5HHOE

Crystal structure of the jm22 tcr in complex with hla-a*0201 in complex with m1-g4e
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
240
structure length
240
Chain Sequence
GGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIRSSYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE02
1T5WA 1KCVL 2R4SL 3FONA 1JWUA 2DJSA 1TQBC 3NVQA 1FE8H 3GMPA 3CVHB 1OF2A 2EXWC 1M7IB 3FB8B 2VJXA 4HPYH 4UBDD 4Y5XB 1N5YH 1JNLH 4QEGA 4BZYA 4PJEF 1FC2D 5HHME 3AUVA 1G1CA 1DE4A 1KLGB 4ETQB 4NQCD 3DVGA 3C5ZB 5DJZB 3HPLA 3V4PH 1MFDH 2D31A 3GHBL 3ZKXC 3PE9A 3ZL4L 2FYYA 1N3NA 4HKZB 5HGHB 2QTEA 4K9EL 3N1MC 5GGVL 4UT9H 1U8QA 3A67H 3O4OC 5E03A 32C2B 3QIWA 5HPMB 1A0QL 3LOWA 2X05A 1DL7H 4XNQB 4OLZH 5I66A 5CUSH 4Z5RB 4FQXB 2OZ4H 1ZK9A 2W65A 4BH8A 1WBZA 5HY9A 3BP7B 3KXFB 4KKAC 4OT1L 3TBVB 3QB7C 1BJ1J 3B6SB 3BQUA 2XKSA 1U3JA 5EBWB 4JO3L 1CLOH 5FDWB 2CD0A 1B3JA 1FDLH 5D71H 2ADFH 3CXHK 6FABH 5IWLC 3B2UD 4RMWA 4X7FC 5GGQH 2Q87A 4KPHH 1QNZL 2AK4B 3NZ8B 4Z76B 3P0YL 4NBYB 4DJMA 4O02H 3VFUA 4FMKA 2AJVH 3FB5A 4HZLA 4M7JH 5DMIL 1QLRB 2E9JA 3HI1A 2IWGA 3QJFB 3V7AG 2QHRL 1QO3B 5MERB 1IC5L 5INDA 3NIGE 1R5WB 1HI6B 2OSLA 3MRFB 4Q9QL 3TJEH 4YDJB 1AGEB 4FQ2H 1P9MA 5DMJB 5IW1B 1X3DA 3O6FA 3PP3K 2DQJL 2R23B 4I0CC 5E4EC 3QIWD 5T3ZH 4YBLC 2FATL 5I6XC 5GRVK 3KGRA 3VFRA 3LMJH 4DKEH 3FAXA 5BXFB 1CD8A 4L1HA 2J4WL 2BJMH 2VLLB 1F4AA 1YNTA 4X6DA 2D9CA 3BQUD 4KK5D 2YWYA 2WP3O 5GGRB 1T22A 2LV4A 5CBEA 4QTHA 3T0XA 3KXFE 2X44D 4X8XA 4PGBA 1WLHA 1BHGA 1OAZL 2NY7L 3EYSL 4U1IB 4ZFZA 2DQCL 4Z0BL 3FOMB 5IIEA 1VADB 1IKNA 4NZUH 4TN9A 2AK4E 2BSTA 3FB6B 4LGPB 1YEFL 4JDVA 3H7BB 5IJVA 1O7SA 2R9HC 1UADC 1AD0B 2OL3H 4M00A 4GXVL 1ZLSL 2DLEA 4LF3B 1GGBL 3CVIL 3O6FD 5C92A 4L29A 3H7LA 4TSCH 3FT3A 2LQRA 2NW2A 5DUML 3NZHL 5IG7A 