5HHOE

Crystal structure of the jm22 tcr in complex with hla-a*0201 in complex with m1-g4e
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
240
structure length
240
Chain Sequence
GGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIRSSYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 49
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE02
4QHNA 2H32B 3MV8A 5E8PB 4NZTH 2YA2A 1BZ9B 2DYPB 5HJ3B 2CMRH 2HP4A 4BH8A 4C4KT 2YPVL 2FGZA 4HXAL 3MCKA 4QGTA 1LMKA 3P2TA 4LEXH 1A47A 5HI4D 3HC0B 4GAGH 4KK9D 2GTWB 4Y4HD 5BQ7A 3BP6A 3PHSA 3KYAA 3B2UC 3GSRA 3SDYH 4I4WB 4D9LL 2BNRB 3BE1L 3BDXA 4U6XB 3RZCD 1U3JA 1RZ8A 1CDGA 3TYGL 4QCIB 5IVXF 4PJXA 5JA9A 5D7IE 1ZSDA 4X6CA 5HHMB 3S96A 1M7IB 5EU3A 4C58B 3QUXC 2CR6A 4I48B 1CQYA 3CK0L 3WIIH 3VFRB 3QXDB 1T0MA 4M7ZB 3ZDZE 1SVCP 1TJIH 1E0OB 3FN9A 3ARDC 4JRYA 2RFXB 5D1QC 5D2NA 5JQ6L 2DD8L 1UVQB 2FO4A 5ICYB 1BFVH 2C3VA 3PG2A 3UDWC 4B7IA 2OJEB 3NCCB 1NGQH 5ID0B 2FWOB 5ACLA 3TJEH 1CD1B 1EHLL 3QCVH 2EE2A 1A6WH 1N0XL 4J6RH 3CLEH 4PRPE 2X4RA 3WJJC 2R0KH 1PD6A 2G5RA 3O45B 2A1WL 3SKMA 3WLBA 1TNMA 1UWEL 4XC3H 1RIVH 1R3LA 2VNCA 2NXZB 4GQ9L 1KLGB 4WTZG 4OM0H 1OAKH 3PF2A 4TVSa 4E0RB 1NDMA 1ZKAA 2IG2L 4GT7A 1UJ3A 2CIIB 3UPRB 4KZDL 1M6OA 1MJ7H 3H8NA 1CF8L 1X44A 3QWQB 5DJXB 4GBXA 1A9BA 5ANMB 2XN9B 1UZ8B 2NY2B 3IKCA 1RJYB 3VG0L 3BPLB 1QSEE 4XHQA 5J13B 3CVHB 3P9MA 3ME0A 2C1OB 5HI3C 4GBXB 4MNGB 3V0WH 4OI9A 1YY9C 3KDMA 3TYFB 1IAKB 5A16A 3MBEB 2GAZB 2LABA 5GS1A 3D39E 5DHXB 2AEWA 2X4TB 3ARTA 1U6AL 1A14L 4F57H 4Z76A 5I1HH 2F53D 3UXFA 5DO2C 3WS3B 2CK2A 4KKAC 4IRSA 3DGCR 1HQ4B 4R4NC 2NXZD 3OGOE 2FLRT 2XRAL 3V4UH 1HILB 1BVZA 1KIPB 3WL9B 4Z0XA 3M8OH 4XCCH 1LILA 1YN7A 3QUZD 3V6FB 2HJLA 3W0WB 3D39B 3GHBH 5KANG 1UGNA 1BQHG 1IL1B 2C3GA 4Q7DA 1HILA 2BVQB 5I1KL 3RHWF 2XA8L 4YHOL 1FL5B 4HCRH 4TTDD 2X4OA 4NN7C 2C9AA 4P5KB 5IB2B 2HJLB 1JHKL 3SGEH 1LDSA 1PKQB 4HZAA 1HEZA 4JVWA 2DM3A 4U6TA 3QEQE 2CQVA 4G3YL 1SJEB 4LSPL 5EO1A 5BRZE 2YPLB 3PWPE 1A02N 4JPKH 1WVZA 2D7PA 2ADFH 3WJLC 2P24B 1NL0L 4FQ1H 3R4DA 4GSDL 3AUVA 1JGEB 3HB3D 1ES0B 1RUPH 1EX0A 4K3GA 2A6IB 1G6RH 4V1DD 2V2XB 4RMVA 1I1CA 4RNRA 4YDJA 2A0LC 3IFNH 5DQJB 3S97C 1HYSD 3NCJL 3CXHJ 3O4LA 4XAWH 3MRFB 2HVKA 4IIQA 3V6OC 1ES0A 4XHJD 2DWDA 4FXGA 3REVA 2CDGB 1OSZA 25C8L 4RGNB 3ARSA 4YO0B 2E9BA 4NWUH 5EWIL 1U95A 3QPXH 2VISA 3MSPA 5C09D 2LVEA 4PRIA 1TCMA 2AEQL 2Z31D 4HS6A 4N1CA 4YE4L 2IQ9L 4BUHA 4ZO6A 1ZANL 4YO0A 4F7TA 1MELA 2IQ9H 4IHOB 5FHAH 3B8SA 5F1IA 3TWCL 5E2TH 1A7NH 1TZIB 3BWUC 1ZLUH 1VFAA 1FL6A 2Y06L 1NQBA 3WS6A 1XFPA 1YEKH 1YEJL 3M17B 1CR9L 2VAJA 4UNUA 4M93C 1A3RL 4HPYL 4GAJL 2K7PA 2EDEA 3MXVH 5HI4C 5DJ8B 3E3QE 2FJGB 1UA6H 3HC0A 4O9HH 2KL6A 5IMMB 4ZQKB 4ODTH 4CNIA 1QA9A 2X40A 4QKXB 1R3IH 3TIDB 4LF3B 5JW4R 4HMCA 2VR9A 4G80A 4X4ZA 1JYNA 4HAFA 4FABH 4QRPD 1MI5E 5FGCE 1IC1A 3GNMH 4PJXB 4D9QD 3NZ8A 1KJ3H 4P4KA 1JZ2A 3ARGC 5DJ0A 1U3ZA 1T89C 5D1QD 3ZSSA 1NCDH 4P4RA 5DTFB 3GHBL 2GTZA 2D7TH 2YBRA 4N5UA 4WI9A 5EU5B 4JY6B 2J88L 5GHWL 1UVQA 1A4JB 3I2CH 1XGUB 4XVTH 2KUTA 3CFIC 5HSFA 1I1AD 5C6PB 4BQ6A 3DXAD 3U4AA 3L3DA 1J18A 1T2JA 5EU5A 1UG9A 3MLTB 4P5TC 4Y4FB 3CSPA 1CGSL 3T3MF 2VUOA 1EZVY 3BEWB 5I8OH 4OFYD 3NCJH 3VFOB 5F7WC 1AO7B 3IS0X 4R0LC 2NXYC 2X4PB 4O51A 1WAAF 4JFZL 3TO4D 4L4JA 4X99B 4YHKL 1AGFA 2EYSB 1JCKA 1M05A 3LQAH 3QUYD 4P9HL 3OJMB 2H26A 3UAJC 5E1AA 4EBQH 3G5ZB 3NABL 1U3YA 4M1CC 1YPZA 2VR5A 5A2LH 2ADIA 1QYGH 2CIIA 3C6SB 2VLKA 3UPRA 1I3VA 4QYOA 3DJ9A 5DD6A 1KNOB 5E1AB 4GKOA 5E99H 3TBYA 4R7NB 1BZ9A 2B8OT 1BECA 2D3VA 4WNQB 4WWID 2VLKB 5E2VL 2QADD 3SPVB 1MCOL 1KPVA 2ZP0T 2YK1L 3VRIB 2Y07L 4XNQA 1RIVL 1V7NL 3K4ZA 2JJTC 5MHSE 1FAKT 3M8OL 3VWKD 1KELH 2Q6WA 2H41A 5L2JA 4LFHD 3DX8A 4OLZH 5DC0A 4Q6IB 3PWPB 4GRWH 1WFTA 3I02A 3WSQH 5I18L 2EO9A 1GGTA 3OWEA 4F57L 4PJFB 1H8SA 4TTGA 1F8TH 3EYVA 5D1ZD 3BP4A 3QUZC 3K1DA 2WSKA 4ODXB 5KTEH 4MD4B 4HGWA 5L8KB 3FOMA 3Q6FA 5DJDB 1I8MA 5KVFL 3C8KA 3QUKA 4JFOA 1NC4B 5FK9B 4XI5D 4ODVH 3IFPA 3FOMB 1P6FA 5CZXD 5ID0A 3QDMD 1HSBA 4XBEL 4OIIH 3SE3A 2X9XA 5CBEA 4GG6B 3A6BH 4M00A 4OKVB 3FO1A 3A67L 5D1XC 4KK5C 1ZHLA 2IG2H 4JZJA 1XR8A 3MX0A 3WNNA 1CI5A 1KBGH 3RWFB 4X9BA 4GG6A 3HZMB 5DJAB 3LV3B 4FFWC 4XC1L 1XR8B 2VLRD 2Z8VC 5BVPL 1AFVL 2P45B 3ZL4H 2X1PA 2V2XA 4RISH 4GG8A 2PTTA 2IQAA 4K3JL 4RNRB 3NTCL 3O6KL 5MEPB 3QIWB 5C08E 3SE3C 4NBZB 5KS9B 1IEAB 3KR3L 5E6IC 3DLQR 4HS8H 4P9HH 4PP1C 4EVNA 5H94A 4OKDA 1I9JL 1ZTXL 4JFXA 4Y5XA 1NUFA 3B9AA 3N0PB 2R23B 3GMOA 2Q76B 2VZUA 4PJGE 5JDSA 3OXRB 2P7TA 2VH5L 4UTBH 4M61A 4IHOA 3BPCB 4MNQA 3HA0A 4LVOB 4OV5B 1I8KB 4UV4H 4LKCA 1QLFB 3MV01 3HNVH 2C1PA 4Y5XC 3T4AA 3ZZ1A 4U7KA 1A22B 3CK0H 2CUMA 3DIFA 3MNVB 4JDVB 2PYFA 5F6HI 3ARFB 3L7EB 3BKCH 5TDNB 2JB6A 4PJ9B 1V3LA 2YKLH 5TJWK 1MJ8H 2BX5A 35C8L 3RL1A 3V7MA 1MQ8A 2X7LA 3CNKA 3QZWA 4G8EA 3PXJA 4ZFZB 2P47B 3H3PH 5C0CE 1QA9B 5AYUH 1UXSA 4MA8L 1NEUA 4GLRH 4LSSL 2HG5A 2Q8BL 4U7MA 2H2SC 3FO9B 5IW1A 4MX7B 4JFQB 2OL3A 3MODH 4GRLD 3CSBA 3DGGA 5FGBC 3OXSB 5EOTA 1T5XA 3GM0A 3VFMB 3NA9H 5FYJD 3W9DA 32C2A 4WTXA 3C5SB 4H25A 3S5LB 4JY5H 5DHVH 3ZHLA 4U1SB 1YEJH 1R5VA 