5HHOE

Crystal structure of the jm22 tcr in complex with hla-a*0201 in complex with m1-g4e
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
240
structure length
240
Chain Sequence
GGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIRSSYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 49
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE02
2VB5A 4BFIB 1MQ8A 5EULV 5HY9B 3OR7A 3C5ZD 4J3UA 3KPLB 4GH7B 5C0AE 5BRZE 5IVNA 4PJFA 4GJTB 4QHUA 5KVDL 1M71B 4PJFE 5I8KL 3U7WL 5DXWA 4ZS7L 2N7BA 2AERT 2FX8H 2X4TB 4ZS7H 1V5JA 1J0HA 3AXLA 4KK9D 3G04B 3JWNC 1HILB 1CE1L 2YC1A 4XGZB 3CSBA 3IS0X 5KOMC 4YEFA 2OTUA 1KCLA 3AREB 1I8KB 4KVNH 4MNGB 1X5FA 1UXSA 2MQCA 1XF4A 1NDGB 4HC1A 3TO2B 3HTLX 3O6FD 3ZKQD 2IPKA 2A6DB 1URLA 2HFEB 3BMWA 1AXIB 1ETZA 4OLUL 4BH7A 4I3SH 4XP4L 1R5VB 4KKCD 5F8QC 4OM1L 2YMXH 2X4PA 1KLGA 3F12B 2ZUSA 1IVLA 1ES0A 2FEEI 4JQIL 5JHDD 4L3EB 4LPXA 4P48A 5CAYB 3QULA 5I1EL 1AC0A 2SEBB 1IC5L 2MHAA 1DBMH 5IG7A 1DCLA 2IQAA 4EN3C 2YBRA 5SWZE 5C0GA 2GFBB 3AS1A 3LQZA 5CIPH 4JGUA 1EO8H 4FFZH 4PPTA 2AJUH 2B1AL 3L3GB 3F7VB 1MFNA 3WHXA 1NEZG 4LIQE 1N8ZB 4TSBH 4WO4D 1XT5A 2CRMA 5H37G 4DN4H 2AJ3A 2ORBL 1VPOH 5L6YH 1J0YA 1FNEB 1LO3L 3RWCB 1FAIL 4UDUA 5F7FA 1BPVA 2DBLL 4QRPD 4M1GL 4ZXBB 2X4QA 5LAXA 1TZHA 3QUXA 1ZWIB 3QXDA 4LPWA 4QCIA 1RIHH 2D31B 3UAJD 5HXMA 2L4OA 3ARBB 1W0VB 1FORH 4ZFOA 3BXNB 1DQJB 3MZTA 3CIQA 4L5FH 3MREA 4H25B 4MHHI 2YSSA 5B8CC 4AT6A 1DUYB 4PRPA 5LGKA 4FFVC 1OTSD 2QQLL 4MMXC 4HXAH 1OAXL 5TE7L 2ERJB 3IRPX 1K8IA 4B5EA 4K3JL 1XF5A 4O02L 3VGDA 5B3JF 2EKSB 4LP4A 1T20B 3VXOB 3UTSE 4JAMB 3DXAD 1XF1A 1CFVL 1G7JB 2P5EE 3MNVA 4NC1C 4P4KA 3DVGA 3U7YH 5LG1A 1N6UA 4PY8I 1OWWA 2XA8L 4OCWL 4X4XA 4BKLA 5J7CC 3MODH 5CJ8A 2BSRB 1EAJA 1KBGL 1IL1A 1WBXA 3EDJA 1NCWL 5FUCE 3TGXA 3RKDC 3TH4T 4YDKH 4LLQA 4N1HB 4BSJA 1FIEA 3MRFA 3F8UB 1EAPB 1A6WH 4WTXA 2IH1B 3EO1B 5E08L 4YHLL 4D8PA 5E00B 1TTUA 5I18L 2GTZB 5JW4Q 1BLNB 3MGOB 1X5XA 4O2FB 2JJWA 4LLVB 5DD0L 2L7UA 5DJZA 1JPGB 4LIQL 5BVPL 4NC0B 5DHVB 3D5OF 4MGXA 1A7NH 5GS0C 4XP4H 1SBSL 1GAFH 4PJAA 4PGZA 1OF2A 1WFUA 4PJCA 1NDMA 4NQEE 2IQ9H 4HX1B 4HD9A 4LK4A 2AEIT 1VHPA 1T04A 3LCYA 1QFWH 3BZFA 4WU7B 1MRDL 1KJ2L 1RZFH 3DBXA 4DW2H 3ZYJA 1C5CL 4NWTH 4Z77A 4IRJC 3SE4C 1EHNA 4NO0A 1X5ZA 3C08H 2FYYB 4WENB 5DMJB 1R24A 2VH5H 4N68A 3S34H 2WWKT 2R2HB 5TDPB 5EB9A 1J11A 5D1XD 2J88H 4M8QB 3QDMD 1RZJC 3OKMB 2I25N 5C86A 3LQAL 3BO8A 1GZQB 4H20L 4NN6B 3K3QA 4NSKB 3P30H 4G8EA 3SDAC 1SMAA 4R4FL 3QDJB 4FQCL 4YJZL 2O26U 3VXTA 3GSRA 1Q38A 3VWKC 3DV6B 4OSUL 3TIDA 3I02B 4FXGB 2V2TB 2NLJA 2QKIB 1J1OH 1HCFX 1IFHH 4ZUVA 1ACYH 3OJDA 2HJKA 3TYFB 5K9JH 3PXJA 1IILE 5EA0L 5DVMA 2EXWC 3C6LA 4JHZA 3HLAA 3TA3A 4PJXB 3KPRE 3V95A 3LKNA 1EEQA 4L4TB 2BK8A 2N7AA 1MIEL 1XAUA 5D5ME 5IT2H 2I60H 1AGFB 5LGHH 4AM0B 4NQXA 1YUHB 5HYSA 2NNAB 4NQUA 4YPGA 2XTJD 4XB7A 4BJLA 3WE6A 3EYOB 2CUIA 1RIVL 2A83A 1YEHH 4YWGL 1L9NA 4C55A 1CQYA 1A3LL 4M6NH 4KKAD 2J88L 3ULSA 2FD6L 5I1HH 5E4EB 2ADFH 3R4DA 4CW1B 2IADB 4C58B 1HSAB 2H8PB 3UZEA 3ZT6A 2X5PA 4XNMB 2WUBL 4PJ8A 5DD5L 3OB0H 3LDBC 4LLWA 3UBXI 2CDFA 4Z7UB 2NY5L 3MLVL 1I9IH 5GHWH 4AQ1B 1RIHL 1QVOA 4KUZH 5E99L 3L5XL 1PJ9A 3OZ9H 1T0NA 1E27B 1Q0YL 3BUTA 3MA9H 5CEYA 2ZUQB 4DGIH 2AK4E 5HVWA 1QSFB 1J1PH 5FAAA 3RY4A 3UYPA 2PTUA 2W9LA 1BZ9A 2XNAB 3KPQB 1T03H 2HT4D 3ULUF 2X4SB 2FBOJ 5IB2B 4YE4H 2DBJA 2JIXB 1FNAA 4WDIA 4F58L 1LWRA 5B8CB 4MNGE 1WC7A 1CVSC 3L3HB 5HGAA 1CICC 4JDTH 4YHZL 4K7PH 3VFPA 3Q6FB 3MOBL 1QR1A 4AZ8A 1OAQH 2HJLA 3SGJA 2QQKL 1NFIB 3HI1B 2R69H 1MCWM 2WBJC 4P2OD 3MR9B 3LRHA 4OCNC 4NRXB 3TT3L 1VEMA 1QR4A 2EC9T 1N4XH 1MFAL 4NYLA 3N06B 1QFWM 1EFXD 1DBBL 4UT9L 2J7LA 4K7PX 5EBMA 4JANB 1P4BL 5GRWA 1XGTB 1ZT7A 1D5BB 1I8IB 3PUCA 2WNGA 4FQIH 2DRUA 4MS8C 4OFPA 3V0VA 2FJGB 3VWJA 5M94B 1JL8A 4PJDB 5GSVB 1Y6KR 3RIAF 2E9BA 5ACLA 1XGTA 1ORSA 4NN5C 3QZWA 1JP5A 3T0EE 5F1SA 3SKJH 3QIWD 4YHYC 1CFSA 4PIRF 3ULVE 1IAIL 4NYLB 5DQDH 1S7VA 4KJQD 5JW5B 1FZMA 1QFOA 4EI5D 5GQBA 3QXTA 5IHLB 4NRXA 4NQDA 1PSKL 1N64H 4U1NB 1WQVT 1YA5A 2HTKD 1I3VA 4PRAB 1I9JL 1SEQH 1WTLA 3RWDB 3EO0A 4XXCA 3MRPA 3O45B 3B8YA 1NJ9A 2CR3A 4LEXH 3R1GH 4NJAH 3Q6FA 1S7XB 4I48B 3QQ9C 5E8NA 5D1QB 3HI6L 4R96B 3L95A 2W38A 1H15B 2YPLB 4LFHD 2Y23A 2JIXA 4D2NA 3S9DB 1MLCA 5DJDA 1Y0LB 3TYGH 3VGGA 2WQ8A 2XNAA 5C0EB 3X13B 1R5IA 3C8KB 5LBSH 4Q9QH 3RZCC 5CILH 5CJOH 4XMPH 2UUDK 4PP1D 5F89A 4NQCB 2DQJH 3BSZL 1OB1A 4WFHE 5GS0L 4QRQA 3BSZH 3O9WA 4HLZG 4WUKL 3DV4B 3H8NA 4OCSL 4OZ4B 5EIVA 4UUJA 2HH0L 1UACH 4XTRD 4GRMA 1QSFD 4MD5A 2ZSVA 4PJ8B 4UAOB 3RZCD 4YFLI 4JLRA 3THML 2DQIL 1WWBX 4PP1C 2BNQB 4XXCC 3RWGB 4TOYL 4WWKA 1S7WB 3L7EA 5IMKA 1NANH 1KNOB 4RGOL 1KJ2B 3DHMA 4ODSL 4ALAL 5F3HB 4UTAL 3KS0J 4L8SA 5IMMB 2FGWH 2ZG3A 3S96A 4M7ZB 1OL0A 3I85A 3EBAA 3BEWA 4OI8A 1PD6A 5JW3L 2VAAB 5FYLL 4JPKL 1UEYA 3VFMA 1AC6A 3CDCA 4ONFL 2BVYA 5HDQL 2Y06L 1HINL 5B38G 5I1CH 5KSBE 1AGFA 1MNUL 5EWIL 5GZOD 2CIIA 3WS6C 1FFNB 2MOVA 4JY4B 4F37F 4L4TA 3BIKA 2XIDA 2NW2A 2YKLL 5D70L 3NZ8B 3P11L 1P7QD 4RRPA 1WZKA 5FOBB 5F6IC 4ELKB 5CFHA 4YHNB 5FYKE 3T2OA 2DIAA 4ERSL 1TJHH 3TYFA 