1Q0YH 5EG6C 2B1HH 3LV3A 2CKBB 2F9BT 2VAAB 3MO1B 3MV8B 1A64A 5E6ZA 2ZNWA 4LCCA 5FK9A 1A1OA 4OLYL 2B5IB 4AZ8A 1BVLA 2FD6L 1AKJA 5KSBB 2M1KA 5A16B 3NABH 3V79C 5C0ND 4QHMB 5ELIA 2EDHA 2E6QA 2H1PL 1MRCL 2ADIB 3MOQA 4YHMH 1VPOH 5LBSH 4X99B 3P0GB 5IVXF 1T0NB 1BVZA 3HC3H 3GMQB 1MEXL 5DEZA 4CU6A 1AR2A 1FIEA 4JPKH 4JQXA 4ODHL 2PXYA 5DD0L 3VFWB 3WNOA 1R0AH 1AIFA 1ZGLA 5I2IA 3MGOA 1DSFL 3OR6B 2K3TA 4LLVB 5E2JA 4WHTB 3UJIH 1G9MC 4P4RA 1CL7L 3M1BB 3O41B 1UENA 3LKOB 3EYQC 4EVNA 2FLBT 1S7UB 3HNTH 3CK0L 2X10A 5D7JA 2GI7A 3BO8B 1P4BH 4JFYB 4X7TA 3MV8E 5GJSL 4GW4A 4ZUWA 1AKJD 3OXRB 3S35X 3NPZB 1XR9A 4X4XA 4JFZL 4WFFE 3P11L 4QYOB 5KSBE 1ITBB 5ESQA 4DZ8B 3BD3A 4XMLH 3UYRH 5L8JB 1MIMH 3MODL 3MRGA 4MB3A 5E8NA 1KCUL 2DICA 5K9KA 1OPGL 1OT2A 5GSRA 2PXYD 2NY3B 2BY0A 2H9GB 1BIHA 3E0GA 1N4XL 1S7VB 4RGMB 2C4XA 5T33L 1IGYB 4MJ5A 1C5CL 1ND0A 5DR5H 2OS7A 4GSDL 5IMOA 4K8RC 3EO9L 2QSVA 3B9DA 2D7TL 3CFJA 1MCWW 4XNZC 4MA3B 4PBVC 2L0DA 1F3JB 5D7JD 4HQQL 4NQXB 1B0WA 1MWAA 4RFNC 4JM2F 3HE6C 4W70A 4BSWB 4PGEA 1CDCA 1F6LL 1GGYA 3X3GH 3THMH 2XQYK 4P2OC 4M5YL 2XA3A 3ZTNL 2WBJB 5DJ2B 2BDNH 4RQQA 3MNZB 1WCBA 3WUWB 4YPGB 3VH8B 8FABA 4G42B 4MNQB 1CR9L 3JBG7 2EDWA 2F54A 4LNVA 4LIQH 4N8CH 3L95A 2AV1A 3LKQB 1G7LA 4HGMA 4L5FL 4CVZB 4PY7A 2IBZX 3GIVA 3OKMB 4HUXB 4HX1B 4YHOL 3L3IB 4R4BB 4Z78A 5D1XA 4WFEE 5FYKD 3JV6B 2CKNA 3MACL 4JHWH 5DRXB 3KPQA 3BDYL 3P3YA 4PJFA 3PGCB 1DBBH 5DZNA 1VERA 3DROA 1QQDA 1QLFA 3EZ8A 4WU5B 3ECBA 4OKVA 2OK0H 2VH5L 2P5EB 4NN6B 1PEZA 2HN7A 4P9ML 5JIIA 4DGIL 1E6OL 5FDYA 1T6WA 4HKXB 2F58L 1PZ5B 3WO3B 3WXVL 2EDXA 4ZD3L 4WJ5B 3LN5B 4YHLL 4JM2C 2C5DC 4OGYH 3X3FH 4C4KO 4QNPF 2ARJQ 5HHVH 5KTEL 2H41A 3ARXA 3KYMA 1I3GH 1ADQL 1FVDA 3DOSA 2D9QB 2JIXA 2W9DH 3V5KA 5L7XL 3IDMA 4R3SB 3HR6A 2F54D 2ZPKH 4GKNB 