1QSFE 5JQHC 5KSBF 3BKML 5FA4A 5D8JL 5MEOB 1S5IH 4POZD 1ZT4B 3O2VH 5J6GA 4NQUA 3GIZL 4Y19A 4DAGL 5IT2H 4FXGB 1CDUA 2K7QA 1D5ZB 2AGJH 2DI9A 4ONGL 4I77H 3HAEB 4XP6H 3INUL 4OZ4A 4WV1B 1RUML 4QTIL 4M1DH 4Z77B 2J1KA 1JTTA 2ZUTA 1RK0B 4NQDD 4BSWA 4M1CD 3MRDA 4ALAL 3AREC 3VG9B 4FQXC 4A6YB 2CGRH 2NY7H 3QIUD 2FGWL 1KJVA 1ERNA 4YHIA 4EN3A 1RUPL 4HIJA 4X6FB 3PGCA 1NL0H 4FQ1L 4Y16B 4HPOL 1IC5H 3VG9C 3MRKB 2P8MB 5IKCA 2ITDB 4AMKH 1OAZL 2FNBA 2D9CA 5C70A 4OI8A 2LAGB 4UU9A 1V5JA 4NNYA 5EU6E 1Z9MA 2O26U 4MAYB 2EDWA 3EOAB 43C9A 3OKMA 1DBAL 3HMWH 3BPOC 3G6AB 4PJBA 1DEDA 2NY0C 2UZIH 3G5YA 3MBED 1I75A 3RY6A 43C9B 1YMME 4PRBA 3EGSA 1BJ1J 5DQ9A 4KVNL 4LVHB 1FL3B 4EIZC 4ODXA 1CGYA 1J8HE 4PG9A 1N59B 1MWAL 1IC5L 4F9PC 5FK9A 1S8DB 4G8FA 3UTTE 1N5YL 3ISWA 5CZXC 3SCMB 2RFXA 3MODL 4PG9B 3HC4L 4OD2B 5EUOB 1BM3L 1KCSL 5C08A 1T1WA 4Y0GA 2ADGB 2ZCLL 1RPQA 1GPOH 2OYPA 3V4VL 5T5NG 2OS7A 1T4KB 3NIGF 3MCLL 2W07A 3DO3A 1B0GB 3LSOA 5DJAA 1OAYL 3X13A 3ARQA 4LKXA 5KVGL 3S4SA 5ACMA 1MCBA 5F9DC 5JORB 2AGJL 4ONGH 4OZGF 4YGVA 1HI6B 2X09A 1AHWB 3O8XB 2F54D 2EIZB 3C6SA 2DI7A 2KKQA 4QYOB 1OT2A 3S4SB 5DD6B 1A7QH 2V5YA 1AD0B 4W68A 3SKJL 5IR1A 1I85A 4Q74A 1HK6A 2R23A 2IEPA 1EJOL 2R9HC 1QBLH 4AENB 1KENH 3OF6D 5ANMA 4V2BA 3ZTNH 1EBAA 5FYJH 3QDGE 4XWOD 4U2ZA 1IGFL 2ORBH 3MLYH 1ADQH 4KJYA 4ZO9A 3ORJA 5M7QA 4NO2B 3ESVF 4HK0A 3CDFA 1F00I 4MQXD 1TVHA 4OBSA 2HRLA 3EOYG 2YUVA 4QHUB 5DVOA 5HYJD 5KVDL 5AYUL 3VGEA 5GRVK 4LHUA 4X83A 4LP4A 5K9KB 1A7OH 1I3UA 1P5VA 1EEZB 2WLYA 3FT4A 2XT1B 4PJGA 5D7JA 3WJLA 3CPLB 2P5ED 1JE6A 1LD9B 4Y4HA 2ZPKL 3ZYOA 1FDLL 4O00A 1EHAA 1WUNT 4JEGB 2HT3D 1A3LH 2AW2A 1LO5A 4JREB 4Y89A 5DD3L 3T0EB 5J9PA 2W9LA 5HBBA 4GUPB 4OZIF 1XF3B 3DI2B 3LHPL 4NWTH 3DGGB 4PP2B 4P5KA 5IB2A 1KLUB 5KSBA 5AZ2H 3O9WA 4N68A 1DN2A 4PJ8A 4N0YL 3G5VA 4IMKC 4NRXB 3RWDA 5KANI 4X7SH 3KPQA 3LKOA 1QACA 2BNQA 4GG8B 1WV7T 1PG7L 2P24A 4YBLC 4HWBA 1AR2A 2ZSWA 3LKSA 1DR9A 3VXUA 1NGZB 5D71H 4XH2A 3VFPA 3C9NA 3OR6A 1EBPA 2GUOA 4L4TB 1P7QB 5D6DA 1N26A 4MJIB 4Y4KB 5JDSB 4F2MA 5CJOL 5F9AC 4HIHB 2X10A 4B5EA 2FH8A 4LVNC 3J7HA 2B4CL 4LKCB 4P2RD 4MDJB 4JFPB 2NY3D 2Q1EA 3C2AH 3GB7B 4KAQH 1BZQK 3C8DA 1KGCE 5C9KA 3UBXB 1JWMB 4OI7A 4NKQB 4LCWB 2ATPB 2JB6B 5KN5B 1H5BB 1FSKB 3O4OB 1S9YB 1PVHA 2HWZL 4XCNA 4YHKH 3HE7D 3L5JA 5ALBH 4JFZH 4CDHA 4NNYB 1E4XH 3MLRH 2IFGA 4EI5A 1CE1L 2OJZH 3QIBA 5ID1A 2VITA 5DC4B 5I18H 1P4BL 2G60H 3GSQB 3RVWC 5BZWB 5IMMA 3KHQA 4N90D 1ZGLP 4I0PC 4S1RL 4LNRA 3U82B 5IHBA 3KXFE 4X9IA 8FABB 4Z7VB 1KTDA 4K2UL 4Y1AD 3TH3T 5MENE 5J0BA 2RHEA 4WI3A 3IDYB 4TUOB 3KNBB 2YN3A 3NZ8B 2VZ3A 2CKNA 4EI6B 1BQLH 1T22A 5IJKC 1TVDA 3ZHKA 4KU1A 1RSFA 4U1NB 4ZAKB 2XQBL 4YHYC 4ZO8A 4YUEH 4O2CB 5KVDH 4RMQA 3GSWA 1QFWH 3HCVA 4WWKC 1NGXA 2QLVB 2N4IA 3X14B 1U91B 1ZXQA 1JPFB 5CS7A 1YPZE 4PJCA 3QEGH 2AXFA 4GRWE 1IC4L 1VFOA 1Q9LA 4OUOA 1B0GA 3LSOB 4POYA 3NFPA 5DMYA 5HI3D 4H88H 1RZGA 3VFOA 2LQRA 5L2KD 4PJCB 4UIKH 3F58H 4OB5L 3S3PA 1DQMH 4G43B 3E6HA 3QWRA 12E8H 4WUKL 4XXDB 4Z7UE 3QEQD 1B4JL 3EFFA 4X6FA 2EH8L 2YZ8A 3OSKA 1A7NL 3PGCB 4G6JL 3OKOB 4LCIH 3QEHA 5C0IB 1T1YA 1W0WA 3MOBH 3VI4E 5T3ZL 1A9EB 1B4RA 3DSFL 2ICWI 2GJ6D 3O2VL 4NQVA 2D7OA 2APXA 3JUYA 4KJQD 1VGEL 3ULVC 1NDGB 4O58L 4EKXA 2E8YA 1S7XB 3B2UD 3GJEA 4XNQB 3ARBC 3IS1X 4LIQH 4W81A 3OKMB 4U1GC 1DQML 2IPTH 5D2NC 3F58L 4OB5H 3DUUA 4YIQB 3HI6L 1H0DB 5IB3B 2VXQL 4S1SL 3BUTA 4NM4L 4QHLA 4P2RE 5EZOL 3MJ9L 5HDLA 5HYSG 4ZXBD 4YH6A 1QSVA 2FD6L 3V8CA 1AY1H 4FQHB 1MWAH 3G9AB 2I07A 3RVTD 3B9KA 4K8RD 4QHMA 1F4HA 2Q8BH 1EO5A 3RGVC 2XZAL 4QF1B 1TQCC 2FX9H 1W72H 1NSNL 1JHKH 2HJFB 4BK4A 5A3ID 5DEZA 3RWJA 4R8WH 4P2OD 1MAKA 2X4QA 4O58H 4ZFGL 2NCMA 1INQB 4NN7B 1DBAH 2C26A 2OTUA 3RWJB 1S7SA 4FHBD 1UB5A 2BOBA 4JFYB 5LGHH 3B5GA 4HUKB 4DKEL 2HFFA 4N90E 1DZBA 1FFOA 3CSYB 4PJXE 1MIEH 5EZLB 3UTSE 5CGMA 3NPSC 4PIRF 5KOMC 5D72L 4UT6H 2AJXL 1MRDL 3U30B 4AK1A 1NC2B 3BP5A 4RGOL 1FP5A 1O0VA 5JIPA 1T7ZA 2CXKA 1Y18B 4L8SA 5E8EB 1QSEA 3LCYA 4G6ML 3GUTB 3RVUD 2IQAB 5C0AD 5MERA 4GXUM 1MHPH 2OTWA 2R15A 3BP5B 4UB0H 2LFGA 5GGRB 1ODAA 2VXUL 3OKKA 2ADFL 3WE6A 1VFBB 4L4VD 3WN5A 3VH8B 2DQUH 2C3WA 2D31A 5B38G 4ZOBA 5C3TA 1A1NB 1BBJA 1FFQA 5CINH 5F71A 4OSUL 4YXHL 1ZHNB 5LBSL 3SDAC 2P7TB 4XP6L 4NQCA 5JOPD 3VXRA 2BVOA 5EC1B 5JXAL 5D2LF 2GITA 4YPGB 5DJ6B 2AXGA 3KPSB 5CKGA 1TTGA 4OCRH 1KBGL 1VESA 1ZV5A 2XA8H 4PJEA 4FXKB 3E1F1 4NQTA 5FKPB 2YD4A 5C0GA 1KB5L 2NXZC 4ZS7L 2BNQD 4HQQH 5C8JA 1U58A 5L6YH 3VCLB 4OF5A 4JO1H 3MLSH 1QSED 5FKPA 4Y5YA 5HVFB 1NCAL 3O9WD 1MFNA 3RVWD 1KIRB 4J3OC 3T0XA 3TPKA 4TOYH 5LCVH 3D3VE 3CFCL 2E27L 2I5YH 5EG6C 5GS0C 1BOGB 4TTDC 3B2VL 2VKXA 4Z8FH 1YEIH 5I8KL 4PJHF 4U1JB 1L0QA 3KXFD 4X0KB 5JPNA 3WLWC 3RDTD 2ARJB 3I50L 1Q94B 4MJ6B 2CKBB 1HNFA 1AP2A 2QADB 1F90L 2FYYB 3CVIL 2DQEH 5JPNB 4NRXA 3UAJD 3ZT6A 1W2KT 3SKOA 3LKOB 5DFVD 5E8DL 4XBGB 4WHTA 3SKNA 3KPOA 1AGDB 2J6EA 4R2GD 4WWKA 4OGXH 3VXNA 2IWGA 3B4NA 4X6EA 2J5LC 2A0LD 1OGAD 3BEVA 1SYSB 1J8HA 3K2MC 2RQ8A 1TMCB 2Q7YB 5IJKA 4I18C 5HI5C 5IMLA 3CSGA 3WXVL 2QADC 1R0AH 2DWEA 2GSIB 5E94B 4Y19B 4GRMB 3U6RB 2CRIA 3DRQA 1SYSA 3R0MA 