5DJ2A 3GSUA 4RFEA 4POZC 5HTSA 4Q9QL 2R0LL 3G6DL 3U9PH 1BFVH 4PTTB 1FLTX 3HNVH 4NJ9L 3VXQB 5E6IC 5DEGB 1VFBB 3L5IA 3RVWD 4GAJH 1DBBH 2UVEA 1T1XB 2FSEB 1ONQA 1A6UH 3VXRE 2DLFH 5SV4A 3HCVA 2F5BH 1AGCA 3VDAA 3WFDH 3MOAL 5FHBH 5LQBL 3HPJB 4LAJH 1AR2A 3N1MC 2EDWA 1KEGL 2FYYA 3O8XC 3OJMB 3V6OC 3KJ6H 1RZJL 5T1KA 1A6ZA 1BECA 1P7KA 3RBSA 4L29B 4JDZB 2LTQC 3W0WA 5IWLA 4XP5H 5D2LF 1WAAA 4JGMA 5DMKB 2X9YA 5GGRB 1BAFL 1TVBB 5C71A 3AC0A 4TNVK 1OP9A 1MAML 3V9FA 3CFDA 1DLFL 2R56L 3RKPA 5C0CD 4Z0BL 3DTXB 5E56A 3AFLA 4A6YL 3OXRA 4KQ3L 5HYEA 4LAQH 4CKVX 3QFJA 3MLYL 4QXGH 5AZEL 4O2FA 3MLXH 2P43B 3FB8B 3GMOA 5D71H 3MRRA 4I3RH 4YFLF 4HCRA 5E00A 2FJHB 4Y1AA 3RUGB 4K8RH 3TEUA 2F74A 4ENED 3P0YL 4KJPC 3MRFB 3RPIB 3BPOB 4RMUA 2HLFD 5I71B 1NSNL 1H3TA 1ZVYA 2HKFL 3UTQA 2XPGB 2E3VA 1MFBL 1KB9K 3OSKA 5CHNB 3CFJA 5CEZE 4DZBB 1IL1B 3H9SB 4LKXA 5JOPE 2WWMC 2H3NA 1Y6NR 5ICXB 4P59L 4PRBB 4IIQB 3B9DA 4IRZL 4NKDB 4X6DF 3SOBH 3V4PL 4HSQA 3B4NA 3IDYB 1SJEB 5I74B 5ANME 3F7QA 3BP4A 4P9MH 1T22A 2PUQT 1QBLL 3LRGA 3QCTH 3BRFA 4WNQA 2IPTH 4I13B 3DO7B 3QISA 4OZIE 4YXLH 3CFKB 1BJ8A 2VDOL 3EYFA 2DTML 1QNZL 2XN9B 5SWSE 1WAAF 3GSNH 5C92A 5KJRH 5DRWA 2JIXD 1FL6B 1PZUB 1U8MB 1BBJA 2VSDA 4IMKC 4P9HL 3BW9B 3BXNA 1EHLH 2CXKA 1NUFA 3RA7H 3TVMD 3SBWC 1U41A 2GUOA 2GTWB 4JFHE 4MA8H 2Y6SD 4LDOB 2XKUA 3KPRB 3WXVL 4XH2B 1J0IA 1JZ7A 4DKEH 1FVEA 3BE1H 5EC2A 2AJ3B 1UWGH 1RUML 3TA3D 1SMOA 1RZFL 5FYJH 3PWPB 3F7VA 1DBKH 1FBIH 3DUUA 2ZUWA 2H32H 5JR1H 4QEGA 4GG6F 4XXDB 3R8BB 5E2WL 4FFWC 4LQFH 5T1LD 2GFBA 3VFTA 1RVFH 3SDDA 4GBXC 5BJTB 3A6OA 1FFOA 4RNRB 1LDSA 4P5TC 4LVNB 1XF2A 1NLDL 5D9SA 4MSWB 3VXSA 4P4RA 4YXKH 2NY0D 1PY4A 2P8MA 2R15A 1IEHA 3OAZK 4KK9C 7FABL 3U9UA 2DQIH 1R5VA 5TF1H 3GJFA 3LKQB 3S3PA 2JK5B 3F7YA 3CPLB 1SBSH 3RRQA 3FT2A 5HHXH 3QG7H 4I2XE 5IVXE 3CXDL 4G6KL 2IPKB 1NFDF 4XHJD 3NACH 3MV9D 3WSQL 3TO2A 4ZTOH 3HR6A 3EKCA 1NDGA 4JRWA 3AU1A 4MNGA 5KS9F 2IWGA 5IT2L 2VZSA 4MWFB 1P69B 4PRHE 4XP9L 1NGZA 4XBGB 2R4RH 1J7VR 4G8IB 3RQ3A 3TBTA 4PUBL 3K1DA 1MJ7L 1KTDB 1FIGH 1F8TH 2BSSB 4OKVA 4PB9L 1M71A 3SGKC 3KJ4B 2UZIH 3WUWB 1YPZB 1Q9KB 4OCYL 4ZOCA 1ZHKA 1XCTA 3TZVD 4G42A 1MCFA 3O8XB 4XP5L 2DQEH 4BFIA 5EIQA 5GGVL 2D4DA 3T4YB 2NTFA 4NRYB 4MJIB 3U4EB 4UQ3A 1BQLH 3QIWC 1S9VA 1HQ4B 1YEGL 2FBJL 1YPZE 3MJ8A 3PIQB 2YD3A 2COQA 5C08A 3DROA 1RK1B 1A7QL 2IAMC 1QLRB 2BVPA 3MLRL 3A6BL 3SGJC 4NT6A 3S37H 4P99A 1DBAL 1KOAA 1BD2B 1DQQB 1QRNA 3V6FB 4KKLC 1P6FA 2GW5A 2D7OA 4HXAL 1FN4B 5IJVA 4EKXA 1XR9B 4ENEC 4QKXB 5IF0B 1KB5A 4NFBA 3UO1L 5I2IB 1T7ZA 2ZWLT 3PJSA 2XZCL 2VQUA 5EU6A 3IKCA 3RKDD 4RSVA 3QHZH 3KLHC 4RFOL 1OAQL 3QB7C 4LMQI 3UTTE 1GOFA 1BIIB 1IGIL 4QHKI 4U1SB 4QXWA 3ZDYE 4H26B 5IK3A 5E2VH 4NUGH 1I1FA 3ZT7A 5H2BB 4KC3B 1MPAL 4MVBC 1BFVL 5KBNC 3G6JE 3PGDB 5K9QG 1JWMB 1MPAH 3ZSSA 4DGVH 3ZYOA 3LDBB 5KOVC 2NY6C 3LS5H 3IFPB 1SJXA 4UINL 3VXRB 5D72H 4KQ4H 5D1ZA 4UU9B 2AXJA 4Z76B 2XWBB 3IDJA 1R3HA 1ZKAA 3BHBA 1ADQL 5A40E 2R9HD 3ZO0A 2C5DC 5I1JH 5EPMA 2VLKA 2JCCE 5IB1A 3JXAA 4QOKA 5DTFA 4R7NA 5I1JL 2BY2A 3O6FB 4G6ML 1VFUA 3C87A 4UMGA 4W4NA 1A7PL 4XC3L 5ITBH 4X4ME 3JTTA 1A7RH 4PRDB 1QSFE 4FQLH 5IQ7L 2IBBA 2EE2A 3HAEH 2EYTB 4UDTA 3I84A 1UM4H 3KWWB 4DKEL 3B9EA 4HK3J 2VL5A 4D9RD 5MERB 5I30L 1OGAB 2XXCB 3HE6B 3SOBL 2I26N 1YN7B 4FZEL 4LDLB 1GH7A 2ITDA 4XB8A 3RVWC 4MJ5B 3IFLL 2NY0B 5D7IF 1YEDA 3SCMD 4F7MA 2XI9A 5FO8A 1U8HB 4ODUB 3PDOB 4XP6H 2MKLC 5TGBB 2D9QB 2B1HL 2A6JB 3SKNB 1FNHA 5F70A 3I3BA 4OZIA 2EDJA 4PJIB 5DI8A 1YMMB 3K1KC 4DK3A 1MJ8H 5LJYH 1MHCA 3V79C 3P2TA 2YD5A 4GUPB 2IBZY 5TQ2H 3IFNH 2HP4A 4NQTA 2R2CA 2VWEC 2AEPL 1MUJB 3M1BB 3SDAD 3H9SE 1CFVH 4WI2A 4QRPB 3MRBB 3GHBH 3VJ6A 3TIEB 4LCWB 5JORB 1PSKH 3SE3C 3D69B 4PRNB 4YGAB 4PR5B 4HIHA 2KBGA 2NR6D 3L3KB 3WKNA 4P57B 5C8JA 3WHE1 5AYUH 1LO0H 3LIZL 3HPLB 4CBPA 1NBZA 1R3KA 1A3QA 2ZPKH 4RAVB 3T0XA 2VLJE 4PRIA 5CLWA 2K3TA 3KYOA 4Z5RA 1HHKB 4K23H 1PY9A 2ZNWA 1C16A 5EUOE 2GKIA 3PXHA 4WHYG 1ZEAH 4POYA 1F8TL 4K8RC 5MEQB 1TLKA 4PTUA 1J8HD 3EAKA 5LCVH 5K9OA 5K93A 3TT1L 2R69L 2FJFA 4U6YA 1CU4L 4GRLD 1MLBA 1MQKL 3NCEB 3QQ4B 3IXTB 3KYKH 5IEHA 4JM2B 4NZRH 3ESUF 3L5HA 3UYRL 2PW1B 3FQXA 4TNWK 5DRZA 4WJ5A 1E28B 4YHOL 3ARQA 4N90D 3LS5L 3HC0A 3CUPB 1OD9A 4FQPA 1BMGA 3LEVH 4YDVB 2D2OA 4L9LC 1F4XH 4QRRA 1DFBL 3Q6GH 5BV7C 3LRSA 4EBQL 3MA9L 2AXHA 5T3XD 1T03L 1HEZB 4A2LA 4LEOA 3BGFB 5E2JA 2FECL 3EOTH 5E9DA 3BT2L 3SY0B 4F33B 1GGYA 1HINH 1KGCD 4XCYB 3UJIH 4HKBA 2DDQH 3ILQC 3MLTA 3PE9A 2F53A 3O11A 1CYGA 4U1LB 4PBXA 1OAUL 1GOHA 5F7WC 2FEDC 4HIJB 5F93C 4JFDE 3FRPA 5IW1B 1Q9LB 5IW6A 4TUOA 4WV1A 1HE7A 5K9KB 3ZTJH 2R0LH 1G6VK 3BQUB 5DK2B 2CO7B 3O6MH 4X7TB 4CVZA 3FB5B 3K2MC 4RBPH 4U1LA 4E42A 4W70A 2F53B 3O11B 5CEXB 3BZEB 3A6BH 3PNWA 2CKBL 3BPNB 3S4SA 3MLWH 3C09B 5C6TL 4ZYKB 4WCYL 3ZE0F 43C9A 4HMCA 2BP3A 1GGTA 4U6XA 1I9RL 3UZVB 3PHQA 4KI5D 4QHLB 4GAGH 1QYGH 3P0YH 3NIDE 3S35H 3GBML 3C5ZA 1M7DA 4P3CH 4YDVA 4GRLA 4NBZB 3SGDH 3CXHJ 5I8CA 3HC0B 4CN1A 3OAYK 4YHKL 5E1HB 4WJ5B 4BFEA 2PW1A 3WEXA 3T4AA 1HCVA 1TPXB 1EERB 2MQ0A 3S7GA 5IEHB 2FLBT 2H45A 4H20H 1YDPB 4WWID 2QQKH 3GRWL 3RTQD 4JHAH 