5TQ0L 2X1OA 1JMXA 3UTQA 1E4JA 1RZFH 4MNQE 3DUUA 3I2CH 4LLWB 4R2GD 2DS4A 2G9HB 3CFBB 1MREL 4ZXBA 4DK6A 5K59E 3RTQA 2EE2A 1NCDH 1VFUA 3ZDYE 5DYOB 4OQTA 3SDXF 1A6WH 4X7CC 3T65B 1E4KC 5D1XD 4OIBA 5FM8A 4X9GA 3S98A 2ADGB 3V6OE 1LHZA 3ZKMC 1BD2A 1IEAA 4RRPG 2PYFB 3BEVA 3HLAB 3GSRA 5JOFA 5EIVA 1Q94A 3QZWG 4HIXL 1FG9C 1WEJH 2NY1C 1R3LB 5CEXA 5BO1L 3S96A 4TTGA 5E0QA 1DLHA 2P5EE 3DIFB 1I3UA 2R4RH 3PWNA 3QH3A 4JO4H 4XCNB 1C1EH 2OL3B 5CP3H 2F74A 3MLXH 2APTA 1HINH 2EXYC 4I4WA 4YHKH 5ICYB 5C0BB 3SE9L 1MPAH 2PNDA 5HI4D 3HR5A 1RJYA 3EYUH 3GNMH 2QQQA 2J8HA 4TVPL 2JIXD 1NFDB 3JVGC 1OAKL 3VGBA 4AEHH 4HHAA 2JB6A 1WFUA 3I75A 5CJ5A 5T3ZE 5DRNA 4S1RH 1NGPH 2GYSA 2AGJL 4ZXBD 5LKNA 2LU7A 3RTQD 2ZUUA 3P9MB 1MCKA 3GSXB 3P40A 3ZZ1A 4OI8A 4PP2A 1CU4H 2OR9L 3BKYH 4MQ7A 3IDJA 1XH3B 1CGWA 1U92A 3A6CL 1BD2D 1QSEA 3QXDB 1F4WL 3VXSD 4GRMA 5T1MB 2V6HA 1I7TA 4RMTA 3KPMA 5TF0A 1KTRL 4AG4L 3HRZB 2Z8SA 4J3VA 5B21A 2E7HA 2Z93B 1CE6A 3G5YA 4CU7A 1DN0A 3PNWB 5ALCL 5F9WC 5EPMA 1EMTL 4UV4L 4W81A 1U93B 4OV5B 4LLYB 4F7PB 5HYQB 4U7SA 3VRIA 1HH6A 4YIQA 5C0BE 4PY8J 4JG0H 4FFVD 2XT1B 5GRXG 4I0PC 1HKLL 4O2CB 2PO6A 4QRPB 1NFDE 3F7QA 5BZDB 1QR1A 4QHUA 4EN3B 2EIEA 2VDQL 5DFVC 4JPWH 5D9SA 4JN1H 1W72H 4R4FH 4X8JA 5DEGA 4JGJA 3D85A 3DRQB 4XGZB 2CRYA 1IC1A 1ZVSB 2VDPL 3WIFA 3QSKB 1HEZB 3I9GL 3MRHB 4XP4L 4AT6A 1Q0XH 4ZNEE 3KPOB 3DX8A 1CFQB 3C8KB 1QSED 4ODXA 4YDKH 5D7SH 2EYRA 1BJ8A 2EDNA 5AZEL 5JHLH 4PRHA 1G7MA 2AQ2A 4LLUB 3QA3A 1FRGL 2XZCH 1UVQB 2VXTL 4DW2L 2I5YL 5C8JB 4AQOA 1P7HL 2XFXA 4LASL 1CE1L 1A5FL 5IEHA 4JHBA 5T3XL 1RUMH 1YQVL 3LEVH 1KB5A 4F37K 4HH9A 2NCMA 2P8MB 3MLZL 3RVTD 4EIZC 4XZUA 2DN7A 5C0DB 4P23A 4NKIH 3LS5H 1A21A 1KB9J 2Y36H 3R1GL 5ACMA 4TTDC 2PO6D 4X7SL 1AHWC 4LHUG 4P5MA 1U9KA 4ODTL 5C0JA 3BYYA 3RWJB 