3HE6B 5I1JH 1BWMA 2XN9D 4KRNA 4L9DA 4KJPC 3GB7A 1JPGB 4J6RL 3AROA 1GGBH 1I3RB 4QXGH 4GW1B 1MAJA 1BFTA 1K8DA 3NACL 2XWJB 2V5SA 4MXWH 4F15B 5BO1L 3U0WL 4IRZL 2EYTA 3PWNB 2BP3A 2ATPA 5K33A 3T0BA 1BFVL 5EBLB 1OARH 3CAFA 5DRNB 1KCRL 3S35H 1AFVH 3ZL4L 4DN3L 4LBEB 3L95A 5SWSB 1MI5B 4KMTH 1A9EA 1NCUA 1QRNA 4YR6B 5D1ZC 5B39G 3STLA 2VDKL 4IRJB 2ZCHL 4Q9BA 5C0EB 2R2HB 4TVPH 3D2UB 4X4YA 1PYWB 4WFGE 1FPTL 1BEYH 2PTVA 4G6FB 5GJTH 3T09A 4AT6A 1RU9H 5GHWH 5HHXL 3OGCB 1D5IH 2D7TL 1IRAY 1D6VH 2VLRB 5EZIL 3QNZB 1GL4B 4XBEH 4MA3B 8FABA 3R8BB 3B9KD 3DRTA 5C08D 1UENA 1AGCA 2ATKA 4WHYG 1SYVA 5HGAB 5HY9A 2AI0H 3OBAA 3BD5A 2OK0L 3PUCA 1KLGA 5GS2H 4UBDD 1G84A 3JTTB 4XNZB 2PETA 4NO5A 4PREB 2FATH 1SJHA 3WNOA 1SEQL 2DL2A 4X9FA 5DUPL 2AERT 5DVNA 4MWFA 4QRSB 4D0BA 3LN5B 1U91A 3P4NB 4KJWD 4ZUVA 5BW7C 1F97A 1N3NB 1OF2A 4JM4L 4U6HA 1RMFL 4PJ8C 4KQ3L 5FB8A 1T7VA 2X9WA 4XP4L 2Y06H 4ZUVB 5SX5H 1BD2D 2AJVH 4ORZC 4GKNB 4RGND 1QPPA 1HXMA 1XF4A 1NBVH 5DEGB 3QI9B 5EU6D 1G9EA 1Q8MA 4FZ8H 1YUHA 2WUBH 2M8XA 4OCWH 4JLRA 1S7TB 2EIZA 3RGVB 4UILH 5ALCH 4FQ2H 3DVGB 3B9DA 3IJYA 4F9LA 1I7RA 3KGRA 4TSBL 3FQTA 1I9RH 4ZD3H 1MAMH 2XACC 1MUJB 1I9RL 2BSED 3TH2T 4L5FL 5DURB 1AGEA 2DQIL 3DVGA 4XPHH 2ZWLT 2DQIH 3UC0L 1P7QD 3VXRB 1F3RB 4XGZB 5H37H 4EUPB 1J1OL 2DQGH 3VRLF 2UWEE 4WU7B 3RVVD 5I66A 4ESKA 1C08A 4NO2A 4XGZA 4UAOC 1U8KB 4JPWL 4ORGB 3L5WB 3I2CL 2X4SA 3LKQA 4H20H 3JV5A 5IT2L 3L5XH 5E2WH 3NCFB 3BMVA 3N1QC 1IFHL 2HJKA 1DUYB 4BQ9A 2X70A 3QEUA 2V7HA 1W8OA 4G8IB 5IESH 3U46B 2DQDH 2GFBB 1MHEA 3QG6B 1FNEB 2J8UE 4WTZA 1SEQH 2FHFA 5DUPH 3TCXA 2KDGA 4OQTA 1T1ZA 5BV7B 2ZCKL 3RDTC 5HVHB 3O3BA 4PGJA 3QDHA 5D1XD 3VE0A 4M7JL 3P0VH 1UB5B 4Z7WE 1NLBL 3SDCC 3V5HA 4PP2A 4IDLA 4LLYA 1HE7A 2NY2D 1EERB 4R2GC 2RCSL 4A2MA 2P8LB 3D85B 4WWKB 3VXNB 3KHOA 2OX5A 3GI9L 2VDNL 2Z0BA 4HMDA 2OQJB 4O5LL 4BFGA 1I4FB 5CEYB 5T1LD 3RWCA 4Z95L 4JFED 3QQNA 5GGSA 3HZYB 5C0BB 1KACB 5E24E 5TQ2H 1F13A 1CF8H 4JZOA 3HE6A 4KMTL 4WHYH 3BKCL 1U42A 3VI3E 3GIZH 2V5RA 3L7FB 4XMPH 1EIBA 1KCRH 5IF0A 4AZ8A 1K5NB 2AXHA 2RIKA 4R4ND 3S36X 1K4CB 2I9LB 4GOSA 43CAB 3ZKSD 2OZ4H 4UT9H 1Y0LA 3TO4B 3VW3L 4OLWH 3ULVF 2DLEA 1ETZA 4UIKL 1GZPA 1BMGA 2PW2B 3LKNB 4B7LA 4MS8D 3VXTA 3RWHB 4X9HA 1LEGA 4KK6C 2VOTA 1L7IH 1WICA 3EDFA 3LD8B 3RIFF 4E42B 5E5MB 3R0NA 4ZAKD 5C0EA 4TNVF 2VDPL 5AAMA 2OR9H 4HS3B 2XG4A 3WYRA 4YX2L 4WVRA 4B53A 2WBJC 5GS3A 1B9ZA 1WSST 4RISL 1U2HA 4MQSB 5SX5K 3U7AA 2VLJD 1S5HB 4HK3N 4CMHB 2R56L 2JELH 3SHSA 4LEOA 1MWAA 1U8JA 4BSVA 1QOKA 1NC4D 3WNMA 4C56B 3QQ9D 1RJLA 5JW4Q 4I18B 2D2OA 1BX2A 1U8LA 2ICES 5HGAA 4JHZA 1JGUH 1G6RA 5D6CB 5E08H 4JCLA 4E41B 5C0ND 1U8OB 1WBYB 4M6ML 1IKFH 1NLDL 1BEYL 3KYKL 3UTQB 5F7YC 1NFDA 4X7EC 2QR0A 2JIXA 3GI8L 5CFHA 3SO3C 2D4DA 4ZDHB 4XP9H 1M71A 1QPXA 4DGVH 1CE1H 4JFHD 5C07B 1A6VH 3HE6C 2ED8A 4LLQB 1LO3L 2XA3A 4MXWL 2P48B 4S1QH 5HYJB 3FHAA 5CP3H 5D7IB 4GW4A 1IGIH 3ARVA 4IS6A 4G42B 3EAKA 4P3CH 4Z6AT 5FGBA 3OR7A 5D7IA 4PJDF 2BVTA 2Y9RT 3WHXB 1JGLH 4N8CL 6CGTA 4X7CC 3BPNC 3FN0H 3I9GL 4RIRB 1UFUA 4QRPA 1JGVH 3EYVB 2V17H 1MFDL 2AJUH 4F33A 4PYHA 1OAKL 3K8KA 1CTNA 1W0VA 4M4PA 2FJHB 2PO6A 3WDJA 1QRNB 4YR6A 4QXUL 4BELD 4TULL 4CVUA 2DJ4A 3K4AA 2PYED 4FFVD 1OCWL 4RAUA 4MMZC 5J8OA 4EQ3A 1BLNB 3SY0B 2R0KL 4KI5F 3Q6GH 1IGIL 1DJSA 4RGOH 1YDPB 2J6EH 2NY1B 4M62L 1FLTX 2VLMD 3F62A 1BLNA 4HXBH 4PRIE 1ZHKB 4M02A 3ULUE 4LQ1A 1IQWH 2GT9B 3LKPA 2ZKHH 1AGBA 4OLYL 1MRDH 5CJ5A 3HRPA 4TOYL 1MOEA 2PW1A 3LS5L 3T2QA 3U30C 2G75A 1MHCB 4FMFA 5ILTL 3KPMB 5C09A 4J3XA 3MV9D 4LASH 2XKSA 2P5WD 1WWWX 2P4AB 5F96H 4JPIB 5EBWB 1ORQA 3BYTA 4PUBL 3HPJB 4NCC2 1YNLL 2QSCL 2NY6C 2AK4E 2LAAA 3LEVL 1QFOA 2I60H 2CJUL 5F93C 1TJGH 3F6LA 2DLFH 1QLFA 4HKXB 2N56A 3ET9F 5CEXA 1V3KA 3MRIB 5D1XA 4ZYKA 1CFSA 2YPVH 3Q5YA 1MEXL 5INCA 4WI2A 2R1XB 1NGYA 2OQJA 3B5TA 3VWKB 5CEYA 4L8BA 3RL1B 4XCEA 5SX4H 3CMGA 4G6MH 2CPCA 1ND0B 3KPNB 1PG7W 1QBLL 3EYFB 5BW7A 1UXSB 4R90H 5FF6A 3MACL 3JV6B 1E6JL 5D72H 4RZCB 3U36A 2BY2A 1J10A 5GGVY 4NZDA 2DB8A 4EUPA 4NHCL 3ILPB 2CLVB 1TVBA 4XVTL 1NBYB 4IRSD 5C0CA 5EUKA 1QTYT 4NO3B 1JHLL 5DEFB 5D7SH 1A7PL 2NNAB 2YC1B 1Q9KA 5HYQB 1GZPB 2PW2A 1YPZF 2EH8H 1JRHL 4XPBL 4OCMC 3ABZA 5C0DA 5SWQA 4HWEL 1AQDA 4NC1E 4U3HA 4EN3C 3GI9H 2BJML 1NMCB 1G9MC 5ABDE 3D69B 2V7HB 5IUSA 4KKCC 1YNKL 4U33A 4ZSOB 5HHPA 2XZQH 4FQXA 1PX3A 4W4OA 1AXSB 5L2KE 1NCWL 4GKZB 5BMFH 1IM9B 3GJFA 1BQHB 1IQDA 1NLBH 3RP1A 3NFNB 3MTRA 1Q0YH 4WI6A 5FUZL 2BRRL 4NFCA 2XXMB 5JNYB 4I8DA 4U1IB 2DWDB 4ZNEE 1IAII 1UM5H 3REVB 1A3QA 4ISVA 4JHAH 4NQSB 4PJAB 3P77B 5LGJB 1WBYA 3WXWL 4OZFH 2UWEA 1HSAB 3S8WA 4OCSH 4FQIH 3ZTJH 5HVWA 5FM5O 2CIKA 2WWMD 4R3SA 2A73B 2FJFA 4YDVA 5MI0B 2NYYC 3E8UH 5KVEH 4FTVB 3DSFH 2DQCH 5D2LA 3ZO0A 5L0QB 2ESVB 1E28A 2W9DL 3Q5OA 3TWCH 3QXAB 4NZRH 4JVPA 4X5WB 4OFKA 1I1FB 1KG0B 5EC2B 4TVPD 2YRZA 4UQ2A 3IDNB 4LLQA 3G08B 3QIBC 5AZEL 1MLBA 3BGMA 4Y7MA 5FO7A 5F9JB 4X5WA 1RHHB 4M62H 4JZOB 3VMPA 2EC8A 1D9KA 1E4KA 3JV0A 4M43L 1LP9E 4DVRH 3L9RA 4I9WD 3W5NA 4HZLA 2APFA 1YJDC 4JM2A 4JRXE 1F4XL 3SGJA 1OCWH 4MAYD 2P8PB 3ARBD 5ALBL 5HHOE 1ZA3A 4DTGH 2YUWA 1JZ7A 