4PRHB 2Q86B 1NUGA 5I19H 5K9OB 2D9CA 3KYNA 4JFEA 4AL8L 5F71A 1AP2A 2GSGA 4HIEB 1YNTB 5I0ZA 3L3DA 4Y4HD 1PFCA 4H88H 1B6DA 5GRZA 5SWQB 1OSPL 4NZUH 4FQHB 4KI5E 5EOTB 3RBGA 1AQKL 2BVQA 2LAGB 4HGWB 5GJSH 4GAFB 5FXCH 3CXHK 2NY3C 3QNYA 3BDYL 4TVPH 3VRIB 1I7RA 3F7PC 3K8LA 3UMTA 1U58B 4BFGA 4JCLA 1N6QL 3JUYA 1G6RL 3FL7A 3VMOA 3ROLB 1DEEB 4PR5A 2WIIB 3RGVB 3B2VL 2WW8A 3G9VA 5DSCA 2FEEL 4Y5XB 5CCKH 1BBDL 3NABH 4NUJA 3RZCA 4KZEH 3STZA 2BNQD 2LU7A 4ETYA 2A73B 4Y2DB 1BWMA 1JNJA 4N0FB 3SE3A 1H3UA 1GGCH 3ARXA 2ICWI 2KH2B 2Y72A 4BQ9A 4CN4A 1ZA3B 4GUPA 4J7RA 4RA0C 5KVDH 1A6TB 1NBQA 1SYVA 5T3ZD 2JB5L 3QWQB 1N7MH 3HC3H 4XAKE 1OGTA 1YYLL 1NC2A 3KPMA 2EKJA 4XRCA 5HVGB 1OSZA 2O61B 1OARH 3PDOA 2PN5A 2IH3A 1PKQB 2FHBA 1D5XB 4TN9A 1UH2A 4XVTH 2F53D 4O51A 1CGTA 4DGIL 1N5YL 2HVKA 1INQB 3RP1A 3VFWB 5J3HC 3DVIA 4JDVB 1OGAA 1UB6A 2XKSA 5F6HJ 3KWWA 1JPSH 1V3MA 3LN4A 2EYTA 4PJBE 1GAFL 4GLRI 5JA9A 3NTCL 4O02H 4OZGE 5D7JA 5J1TC 2F8VA 3PABA 4PY7B 1BQHG 1FC2D 5LVEA 5EO1B 3O2WH 5FYJD 3LN4B 1AY1H 2YD1A 1INDL 3BHBB 1RUQL 4ZS6D 1Z9LA 3IDJB 1M7IA 1LP9B 2XWBA 1UG9A 3IU4L 4UU9A 5D1XA 3LPFA 2X70B 1L7TL 1QFHA 5HD8C 4HV8A 3TJEL 1CLOH 3REWA 1RZ8A 2W65B 5CWSA 3DVNB 1G1CA 4ZO9A 1ZLSL 2K7PA 4CGTA 1D5XA 3T09A 1J8HA 1NGXB 1DDHA 2J8UF 5ANMA 3TJHD 1KPVB 1M6OB 1RD6A 5ILTH 3PGDA 3FO2B 3KPMB 2AI0L 4N9GA 4DN4L 3EYSH 1CGYA 5KTEL 1ND0B 1MFCH 1A6TA 4X83A 4LRNH 1U2HA 1F11A 3LSOA 4IJ3C 2ED7A 3MLRH 1KIQA 4M1DH 2BMKA 2BCKB 5FM5M 3NGBC 2BRQA 5D6CB 1A7QH 2VZ3A 3FB7B 4XNZC 1QRKA 3HI5L 1QP1A 2R23A 4PS4L 1W0YT 2J1KA 5D7KD 5TE4H 2O5XL 4LHUG 3OB0K 3O3DA 1NC4B 3E3QE 4ZTOL 1U3ZA 4M61B 1RK0B 1CI5A 2XZAH 4NT6B 1UADC 5J57B 1I8MA 3HUJE 2NXYD 1QKZL 4CMMB 5DVNA 1LP9E 4B0MM 1OLZA 2V9QA 3G08B 5JIIA 1OTUC 1KEGH 1ZEAL 3TC9A 1EGJL 5EUKA 3O8XD 1FIGL 4CU8A 4YHKH 4UQ3B 1KT2B 3T4YA 3QDGD 3SE4A 1WAAE 4EXPX 2OSLA 4NBYB 2ZKHH 5D96B 1MCQA 4NJ9H 4Z9KB 3DYMA 3ZL4H 2GK0A 3WUWA 4GAJL 5CD5C 1LE5B 2B4CL 3FKUS 1GJIA 3FQWB 1CXIA 2F8OA 5CJQH 2OXHA 1EHXA 2DI8A 4XAWL 3MLWL 5CJQL 3ZSTA 4J4PA 2ICWA 4X6DB 1XMWA 3QI9D 3QIUA 1W72A 5AG9A 1JHTA 2EIZB 2P5WD 1OCWL 1JMXA 25C8L 3RIFK 3UJJH 4X5LA 1JGLH 3AU1B 4LCUB 1UM6H 4UNVA 3B3IB 3SO5A 4PJHE 1G84A 4XVSH 3OL2A 1QO3A 5JIHA 1YEEL 3DX9B 3MV11 5ESAA 3QJFB 5MENE 3P0GB 43C9B 4IIQC 4G9FE 3FOLA 5HGHB 4KKCC 1EEZA 3WBDA 4UIMA 3QWRD 3KLAA 4R2GD 3BZEA 2F58H 5C7XH 2ITCB 1QFWL 5ISZD 2M2DA 3PV6B 3NIDF 4RZCB 3TNMA 2AEQH 1XF2B 1YYMH 3KXFE 4HT1H 1NCAL 4CNIA 5I66B 1NL0L 2XZZA 5T1LB 2Q76B 1LILA 1OSPH 4NZUL 4EUPH 2R2BB 1A0QH 4TUOB 4V1DE 3VFTB 1VGEL 5CILL 1NCTA 4OF0A 4HIJA 2XY2A 3QIUD 4UV7L 4HKBB 2W59A 2DWEB 4M9PA 1SQ2N 2A0LD 4YXKL 3WIHA 4J6RH 3O3UN 2VIRB 3SJVE 4P9HH 3V4UL 3HZYB 1CDJA 1D9KC 3ZKXC 1FVEB 3EJYC 1LEGA 2PXYA 5E8DL 4IOIB 1ACYL 5TE6L 4X7EC 3GJFK 2ICCA 4ZUWA 3RDTC 2VDML 3SCMB 3ARWA 1RU9H 5DWUH 4F7TA 2H9GA 5HDLA 3RNQA 3FQXB 4X9GA 1E6JH 3DGGA 3F5WA 1S7UA 5I76B 1MAMH 1F4AA 1CE1H 3IXTA 5DMIH 3X12B 1D6VH 2AV1A 4P4KD 4Z0BH 1HN1A 2E7LA 2AJZA 3RU8L 1T4KB 4WNQB 1FFRA 1KN2H 5FYLD 1HWHB 3P73B 3D25A 3BGAA 5DZNA 2MCG1 3G6JB 3QZWG 4R4BB 4Z8FH 1ZT4A 1HHKA 3WFBL 3MNWB 4OQ1A 5GGTH 5IUSA 2PYEA 5F7YC 1JPSL 4X4ZA 1GGUA 4LCWD 1D5ZA 3LB6D 1AD9A 4DZBA 3QRGH 3FQTB 5HHMD 3KGRA 4V2BA 3DXAB 1HDMB 3ZE1E 3L3KA 1HHIA 3MROA 4ORGB 5I1GH 1WZMA 3D69A 3MLUH 3WFDL 1X4YA 4M6MH 3SE9L 5CGMA 1YY9C 4QRPA 1N0LA 4QYOB 3GI8L 2AABH 3MRRB 1MCHA 3FB8A 5EU4A 1N7ML 5JQHC 5FUZH 1CE6A 3JSSA 1C12A 4IRJB 2MCPH 4M4PA 5EWIH 4PJ5A 3ZHDA 1QLEL 5HDQH 2G60L 2E9IA 4X80L 5ESQA 1T3FB 5E08H 1P7HL 1YMMA 5BV7H 1IGIH 3RL1B 2A6JA 3S37X 2P5WE 1JVKA 4NKOB 3WFHB 2AEQL 1X7QA 4NZRL 1W8OA 2I5YL 1Q9OA 3KYKL 4F9PC 3VWJC 1CN4A 5J12C 1A6ZB 4J8RB 4I9WE 3FQUB 4IEFB 3FFCB 4WI4A 4YDIL 3HA0A 4Y5YC 35C8H 2LTQB 1U93B 2HH0H 2EIEA 2VL5B 5HYJD 2BHUA 3DECA 4KV5E 4AIOA 1QFUL 4DN3L 1U42A 1V3LA 2PW2B 2V9RA 1B0GB 4OV5B 5FYJL 5J6HA 4LKCA 3FFCD 5EZIH 3K80A 4TNWF 1WIOA 4N5ED 4OGZA 5D2LE 3QUKA 4PJIF 3KPOB 1BREA 4EXKA 4JQVC 5F7KC 1RZJH 4OLZL 4Z76A 1BJ1J 3NIFF 4RFOH 3QO0B 4GBXA 3UJTL 3DETC 3S5LG 5IB5B 1V3JA 3L9RB 4NHUB 4RFEB 1JV5A 2W0KA 5IMOA 4OFDA 3ZL4L 4R97B 4R26H 4OD3H 4WUUA 1E4XL 3T2QA 2C3GA 1TQBC 1QFPA 1DE4A 4KHTH 2YUXA 4OLYL 3K46A 3DYOA 1EZVY 4U0QB 1I1FB 4PP2B 2BXYA 3ZKSD 1OAZL 2IAMD 4I18C 3ALPA 3QUZD 4ZAKB 3NIGE 4TUKH 4KK5C 5B39B 1X5IA 3AY4A 3ZHLA 4FQXA 2L0DA 4IS6B 5E95B 3VH8G 4QNPE 4NO5A 3UTTD 2NY4C 4JB9H 4JZNB 3KYMA 5F3HA 1Z0MA 4AEIL 2YPLD 4U1MB 3K2UL 1KNOA 5C0RH 3KPSA 3RWGA 2FWOB 3SGEI 1QRNB 2N1KA 3V6FA 3P3YA 4MD5B 3IDYC 1QLRA 2BVPB 1MRDH 1LEKA 1KCUL 4PRHD 3DROB 3FT3B 3MZGB 1Q1JL 4RGNE 2C9AA 4U6TA 5F89B 1HQ4A 3QIBA 5JOFA 5JO5B 3EOTL 4U1HA 1R5IB 5CSBA 1BAFH 1WITA 2AV7B 2HKHH 4OZGB 2V5YA 1SVCP 1MH5B 1YPZA 2YD6A 4DEPB 3QNZB 1D3CA 2EDEA 5HD8D 1VFAA 2ZUYA 2NY6B 3H0TB 1U95A 4YBLB 4PRAA 5F9WC 1NGZB 1UA6H 3BH8B 5GZND 1A4JB 2P8PA 3E6FA 4Q0XL 4G43B 5C3TA 3WO4C 4JQIH 2PXYD 1CF8H 1T80A 7CGTA 3DRQA 1CFSB 4Q2ZB 3TBYB 5J56B 2X4UA 5GJTH 4LVEA 3WD5L 4JFZH 3Q2CA 5D7KE 3NCJL 2IG2H 5CP7A 1FCCA 5FA3A 3WMSA 1FBIL 3SKMA 3GBNL 4J1UA 5KSAC 2IAND 4O2EA 4JO4L 4M7KL 4S1RL 4XPGH 3U2SA 4OZFG 