1F5WA 4QRPE 5DGRA 5C6TL 5K9OA 4KJQC 1W0WB 4ISVA 3D85D 2A9NL 3MRBA 3BJLA 5I18L 2EDTA 5C3LD 1KTLB 5EO1A 3VG9B 1Z9OA 4HEME 1JGDA 2DQGL 1GPOH 1IGIH 4HUVB 3FHAA 1IL1B 2IAMC 4PREB 5HGBA 4FHBD 2QR0B 4PRHD 4NNXA 4IRZL 1KELH 4OD3H 1Q8MA 3RY5A 4U05A 3FQWA 1I7UB 2YD3A 3B2VH 4RGNB 4R97C 1JHTB 5D5MB 4OCWL 5K9QG 3BZEB 3QNXA 3VFNA 1XGPB 3TCXA 3K1DA 4GW1B 1JHLL 1GGIH 4FABH 4O4YH 2AQ1A 3GMLA 3EDKA 3B9EA 4U6HA 4AM0B 1YJDL 4JFQB 4UTAL 1NGYB 4WW2F 3WJJC 4P23D 4WUKL 4KDWA 3IETB 1DQMH 5GSVB 3BZDA 4G3YL 5T1KA 4M48L 5F96H 3D25B 2HLAB 2I07B 4NKQB 3MJ8A 4PJIA 5EZIL 2ZNXA 3RBGA 1UB5B 2DB8A 3KWWB 4YWGL 2JLLA 1A7QH 3HE7A 5AZ2L 1XT5A 1KG0B 2EC9T 3U36B 1H9VA 3SJVA 5E1AB 2E27H 5DRWB 5I1KH 4DGVH 3O9WA 1LP9F 3QDMB 4GW5B 4KZEH 1P69B 1V7ML 5HHOA 1XCTB 2K9UA 4FQPA 1FFRA 2QQLH 2A6JA 5CSZA 1JGLL 4GLRH 3DI2B 4MGXA 5IBLD 2VDMH 2X09A 2Q86A 4EQ2A 5D5ME 4LIQE 4R0LA 3F12A 1I9JL 4LCWA 1BAFL 1P7KB 5DMKB 5CSGA 2VL5A 4GRLC 4WW2C 3EYOB 1T1YA 2BNQB 2OI9B 4HC1A 4JCLA 5FKAA 1FQ9C 3EOAB 1DUZA 1S9WB 5HGDA 2OLDA 5M7QA 3DX7B 4G5ZH 1EEYA 1Z0MA 1BQLH 1QKZH 4JO1L 3OHXA 3VDCA 4XWGH 2KQMA 3HE7D 3V7MA 2YMXL 3HUJF 1UM6L 4KKCD 4ELMF 4L4TB 4P5KA 4KROB 3SJVD 1I1AA 5D6DA 3HI6H 1L7TH 2NY0C 1CYGA 5DO2C 2C3VB 3O9WD 5BZWA 4EBQL 5JOPD 4Y5VA 5HHOD 4D0DA 1OLLA 1UH3A 1Q9WB 4LEXH 5SX4H 1AY1H 5CLTA 5I71C 3MLRL 5DI8A 1B2WH 1WWBX 4YH6A 1PYWB 1D3CA 3VI4F 2BOCB 3UPRB 4W6YB 2DKSA 4OF6A 3U0TB 3RWDB 1I8LA 1VESA 4KZDL 3ARDA 3QQNA 4XNUL 3BOVA 3GGWA 4NWUH 1N64H 2FBJH 4LCWD 3WFCL 4DKFH 1I9RH 4HXBH 1HNFA 2RGSA 3MBEB 4M1CD 2WWMC 5BOPA 1QVOA 4OUOA 5JIKA 4FNLL 1NAMA 3EOBA 3AVEA 5IEKA 4OZIF 3NGBB 5B8CC 4JN2B 5C9KA 1F2XK 2BNQE 4YC2C 1LILA 5IB5B 4PS4L 3TJHC 4QY8A 3MUGB 4M3KB 4M43L 1B90A 3RY6C 4P2RA 1PKOA 1I1AD 2A77L 5KVGH 2Y25A 3MFFA 4KQ3L 1ACZA 3ES6A 4L4TE 