4V2CB 4RBPK 1WZMA 2Q3ZA 3OG6B 1YEFL 4CUCA 2V7NA 3S88H 1IZKA 4TSBH 4ZD3L 5DLML 3IDXH 3P4OB 3VG0H 1FRGH 4OCXL 3HC3H 1LP9B 4K9EH 2K3TA 4FQPA 4FFVC 1N64H 4M4RA 3E6FA 5CJXC 1LEKA 4X4XB 5C0RH 3U83A 4KHTH 2J8OA 4N0FB 4AQ1B 4J7RA 2NLJB 5IW6B 3JZ7A 4APQB 4OAWB 3QNYB 3E6FB 3CX5J 1T4KA 3PWVB 3SGKC 1XCTB 4WEUD 3V0VB 5EU4B 4RFNB 1MCKA 2RR3A 4AEHL 3QNZA 1T20B 3EYOB 1P4BH 1JWUB 2PNDA 5DHVB 4EIGB 3C08L 2X41A 3SO5A 2DM4A 1MHCA 1M7DA 1R3JB 2B5IC 1S7VB 5AUMB 5C09B 3EYOA 1NBZB 1JZ5A 3H0TA 4P2QD 1I1YA 3QFDA 4LSSH 2DD8H 2F53B 3T0WA 1IKFL 1PAMA 4KVCH 4WWKD 5ERWA 2ICWJ 3GIVA 1E4XI 1BVKA 3I75A 3O6LL 2ZPKH 4D0BB 2M1KA 5I9QB 1C1EH 1CXIA 4P23C 5GGTA 4NO0A 2PR4H 1EFXA 4GAYB 1IKNC 1WWBX 3FRPG 3CLFH 5D1XB 1FG2B 5DT1H 5DJ2B 4A6YH 1KN2L 3S34H 5GJTL 3ZDYF 1CVRA 1GVIA 1YA5A 4Z7QE 3HNVL 1ACZA 5JOEA 1XF4B 2ITCA 4N0CC 3IJSA 4L3EB 3VXMA 4Y4HB 1X5KA 1Z3GL 3EZ8A 3QUZB 4TYUA 4C83A 3QHTC 1KN4L 3DTXB 4KJQC 1WT5C 2EDTA 3WJJA 2B5IB 5DUBB 3O9WC 2WWKO 3FFCE 4ZMAT 1I1AA 4LRNH 4N8VB 4Q6IC 4KFZC 5EO1B 2HN7A 3S34L 4FQQA 4NUJA 5DJCB 5DMJB 5DQDL 3MNZB 1UH4A 5GS1C 4K94C 3IAPA 4WY7H 5AEAA 4K9EL 4TN9A 3WIIL 3HC3L 4JJ5A 4DK6A 2DS4A 2A6KA 2XY1A 2VL4A 1A3LL 3BGAA 1T21A 4NUGL 4NQEB 2X4SB 3QO0B 1I1RA 2B39A 2HVKB 5GRJH 4OIBA 3LS4H 3NH7L 4LARH 3SGDI 3SDXB 4MD0A 4XNUL 4G8IA 3KWWB 5T5FL 2VE6B 5A1AA 5CBAB 2WIIA 3MO1A 3QUML 1MCWM 4FRWA 4KVCL 1FZMA 3ZTJG 3C87A 2YPLE 4HIHA 3DO7A 5EIIA 2X1OA 3O2WH 5LQBH 1FORH 5AZEH 1REIA 4GS7B 4Y2DD 1LK3L 4QOKE 1LE5A 5IEKA 1XGQA 1U9KA 3DO7B 5TFSL 2P1YA 2CIKB 1OSZB 4D9QE 2YPKB 2C4XA 4YEEA 2DKMA 4BFIB 4P57B 1BQSA 3MRGB 5E9DE 1IAOA 3E8UL 2H9GB 5DZLA 3MA7B 3H42H 3L5XL 4L8BB 4PGEB 5TDNA 1JPST 2HVJA 5IOPA 3A0OA 3IETB 2BDNH 5GJSH 3MREA 3CXDH 5AWNL 5CD3B 2VLKE 3BMWA 4U1LA 4XP5L 5L0QC 3ARYA 4D8PA 3JVGA 1FGVL 3U36B 5JXAH 5F3BB 4OCYL 1EDQA 1DE4A 1J1OH 4QRTA 3RWEB 3KYOB 2AJSH 1K8IB 4MA7L 4OSUH 4YXHH 3SDAD 5HYIA 1N8ZA 1YY8B 4BZ1H 3EDKA 4V1DA 1EGJA 4RMSA 4K3DL 4ODHH 4ZO7A 4H1LG 2YD8A 2Q87A 5FYLH 4I2XE 3WKNA 4P4RB 4GMSH 3RIAK 2VSCA 5T1KA 4LVHC 2GJ6A 5GGVL 3DX7A 1RUMH 3HMXL 5B8CA 3GSWB 2AJXH 1LWRA 2IAMC 2NX5B 4QOKA 4U31A 4N0FA 3BH9A 2AV7B 3IAGC 4JB9L 5E5MA 3IJHA 3CFKB 4HBCH 2AJVL 3JWNC 3W11D 4NNXA 4PJCF 4OTXH 5DHYA 4JY6A 2YD9A 5EUOE 2A6DB 3INUH 2OBGA 1UM6L 2VQ1B 1GC1L 4HUXB 3MACH 4WV1C 4KJWC 3TT1H 4LSQH 3DOSA 2W1NA 1JVKA 1WZ1L 5CD5D 3V6OA 1NCNA 4YHPB 2CR3A 1AI1L 4Y4FA 2UWEB 2VDLL 4QRUA 3OJ2C 3IDMB 4RGNC 4QNPE 5FECA 3QB7C 4OZHB 3GSNH 5EUOF 3PP4L 5DFVC 4KUZH 4X99A 3BAEH 3H0TB 3FO0H 1MEXH 3L3KB 4RDQF 1CICB 4X9GA 5B8CC 5BMFL 5D96C 1EEQA 3NA9L 5IQ9B 5E8PA 1TETH 1QO3A 2CUHA 3X12B 2DQTH 3G5ZA 3O6FA 2Z31B 4ZDHA 3G6DL 5CJQL 2GK0A 3JTSB 3LQZA 3BGMB 4S1SH 4M48L 2NY7L 5L2JB 1NMBL 4U6YA 3B6SA 4TRPL 4H5SA 4JO2H 4ALAH 2V2TA 3JUZA 1F5WA 4DW2H 1P84J 3MLZH 3WNPA 1YNTA 2EXYC 3PV6B 4K7PY 5ESQB 2CLRA 3OKLA 4IMKA 5CILL 5T3ZH 1RZ8B 3TBWA 2MCG1 5C0JA 2VWEE 4YE4H 4G6JH 5ESQA 3JBG7 1L0XA 3I02B 5FXCH 1A8JH 4YQXL 2AEPH 2WZPD 3F6IA 25C8H 4IRZH 3HFML 4XBPB 1QR4A 2FJHA 2HA1A 2CH8A 4IOIB 4UV4L 5M95B 4P5MA 3CZJA 4W4NA 1FLRL 4WUUD 4AJ0A 2NLJA 4HGWB 4NC2B 4JN1L 1IKNA 4P2OB 3L3OB 2HTKC 4UOW0 5I1JL 5F7MC 1XGYH 2WWKT 5MEND 2NY1C 1ITCA 5EA0H 2HAZA 4P49A 3BQUA 4UV7L 4BJLA 3KLAA 4ZFFA 1R3KB 4G3YH 2HLAB 1DQDH 1KC5L 2GT9A 4XC1H 5CP3A 3FN0L 2NY2C 1ZHLB 3BQUB 4AG4H 3KPRD 3BW9B 1XR9B 1DFBH 4I13B 1C5BH 5H94B 1FIEA 4JFXB 4Y5XB 5JIHA 4HX1A 4CADB 1RZKH 2HFGH 3M1BA 1W72B 5KSAB 3MO1B 1J9CT 5T1DH 1EHNA 3SE4C 3I50H 4OLXL 4OLYH 4I3RH 4K2UH 4L9LB 1Z5LB 5EBMA 3V4UL 1UWXH 1FHGA 1LDPH 1SQ2N 3KG5A 4JDVA 2A83A 3U4BH 2XQYG 5HPMA 4E0RA 3MV8D 5KVFH 1FYHB 3BRFA 4KTEL 3HUJA 4PJ9A 2BOCA 4NM8L 3OB0H 5JHDE 2CSPA 3BZDA 3GI8H 2VO5A 3FFCA 4PJFF 1I8KA 15C8H 1MRCH 1NUDA 2CO7B 4HWUA 4NPYA 5FUCC 1NGYB 4U1LB 1EA9C 1FVCB 5H37G 5D7JD 4LLDA 5E8NA 2JJTA 5JMRA 1IM9D 3DTXA 3HZKA 1KELL 5IFHH 4JFQA 4YBHA 3QA3B 5IMKA 5E99L 2R1WB 3S37H 4G9FB 4FP8L 3WFBL 1CE6B 4Q0XL 1KJ2A 1PKQA 4XC3L 1FBIL 3I9GH 2D7QA 1QBBA 1XF3A 4XPTH 4LSUH 3LQAL 5K9OB 3EYUH 1HQRA 4M5YL 3DX7B 4JN1H 2RBLA 1T21B 1X5HA 4FTVD 4XNXH 3VW3H 3QCTH 3VFSA 5KS9F 4N0UA 5CWSB 1PQZB 4PJDE 1ED3A 3FQNA 3HZVA 1FAIH 4KDTA 5ITBH 1YEGL 2W92A 4DUVA 2E6JA 3VFPB 3OR6B 3EBAA 3TO4C 5I1CH 4OLXH 3RUGB 1RZJL 5INDB 4K23H 1QFUH 3MROA 4RWYH 1JI2A 5EIVA 4F2MB 3IU3B 4PRPA 4NDMB 4LPUA 4PPTA 1R5IB 5JLZB 3H7LA 2LU3A 2DL9A 2VDOL 3MLPA 2YK1H 1OP5H 1QR1B 4PB0H 2GSGA 3UBXA 1T3FB 1B6UA 1U3HC 4HKJB 1EEYB 4D0DB 4WI4A 1ZT1A 2YMXL 2EH7L 4JKPL 3HR5B 1J1XL 2MTPA 1UA6L 5B21A 2VLME 4EDWL 1I1FA 5B22A 3BIAX 4HXAH 2FJGA 1AC0A 1V7MH 4Y4FC 4D3CH 1CWVA 4UT9L 5CIPB 2APVA 4G6FD 4MB5A 3EO1A 2EKSA 4HT1L 1BGXL 1P6AB 5CSGA 3M17A 4YFDB 5F1OB 2GTWA 1C5CL 5BQ7B 3CIQA 4HG4J 4OF3A 1WBXB 3QJHA 3MJ7A 5I8OL 5BV7C 5T5NF 1IGYA 4Y16D 2AK4D 4OTXL 1FH5H 5EOCJ 1IM3A 3OHXA 2QQKH 4CNIB 2KQMA 3TBVA 2XNAB 1FNLA 1U41A 1F6AA 3MJ9A 1AQKL 1YYMH 3MMEA 1M7IA 4DZBB 1UACH 4JGJA 1LP9A 3QWRD 1T0MB 1L4IA 2WBJD 1G9ML 3AU1B 3EYSH 3BZFB 4Z5RA 2DMCA 1NJ9A 4PJIA 3TIEB 3B5HA 3O3UN 4LPWA 1S9VA 3V4VH 3G6DH 5CJQH 4M8QB 5IW6A 3N1MC 2OJEA 2FCBA 3BZFA 2F5AL 2FWOA 