1RIVH 5E6ID 3OKNB 4JANA 5JW4R 8FABB 2ZG1A 4MSWA 3VXSB 3TBYA 4WUUE 4JO2H 4NO2B 5EUOA 3LEXA 3L3IA 3OXSA 4YGVB 4OIIH 2P8PB 4FQ1H 3SDDB 5E2UH 5F96H 3VXUB 3ULUE 2VXTH 3IFNL 1F02I 4JFOB 3O4OB 3ULUH 3HI1A 4NWUH 5EU7E 1R3LB 3DUUB 2A9ML 1JN6A 3MRLA 3VFPB 1GXEA 4NZJA 4OZHA 4QY8B 1WCBB 4K07A 1V3KA 5HDOA 1WC7B 3GMNA 5D2LB 3EYVA 4XCNB 5C0AA 3RVXD 3HMXH 1TZGH 1NAMA 4LEXL 5FB8B 1FE8L 3KPRA 3RWFA 1QSFA 2DKSA 1I9RH 2GUOB 4WFGD 5H35B 5EOQL 5CEYB 5L8LB 1E27A 3C8DA 1FO0A 4Q97A 5B3NA 5DMGC 2ZUQC 1QEWA 2AQ1A 4HS8H 3BW9A 3IU4H 1JK8A 4FFZL 5D70H 3BGMB 2H1PH 4RWYH 4GG6B 5J1AB 4LLWB 1EJ6A 3ALXA 2HLAB 3QIUC 5DRWB 1NGPL 1T5WA 4OF8A 4S2SB 3KPSB 5F21B 2IADA 3D85D 1YEKH 3HZMA 3DO7A 4U1MA 5HGGS 3ARDB 2AKRB 4WUKH 1J5OH 1T22B 2VXQL 1WVZA 4LLDA 3VRJB 3S36H 2ZCLH 5GS3A 3GRWH 4FFWD 3MV8D 3CLFL 2YMXL 1TJGH 2A83B 5DVOA 4RISH 5DQJA 4M3JA 1Q9WA 3ILQD 1ZHBB 4IIQA 4UINH 4PLKC 4LSVL 5CBAA 1ADQH 4XNZB 3KAAA 5GS1C 1JWUB 2X2YA 3Q1SL 3WJLC 5CHNA 2WUCL 3LKNB 3VFGH 2VABA 4FTVB 2YUZA 4LSTL 2KZ1B 4WUUB 3C6LB 5IBUG 2FR4B 3UZQA 3VRLE 3OJDB 3VXPA 3D85A 2F74B 3L9RA 4LLYA 3STLA 1CG9B 4DKAA 1K5NB 3P11H 3OKEB 4EI5A 4KK5D 1E4JA 2Z35B 1U8KA 3O4OC 4UV4L 1J9CT 1JWSB 5A2JH 4LASL 2ZKHL 4NQCE 1GZQA 3FZUD 4JFQB 3CFDB 1B0GA 3VMNA 3TV3H 3TT3H 4JO4H 4M7KH 4S1RH 5L0QB 1KFAH 1MAKA 3M17B 1J88A 1DBJH 1FSKC 3Q0HA 4FABH 2NCMA 3VXME 4RGNC 4OGXH 3GHEL 3VXNB 1ZLVH 3OGCA 2Y25A 1IM3A 4HUNB 2QEJA 4PJ9D 1A6UL 3WFEH 4P5MA 4KAQL 3QUYB 4OIIL 5FYKH 1OW0A 1P7KB 3GSNL 5AEAA 5C0JA 4WU7A 4KVCH 4P5MB 5F88A 4WW2C 4X5XB 3O6LH 4HX1A 2A9MH 5DD0H 2CSPA 4MAYD 4RMTA 1BM3H 4J3SA 4MNQE 4HLJA 5DJCA 2BVOB 4KUCF 3BKJL 3MO1B 3WNMA 2E9JA 1RSFA 5KZCD 4P4KC 3L1OH 2EIDA 4P59H 2IANE 5ESQB 5IFAL 1HIMH 4M1CD 4OCRL 1A22B 3QP3A 2GJ6E 2AK4D 2DQCH 1OAKL 5JZ7C 1VFBA 3MGOA 1SY6A 5MI0B 4YHMH 1J8HE 3B6SB 4M1GH 1BJMA 4D0BA 2C4FT 3ZDXE 2IH1A 3D85B 1JRHH 1L7TH 1EAPA 2XN9E 5SWSB 3HNSH 2J3SA 3T0EC 5BXFA 1ZLSH 4JN2B 1EJOH 2VABB 4NFDA 3NCFB 5MP6L 3DXAA 4KKLD 3CD4A 1FFNA 4DOHE 1D5ZB 1JWUA 3PQYA 3VA2C 4JJHA 4HLZH 1X44A 1Q9WB 3MNWA 3RWEA 4R4BA 4PJBA 3MJ7A 2HMID 3O0RL 4JAMA 4EIGB 4PBWD 4UB0H 1BP3B 1UWXK 4H5SA 3P73A 1F5WA 1MVFA 4YUEL 2C3HA 3HZMB 1A6PA 2E6PA 2IG2L 2NW3B 2ENSA 4I2XB 2WWKO 4OQTA 4YXHH 2DJUA 4L8BB 2HLAA 3MXVH 3OKYA 5JUEH 2RCSL 4Y5VC 2IQ9L 5K9QI 4PRPB 2H9GB 2OMBA 3DV4A 5HHME 4NJAL 1G9MH 1QEWB 3FAXA 3VFNA 5HDBE 4N90E 3L5WA 5CS7A 2EC9U 5IBTL 2JELL 3ET9F 5FB8A 1LEGB 5LAXB 3CVIH 1T83C 2P1YA 4KMLB 5B39G 4UDUB 2A6KA 2W0FB 4LSPH 3RWCA 1FNEA 5F7LB 3KPTA 4WWKC 4NM8L 2YPLA 5TE7H 3HC4L 2DQEL 1V7NL 1IAMA 1NGQL 2XWJB 3EHBC 4YHOH 4ZSOA 2WZPD 3U9PL 3ECBA 5CZXD 4FFYH 5TQ2L 4ZFGL 2FHFA 3AB0B 1T1YB 2YR3A 4JZOB 4CMHB 1VKXA 3VG9C 5K9JL 3ZTNL 2VLKE 1DUZB 4FXKB 4JFOA 2V2WA 2BOCB 2Q8BH 5GJTL 4ODSH 4JO3L 2PO6D 4M5YL 5T1LA 1S7VB 5I66A 4DW2L 3LH2L 3TNMB 4O5LH 3S3JA 5HSFA 1QYGL 4OCMC 2WBJD 4LPCA 3T0BA 2O93L 3BD3A 5EZIL 3MXVL 4EN3A 4Y5YB 4FG6D 3UPAA 5EG6C 1NGPH 1OVZA 5TDOA 3VWJB 3OTTA 3V0VB 3FOLB 2HFEA 1I8IA 3FB6A 1WT5C 3ZDZE 2YD9A 1KC5L 4PBVC 4WTWA 5EBMB 1MCCA 4M02A 5I19L 4Q2ZA 1F45A 4LCUA 3FRPG 3BJ91 4G43A 1UWEH 4FMKA 3DSNA 4XBPA 1JHTB 2EIZA 4GG8A 4XGZA 3GSXB 4OLYH 1MQKH 4LMQE 3IAPA 4KQ3H 4K7FA 5HYJA 2ICWB 4X6DA 4I3SL 4ZFZA 3V6OE 4FS0A 4P2RD 1PX3A 3FQWA 1I9IL 3QNZA 5GHWL 4XWOD 5I6XC 2W9DH 3VFSB 3L3HA 3H3PH 3TFKC 1CGSL 4TPRL 3CX5K 4Y4KC 1QLFB 4OZGA 1BFTA 2XZCH 4JZJC 3OR7B 4NQEB 3MRNB 1RIUH 3TM6A 1UH4A 2NY7H 4R7DB 3OG6B 3B9KA 2Y7QA 5ADOH 5DRNB 1WV7T 2CLVB 3QUML 4JO1L 3TCXA 4GRWB 4OZFH 2VJXA 1EMTL 3BMVA 2NX5B 1TVHB 4D3CL 4F9LA 5HPMB 4GKOA 5EUKB 1I7ZB 4N0UE 3ZKMD 4RCAA 4OFYD 3MLUL 3L1OL 1SM3L 5EZOL 2MSPA 3HB3C 1G9EA 1XGYL 3ZYIA 1LEKB 4WW2F 1X4XA 2AXGA 1Z6JT 4RIRA 1RHFA 5FIEA 2J6EL 1I8MB 4Z0XA 1KFAL 1RK0A 1I75A 4OGAC 4TULH 1AR1C 2FWOA 4DOHB 2Z4QA 4XMLL 3EFFA 2IAMB 1P4BH 5KN5A 2P7TB 3ULSB 5J11B 2BSED 5IJKA 3TBVB 3ARRA 1QD0A 3QQ3A 1MFAH 2VLJD 2VDOH 4L4VD 2BCKA 5AZEH 4IS6A 3UTTB 4OFYA 4XVTL 4MX7B 3WE6B 4K3HA 2X1QA 4FQQA 1G0YR 2DQTL 5JHDE 4F57H 4GMSH 3E3QC 2UV3A 1FAKT 3MGAA 1MF2H 5DUPH 4JB9L 4N9GB 3HZKA 1FHGA 1UA6L 2B0SL 3TA3B 1SYSA 3HLAB 1IQDB 4Z7NF 4QHKJ 1KIRA 4HWZB 4MAUL 4Y5XC 2OR8A 1MFBH 3HG1D 3CH8A 4JHWL 4I4WB 5IB5A 1RJLA 4TSAH 3K7UA 4LVOC 3QO0A 5TFSL 2V2TA 3LOWA 2JKXA 2HN7A 2X70A 1I1AA 5DLML 1CICB 2GJ6A 4LSSL 5GS2H 1I7TB 3OPZH 4XI5D 1GRWA 2CDGB 3FOMA 2NY0C 2PNDA 3QUKB 5JW3H 1H8OA 2XG5A 3KG5A 3SGEH 2OLDA 4NSKA 4HEME 2MWCA 4MXQD 4GO6B 5J6HB 2Y06H 2X41A 3GB7A 5DS8A 4LSUH 3SN6N 3JBG7 2I9TA 3L5XH 4M8QA 2WM0A 4G3YH 1VACB 3BPLC 5CKGA 1VB9A 3GM0A 5AWNH 2D3VA 3FT4A 4HS6A 3H3KA 4MQTB 3AMLA 5BVPH 1XIWA 4JPWH 3VFWA 1AKJA 4CAGA 2BDNL 2DYPB 1FZJA 3ARVA 3TO4A 3NZHL 4KI5F 2BDNH 3BZFB 3BX7C 1OAYH 4HUXA 2V2XA 2J4WH 5DYOB 1X7QB 4DUWA 1TTGA 3T8XB 3W82A 1OSZB 4GAYA 6CGTA 2QLVB 2BFVH 1NC2B 3KPSE 3H3PL 3MYZA 1FO0L 4S1SH 1JPFB 2EYSA 1P9MA 1SYVB 3IKKA 3PGCB 1KB5H 2B8OT 4UBDD 4JRYE 4L4VA 5DHYA 1YY8B 5DJZB 5DEFB 1H3PL 1C12B 4IRJA 5GRVL 3LN5B 4O4YH 5DJAA 1CGXA 1HHHA 2HJFA 4WHTA 1WUNT 4OFIA 3X3FL 1R5WA 4WRLA 3FCTA 4MJID 5BZDA 1O7VA 5KVMC 4OV6F 5DSCB 3VRLF 2G60H 4X80H 