2EH8H 1XF2B 4L8DA 4KKLC 4WUUB 5TE6L 3GBMH 2YWZA 1JPSH 3AAZA 3SGJC 3MRPA 5DT1H 4GAGH 5DQ9B 4K7PY 5J11C 3SE4C 3SDAB 1HDMA 2BCKA 5DA0B 3ARDD 3OKDB 3C8DA 3IFOB 2J1KA 3VWKB 1FNEB 1L9NA 5IM7A 2A6IA 1W72B 1ZLWK 2NY6C 3TIDA 2CRIA 1BFOB 4ZPTA 1JGUH 2JK5A 2RB8A 1J05A 2OQJB 3DMMA 4O2FA 5IQ7H 3Q6FB 1KPRB 3DHMA 4IBLT 4JZNA 4BKLA 1I4FB 1XGQB 5C7XL 2BVQA 1LD9A 1D6VL 25C8H 3WFDL 4NJAH 1ACYH 4PRPA 3VE0A 5IHZA 2Y23A 3OKEB 1YMHB 4TNVF 2JCCA 2HT4C 1U3HD 4P2RD 4LLQB 3GSNA 4TULH 1OGTB 2P46B 3FT4A 1NFIA 4BFIA 1AJ7H 1RJCA 4KGLA 2NTSP 1R24A 1MELA 3K2UH 3GO1H 5IBTL 4WUUE 3VRLF 3OR7B 4IOIB 2A1WL 4Z7VA 1C08A 1MIEL 1MAML 3RZCB 1BGXL 5F7DA 1NDMA 2O5XH 3VFVA 4U31A 5JXAH 3MLUH 4U33A 2DQIH 1XGUA 2WUCH 5GS0D 1ZHNB 3DO3A 5JA8B 5MEOA 4AIOA 1EFXA 3ZHKA 3IDIA 2IGFL 2DOCA 3DMMD 4ZFGL 2RFXB 1CGYA 3OAZK 4XPHL 2AXGA 2Z92A 1ES0B 3L3OB 4IJ3C 3NTCL 3OB0H 1KJ3H 1WT5A 4H88L 4M93C 4WW1B 4PRPD 4XPGL 1BVKA 5T1LA 4ORGA 1LDPL 4NQCB 3CMOL 2M26A 4RA0C 1KTDA 2B2XL 3ARGC 4LL9A 4F9LA 3R06A 4ENEC 3HAEB 4FZ8L 4NO2A 1MHHB 2R0ZH 1G7HB 1IGFL 4UB0L 4XX1G 3RJDA 3IS1X 5EZOH 1P1ZB 2HFGL 4PJBA 5E5MB 5MHSD 4ACPA 4UU9A 5DK2B 5JMOC 3PDOA 1DR9A 1MHPL 2YD1A 1MCPH 4S2SB 1K6QH 3EOTH 2EDDA 4N0FA 5J7CC 2EEAA 4D0CA 1H15B 4HFUL 1MFAH 3JV4B 1EBAA 4JFXB 3SDDA 1KB9K 4XVSL 2IJ0C 1UJ3B 1AC0A 1EFXD 3FJTA 4NRXB 4LRIC 3U7YL 2DF3A 4Z77A 1CLZH 5F1OB 1KNOB 5FYKH 1BF8A 1FGVL 4MLIA 2QBWA 3BKJL 3CVHL 3FONB 1JWUB 4XPFH 5GGVY 3RIFF 3GMPB 2GK2A 1UZ8A 3RX8A 1OF2B 4H0GA 2APVA 4H26A 4OFKA 3UJJL 2VLMD 3GBLA 4MDJA 5T1LD 1IM9A 1DE4B 2UV3A 4D9RD 3W11C 3HZMA 4HUUA 3MNWA 3MNVB 3HPLB 4TYUA 5I16A 2D31B 3KJ4B 1KF9B 1MWAH 4NQCE 4YX2H 1PG7L 1P84J 3WL9A 1GC1H 3C9NA 4GS7B 2WLZA 1U8QB 6CGTA 3QIUA 3QIWB 4KHTH 5C70A 5I66B 4J3WA 2CK0L 3UTSA 1BEYL 1CFVH 4BH8B 5GJTH 5HY9B 1A4JA 