4OLVH 4XRCA 2J8UF 1R3KA 5IIEB 5HVHC 1D5BB 3B3IB 5I1LB 4JG0H 4Z7UA 5H2BB 5DEGA 3SDAA 3TM6A 3ALPA 1XT5A 4Y8DC 4ETQA 3JXAA 1MH5B 2VSDA 3MLTA 3L3KA 5E6ID 4JFDA 1T7WA 4JE4B 1GGYA 3MJ8B 1IFHH 2APWA 1OW0A 4WUUA 1YNLH 2EDRA 5DMGD 1UB6A 4AL8H 1AGEB 3ZKMD 2I9TB 5F96L 1KPVB 1VFUA 3VMOA 3VRIA 3ZHDA 4HBCL 3RPIA 5I75B 4R7DB 1G7LB 5E2TL 3LEYL 4JR9H 1RQ5A 4OZHF 4EI5D 3NAAH 1AE6L 2E7LC 5I1HL 2ZZUT 5LWYL 3TBYB 1N4XL 5I15H 4GFTB 1BWWA 4ELKA 2XFXB 4MD5A 4IMLA 2AABL 4ZUSB 3O6ML 4X98B 5E6ZA 3S98A 1DUYA 2P5EB 2X70B 3QEUB 3FQRB 1P7KB 4MD4A 3D85D 3DETD 3HZKB 3RZCC 3VXMB 4TNWF 5F70A 2IMNA 4L5FH 3BHBA 1FNEA 4P5MB 3QI9C 2J4WL 4IJ3B 4X6DE 4LHUB 1QFHA 1FVEA 3FQUA 3IDIB 1VFMA 5T1LB 3OB0K 1OP9A 4LLVA 3GSXB 5FUCE 4KTYA 4TVPL 4QTIH 4O4YH 1RZFL 5TE7L 4PJ8B 1BVLA 2QQNH 4CVZB 3KLAB 4AIXA 1QFWI 1MCRA 4L3AA 4YNYA 4N0UB 2ZOLB 3UJTH 1N5AB 2IJ0C 1Z9LA 4JY4B 4POZC 4IJ3C 2A1WH 5KJRH 3C6LD 1OB1A 1D7FA 2PTTB 3FOLB 3ZDZF 3I3DA 5LVEA 1X5IA 1GGBL 3FO1B 1LO3H 3O2DL 4OFPA 4RWHA 1KEMH 3UJIH 4C55A 1JYXA 1FFNB 2A6JA 1FZKB 1HHIA 1TENA 4I2XB 5JQ6H 2OI9C 1QQDB 3QIBD 3QUMH 2LTQB 5INDA 2AJYL 1R0AL 3LHPH 4NWTL 1K5NA 2XY2A 4GKSB 1CLCA 5CLTA 4PLOB 2CDGA 5CEZL 4OZGE 1R5IA 3WHE1 4EUPG 2D31B 1NLDH 1NAMB 4I3RL 1FQ9C 3DECA 5MHSD 2CLZA 3BN9C 4P46D 1TJIL 5E08L 2VXTL 3BE1H 4PB9L 5TGBB 1T3FA 1FNSL 3T2OA 2DQEL 1YY9D 1MRFL 3MUGB 3I6KB 5A2FA 3CMOL 1QUNA 4KPHH 4Q2ZA 3IVKB 3IDGA 4MCYA 4X7TA 5I30L 2P5WA 4RDQG 5HHME 5DRWA 4LCYB 4OFDA 5BZWA 2DQFB 4P5TA 3RVVC 4GAGL 4HV8A 2P5WB 2W0KA 4YHLL 5L7XL 2UY7A 3SGKA 3KNBA 4ELMB 3EYUL 3MRJA 4MQ7B 4RMRA 1J5OL 3VFMA 1CXLA 5I17A 2OR8A 3GMRA 5L6YL 3SKJH 2W60A 2Z4QA 5GXBB 2O93L 3HFMH 5F72S 32C2B 1Q94A 4Q0XH 4OJFL 2J5LB 4HIIB 4MSWB 3ZT7A 1JF6A 3UTZA 5KBNC 1FZOB 4JN2B 4HWBH 1WTLA 2A74A 4JGUA 2YBRB 4ONFH 2PN5A 5E5RB 4HFWA 4CVXA 5IROA 2MQ3A 5CINL 4RMTA 4GXVL 3BH9B 4HG4K 1PZUB 2DBLL 2W9EH 4K7FB 1HIML 1BP3B 4RMWA 3SN6N 2VQ1A 5I6XC 3QDMA 1NGPL 4NDMA 1HH6A 5T3ZD 4HIEA 4YXLH 1Q9LB 3B2VH 5I1EH 2NYYD 3QEQB 2BNQE 1QG3A 5GGTL 2HH0H 4OD1H 3NOIA 4PV8A 1HZHH 5T33H 4MLIA 1NCAH 5TDPB 4XCYA 2D7MA 4AEHH 5E0QA 3HR5A 2ADIB 1DL7L 3V79C 3NAAL 5LGHL 1H15A 3D87B 3MRDB 1VADA 5HPOA 3U7YL 2D03H 1I8IB 2DQDL 1WBZB 3SY0A 5IESL 3BRDA 4ENEC 1RVFL 3DARA 3VGFA 2VZTA 3EJYD 1OTUC 3PWLB 1CGWA 1JF1B 1VADB 1ZA6B 1CGUA 5ADOH 4BH8B 4RBPH 1SBSH 3GSNB 4QEGA 5T3XH 4IMLB 3K81A 3BIKB 4AM0A 1IGYB 3DETC 4HJ0D 2QV2A 4W4OC 4BA8A 4FMKA 1AIFB 2H6PB 3O81A 5FYJE 3U0TB 1M1SA 4UDUB 4EBQL 5KSBE 3AU1A 2BJMH 4UT6L 1I8MB 1G0YR 1SMAA 5JW4M 3VFWB 3CDGA 1DBJL 3DVIA 4HWEH 3V6ZA 3IFPB 1S9VB 4JRYB 5HXMA 1XF2A 4PY7A 5D2NB 4B0MM 4G7YH 3V6BR 1FCGA 3WBDA 3HNTL 4N8PA 5J89A 4P5TD 5FUOH 4ETQB 5AWNH 1XIWD 4YGVB 3DROA 3VXSD 5J6HA 1HI6A 4DW2L 2J88H 3VWKA 3HE6D 1P2CB 3RTQC 4JM4H 5E7BA 2VC2L 1RUAL 1ZWIA 3GMLB 1FNAA 3MGOB 5IFJB 2FR4A 1CBVH 4HULB 3HTLX 4LOUC 3EYFA 1X5GA 1KTKE 1LE9B 1LNUB 3W82A 4HK3J 5ENWA 3RGVA 1I7TA 1Q0YL 3GMLA 4Y19E 1FO0A 2DQTL 4GRLA 3CVHL 3GUTA 4JDZB 4GO6B 2MHAA 3VFTB 3WCYA 4GXUN 1NBYA 2BC4A 4NT6A 4PG2C 3OKKB 4I5BA 2OK0H 5IMOA 3E2HB 1AD0A 2A83B 2NX5D 3L3GA 1MCEA 3MC0A 3D5OF 4Z7NE 2HRPL 1CFBA 3CH8A 5TQ0H 1ITBB 1MHHB 3KXFB 4XX1E 2BOCB 2HT4C 5MP6L 2ZUUA 4N0CD 4Q2ZB 4CRPA 1U8KA 3MOBL 5HHXH 1IAKA 1D9KD 3L3HA 1UM6H 1BJMA 3P3YA 1PKQE 4LCIL 4HKBB 4PJEB 2HYMA 4S1RH 2HJKB 3P73B 2NR6C 3LAFA 5TF1H 3NIGE 1KPUB 3UTPE 1L0YA 2FLBT 3AM8C 4G5ZL 3OAZK 2XZZA 2VZVA 1KJMA 3DX9A 3GSXA 3SE9H 1EVTC 3ARRA 1IEBA 5I74C 5J11C 1OARL 1B4JH 5DF0A 3RU8H 3GK8L 4PJDA 2QHLA 4JQXA 5CHNB 2FYYA 2NPLX 3OX8A 2F8XC 1KJMB 2QTEA 2IPUK 1IL1A 3I85A 5KOVC 1Z3GH 1ZVSA 1VKXB 1R5WA 4OBRA 4RGNE 2ZOLA 3QXVA 4U1JA 1WISA 1DCLA 1RJZA 4K3JH 5DDHA 2MCPL 4HAGA 4DUXA 1CGTA 1IC4H 3S5LA 2ZSVB 3LKSB 1MFBH 3GGWA 2Z8RA 1C8PA 3O4OC 3NMEA 1FSKC 2YUZA 3O41B 1RHHA 4ODBD 3OB8A 3LEVH 4K7FA 1UQSB 4HHAA 3FAXA 4PJ5E 4YAQB 4FG6D 4L3ED 5DC9B 3CD4A 3D0VA 3MFGB 5IFHL 5BS0B 4PP1D 2E6QA 1TPXB 4ZPTA 5C2BH 1GGIL 5GGRY 3BN3B 4BSWB 2OJZL 1K85A 3WFEH 1NEZG 4X7SL 1TZGL 5IVNA 3OZ9H 5M94B 3G5XB 3QHFL 4YFLI 1C7TA 1FYTA 3ECBA 4MJ5A 1S9XB 5J57B 1ZLVH 2BVYA 3D2UA 5HGDA 4OFYA 1LEKB 4X7TB 1HWGB 4X4XA 1L9NA 5D96B 1HHHB 5T1MA 5F6IB 2KBGA 3ZYZA 1ZA6A 2FEDC 4AEIL 3DMMB 5EU4A 3AAZB 1LK2A 4HF5H 1HIMH 2YA0A 3WN5C 5J1AA 4BSVB 4WTWA 3TNNB 3TNMA 4ODWB 1J12A 5F44A 1HYRC 2F58L 2JJWA 2VLRA 4JDTL 2WBJA 5JOPE 3NGBC 1JGLL 3H9YA 4JDTH 5EU6A 3MRHA 5LAXB 4HUVB 1T66D 1AKJD 3FO2A 5I1AB 4YX2H 3LH2L 4YBLB 3GKZA 1FZOA 4LSRL 4ZAKA 3PGDA 1MCPH 4HF5L 1UT9A 5D93C 3SBWC 3S88L 4YGAB 2FX8H 5C7XL 3FO2B 4U4BA 1IGMH 3L6FB 4XB7A 1IAMA 5FO8A 4NM8H 4HUMB 5C08B 1A6WL 3CUPB 4LQFH 4TSAL 1F2QA 2JF1A 4LSTH 2EDJA 3T0EC 1I85C 2BY3A 4JLRB 1XGTB 5ECJE 5IIEA 1CLYH 4RGMB 4LKXB 4IRJD 1WAAA 3HG1E 4OLUL 3ZDYE 1MPAH 4MNQE 3WKML 1HDMA 3FQTB 5FYKD 3PP3K 1HXMB 5J7CC 2EYSA 3MLZL 1B0WA 4XVUD 5CGYC 1C5BL 3BKJH 2ICEB 3QXUA 4MZ2A 3OG4B 2HKHL 2EEBA 2IANB 5D7JC 2AK1L 1NSNH 1HCVA 1DQDL 1KC5H 4M7KL 2VLRE 4N8VA 3MJ6A 1EO8L 1OD7A 3IJYB 5HHOD 2ICCA 5FIEA 4R6UA 2BRRH 4PJFE 2HT4D 3TN0C 1W0WB 4JJ5B 4HJJL 3O8XD 3TN0B 3SJVB 2XZQL 4KRPC 2DF3A 4KUZL 3MCG1 4KROD 2GFBA 