4R4ND 2DIBA 3P30L 2X1WL 2B7DT 2VDPH 3ROLA 3DPBA 4ZFGH 1U58A 4XHQA 4PJBF 5D8JL 5DURD 3TZVB 3ULUL 5TF1L 1AD9B 2M26A 3O9WD 1EX0A 5CJBA 1ZS8B 3MGTB 1UGNA 4J4PD 1C5BH 5KJRL 4FHBD 4TSCL 3BIAX 5KAQG 1ZT4B 4YDIH 2DKMA 2GSGB 4K3GA 1K4CB 1HKLH 3RAJL 4TVPD 2WV3A 4DVBB 3D25B 3QDGE 1G9NH 2LVCA 4OZIF 1ZV5A 1JFQH 1F97A 1PVHA 1T4KA 3QPXL 4B7IA 3VDCA 4F3FA 2AV1B 1X5YA 3CAFA 1K8IB 2PTTB 1JNNL 3UJIL 5GS0D 3C5JB 4Y4HB 4XP9H 2C1PB 2E5EA 4P2OC 1XR8B 4X5WB 2R1XB 4K7PL 1X9QA 5I76A 4QXUL 3F5WB 1T1ZB 2YSSB 5A43C 1IC7H 3KJ4C 1A14H 1B9ZA 5I8CB 3CC5B 1SM3H 4GOSA 1M7DB 4LGSB 4TVPE 1S3KL 1M05A 4Q9CA 3QUXB 3QXDB 4QCIB 1UC6A 2QR0A 1A5FH 1AJ7H 5GS0H 4ZXBA 1CBVL 1A0QL 2V7NA 5DVLA 1A5FL 1AJ7L 1EEYA 2XV6B 2QADB 3U0WL 1QSEE 5A2IH 3CFCH 1U8LB 1RURH 2ZUTA 5T1MB 2VYRE 2NY5H 4MMZC 4EUPA 1HXMA 4XWGL 1S7QB 1BQHA 4TTGA 1DBAH 1QRNE 4PG9B 4QHNB 3HUJF 1QACA 1AGDA 1FPTL 1KF9B 1PG7W 3GBMH 2JLLA 3V4UH 2CXGA 3ARPA 4KXZI 3UEZA 4XCFL 1JFQL 5IROA 2Q76A 5E7FA 2MHAB 4QXTB 4JKPL 5LGJB 2XZAL 3K2UH 2A6IB 2X1OA 3HS0B 2ITCA 5DDHA 5HYQB 4P5KA 2X4OA 3QXUA 1WBZB 4X7CC 1OPGH 3SDYL 2XZQL 2YD7A 3B2UC 5E9DB 5BRZD 3OKOA 4ORZC 5HGHA 5L8JB 1NCDH 1HEZA 1KCKA 4C56D 5FHAL 2A6DA 2W07A 1EIBA 3KXFA 4K94H 1RUQH 3G5YB 3G6DH 2JJSA 5ISZA 3C5ZC 3MV7E 1U9KA 4N0YL 5F9DC 5FECB 4WTZG 5C0CE 1BQSA 5CJXA 1UXSB 3SO3C 2EIBA 2YPKB 1IAII 1MIML 4FQ2L 3TFKD 1ZLWH 1OARL 3CFBB 1QNZH 3SDDC 4J23A 4KZDL 4KRMB 3VGFA 4BSVB 5DA4A 1F4WH 1FFQA 5D7SH 4ELMA 3MPCA 4GAGL 4UBDC 4HWUA 1X5JA 2VZOA 1OGAE 2E8YA 3SGDI 1LE5A 2FZ3A 1FVDA 4JPWL 1JGLL 4KRNA 3RDTB 3T08A 2DOCA 3I75B 4ALAH 3P0VL 5D2NA 1UM4L 1Y18A 2OSLB 4MXVE 1T83A 2WMPA 4KKAC 3SO3B 5IQ7H 4N8VA 1JHLL 2GT9B 4C83A 1MCNA 2JCCB 2NPLX 1REIA 2B2XH 3D3VA 5I30H 5F72S 4MQ7B 3T77A 4U4BA 4OM0H 1R3KB 4PLKD 1P4LA 3G08A 3HPLA 4LQFL 4RQQB 3QIBD 2F58L 1YYML 4IMKA 3TIEA 1AQKH 4KKBC 3O3DB 3OKLB 3IVKA 1EV2E 3ULUD 3CVHA 4K9EL 2N56A 2OJZH 1T66C 3SKOA 1D5IH 5HHNB 5HHOE 3MLZH 1NBYA 2ARWA 4NDMA 4JQXA 5BS0D 1F2XK 4QRUA 5E24E 4JZJA 1F11B 3GSQA 3LSOB 3S36L 3ZTNH 3N1FC 3GSNB 1MHCB 5E03A 3IYLW 2AGJL 4PJCF 1FNLA 2QSVA 4PJIA 2ADIA 1NMCC 3GHBL 3OJVC 5DUBA 3BH9A 1F3JB 1TVDA 4ODUA 3BFOA 4F15B 1U8HA 2WUCH 2APVA 1SVZA 1D9KA 1YEDB 4F7CA 3G5XA 2OJEB 3DJ9A 3AS0A 1KJMA 4JPKH 4R9HA 2E8ZA 5TJWK 5D1XB 4U6VH 2EEBA 1LP9A 1QKZH 1UZ8A 5MERA 1G9ML 1TQCB 4RDQG 4JPIB 2AJVH 4HUUA 1HYSC 5ACZB 2OX5A 3TPKA 2Y5EA 3D1MC 1ED3B 3QIWB 4X6FB 5F7EH 3EOAB 5IHUH 1RUAL 5IFJA 1D6EA 5DTFB 3L7FA 5I8EA 4QF1B 2XT1B 3IB4A 4KV5F 5HJ3B 4M8VA 1T2XA 1FYTD 5B38A 1UB6B 1CT8A 2DQDL 3HI5H 3QUYD 1A6VH 3U30B 4HUKB 2CK0L 2HG5A 2CKBH 3G5ZB 5EZLB 5BQ7A 5MP6H 4TUKL 1KJMB 2IC2A 1F4XL 3U48A 5I1LB 3O4LD 5D71L 2EXYD 2C1OB 3N1GC 2R4RL 3BH9B 4X6CA 2IANA 2J8UE 1H3PH 1CDIA 1YNLL 4UIKL 1UXWA 4XCFH 4H8WH 3CDYA 1YQ2A 4WW1A 1IARB 4M6AA 3GIZH 3HMWL 3WNLA 4AY0A 4DKDC 3QCUL 3IGAA 4LLUA 4AEHL 1OAUH 2YZ8A 4JZJB 1KCUH 5GXBB 3W0WE 1MCDA 4WEMB 5E2UL 5F96L 5J1SC 3PJSB 5GGQL 1U8NB 1A8JH 1YYLH 4MB3A 1RJYA 4NZTH 1IBGH 1XR9A 1FN4A 4PD4K 3KR3L 4LNRB 1NKOA 2HT4C 2YUWA 3DMMC 2WIIA 4ODXB 4QNPF 4ZO7A 3VXMA 3IDXH 1KN4L 4PRPD 3T0WA 4FQJL 1KCRH 4OD2B 4RQQA 4ZO8A 3R0MA 1WEJH 1CDYA 3T77B 1OP5K 3MJ8B 1LO2L 1H8SA 1RZKC 5HGDA 3D3VB 5CZVL 4MJIA 3U4EA 3CGTA 5C07D 4NIKB 1YNTA 1L4IA 1Y18B 4AEIH 1XCTB 3I75A 2A9NH 3JTSA 2Q86A 2Q3ZA 4PRHA 4QRPE 4NQVB 5EO0A 4ZFFB 1HZHH 1ZT1B 1HZHL 1N59B 2CGRL 2JF1A 4BSVA 3QI9C 4ZPTB 3LEYH 4XPFH 4PRID 3CMOL 1RFDH 2ZUVA 4XBGA 4S0TD 3WIFA 1J10A 4G9DB 4GW5A 5CD3B 3ZLQC 1F58L 1E6JL 1JGUL 1UQSA 2OBGA 5FYLH 5L2KD 1E4XH 2VDQH 1T0MB 2DJ4A 3LQAH 3B5TA 12E8L 3AAZB 1MNUH 1C08B 4Y4FB 2QL1A 3UDWC 4QGTA 1WIPA 4R90H 1NH6A 4M7JH 3HRZB 1K9TA 2JK5A 3MCLL 1CXFA 1OAZH 5LCVL 3PP4L 5GS1A 2K7QA 2D03L 1BF2A 3PNWB 2OJZL 4ZFOL 4R8WH 1WBZA 2J4WL 4R0LA 3LKPB 4Z7WB 5ESVB 3RFZC 2WP3T 4PFEA 2V7HB 4S1DD 2B4CC 2FIRT 4M6OL 3BQUA 3RHWF 3Q5YA 1ZLVK 1KCVH 3O6FC 5D96C 3OHXA 5BJTA 3LIZH 4PJXF 5IW1A 2BFVL 2FIKA 1XZ0B 4MLIA 1I1AD 3DUHA 1AGDB 3QAZC 4XXDA 4RGOH 1YN6B 2CRZA 3TH3T 2VZVA 4JHWH 5J89A 3MJ9L 1GPOL 4YPJA 2OL3A 5T3XH 3MNZB 4R2GB 4P2RB 2NY7L 1KJ2H 3BPCB 1CLYH 4K9EC 2UUDH 3PHSA 3TN0C 3VWJD 3NN8A 3NFPB 2AK1L 1CWVA 5D5MF 4OCYH 4HZAA 1YMHA 4CADB 5C9JA 3OBAA 1K85A 5C0ND 3EJYD 3LRSB 3CH1A 3NH7L 4JFFE 3RVXC 1WZ1L 5DJ8B 4P23C 4QRRB 1KPRA 2GTWA 1ZTXH 4LVNC 4NCDA 1EEUA 4JRXB 3CCHB 5C0FA 2V5MA 4RMVA 1CXEA 4X4YB 3R06B 2C1PA 2FX9H 1HIML 4U6YB 2CJUL 3CFKA 2Z8RA 5FYJE 3RI5K 2XYCA 4QHMA 5DK0A 1KCVL 1GIGH 1DVFB 2E7MA 3RGVD 5HYSG 2Q6WA 1SJEA 1RULH 1UB5A 3O2WL 4Z5RB 5FO9A 2P4AB 4O5LL 5DF0A 3LKOB 4PRBA 1U6AL 3QUZB 2OZ4A 1HWGB 3VU2A 3KJ6L 2QQNH 1CLZL 4WI6A 2DICA 5E2WH 2ESVA 4Z95H 2VSCA 4M43H 1QFWI 5C2BH 4LPVA 4YZFF 1OTTC 2VZTA 1CLCA 1MELA 3RPIA 5E8EB 5JORA 2ZOKB 3QUMB 2HFGL 2E27H 1UCBL 5L7XL 4FFYL 5BZDB 4Y1AB 1LO3H 1R5WB 4OGAD 5ENWB 3GRWA 3HE7C 1DR9A 3WDIA 3CX2A 4IOSD 2Q8AH 1R3IL 2GEEA 1FYTE 3DOSA 1A4KA 4QO1A 3GI9L 5DJ6B 3LN5A 2DM3A 3ROOB 4IMLA 2NZIA 1YY8A 4POZD 1DANT 3V4VL 3QG7L 2EYSB 2R29L 4HJGA 1F13A 1G7IA 4MCZB 3A67L 3I50H 4J2XA 4F58H 4G8GE 3OX8A 2X42A 2WLZA 3DX8A 5DMKA 2QQQA 3T8XA 5CEZH 3QPXH 5E8OA 