1F4XH 1UA6H 4LSTH 5F7UA 1JZ5A 1TETH 3SDDD 1G6RL 1MCHA 4DKAA 2YD2A 4POZD 3MBXH 4DGYH 1IGCL 4RAVA 2Z31A 5E6IC 1MCOL 4D9LH 2QADD 5F7EL 3EJZD 3VFUB 1YQ2A 3P4MA 3FB5B 4HZLB 4LRNH 3U7WL 2JJUA 3HI1B 5KAQG 3MLSH 5INDB 4U0RC 3RVWC 2OMBA 4MWFA 2OSLB 3W39A 3IFLL 3RL1A 2CRMA 3UTOA 1B6UA 2BOBA 3DWTA 4PLJC 5IT2L 3QIUD 2XYCA 2D7PA 1TTUA 4JLRA 3VFRB 4EQ3A 2R2CA 3ZDXE 3UTSD 4S1SH 1MY7A 4CN6A 1YNTB 5CD3A 4X6DB 1P4IH 1T22B 2F5AL 4CVXA 4ZFOA 5C2UB 5CBEB 1TZHB 5F9AC 4AL8L 4OQTH 2FO4A 1MVUA 5AUMA 4PGBB 2ZUWA 4LEOA 1G6VK 1NBYA 2Z31D 2YPKA 5IWLA 2W0PA 4ZFZB 1DBKH 4P46C 5IIEB 1A9EA 4XB8A 2SEBA 4HJJL 1TTGA 2UWEA 4UINL 2BSTB 3S36H 4JDVB 2I60L 3IJHA 1WZLA 4KKNA 2BMKA 1DBMH 4PJEA 1RUPL 5F7MC 4DN4L 1VFAA 2ARJA 3BGAA 3ZTJH 3KPRA 1BZ9A 4TPRH 5DQDL 1CGTA 3QCVH 4PG2C 1EEZA 4L29B 4U3XA 2VSDA 1DFBL 3RVVC 4DAGL 5I1GL 4X4MA 3FT3B 1FJ1A 1WFOA 2NW2B 4G6FD 2W0FB 4RMUA 1OAXH 4UQ2A 2CKBL 3RL2A 3LV3B 1TZGH 1Q1JL 1GAFH 1M71A 3QI9B 5H94B 2HFEB 3WKML 3MYZA 4NZTL 5AYUL 4V2BA 5FK9B 5JPNA 1A1OB 1BBDH 1Y0LA 2FH6A 5EC1B 5SV3A 4Z7WF 1BVLB 4LQFH 4OM1H 2WMPA 4X6DE 5IB4A 1H3UA 1AKJB 1N0XL 5BVPL 5JPMA 4XWOC 3WYRA 5EUOB 1EO5A 1QSFA 3SE8H 3U46A 1VFBA 4EDWL 5CEZH 4UOJA 1T80A 3V6ZA 3DARA 5KOMC 2ZUYA 3WD5H 3BW9A 3IJSA 4MA1B 4FTVA 5GS2D 2VERN 1YEDA 1A3LH 4TSAL 1N6QH 1IMHC 3TYGH 3UJTL 4BJLA 3NPSB 4XXDA 3QUMA 1FCGA 3MUJA 5FEBA 2PXYB 5HJ3A 1CBVL 3KPRD 4OKDA 4IMLA 3R4DA 4X4YA 4G7VL 5I2IB 1ZGLB 4GAJL 4F9PC 3C6LA 1WTGT 4XH2A 1OD7A 3NFSL 1NGZA 4ORZC 4NFDA 3MRNA 3V4UL 3C08H 5EORH 4P4RB 1YEIH 4WENB 1A2YA 1K3IA 1EGJL 3VGAB 3ULUF 1Q9KA 3MLTA 2FH8A 2ZUSA 5EU7E 5LGHH 2FSEA 5D7JB 4MJ4A 1OP5K 5CZVL 4YE4H 5DZOA 4X7TB 2EYTA 5HVHC 1P5UA 3QQ3A 1NEZA 4GW4B 4PGDA 3BZ4A 4ZUWB 2DBJA 2EDEA 5BV7C 2R1WA 1FV1A 2R2BA 4X4XB 3LZFL 4NJ9L 4G6JH 1QSFD 