4P99A 4U6VL 3NPSB 3THML 4CW1A 3MLYL 1XGRB 4OLEA 5DD0L 3I6GA 3SDXA 2FZ3B 2X89D 4P9ML 5F7FA 1CBVL 3AMKA 3OL2A 3FT3A 4KHTL 1H9VA 2OMBA 5ACZA 4DKFH 5KW9H 2BFVL 2KQNA 1TTUA 1E4WH 1J7VR 2VLLB 5IFAH 1DLHA 3HN3A 4NKDA 3IDIA 1XGPA 4CN4A 3QPXL 4HC1L 5E8OA 4JZNB 3CCHB 4J3WA 4RA0C 1HXYA 5BXFA 4NQED 3NVQA 2NY4D 4HKXA 2AKRA 5TQ0L 4X80L 5FO9B 1BFOB 5I16B 2VMFA 2YRPA 2IALA 1FNFA 2CGRL 5D7LA 3BKYH 3RJDA 4IM8A 5B3JE 5J4MA 2OTUB 3IETA 3G5VB 1ZWIB 4HUWA 4S0TD 3P4LA 2FR4B 3QBTB 1DVFA 3TA3B 1ZT7B 1P9MC 3NFSH 1PLGH 1N2RB 3VD5A 4QT5A 2ZCKH 5HDQL 1F58H 1FZKA 1K4CA 1ACYL 1WIOA 3GMMA 3JV6A 5DSCB 3F5WA 2B1AH 2GJ6E 4WFHE 4JAMB 5C0AE 4YHML 4B50A 3EYQC 2QSCH 2HTLC 1QLRA 4FQIL 5MERB 4YXKL 5T1KB 1NKOA 2F9BT 1IC7L 1FYTB 4LASL 2F8VA 4MYWB 4R26H 3S35X 5MEQA 3WN5B 1YN6A 4FN0A 2D03L 2VL5B 4Y16C 3LS5H 3Q3GA 4N5EC 1U8NB 3KPRA 1ZHNA 2BSSA 4GAFB 1B0RB 4QGYA 5B38A 5AYQA 2IAMA 4JFFD 3D69A 5AG8A 3R06A 3JWOC 3V5KB 1U8NA 3KPRB 1CYGA 1F02I 4OD1L 1BOGA 5TE6H 1BQHA 4ZXBA 3T2NL 4DN4H 4QY8A 5MENA 2E9WA 5D7LE 3QDGA 1L7TH 2VZSA 3D9AL 4YDLC 3O3EA 2HT2C 4RFNC 1NMAH 2HT3C 3UTQA 3IDMA 3HB3C 5GRYA 4NRZA 1RZJC 5AAWA 1CXFA 1NBVL 3GMRB 5LKNA 2E8ZA 4GQ9H 1JGVL 2EO1A 2R2BB 1QVOB 1G6VK 1HOCA 5CMAB 5IP4A 4PJ9C 3F12B 3RX5A 3UJJH 1MCLA 4EQ2A 5IMLB 2HMIC 3CUPA 2DYPA 3ZYJA 4HUUB 3SEPA 3MRMB 3TJEL 3DRQB 2NTFB 5T3XD 1T5WA 1OGAE 3V2AR 4ZPTB 3NFPB 4EI5C 1FORL 3D39D 3SQBA 4PJHA 4X4MA 4PJ5D 5AZ2L 1W0VB 3B43A 2Q7YA 4K9EC 5C0BD 2AI0L 1XIWB 4GRMA 3U6RA 4MJ5B 3ROLA 2LV4A 2I60L 2GJZA 5SWSA 1KN2H 2VDOH 4XXCA 2JK5B 1CLZH 4XCYB 3A67H 3TCLA 2XKNB 1FN4B 2P42B 5DJYA 2J8UB 1GCFA 3P9WB 4PJXF 2F54E 4Y4FD 3SDYL 5L9DL 3MQIA 4U3CA 4YWGH 2C3VB 4YDLB 3MLWH 3PWLA 3TT3L 4RAUB 1G0DA 3FTGB 3WFZA 5D6DC 5KTEL 1BIIB 4G9FD 2K1MA 4QXWA 1L9MA 4LL9A 5I0DA 4WDIA 4NQXB 3LN9A 2BSRA 1FNHA 4J1UA 5DS8A 1I9JH 1QRND 2YRLA 4NBYB 5GGUB 3FTGA 1XAUA 5LCVL 1BIIA 1I8LC 3MLSL 3UTOA 2I07B 3HE7A 1DVFD 4F7EA 4QLRA 1V05A 5D5MF 5HYJE 1OPGH 3HG1A 1SM3L 2KPNA 1KGCD 5L88H 3C5ZC 4I3GA 4N8VG 5ERWB 5FO8B 2HJFA 3QUYC 3NTCH 4ZNCD 2XN9A 1G7MB 2R1YA 1MCOH 4F7EB 4ZFOL 3JTTA 4KKBD 1HHGB 3QUMA 4RFEA 1ADQA 1M7XA 4QRRE 4L3EE 4XWGH 3RFZC 3SCMA 2G5BA 5EOQL 5TF0A 3HUJB 3ARUA 2M2DA 1XF2B 4O4YL 4XVJH 3LRSA 3LPFA 5E4EB 1S9KC 1J8HD 5BS0D 1FG2A 4OM1H 4YC2B 3UYRL 5F88A 4HBQA 4XCFH 3U7WH 2X1QA 2YWYA 5DLMH 1HWHB 2QQQA 3W9EB 3HRZA 1N3NA 4UB0L 2V9TA 4PRAA 2ITCB 3VWKC 4Y88A 1OAUH 3T65A 3VXUD 3W9EA 4AH2A 3O6MH 3CFCH 1A6TB 5BVJA 3SKUD 3U4BL 1FIGL 5EUKB 4Y2DA 4PBXA 1QFPA 2F74B 3I3EA 2MHAB 1JNJA 4Q9CA 3KYKH 4KXZI 4BSJA 1A1NA 2NW2B 1H3PH 2UV3A 1C08B 3WIFA 4HQQL 3ULVD 4JR9L 1EGJL 2EC9U 3UJTL 5F1KC 5I1IL 1ZS8B 2NY6B 3EO0A 3BH8B 1DEEB 3VD7A 2O61A 1OW0C 4O2EB 3UDWA 4UDTB 3GJFB 2YC1A 5HYQA 1MVUB 1V7NH 1DEEA 1XCQA 2GCYA 4JPVH 3ARDA 5JXEA 1MHEB 4KK8D 4AMKL 4XVSH 2HT2D 3QDJB 3AXLA 4LHQB 1QYGL 3IU3A 4PRPB 2VDML 3SCMC 1G7QA 1NCWH 2NXYB 5SWZB 3Q2CA 1A3RH 2MSPA 2CO6B 1UKSA 5D2LB 4LIQL 1R24B 1IGJA 4KQ4L 3MZGB 1XGQB 3JV4B 4PJ5A 4UILL 4GUPA 5C3LD 1S78D 4PJAA 3C6LC 1PZ5A 1T7XA 4PJ9D 1RZ7L 1IVLA 4FZEL 5D93B 2F53E 1YEHH 3RPKA 1UACL 3NCEB 3NN8B 5SWZE 2SEBB 5TQ2L 3FAWA 3H9SE 4LCUA 3FL7A 3F8UB 4U49A 4NWUL 1F4AA 3BEVB 4XP4H 2H32A 3LRHA 3TO2A 1L6ZA 4AL8L 5DJ8A 3DV4A 4U05A 3F5WB 4JG1L 3RIFK 3E3QC 5F1NB 3TZVB 4AEFA 4ENED 3ARZA 1TXKA 4XH2B 3QQ3B 4HJGB 1UKQA 1YYLL 5ICXA 1P7HL 2B20A 3IFLH 5DK0A 1QLRB 43CAA 1JZ3A 2YEZA 3QRGL 4LIQE 5DVMA 4Z9KB 5KSVB 2PTUA 4G80B 3JSSA 4HJGA 5ICXB 5EZOH 4JM2B 3LKNA 2APTA 2P8PA 1FJ1B 5LXGH 1KB5A 3BXNA 4EDWH 3QDGD 1J1XH 1CTOA 4HKZA 3B83A 5DJYB 1F4WH 3QUXD 5A43C 4OAWA 2DLFL 3D2UD 4IOSD 5E56A 3L3IA 1VGEH 3ZSTA 5DK2B 3U2SA 4PJIF 1WZ1H 3BDBA 3PIQB 4ODSL 1J87A 1YMMA 3EFDL 5FHAL 4RAHA 3QG7H 3G6JF 4Y1AA 5GGQL 3IDUA 3L3IB 3O3EB 3OGCA 1FV1A 2AEQH 4Z7WB 1KULA 1WT5A 5JW5B 5E9DD 4JB9H 2G60L 1VHPA 3H9SA 1OT1A 5FEBA 1UWXK 4AIOA 5IB5A 4NBXB 2WBJB 1K6QH 5CJXA 3V7AG 1C5CH 1O5DT 5EWIH 1YPZB 4ERSH 2J6EL 5HYSA 3ARWA 4GRWB 2YZ1A 1RIHL 5DRXB 4CMMB 1CL7I 2J7LA 1C16A 1U8OA 2IAND 1EFXB 4FQLH 4JHWH 1OAXH 2FX7L 1QNZH 1U8HA 1NDMB 5I2IA 1CT8B 2OSLB 4JPVL 1OTSC 4NQDE 3GHEL 2NTFA 2COQA 5GSVB 3QIUC 3RAJL 4F3FA 1A6UH 3WFCH 3BESR 1NGXB 2XFXA 4GBXC 1NFDE 2ZUSA 5F89A 4JFFA 1WITA 5J12C 1MFDH 2XTJB 3FFDA 3MFFA 5CJ8A 1MLCA 3KDMB 5A16B 3GMPB 3TYFA 4F33B 4NQCE 3MBEA 2GAZA 3GSOB 4U1MA 2OLDA 3EHBC 1X4ZA 1WZKA 2AJZA 3FRPA 3RRQA 3X3GL 1FG9C 3TA3D 3S96B 5I73C 1I8LA 4YBQD 4IOIA 3MLRL 1ZAGA 4IRSC 3MBEC 1MIMH 5IEHB 3E2HC 3ZE1F 2A6KB 4CVZA 4PGCB 2EE9A 3QIWC 2BVQA 1QSFD 4OKVA 2PXYA 3DUSA 4LCCB 3TFKD 2C4FU 2EEAA 3RI5K 3QIUA 3HNSL 4QRRA 3KWWA 1C5DB 5CBAA 4IDJL 1RU9L 1G9NC 1IAIL 5I75C 3KPMA 2Y07H 4KRLB 1DQQA 1R3HA 3RL2B 1WF5A 3FQXA 3M45A 3K1KC 4KUCD 2PXYD 4HLJA 5KAQG 3M1BB 1CFTA 3LKPB 1CK0H 3BDYL 1MJ7L 1Z6JT 3QG6A 3DX6A 3IXTA 5ETUB 1HKFA 4OF0A 4UV7H 5DGRA 3BD4A 1E4KC 1DLHB 3CLEL 4HH8A 1UWEH 1E6OH 1SM3H 3GO1L 5L88L 4N0RA 5FCUL 2X6MA 4NZTL 5AD0B 2HFEA 3BUYB 4KMLB 3DURA 4L3CA 4QXGL 1OP3K 1PZ5B 3CH1A 2Y6SD 2XG5A 3I6KA 4MVBD 5D1QB 1A6VL 3AY4C 3TEUA 1S7WB 5D7LB 3REWA 4DGVL 4LOUD 4BUGA 4UNVA 4XWOC 2BSTA 1MCIA 2AEPL 