA 2WNGA 1WBXA 5FM4A 5HYJA 1YPZF 3TBVA 3LS4L 3PQYA 3HS0B 1YY8A 5D1ZD 2UV3A 3SKNB 5GGTL 4IRSB 1Z9OA 3HNVL 5IB4B 4DVRH 3B3IB 4WWKD 2AJSL 1U93A 2W1NA 5KVGH 3QDME 1FO0L 5I1HH 2APVA 1HSAB 3ZDXF 5C0EA 1R5VA 3OHXA 2J8UA 2HRLA 3RNKA 4HDIB 1JMZA 1JNLL 1OY3B 2EKSB 3EJYD 1G1CA 2H41A 5C0BE 4CMHB 4F80A 4R7NB 1FZOB 2PXYD 3MXWH 3VXSB 1EERB 3P11L 3SKMA 1EHLL 4LCUB 5DK2A 3F7PC 3HZMA 2B0SL 5JPNB 3BZ4A 1I7UB 4RA3A 1FNEA 4PJAE 2J8OA 1HHKB 1U91A 5CZXD 4LP4A 1F8TH 3SBWC 4PRIE 5F7EL 1FE8H 1YMME 2VDKH 5IJKC 1KC5H 5DK3A 2HKFH 3KPPA 5I8CA 2QTEA 5IIEB 4KI1A 4HUXA 3SE8H 1IAMA 3FN9A 2NW2B 2J8UF 1TETH 4XP9L 3RWHA 4HFUL 1KEMH 3DURB 1UM4H 2Y6SC 1Q9LA 4LLWA 3RWGB 1BBDL 1J8KA 4LIQH 2WLYA 3SGJC 4LSQL 1U58A 2GUOB 3MREA 3P9MB 5C2UB 4Y4FB 4L3CA 5C09A 3HI5H 1MHHA 4ELME 2IANA 1LEIB 2LU3A 3H9HB 4WTXA 5KOMC 4TSCH 1H15B 4OF6A 4KZDH 3DX6B 4M1DL 1LDPH 4X0KB 4QHKI 1VPOL 2GTZA 4LBEA 4JRXD 2X4NA 3BH9B 3HI6H 2FBOJ 2C1PA 1NCCL 3RHWF 3QUMB 2FO4A 1NANI 1FL5B 3UJTL 5E6ID 4BYHA 4FQ1H 4C55A 1PJ9A 4EDWL 5KN5B 4XPBH 5J3HD 4UT7L 4Z7OE 3LHPL 2XA3A 1OB1B 4WWID 1BMGA 3I02A 3VWJB 3MRJB 4F7EB 5E99L 4POZC 1MJ7L 2DB8A 1R0AL 4G80B 1KPUB 1OGTB 3MODL 3P0YL 3HE7D 4NYLB 4HUVB 5ITBH 2YWZA 3AGVA 1QRNB 4KROB 1CDIA 3SJVD 3BAEH 2WANA 4QLRA 1EVTC 1DL7L 4KUZH 4G5ZL 2F54B 4Z7QF 1FYTE 1Q1JL 5LBSH 3AVEA 1A2YB 2PYEB 3EFDH 1YNTA 3VXUB 3C87A 2QKIB 3SEPA 1IAKB 4WFHE 4HWBH 4U1HB 2ZWLT 2HJLA 4ZUUB 1ZHLA 3HUJE 4U1SB 4QXTA 3MA7B 3VXOB 4GRWE 5I1IL 1OWRM 1KT2B 3SGKA 4HQQL 3CSGA 4Y16D 5GS0C 5D72L 5D6DA 4ZAKB 3QPXL 4XRCB 1EXUB 1T6WA 2CIKA 1QO3B 1ND0B 3ARYA 5L8LB 3N1GC 4Q9QL 1K6QH 3MLWL 2DWDA 3QIBB 4L4VB 3WIIL 3C6SB 3GSNA 4GBXC 3QIWC 3ZTNL 1DJSA 5I1LA 3CXDL 4PY8I 3RI5F 12E8H 1MEXL 2AEQH 1TPXB 4QHNB 1MAJA 5GGUB 1O0VA 3NIDF 3GEWB 3RX7A 4WUUD 4L4TE 4ZUSB 3ULVF 3QDJE 5AD0B 4M7JL 3HAEG 1E6OH 1ZGLA 4ODSL 1BBJA 2HFGH 3UXFA 4LFHG 4GAYA 2XTJD 4U1IA 3NFSH 1S7QA 5E94B 2J7LA 3O41B 1FDLL 3BFOA 3OAUL 5FO9A 4LK4A 4I3RL 4J1UB 5EC2B 1DBKL 3L9RA 3QUXB 4DZBA 4LKXB 4JQIL 5JHLH 3FQXB 5DK0B 5GGRB 3BZEB 3G5YB 1DR9A 4RNRA 1CL7L 1Q9KB 4L4JA 2QHRH 1RIUL 1CT8A 1A5FL 3RUGA 2IGFH 1YNKH 2XN9E 4TNWK 2PKDA 2Q8BH 1AO7B 4G8GD 4RRPG 1HXYA 43C9B 4ZFOA 5EO0A 1I9JL 4A6YH 3UTSE 2DLEA 2ICWI 4F7MA 4MJ5A 3IETB 5DFVD 2CO6B 1OSPH 3RVWD 1X5ZA 2FNBA 3QG6A 2VYRE 3TBSA 1BVKA 1GIGH 4JPKL 5D2LB 4MNQB 1DQQA 1BFSA 2BVOA 4U3HA 2WWMD 5IFHL 1RFDH 4HPYH 2X05A 3U7YH 1F2QA 5EOTB 3G9VA 4F7CB 5DD3H 4BZ2H 3VFWB 1I3RA 4NN7B 1SVCP 2X4QA 2CRIA 4KQ4H 4PJCE 4ENED 3QWQB 1YN6B 3RUGF 1Q9WA