5EO9A 1QSVA 4HUVA 5DYOA 1DP0A 1HHJA 2W91A 3VDBA 1LQSR 3PWPD 1PKOA 3NVQA 4NO3A 4WFGE 3B9VA 3EHBD 1YN7A 5JA8B 3FT4B 3MCG1 3HE6A 5DK3A 3V5DA 2DAVA 4YHIA 3VH8B 2I27N 5L2JB 1G7LA 1KLUA 2I9TB 1U8OB 4HEPG 3A0OA 4HDIA 4Y16C 5HHVL 3UTZB 4BUGA 1R0AL 3I6GA 4H0IA 3MV9A 4AL8H 4ODHH 1RQ5A 4JRXD 1KELH 1KEML 4HWBH 3ZDYF 5MHSD 1AO7A 2CDGA 3IJHA 3JUZA 4X99B 5EIIA 1R3HB 3BWAA 3JV6A 3HHRB 4BQ6A 2VDPL 1I1AB 1B2WH 2X89A 1ZSDA 5D1ZB 3MCLH 2GHWB 5L88H 5FDYA 4BZ2H 1MCLA 1MFCL 4G8GB 4QOKD 3OKKB 4HWZA 4U7KA 2Y9RT 4LBEB 4LCYA 4YHNA 4NC2B 4OLXH 3ILPA 3TJHC 2BNUB 3U4BH 2VOTA 3NZ8A 3HZKB 3MRMA 3Q5TA 3L6FB 4JY4A 3ULVL 1U0QA 1Q8MA 5JIKA 2CIIB 5EN2B 4L8CB 5IK3B 5EA0H 3RX8A 1JZ2A 4U7SA 3VI4F 2FO4B 4ZNCD 3D0LA 3SDXA 5FUCC 4E5XB 5HVFB 5T3ZL 5FM5O 1EHAA 5J6GB 3GIVB 2GK2A 4XP6L 2YRZA 4I5BB 4YBQC 2OP4L 2P7TA 3ARZA 3NPSC 5I2IA 1NL0H 3ZE1F 3GGWB 4N5UA 2FATL 3TF7C 2BNQA 4CDHA 1BD2A 1DQQA 4YFEA 4JFFA 4Z6AT 5IEKB 1HH9B 2P49B 1AGEB 1PZ5A 3MRCB 2AXGB 4TYUA 4Q6IC 1A7BA 2BOBB 15C8H 1P1ZB 4J3TA 3W2DH 4MD4B 5CSGA 3ZKND 3CFEB 2H32A 3U1SH 4HPOH 2PCPA 2NX5A 1PYWB 4PJGA 2NTFB 2FX7H 4K71C 3X13A 1TZIB 2DI7A 3SGKA 5DJDB 4X8JA 4TSAL 4G42B 1J1XL 2IF7A 3OWEA 3NACL 4LSSH 3DARA 5D1QA 4FA8A 1HK6A 4I48A 1UEMA 2NY3B 2VDLL 4Y2DC 1BFSA 1I1RA 5I17B 3O45A 2IBZX 4YO0A 1IM9A 5C6WH 2OTWA 3RWDA 3VXUE 4O9HL 4JDTL 2P48B 4GG8B 3TYGL 1KG0A 1FZMB 5KANI 3EOBB 4HS3A 4JREB 2UYLB 2P8LB 4IBLT 1KB9J 2IMMA 2PXYC 5FGRA 5C9KA 1EJOL 5C0CA 4KFZC 2FATH 4JFFD 1ZA6A 1YECL 4LRNL 3QZWB 2EE3A 5C2BL 3DUSA 5BW7A 4KGJA 3CPLA 3F7YB 4UNTA 3MQIA 3GJFB 1TCRB 3DSFL 5I16B 4FP8H 2P8MB 1Z9SA 4WCYH 4UOW1 4HBCH 4G8GD 3C2AL 5D1QC 2F5BL 4P4RB 4PV8A 3SKUD 4UV7H 3L3OB 3HUJB 3WNKA 4DTGH 1OY3B 2VZUA 3RUGF 5D7JD 1BQUA 2QHRL 4HJ0D 1BVZA 5ADOL 3ZDZF 2JJSC 1LO0L 1NAMH 1NFIA 4FXKA 3WFCH 4OT1H 3FN9A 3BP6A 3VXSD 2AXFB 3T0AA 4CVUA 1QR1B 5E6IB 3ULVH 4OUOA 5F44A 3LHPL 1U8PB 4MA3B 4ZOEA 4KJWC 2X89D 4OB5H 5EFIA 4HGKC 5DD6B 1TJIH 2YXMA 3SDAB 3OAUL 2I9LA 1HOCB 4XH2A 4C56B 4F7PA 5ICYB 2B39A 1UWEL 3TV3L 1J0KA 1II4E 3ULVD 3L5WB 4I3GA 2Z0BA 3O4LB 2WK2A 4PREA 1QVOB 3BDYH 1I1CA 3LN9A 4Z7UA 5GJSL 1WWWX 3QJHB 5GISH 1FL6A 4XPAH 4YH6A 1BEYH 1U8IB 1SY6H 2NW3A 3JVGA 2HKFH 2CKBB 1F6AB 2ID5A 3BOVA 1HQRB 4H5SB 3BP4B 3QNXA 1MFEL 1P7QA 4G9FA 1A7PH 4HFWB 1NMCB 4PJBB 1EO7A 4HXBL 4NKDA 5FKPB 4U6HA 4XZUB 2CQVA 3UYOD 5HYSB 3WS6A 5ILTL 3PQYB 2H3NB 4MXWL 4GMTL 3KPSD 5KSBA 2VISB 4DGVL 4E0RB 4P9ML 4MQXD 4N5EC 2XPGA 3UTQB 1ADQA 1AFVL 4FN0A 1CDBA 4LGPB 4KQ4L 1WWCA 4GW4B 1ORQA 2VDQL 4FQXD 4YDLC 3CDGA 4J3VA 3CVIL 4NRZA 4WFHD 4Z7OF 2O5YL 1CDGA 1K8DA 3GSRB 2ESVD 3OXRB 4YBLC 1B90A 1EO5A 5TF0A 1P9MC 3SDXF 5T1KD 3EJZC 2J12B 4NGHL 5T33H 1BGXL 3S6CA 4LPYA 3CSYA 4G6AC 3OKMA 2HA1A 2BVOA 2QADD 5ABDE 2P46B 1CFTB 4YC2C 1QQDB 4PJCE 3CLEH 2IPUK 4NO0B 1T6VN 2ZJSH 3RVTD 4L29A 1Z2KA 3QUYA 2OR9L 3FONB 2W0PA 4JFDA 4APQA 1T04B 4RMSA 5IOPA 1JF1A 1NC2D 4N8CH 3WDHA 3CFIC 1CFTA 4PJCB 5CZKA 1Z0NA 4D0CA 1X5KA 5IQ9A 3W9EB 1S8DA 3PL6D 4EDXB 2Q7NA 3M17A 1JNLH 3BZDA 3CSYB 4FQIL 2IFFH 2PO6B 3C09C 1FCGA 5F1KC 1YJDL 3F62A 4LOUC 1YEJL 4WFFD 5D93C 3MXWH 5GIRA 1JPGA 1H5BC 5E5RB 1JZ4A 3SKJL 3KPPB 4LLVA 1RJZA 4DCQA 3VXQA 1BVLA 3RNKA 3STLB 3WLBB 3IXAA 1ODAA 4GKZA 5HI5D 3WSQH 1J1OL 5C07E 2CIKA 3W5MA 2CLZA 2ADGA 1LO5B 4LLQB 4KTYA 5EH1A 1CF8L 3N1PC 4OCXL 4P46A 3I9GL 4QRTA 3BIKB 4NQDE 3OG4B 3SBWA 4DCQB 1A1MB 3KPPA 5JTWA 2H26A 4U6HB 4XZUA 5EU7C 1ZHBA 3Q5OA 3BVNA 4LSQL 3RHWK 1DQLH 2AVGA 3IDIA 3MNVB 3DRTB 4P3DA 4L4TD 4G9FB 3TT1H 1N26A 3AVEA 1YEHL 4X98A 1B3JA 1JCKA 4HQQH 4GFTB 2QADC 3CU7A 5AD0A 3AMKA 5JXEC 3MRQA 1LEIB 5CGYD 3W11D 5E7BA 2GCYA 1S7WA 3L7EB 2VAJA 1T5WB 3P4NA 2R1YB 3MRKB 2ZSVB 4JFDB 2XG4A 4APQB 1P84J 3OR6A 4LRIA 4G9FD 1TJGL 4Y4KB 3CVHL 4XC1L 4KHTL 4LF3B 3MJ6A 3CSPA 3MREB 3BPLB 3GNMH 4PREB 3DNKA 4GT7A 1W0VA 4ZFOB 5E99H 3P9LA 2D31A 2O5YH 4N8PA 4LLAA 4Y4HC 3C8KA 2X4QB 5C0EA 4P2YA 5GISL 1MLCB 4XCNA 3SDAA 1UM6L 2G9HA 5DD6A 3S36X 3GMNB 4M5ZH 1CIUA 4UZGA 4R96A 4I9WD 5I1CL 4G80B 2P24B 4BUHA 1U3YA 4X7DC 5IBTH 3X3GH 4Z78A 5IP4A 1FLRL 2C4FU 4OB5L 2YWYA 3WHXB 4RA3A 1NJ9B 4RAUA 3L3GA 3EO0B 3HAEG 4LU5L 1ORQB 4FMFA 4GW4A 4XX1G 5JHLH 3VXUA 3T3ME 1E6OH 4JG1H 5C0GB 2DL2A 2NY2D 3JWOC 4LHJB 3LEXB 4J12A 2SEBA 2VXQH 3K8KA 4E0RA 2VISA 1QBLH 4V1DA 5IGXL 3KXFD 3M8OH 1XGQA 4TOYH 1HHGB 5FKAA 4DTGL 3GO1L 3SKMB 4XT1C 1AD0A 1TMCB 5I75C 4M1DL 1KCRL 1D5BA 4LSRL 3QNXB 1P7QB 1NSNH 3AM8C 6FABH 1NAKL 4LARH 1HQRA 5C0CB 4JO1H 3DRQB 1F6AA 2PF6A 4LIQH 3SHSA 5ECJE 4PGCA 2XA3A 1XF4B 4HS3B 5FUZL 2VLKD 2Y1VA 4TRPL 2NTSP 1IQWL 1ZK9A 1OP3H 1LNUA 4WHDA 3G04A 4ODVL 3VGAC 3AXLB 3KPNB 1AQDB 2HJLB 3NA9H 4HUWA 3VGEA 3E1F1 5I1IH 3QT2A 4LU5H 3N50A 4X7SL 2DIJA 4N0YH 1BOGA 5C0DB 2I24N 3CU1A 2CR6A 4EUPG 1WSST 3NA4A 1TITA 2APTA 3AS3A 3HN3A 3GDBA 5IB2A 2V5TA 1G6RB 4G6JL 2DLEA 2P5WA 5I6XB 3KPQA 1BZ9B 1QBML 1WT5A 2BVUA 4LAQL 4N0RA 2CLRB 1CK0H 5D1ZD 1PYWA 4A6YA 5JO5A 2GY5A 4MA3A 1A1NB 3HFML 3CFEA 5EUOF 1KCSH 4MA7H 2EDYA 1LO4H 3LZFL 4ZMAT 4YR6B 4I0PD 2Q20A 1S9YA 4MA8L 5BVJA 1MWAL 2VDNH 1AGEA 1IAIH 2UY7A 3O6LL 3JZ7A 2Q8AL 5IEKA 2H8PA 3GGWA 5D2NE 4P2QA 