4PLJD 4RFOL 1L6XA 4ZYKB 3RWGB 5L8JB 4M6MH 1YZZA 1NFKA 4MJID 4Y4KD 3V9FA 5IVXB 4L8SB 5L9DH 1DN0B 3DVFA 4M7LL 1INDL 1H3GA 4H1LH 1MFEH 2OTWB 3KYOA 2NNAA 4JVUA 3N50A 3EO0B 3UROR 4FFZH 5EN2B 2R8SL 5CEZH 1FVDB 5IB1A 4YDIL 2CUIA 3VXQA 3IJHB 2NZ9C 4U1KB 3O4LE 3AS1A 2AXGB 3KPSA 2ORBL 4LEXL 1MNUH 2JJSA 4HGKC 4WI5A 1JHTA 2Y5TA 2VXQH 5DTFA 4DEPC 5E00B 2GTZB 4HPYH 1KCUH 4JO1L 1FLRH 3V5KA 2NZIA 1XH3B 1A2YB 1T1XB 4QOKB 1FV1B 2AV7A 4Z7WA 4Y5YB 4TSCL 2BY1A 4NNXB 4YDJB 3KPLB 5DQJA 1U92B 3WIHA 3LB6D 3UJJL 4XMLL 2CKBL 1JNHA 3V52L 2KZWA 5ESAB 4CKVX 3BVNA 5E2UL 1MCWW 3JV4A 4PJ5B 5DUMH 1ROWA 3O6FB 3DBXB 4PGZA 1EZVX 5BRZD 4Z7OE 4IRJC 5ESVB 2E9IA 1AKJA 1QR1A 1OAZH 1CXEA 4NQSA 2H3NA 3WNLA 2J2ZA 1OWRM 1CQKA 1P9MA 4CN1A 3LDBB 5JZ7D 5F7DA 5ISZD 4M48H 4OV6F 3SDCB 3C60C 1BM3H 5GSVA 3O11A 1D9KB 2DQJL 2NY3B 1P53A 3T2NH 4DN4L 4GMSL 5I6XB 5HYJA 4HZLB 3QQ3A 4GW4B 1SJVA 3P0VL 3QQ4A 2BNRE 4HEME 2DLIA 3OAUL 1B3JA 4JO3L 1N4XH 5I15L 3B6SB 1MLCB 4NZUL 4DKEH 4WO4D 3G6JB 3U48A 1YC8A 3EHBD 4PJHB 1FE8L 4FZ8L 3PQYD 1T6VN 3TIDA 3EOTH 5CP7B 3VFRA 3T8XB 1JPGA 3PWPA 4XNYH 2AXJA 5C07D 3CJJA 1IC7H 2C3XA 3PDOB 2BDNL 3TBWB 5GPRA 3R1GL 3MMEB 4PGDA 1ACYH 4R8WL 3VGDA 4DZBA 3S37X 2DIBA 3CDGB 4WRLA 2MWCA 1WIPA 2IFFH 3L3JB 3T8XA 1KFAH 3DWTA 3IDJB 4RAVA 2EDLA 4JGMA 2DN7A 1ZE3C 1NC4A 4S11A 3P11L 2DQGL 2HLAA 3MJ9H 1TQBB 1U6AH 4R4BB 5GGVH 2H8PB 3HPLA 4LCCC 2EICA 3PNWB 3SDDC 2UUDH 3AC0A 5LQBL 3KLHC 4OGAC 2I26N 3BEWA 2O5XL 1IBGH 1M7DB 1R3JA 4HC1A 1S7VA 5AUMA 2PF6A 1CVSC 3WIHH 3MGOA 4WW2A 1QLEL 2DICA 2V2WA 5ALCL 2FIRT 1RIUH 1I1YB 3QFDB 4HC1H 2X4UA 5TDOB 1TLKA 5I73B 5HY9B 4MA7H 4MHHG 1A7PH 2R0ZH 3MJ8A 1KPRA 5IBTL 5KSAC 4KY1H 1VPOH 4X5XA 3ZE2E 1YJDL 5JOFB 1PW3A 2R69L 4CAGA 1CU4L 1IEAA 1SMOA 5CJOH 1SJHB 2ZCHH 4WY7L 5CEZD 5IMOB 3BKMH 2OP4L 2D0GA 4HLZH 4KJYB 1URLA 4JFFB 2JB5L 4J3SA 5D1QA 1U0QA 4M61B 4EUPH 4TPRH 2D0FA 3FZUC 3T0DA 2DTML 4I9WE 3QEGL 5CGYD 4GAYA 1IJ9A 1OTUD 1NAML 4P2YA 5IMKB 3MOQA 2CDEB 3QI9A 5L8LB 2FECI 3S3SA 3T65B 4O2FB 1DLFL 4PJFA 4Y1AE 2AK4B 1CN4A 2XQBH 1MFCL 1DN0A 1S7TA 2IPKB 1EK3A 2YXMA 1UM4L 1OTTC 2CDEA 2HN7B 2EDQA 4HJ0C 3CDCA 5DJDA 3IGAA 4NUJB 5DJCA 4FQCH 1HEZB 3TH4T 1KYOK 4K8RC 1X5ZA 1TVBB 2PR4L 3A6BL 1CLYL 1FVDA 5D9SB 5IB1B 1KB9K 3QIUB 1Q9KB 3D39A 1TDQA 1A7OL 4RWYL 5CBEB 2FH6A 4WU5A 4BH7B 4ZTOL 1KTLB 1SBBA 2WP3O 1A6ZB 4O2EA 5BZDA 2QHRL 3PXHA 3VXSA 4ZUWB 1OB1B 5JO5A 4HHAB 3LV3A 5DXWA 3FT2B 3GM8A 3VFSB 3VXPA 5FM8A 4MMXC 2X9YA 3MRFA 1JZ6A 4M5ZH 2ZUVA 3VXSB 2FX8L 1X5JA 5CGTA 2QSQA 4KGJA 3V4PL 3U1SL 3MXWL 2GUOB 4KH2A 4MJ4A 1P7QA 4BYHA 3SQOH 2ZJSL 3MRLA 3KYMA 3EOBA 2VLJE 5C7XH 1P4LA 1VDGA 3D25A 4MD0B 4X8XA 1T0NA 2Z92A 2VE6A 4QXUH 3UYOD 1U2CA 2CLZB 1HSAA 3GBLA 1RZIB 4LMQE 2HLFD 1JWMA 2ZNWA 3TZVC 2VXVL 2YSSA 5JLZA 3DI3B 3V5HB 4HS6B 3SJVD 4LRIC 1HHHA 5LBSH 5KVGH 3MV8B 1OGTA 4G9FE 4HIJB 4PR5B 5B39A 4LCUB 4CU8A 4BFIA 3H9HA 5JIKA 4XAKE 3AB0C 4Y16A 5F9JA 5FO7B 3RWEA 3V4PH 1BQUA 1WBXA 3RIAF 1EMTL 1X5FA 3MA7A 3UO1L 2E7CA 3TNMB 3TNNA 4PJAE 5GSRB 3FCTA 1XZ0A 3FRUA 1D9KC 3HC4H 2EDOA 4OCLC 3PE9A 1TZGH 3GSRB 2EKSB 1JV5A 2MQCA 3MV8E 1CDBA 4MQ7A 5DJ0B 2B1HH 4MX7A 4N5ED 1G7IA 4C56E 1LGVA 1JRHI 1N8ZB 2OXHA 3X17A 1FJ1A 1JV5B 1SY6A 5FHBH 5LGKA 3DMMD 3L3JA 1T22B 4NKIH 5T1DL 2W9DH 3A6CL 1CXKA 2LE9A 1F3JB 1F6AB 3HHRB 3HMWL 4S2SB 5DD1H 1UZ6E 3WDIA 2PYEA 4ZFGH 3IDYC 4OCRL 1A5FH 2MKLC 3C6LB 2N7BA 3B3IA 5FOBA 1YQ2A 4C4KO 2X4PA 4O51B 4ZFOB 3IU4L 2AXFB 4I0PB 3BRGC 1U92A 1XCTA 1W0YT 3QP3A 3QDMB 2EDKA 1NAMH 4FQLL 4LEOB 2VDQL 3L3DB 4ZFOA 2VXUH 2XTJD 2X1WL 2EZ0C 1ADQL 4W6XB 5IB5B 1IGFH 1T2XA 2OTPA 2EIDA 3HAEH 4UTAL 2W65B 2FGWH 1AO7E 2JTDA 3PL6D 1IT9L 1AGFB 3WFHB 1TZHB 4HFUH 1OAQL 5JOFA 5HHNB 2HMID 3HI1B 1TCRA 4QO1A 2RJMA 1WBZA 1UB6B 1M71B 1RJYA 1LHZA 2NQCA 5F8QC 3HI1A 1FO0L 4Q6YA 4OUUA 5F9WC 4L8CB 1X6LA 1NCDL 4JQVC 5DJ2A 3G6JA 3TJHD 3GSNA 4KK9C 2E7BA 3NIFE 5GS1B 1TQCB 3FB5B 5CP7A 4WEBL 4MQXC 4U6XA 1N7MH 5MP6H 4HK0B 5DGQA 1KCVL 2MPAH 4JFEA 3DHMA 5T1LA 2Q6WB 1QSZA 3G5YB 5GRUH 1QP1A 4L4VA 4MNGE 2GHWB 5DMKB 4RIRA 4QF1A 3BO8B 4RAVB 4O9HL 3K8LA 4L4TD 1LQSR 3ZDXF 3L3OA 1YN7B 3CPLA 1A1MA 5E8OB 3IFLL 2FO4B 5ICYA 2EYRA 4G6KL 4QWWC 1KFAL 4P2RB 3LIZH 5IEHA 5F8RC 4FQQB 4OF7A 1A1MB 2IANE 4NC1C 2VDRH 2EIBA 2H1PH 4MDIA 3FOLA 3MA9L 1EO7A 3AS0A 5EOCH 5EORH 4Z7NF 5F7NC 4KKNA 3D18B 4WEMB 1QHOA 3ULUC 3TA3A 4OQTH 4MDIB 5F7EL 4HX1B 4CADA 3FT2A 3VXPB 3TVMB 5KG9A 5KSAA 1JGEA 3EIFA 4OZFB 4UT7H 4XMKH 1DBML 1R3LB 3ULUL 4DGIH 1JGDA 1RY7B 4ZTPH 12E8L 4ONOA 3TVMA 5KG9B 4K8RH 3C09C 1BD2B 5DJXA 5DA0B 4PRID 3RI5F 1KB9J 3C9NB 1G7HB 1PEZA 3VH8A 1C12A 1F11A 3VGHA 1JN6B 4JFDD 2HWZH 4R97B 1ZTXH 2NTSP 3MUZ1 4ODUA 1JK8A 3MRCA 4OD3L 2HLFC 5EPMA 2C1PB 2GW5A 4EVNB 4P23D 1S7RB 3ARFA 4NNPL 1DBBL 2YSSB 3L7EA 5I0ZA 4RQQB 1J1PL 3QDAA 3MBXL 2AJSL 4K3EL 4APQC 3T4YA 5K59E 4ZOAA 5ADOL 5F9OH 5HPMB 4DAGH 4NRYA 1WEJH 4LDOB 2CKBH 5GRXG 5SWSE 2XKUA 4OM0L 3V52H 1HQ4A 3WS3A 4BFEA 2OXGA 4QHUA 5DO2D 5C07E 4XNMB 5CZKA 3TN0D 5DR5L 1CDYA 4TUJB 1JNLH 4D8PB 5DWUH 2B4CC 3H42L 4XCNB 2QL1A 1T04B 4YZFE 1HINL 1FYTD 1PSKL 3FB6A 1IEBB 3UCRA 3EO9L 5E8NB 3QZWB 