4TQEH 5DGQA 1TIUA 4XC3H 2P44B 3U6RB 4CW1A 2A38A 3RTQB 3T2PA 2R0WH 3HUJA 2ZJSL 4HIIA 5FYKD 4PV8B 5DC0A 4XCEA 2CRYA 1FV1A 3AROA 2DM7A 4PJ8D 3SDXE 4FQXB 5J9PA 4E5XA 3C9NB 4OF3A 5HHQB 1G7HB 1OQXA 2OP4H 2UVFA 2IALB 3I6LE 4PGDB 1KENL 4X6BB 2BNUA 3EOBA 2BXZA 4DFIA 5ISZE 1TJHL 1KG0B 2Y6SC 1A2YA 4IHOA 3EUUA 3OKKA 2HJKB 4NHUA 1H5BA 3NCCB 4FZ8L 4GKNA 1KCSL 4MA7L 4U1KB 4YK4B 1IM9B 1GYAA 3TH2T 4ODWB 3EFDH 2R1WA 3U1SL 4ETQA 5E1AB 2OR7A 3QDJA 3VG0L 1XFPA 1FGVH 4G8EB 3DURA 3I3EA 2F5AL 3MV7D 5TPWH 3V52L 4OV5A 1GGBL 1IFHL 2LFGA 5B4MC 1V8HA 2YN3A 5SWZB 1TZIA 2PW2A 5E8DH 5ADPL 1KLUB 4K8RD 4UTAH 4Z7VF 5KVEH 5L2JA 1TNNA 4IRSB 2XTLA 1G9NL 2ZPKL 4EEEA 5JOEA 2B2XL 3TN0D 4DAGH 2UZXB 1N2RB 3C60B 4FXLA 2NY1B 3QR2A 2YRPA 4NO3B 1LGVA 3DBXB 2JB6A 2ILLA 2PKDA 4FQXC 3GSVB 3IETB 2WSKA 1ROWA 1B0WA 2EE6A 5GGVH 5I18H 3WFHA 4NKOA 4YNYA 3TN0B 1IC4L 3NCYS 5BZWB 1U8QA 1ZLUH 2XWTA 1T3FA 2YEZA 4N1CA 3TVMA 2I5YH 5DHVA 1CD8A 3D0LB 3C60C 2VLRD 1CE6B 4IMLB 2DLFL 2IEPA 5GSRB 5I8OH 3QUXC 1U2CA 3CSGA 1X4ZA 4L8CA 5KSUB 5CJ5A 4MZ2A 3QDGA 4MB4A 1GGIH 1E4WL 1IEBA 3T2NL 4MYWB 3KS0H 3ILPB 2ENYA 3QUMA 1AO7D 2VTFA 2ZCHH 3GMQA 3D9AL 3CZFA 1A47A 3OKDA 1P6AB 1DBKL 4GQ9L 1G1YA 2AJUL 2B1AH 2X4RA 5L2KA 4RWHA 3V6BR 3ZE0E 4GS7B 1YQVH 2BSRA 3VD4A 4X99A 2Z93B 3CMOH 3OB8A 5DC4B 4P4KB 3JWDC 2EE9A 1NLDH 4U1IA 1NFDB 4GMTH 1S78C 3SDCA 1ZGLP 1GOGA 4FABL 2D7PA 3CNKA 4KDWA 4OI7A 5DK0B 1L7IH 4I18B 4LPUA 2EKSA 3CFCL 4ZAKC 2C4XA 1WWAX 1G7LB 4NC1E 3UTOA 4JCMA 1MOEA 4DZ8A 4YHIB 3V5DB 2H6PA 3U36B 2VLLA 3S37L 2FB4H 5J06A 4D0DB 3RNQB 5CZVH 1OTUD 3GMRA 4F7TB 5FYKU 3HAEB 3CCHA 1QTYT 1GIGL 1DQJA 1LE9A 1G7MB 5E8OB 1PBYA 1YNKL 3DX8B 1MJUH 3ORJA 2JTDA 2GYSA 3LKSB 3QCVH 2H2PC 3ZT5A 1S9KC 4X6EB 2G75A 2VNCA 4HWNA 1CL7L 3WL9A 1ZXQA 1K4DB 2Y5TB 2Z31C 2DWEA 4M43L 4MXWH 2UWEF 5BS0B 3U7YL 4P2RA 3MNZA 1RHHB 3DI3B 3VE0A 2OL3B 1NGYA 3MODL 5ITFB 1CLYL 5F7DB 4YBHA 3V0AC 5F7UA 4Y0GA 1Z3GL 4UNUA 4XPBH 1JNLL 2YBRB 3ARED 1FJ1A 4CNIB 5D4QA 2V7HA 4PY8J 3T65B 4KVNL 1OHQA 1KN2L 5DJ0A 4GSDL 4HMEA 4M4RA 3KLAB 1P5UA 1ES0B 2UWEE 2EZ0C 4OI9A 4EIZC 3WV0A 3G5VB 2C3XA 1JGEB 1C1EH 1H0DA 3H9HA 4HK0B 4BH7B 2OQJA 3U82B 1OAXH 1UB5B 1ZHLA 1I1AC 3QFDA 1A1OA 1PGRB 1DVFA 1C08A 1CD0A 3AAZA 4YHPB 4NGHH 2VDMH 3HMXL 1S7RA 3OAYH 4NPYA 5E2TH 2JCCF 1FO0H 4S1SL 3CJJA 4G5ZL 5ID1B 2EDKA 4L3CA 2FGZA 4UV4H 1HILA 3EYUH 5FM8A 5I15L 2EECA 2R0ZH 4QRSB 5E9DD 4ZPTA 2F9BT 4JRXE 4MQSB 1ZVSA 1QUNA 2VXSH 2AK1H 2X4TA 4JRXA 4LRIC 4WEUD 4ZOBA 1RFDL 4AG4H 5JQ6H 5H94B 1S5HB 4JR9H 2FHCA 4PJ7F 1HXYA 2OCFD 4OIAA 4NKIL 4GW1A 1XIWD 3JTSB 1RZ7L 4FQ1L 5B3JE 1QPXA 2NY4D 5MEOA 1MWAA 3TO4C 3MX0A 3NFPA 3NN8B 4PLNC 3WNNA 3CVHH 5HGDB 4Y4FC 1I7UB 5FGSA 3O6ML 2AGJH 5J11C 1KUMA 4V1DD 4X0KA 4J3XA 4BA8A 4OD2A 5C6PB 1W2KT 3BDXA 1I4FA 1YEFH 4Z7WF 3PF2A 1YN6A 4WI9A 1N5AA 2FIKB 2FGWL 1DN0A 2KZWA 5D6DA 5HHOD 5E5MA 4Q7DA 1MCBA 4Z7QF 1ZGLM 4KKBD 3EDKA 1QOKA 4I77L 1WJ3A 2R23B 1KTLA 5ESVA 4JQXC 4M5YH 3A6CH 5HHPA 3LKPA 3FB7A 5EU3B 2B0SH 2XRAH 4O9HH 3BN9D 3TPUA 2WBWB 4P3CL 2GSIA 4JJ5A 5EZJA 2EDQA 5GS1B 5I1KL 1ZVHA 1F6LL 1X6LA 4PGEA 2WWMD 1FVCA 4WW1B 5IV2A 2VZ1A 5IB4A 2NY6D 3WN5B 4AEHH 4ERSH 4GKSB 3MRGB 5C07B 5E2VL 3MSPA 2X7LB 4HG4J 1CGVA 3FO2A 3PWLA 2IMNA 1KPVA 3IDNA 5ANMB 2VDRL 4G8FB 1NGXA 1J8HB 4GW5B 4QTHB 4MQXC 3U79A 1W0WA 3WCYA 4F2MA 3WIFB 3MOQA 3MUGB 3DVNA 4YDKL 5CWSB 3MA7B 3QXVA 5B22A 1J05A 1KJ3H 2YRLA 5LWYH 5EZLA 4S10A 3ES6B 4KJYA 1OP3K 1UM5H 5E5UB 1M7IB 5IESH 3V6OA 2AEWA 1T7WA 2Z31D 5C0BD 2ADJB 3RAJH 5FO7B 4HH9B 5EO1A 4M1CC 4NBXB 1DL7H 2IGFL 1EFXA 1LK2B 3EIFA 4WV1C 1ED3A 3QIWA 5D7JB 1FNGA 3S88H 4KMTL 4NN7C 3QEQB 1R3JA 5EZOH 1FG2A 3V7MA 3C2SA 3MRJA 4JPIA 3VFOB 1DQMH 2O5ZH 1RZIB 2Q3AA 1UZ8B 4NQDD 2ZOLA 2HT2D 4H1LH 1OTSC 4PGBA 1E4KC 1B0RB 4C4KO 4PV9A 5HVHC 5JPNA 4JFZL 3TBSA 3ARGD 4ZXBC 3NA9L 1MI5D 4OD1H 5BO1H 5HI3C 3WO3B 5ICZA 2VDKH 5CEZD 1V05A 2O61A 4CVXA 4POUB 5MEND 5DUBB 3V7AE 4XRCB 1OOAA 4CL7A 1NGWB 1IGYB 1TFHA 3U0PB 2BNRD 5D7LB 2WIMA 3PDGA 3UC0L 1PDKA 2YD8A 5CGTA 1AIFA 2ERJC 2F8XC 3E6HB 1WZ1H 1DFBH 2ATKB 4U31A 1YJDH 4P0DA 4NNYA 5TH2B 2NR6C 1JPTH 1UXWB 4Y2DA 1IGYA 4EQ2A 3STZB 1F00I 3SE8H 1QSED 3D39E 1MF2L 5IB3A 2HVJB 1R6VA 1JF5A 2ZG2A 3PWJA 4KI1A 4L3AA 5I1LA 4G6KH 1J1XH 3PWUA 4MNQB 5CIPA 3QXWA 1QBAA 2AQ2A 5D1QD 3V6ZB 5BQ7B 2VC2H 1I7RB 1RI8A 4NZDA 3G5ZA 2HG5B 5EOCJ 4PGBB 4JM4H 4M7LL 5F1NA 1FRGH 2ZOLB 3IJSA 1CT8B 3H7BB 4WFEE 1NCAH 5JXEA 4QF1A 5IFHH 2GT9A 1MCWW 3QEQA 4HIEA 3X3GL 4ZODA 5IFJB 1UCTA 1SHMA 3IJYB 4JFHD 1IMHC 5JR1L 3CK0L 4KPHL 3K4DA 4OBSA 1OQOA 2DD8L 3UPRB 4YWGH 5ACZA 1MY7A 3B9AA 1YDPA 5EU5B 4Y16B 4Q6YA 3GMMA 1BEYL 1J18A 4ELMB 3T4AB 3ES6A 4KJYB 1LO4L 3LZFH 1O7SA 2KQNA 1F90L 2ED9A 4IJ3B 1WTGT 4HC1L 3D48R 4LCCC 4MCYA 2OJEA 2CRIA 1Z5LA 1W0WB 4XNUL 4U0RC 4L8DA 4XNUH 2UZYB 4GRLB 3IDNB 1F3JA 2OZ4H 3BUYB 3GK8L 3SJVD 1NBVL 5A16B 2X7LA 5T3ZE 5KVFL 1I1YA 2X9XA 5CJXC 5IVXB 1H3WM 3Q1SH 4K55A 4LDEB 2BX5A 4U6XB 3WN5A 1IGJB 3GKZA 1XGRA 5TE6H 4XVUC 3O3BA 3KXFB 4ZYKA 2ARJA 1NCWH 5JOPD 5D5MA 4ZTPH 4UQ2A 1CFNA 5EZJB 1E4XI 1NAML 4S11A 3W81A 5DD1L 4NO0D 3VXMD 2X4OB 5HGBB 1CR9L 4KRPD 5C3LD 1MCOH 2JE8A 43CAB 3KDMB 2A6IA 3MFFA 5LXGL 2ZSWA 1TETL 3C8HA 5INDB 2DF3A 3HE7B 3OKLA 5MENB 3IVKB 2E7BA 1KTKE 4W6YB 4KI5C 2YK1H 5ETUB 4MAYC 1DN0B 4HQQL 3VG9B 4WHCA 3FTGA 3VWKB 3P9MB 4WW2A 4PG9A 4QHNA 4XNXL 2BHZA 1H9VA 4X0KB 3EGSB 1MFDH 4LPTA 5KSAD 4IOFC 1VADB 4MQ7A 4PJ9C 2F5AH 1S7TB 5TE4L 5JHDA 4LEOB 4ZUUA 1CGSH 4TPRH 1OT2A 4JE4B 3GEWB 5E6YA 2VLME 5D2NB 5JNYB 5EOQH 2W1NA 2A2QT 3BKML 2QR0B 3FO0H 5HI3D 5SWSD 1S78D 1KJVA 1FVDB 2AP2A 5EOCH 1B4RA 2FDBP 2EDDA 5H94A 2DQUL 3DLQR 4XVSL 3P4LA 1ZVSB 3WFCL 1E28A 1CIDA 3CFBA 3M07A 1N64L 4X9FA 2R1XA 2HFFA 3OJ2C 4JM2A 4LLMB 2YPKA 3QQ4A 1OPGL 1UCBH 1KC5H 1JE6A 4F3FB 4XMKL 4JFYA 4NPYB 3OAZH 2VXUH 4YHPA 4JREC 3N9GH 5ISZB 1MCJA 3WKML 4MD0A 3K4ZA 2R39A 2W9EL 2FNBA 4HT1L 5F9AC 4WHYH 1BD2E 4LP5A 3BYYA 5HDBF 5DFVC 2Q7YB 1JGEA 2M8XA 3HZVA 1DQDL 3G5VA 4NQCD 2VR9A 4N0UB 2MQ3A 4U2YA 3MRDA 1NBZB 5DDHB 4JHBA 4CN6A 3TZVA 3T65A 4XWGH 1XF3A 3FRUB 2AAVA 2VLMD 4HG4K 1TNMA 4W6WB 4UT7H 2KDGA 3QHFL 4YHYB 3REVB 4Y5VA 1XGPB 3QWOA 5FGBC 4WI8A 3ARFB 4GQPH 4GXVL 5DQ9A 1DQLL 1RUMH 1AXTL 1NCBH 4LFHG 5ALBL 2VWEE 5AAWA 5F6HI 5KW9H 5BS0E 1MRCH 4L4JA 1S7QA 1GL4B 5BS0A 1HXMB 1INEL 5DEFA 1FNFA 2BJMH 2Y5TA 1K4DA 5T1MA 5DHYB 4L4VB 3FO1A 1U8LA 1CBVH 2DWDA 1MRFH 4AEFA 2G75B 4Y19E 1P5VA 4RISL 4PLJD 3LKSA 4X7SH 4PJGF 5TGBA 2Q87A 1M7XA 1AFVH 5JDJA 1LDPH 1G7MA 1S7SA 4BFBD 5I1AB 5GZOC 4F7MB 5FO8B 3CC5A 4L5FL 4ZDHA 4PLOB 3TNNA 5JMRA 4MJ5A 1JUFA 1T21A 1ZMYA 1FZJB 5JDSA 1CCZA 3WS3A 4K3DL 3C5SA 4LARL 1U3HC 5ID0B 2VLLB 3U36A 4DJMA 1XR8A 4X5WA 4TVPL 1NMBL 4DZ8B 2PTTA 1U3HB 1VACA 3QEGH 4Q9RL 3P0VH 4OCSH 5CKAA 4Z7VE 1ZHNB 2BC4A 3WO4B 1BWWA 1MEXL 5J8OA 5F7MC 2F54D 2I07A 3O6FA 3SDCB 4V2CB 4R7NB 1JJUA 1LD9A 2ICEB 1LHZA 1X3DA 4XCCH 2YPVL 4DVRH 1I7TA 3GSOA 1P4IH 2OI9C 4KTEH 1UFUA 3C60D 1JTTA 2HN7B 2D0HA 1JGVH 1C5CH 4NWTL 3D0VB 1RMFH 2LVEA 2BHYA 4NKIH 4I4WA 2EH8H 2UY6A 4PG2C 1KIRB 3W9DB 5LBSL 3CZFB 3PWNA 2D7TL 2QBWA 3GMQB 1UYWH 1I8LC 3VFUB 4OLVL 1S5IL 3FCTB 3AUVA 5FGCB 4CRPA 5GGVY 1B2WL 1P2CB 5KSUA 3MXWL 2R9HC 4WHTB 3IAGC 2D03H 2HAZA 3KLDA 5DJAB 4HPYH 4H26A 3HR5B 1I3GH 4XPHH 1R3IH 5FV2A 2EDRA 3J7HA 3AM8A 3B5GA 3MYJB 1NBVH 3ARDC 32C2B 3TBVA 4MDJA 4WIQA 5DUPL 4EI5C 5D7LE 4EOWL 5DVKA 3T0ED 4LVHC 5FF6A 5IJVB 2RCSH 3SDYH 3EFFB 4Y4KD 2Z4QB 4TUJA 1DSFL 1VENA 3K4AA 3FN3A 3CLEL 4RIRB 4ONFH 3BEVA 3NCJH 4MJ6A 5C0IA 2DYPA 3TO4B 4WO4B 5LQBH 1A6AA 5DC9B 1XIWB 2Z31A 3C08L 4EJ1C 3PIQA 3WJLA 1E0OB 4AIZB 1NC4D 1RMFL 5HPMA 1RUPL 5FCUL 1OW0C 4PJFF 5DRNA 4KTDL 4O00A 4R7DA 4Z8FL 4AENB 3MACH 4Y19A 1TXKA 2DQFA 3MRNA 3GMPA 4K2UH 4ZUTB 1K3IA 1ZHKB 1IGMH 4F80A 4R3SA 5EBLB 5CP3A 1GZPA 3JV4B 1CFBA 3Q3GA 3HG1B 2GJ6B 5AYQA 4ZFZB 4K3EL 3ZKMC 4YHLH 1J12A 4G8IA 2IPUG 1H5BB 4BQ8A 2EH7H 1BFOA 3BKMH 5T5FH 3VFVA 4MWFA 3UAJC 3GI8H 5IJKC 5EOCL 5F9JA 4H8WL 3W0WD 4CJ0A 4PGDA 2XFXB 1NEZA 3FZUC 3NFNA 4OJFL 5B21A 4OFVA 1A7OL 3QDHA 1U6AH 4KROC 1JNNH 3FB6B 4ODVH 3VWKD 1P53A 4PJEA 5F8RC 4MX7A 5TDOB 1MI5E 3U9UB 3UTTA 2DMBA 4YHML 2YWZA 5CMAB 4Y5YA 5T3ZH 8CGTA 3QXAA 4CU6A 4OD1L 3BGFC 4Z7NE 3MACL 3DWTA 2D0FA 1KLFA 3NCYP 2ADFL 4KJQC 3ZKXB 2X09A 4DKFL 3GHEH 1A6VL 1MHPL 4Z0XB 2BOCA 4G6JH 4Z7UF 1FYTA 5D8JH 4XWOC 2FBJH 5BVJB 5KSBF 4BM7A 2K1MA 3X14A 4LQ1A 1QA9B 2G5BB 3QWRA 4R90L 3O3AB 5DFTA 4GRWH 2XWJA 4ZSOB 1RIUL 2BSTB 3FO0L 4KROD 2XY1A 2CLRA 2Y7QB 1F4YL 2NQCA 4FTVE 4ZD3L 5C0NC 2NZ9D 4NQEA 5M95B 3BT2H 1SJHB 1IAKB 1OAYL 5C0DA 1KIPA 4KKNA 3VFSA 5T33L 5KS9B 1AKJD 4FZEH 5AUMB 1NQBA 5FK9A 3RX7A 1T1WA 1OLLA 1F42A 4IOFD 3RL2B 3IFLH 3MJGX 3DYPA 3IDMA 1LNUB 4P2RE 1SEBA 5DRXA 1IKNA 1JYWA 2WINB 3GSXA 2CGRH 4XBPB 2XN9A 1IZJA 4IDJL 1PAMA 2JB5H 1K2DA 2CPCA 4M7LT 5HI5C 2EH8L 4JFPA 3BKCH 4XPBL 2AQ3A 2WP3O 1AO7E 3FHQA 4XNYL 4OAWA 3MLZL 2CUMA 1BX2A 3RWEB 4KHXH 4YAQA 5I74C 2MPAL 3EDDA 3PDDA 3PQYE 1IAOB 2FL5B 3PG2A 5ICXA 5FA4B 4PJ7B 4EN3B 3H3BC 4MB5A 3THMH 2HTKC 3B2VH 2VLRE 4Z7VA 3ABZA 3BRDA 1WK0A 3GK8H 1IEAA 3O0RH 4HKXB 4YZFE 5IM7A 5BXFB 1YEFL 2GJZA 1JHLH 1T89A 1MCEA 2XQBL 5A3IC 2V2WB 3G6AB 4ESKA 1MRFL 4ZQKB 2FX8L 2APWA 4ACPA 4B41A 1T1YA 1NMAH 4JZOA 1VKXB 3IU3B 2HTLD 3ECBB 3EYUL 1IJ9A 5I15H 4Z7OE 4G80A 1BF8A 4DGYL 1LMKA 3DTXA 1CR9H 4ZPVB 2J5LB 1S5IH 4FTVD 5IHZB 4GXUN 4ONGL 2P45B 4KJPD 5B4MD 1AGBB 5DJCB 5IBLD 2EXWD 4ZOAA 1LO2H 3P9LB 4X5XA 3SDCD 1KPUA 3VFNB 3W0WB 2HT2C 1IZKA 4Y4KA 1BQLL 3MFGB 2G2RB 1TPXC 1CICD 1MFDL 3IF1B 4KROB 3MRKA 4ODHL 3VFRA 3P4NB 4O2CB 3O3EA 5JPMB 2GCYB 4I2XA 2J6EA 5C09B 4P2OB 4X4MA 3T1FA 4DN3H 3P4OA 2J8OA 5DMYA 4DQOH 4P3DB 3IDIB 5J4MA 5KVEL 4X9BA 1T1XA 2XACC 3HMWH 4OKDA 1MIEH 1Z3GH 2UZIL 1FGNL 1A1MA 3QEQD 3U0TA 1OGAD 4JY6A 5J3HD 2GAZB 4U6VL 5A2FA 3NCMA 1JTPA 4LLYB 2P47B 4L1DA 5IROC 1ZTXL 3VXPB 5INCA 4M7LH 4HULB 2ADGB 3PP3H 1VFOA 2CIKB 1EXUB 2J8UB 5SWSA 4W4OC 2BNQE 4GKZB 1TDQA 4D0BB 5GGSY 3E8UL 4QTIH 3NMEA 5FGBA 5IIEA 4Z18A 3WLBA 3B6SA 4E41A 3EJJX 4RGNB 1OT1A 2AK4B 3RY5A 3HNVL 1FSKB 5HHXL 4JY6B 2FB4L 4ELME 1AHWA 5LKNA 2VAAA 2J8HA 5DQJB 3BEWB 3GJEA 4LSTH 4YIQA 1GSMA 4HF5L 1MJUL 1G0XA 1UVQB 2X1PA 4RMWA 5KANG 4LLDB 2DL9A 3LKRA 2PO6A 3QRFM 2P5ED 4YDJA 3W9EA 4ZAKD 1NCNA 4D0CB