4ZFZA 2E3VA 2GYSA 3LZFL 5I1GH 3T1FB 5I1EL 4YXLL 1JI1A 4WU5B 4BH7A 4XPGL 5K9JL 3WFDH 4YDIH 3BJ91 3VXUE 4PTUB 1R5WB 1HZHL 5T33L 3QCUH 1CE6A 2F19L 3PHQB 2OL3B 4Q9RH 4F7PB 3O3DA 4NGHL 3U4EA 1CDCA 2IBZX 3WUWB 2AEIT 4LARL 1BJ8A 1INDH 4XPFL 1MJ8L 5GRJL 4JN2A 3SDCD 1I9IH 4U1NA 1D5ZA 3HAEA 1D6VL 2KZ1B 5EZIH 4KAQL 1JYVA 5GGSY 3VXUB 4WGVB 1A7RL 2VXVH 2LU7A 2VQTA 2VXSL 1LO2H 5DURD 5FA4B 3EOBB 3MV9E 1P4LB 3NA4A 1FNGA 1X5XA 2JELL 3BVNB 2AP2A 1J5OH 2Z31C 1KLFA 2XXCB 4ISVB 2VH5H 4YPJA 1NCBL 3RUGA 5B4MC 2PKDA 1I8IA 2JK5A 2Y25A 3QEQA 1CICA 5BO1H 3U0WH 3UTPD 3ECBB 4XXDA 3MRKA 4NN6B 4JANA 5I71B 4S1QL 5IHZB 3EYQD 5TDPA 2HTLD 4NN6C 3TA3C 5CSBA 2PCPA 3VXME 4DOHE 1EFQA 3QFJD 3RVXC 4LAQL 4R4FH 3H2WA 3CX5K 4JQIL 3UBXG 3FCTB 5CJBA 3L5IA 1NDGA 3MYJB 1OD9A 3QQ4B 5DS8B 2CD0A 4LF3A 1FGNL 2EDHA 4J3VA 4KPHL 1D5MA 1YEDB 3MYJA 1CLZL 5IROC 5SWZD 2YWZA 3TBVB 3F7QA 5C0JB 3QI9D 5EU6B 1OAYH 4QHLB 3HMXA 2WNGA 1FNSH 4NGHH 1V3JA 2NW3B 4HIXL 4H26A 1UXWA 4JQIH 3RZCA 1JFQL 2EXWC 4KDVA 2F19H 3RGVD 4OD2A 5EUOA 4S2SA 5SV4A 2EDFA 2O5YH 4FQJL 2UVFA 3QPQC 3LN5A 5HVGB 3OHXB 4MZ3A 2FSEA 2XPGB 3BYYA 3AY4A 1GIGH 3TVMD 4PTTA 4E41D 2ILLA 1F4YL 1YECL 4MJIE 3RDTA 5IBUG 1U8QA 1E6OL 3GO1H 3X14A 1HKLH 4F37K 1GAFL 1S7SB 5IFJA 1CCZA 2NXYD 5EZJB 2J8HA 4ZFFB 2VABA 4BQBA 5I1DA 1YEKL 1CK0L 3BDYH 2UZIL 2Y6SC 4JFDB 1T20A 1DDHB 4CU6A 5DR5H 1JWSA 5EU7C 3ARXA 4M6NH 4WUUB 4XT1C 3LMJL 1K4DB 2BHYA 5HHNA 1GJIA 2QQLL 4JRYD 2JCCF 3C8HA 1AXIB 1Q72H 4DGYH 1IZJA 3GHEH 3L3GB 1AHWA 3O8XA 1DBBH 1PY4A 1T03H 4KRPB 5C0FB 3MCLH 3IT8D 3QDJD 1GZQB 4HPOH 3WIFB 5F21B 1UC6A 5EFIB 4GRLB 5J06A 2YN5A 5JMOC 3DPBA 4ERSL 4QNPF 4OGYL 4TUKH 3F7VB 1QBML 3RPIB 3T4YB 3D6GA 3P73A 1G7LA 3H6JA 4F58H 1DQLH 1JMZA 4Z78A 1EEZA 2A9NH 5D7JB 3C5ZA 3DX9B 2NY5H 4UT7L 4X8JB 3MGTB 4LSPH 3UTTB 4TUJA 4YBQC 5E4EC 1PBYA 1WFNA 4MD5B 5CHNA 3BPOB 3OX8B 5IJVA 3V8OA 3P0GB 3R1GH 1OWWA 4X6DF 1UWGH 5EORL 5BRZB 3NCMA 2DQCL 2EE3A 2UWEF 2AJ3A 4G9FA 2IPKA 3DYOA 3QIWD 4NSKB 4U0RB 3SDXE 2VDRL 3NGBB 1X3DA 1UYWH 3VE0B 4YHZL 5DUBA 3TFKC 3W0WA 1LD9A 2ED7A 3W2DL 4UUJA 3RAJH 5HDQH 4PTUA 2IBGA 3G6JE 4JG0L 4NNPH 2BNRD 1QZ1A 5D9SA 3SBWA 1HQRB 5FO9A 4DWHA 2BNQB 2MFNA 2IALB 2ARJQ 2CKBA 4WFEE 2X5PA 1JZ4A 2CXGA 1A14H 1YQVL 4OZHE 4HUWB 4OZGA 4OGYH 1UADC 1WC7A 3VWJA 5JO5B 3HZVB 2ZSVA 5J6GB 3HZYA 3C60D 3PQYB 3N9GH 1G7HA 4CBPA 2EEDA 4KGLA 5JR1H 4XPBH 2JCCE 3DXAE 2YR3A 3OJDB 3D0VB 4I77L 5B4MD 3RWIA 3D25B 1T0NB 2Z92B 3LMJH 4WO4C 3OAYH 2MOVA 2DYPD 2ZOKA 1TTFA 3Q48A 4TSCH 5F6IC 3UTSD 3VMNA 3MV7E 4KI5C 1DANT 5T1MB 3JWOH 4PLJC 4TNVK 2XWBA 4LP5A 2Z91B 3D3VA 1S9WB 4P3WA 5JPMB 5E2JA 2ZOKB 4G9DA 5HD8C 1G7PB 2N7AA 4JY5L 1WLHA 1KCUL 3EJYC 1N6QH 2ITDA 1S9XA 2VDMH 4YZFF 3HAEG 4HMEA 4JRYE 4WW1B 1I7ZB 3MREB 4X6DA 3KR3H 3Q0HA 3QRGH 7CGTA 1II4E 3QXTA 4MAYA 4EEEA 1BREA 3UBXI 3VRJA 5I1AA 4I18A 4EXPX 2GK2A 4PRDB 3BT2H 5J1AB 4OGAD 1YEEH 5DMIH 5ADPL 3EUUA 4HCRL 2VITB 3UTZB 4X0KA 2EXWD 1FL3A 1JJUA 3BP7A 5CEZE 4NP4H 4UBDC 1C16B 3C5SA 4H25B 3VU2A 3O3DB 1QVOA 4Z7VE 5I17B 2ZG3A 2WLZA 2W60B 2Z4QB 4FZEH 2OSLA 2GQHA 1RZ7H 2VWEC 5I8EB 4QRPE 1GHFL 2PYEB 5FKAA 1FIGH 1BF8A 3WNKA 3C6LA 3L6FA 4R4FL 3LB6C 3MRBB 3ULVL 2AS5M 5SX4I 5K9QG 2A77L 4ZNEA 3KJ4B 5EZJA 2VABB 3UO1H 4HDIA 5GS0H 4J4PA 3MRBA 3C09B 5E6IB 1U8MA 1JWSB 3UEZA 2JJSC 4LCWE 1ULVA 5JORA 2OCFD 2XI9A 4QRPB 5E03A 2PYEE 4PBVC 2BCKA 5L2KA 2WK2A 1KXQE 1RZGB 1K8DB 4FQXD 3S3JA 4K94H 4HIEB 4OZHA 1Z0NA 4WCYL 5I76B 5MI0C 5A2JH 2DBJA 4XPTL 3K74B 4UOJA 5D7LD 1FN4A 1U8PB 4XP1L 2XIDA 4LLMB 4G8GA 4G6AC 1MUJA 2B7DT 4NYLB 4N8CH 1NEZB 1H3PL 4LCCA 2YD2A 4URTB 5C0IA 2R2HA 2B0SL 4ELMF 3MR9B 4LMQI 1FYTE 4JRXA 4Q9QL 3GRWA 3JVGC 4WU7A 4AYFA 1YECH 4CDGC 3RL2A 3DX8B 1E4JA 4PJ7E 5C71A 1G7JA 1S7XA 3GJEB 5ISZE 3MGTA 1MIML 2EECA 4Z8FL 3CFBB 2B2XH 4JFEB 3QXWA 1G1CA 1KTRL 4E5XA 3Q5TA 4CW1B 4LU5H 1XGRA 3UYPA 5F7KC 3HE7B 1EMTH 4HGMA 4ONHB 4HEPG 4AM0B 5HYFA 1GGIH 1UCBH 1N0LA 4OT1L 1RFDL 1RZKL 3OTTA 5IVZA 1LVEA 2L7JA 1MI5D 4M1GH 5TPWH 4QRSA 5DFTA 2AQ2A 1T1ZB 3MRNA 4KROB 2BXZA 4B41A 2XOTA 4P2CG 1A1OA 1ZMYA 2HFGL 2WMPA 1NFIB 1GGUA 1UM4H 3X13B 4YNYB 1DDHA 3L5HA 1OPGL 3RNKA 1GOHA 3VXRE 1W72L 4K94L 3ULSA 5HHOB 1J1PH 2ICWA 2Z8WC 1YC7A 3KLSA 4PRAB 4XCEB 5JHLL 4PJBF 3F7YA 3AFLA 2UZYB 5GISH 2LVCA 3R8QA 3DYMA 1MHPL 3PWUA 5FF6B 1CLOL 2DKSA 5FYJL 4YQXH 5GS2D 1N6QL 4Y2DB 4J4PC 1WCBB 1NCBH 1C12B 3C5JA 3TT3H 1KYOJ 3KPSE 1CGSH 1KT2B 4NHUA 5IF0B 4HLZG 3B9VA 8CGTA 4IEFB 5CILH 5GZND 1B0RA 4JO4H 2IH3A 3CC5A 4Z0BL 3V6OE 2I9LA 3FQWA 1ZLSL 4AEEA 1BBDH 2ZUQB 4Z78B 2ZUXA 5I66B 2WW8A 1CL7L 3DIFB 4KK6D 5E00A 4WW2C 3TPUA 4XPAL 1OP5K 3IDGB 5K9KA 3L5WA 3LKQB 1RIUL 4NCC1 4F7CA 2BNUA 4Q97A 4PJ7F 3QYCA 3KS0H 1SY6L 3BT2L 1U3HA 3T0VA 4XAWL 4TRPH 5EIQA 4NO0D 4FABL 1NMBH 3T08A 3Q1SH 3QDJA 4LLDB 2XZAH 3L3HB 1PFCA 4TQEH 5CSZA 4G8EB 2BVPB 4KC3B 3AREA 3ARGD 4GSDH 3PP4H 4FFYL 4X7DC 1Q9OB 1QKZH 1MFAL 2PXYC 2X42A 3G9VA 3IYLW 5J3HC 3ELAT 4RX4D 5C0NC 3P30H 1KJ2B 1RJCA 1PSKH 1QFWL 2C3HA 4W6WB 2QSVA 4X6EB 1AH1A 1D6EB 1P1ZB 4P3DB 5DWUL 3O2DA 1K3ZA 5CUSL 1Z0MA 1BAFL 1T5WB 1BJ1H 5I1KH 5HJ3A 4U1SA 1NGZA 3FB8B 3LVEA