3ESVF 5ESQB 4WI4A 5F6HJ 5GRZA 3P4NA 1NLBL 1J10A 1YYLL 1SYVA 4Z7UA 2P4AB 5DJDA 5E8NB 5GRYA 3P30H 2B0SL 4FTVD 4Z7NE 2VZSA 1CD1B 1RIVH 1ETZB 1CZ8H 2PTVA 1KB5H 5KZCD 5GSRB 1CLYL 1NBZA 3REVA 3C6LD 1JRHI 4MJ5B 4N5EC 1UWXK 5IFJB 5IMOB 1FE8L 3GUTA 1GHFH 3CFJB 4HPYL 1A3RH 3H2WA 2MTPA 1EUTA 1N5YL 1JNLL 4HUNB 2HRPH 4LDOB 4LFHG 4MYWB 1SJXA 1EHAA 4LK4A 2XQBH 1DEEA 3IDXH 5E5RB 5J6GA 3V4PL 1MFDL 1ZWIB 5F9OH 5FKPA 2IQ9L 3BUYA 4DFHA 1MWAB 1Y6KR 5DHVA 4YPJA 3T4YA 4PGEB 4YNYB 5I73B 4CN1A 1X5AA 4XHJC 4UT9L 3A67L 3QIBB 2NXZD 4OIIH 4TUKH 4RQQB 1XIWC 1MRFH 1EEQA 8FABB 1DL7L 4OLZL 3BRFA 3IDYC 5CUSL 3QEGH 2F54B 4OZ4A 2OZ4L 4Q0XH 4OCRH 2YUZA 3L95B 2X4NA 2AV1B 4R2GB 2E7LC 3ARBC 2VR5A 1WCQA 1G7LB 4KTEH 5IVXA 4OLWH 5J89A 4PY7B 1CLOL 2YR3A 3BD4A 3GIVB 1U8MA 1FDLL 5D71L 2ADFL 1YY8A 6FABL 4I3SH 4KU1A 4Z78B 5D1XB 5GGQL 3QISA 4KPHL 3WS6C 1ZLVK 3PV7A 4PPTA 2X4OA 3KPQB 4PJFB 1MCBA 4YXHH 5I1JH 2UY6A 3ZYJA 1A7OH 4O02L 5FYKE 1QQDB 1QLFB 3PWVA 2AJVL 4R7NA 4NN7B 3ECBB 4M7JL 4OKVB 2E9WA 3DJ9A 5C0FB 1JK8A 1NGQH 2HN7B 3RWFB 2R0WH 3U9PH 1QLEH 1ULVA 3TJEL 5H37G 4FQ2L 1C7TA 4N0CC 1JWMA 5D70H 4LPYA 2Y7QA 1AGBB 3MRLA 4H0HB 1FVDB 5T3ZL 1Z9MA 4P2OA 3V5KB 1J8KA 1RK1A 2L4OA 3IDMB 3LMJL 4WY7H 4DKEL 1P84K 3RWEB 3UTQB 4CJ0A 2BJML 5E70A 3PGDA 1FZOA 2F54E 3NCCB 4EEEA 4ZXBB 3TF7C 1LVEA 3MA9H 1WWWX 3RTQB 2DI8A 4JANA 2CLZA 1HH9A 3DBXA 1QFWM 1BD2B 1IEAB 4HC1H 2CUIA 1HHIA 4GAYA 3QJHB 4AY0A 1PX4A 3BEVB 4NZUL 3VXSB 5IVZA 1EZVY 2ESVB 3GSRB 5H8DA 3NACH 5JOFB 1QA9A 4PJFE 1Q94B 5CEXB 1CGUA 3S96B 1TPXB 2OL3L 1DLHB 3QAZB 3FT2B 2XKUA 3QH3B 5GRUL 3AS3A 2F74B 5CAYB 4G9FA 1H3PH 2MJWA 1MJUH 4ODWA 4I4WB 4I3RH 2YXMA 5FO7A 1ZS8A 1NMAH 2DRUA 8CGTA 3C5JA 3HR5B 1RJYB 4TSCL 4JM2A 1DQTA 1LNUA 2UZIH 2OR7A 4P2OD 4DUWA 4HF5H 2JJTC 4CDGC 1Q0YL 5B3JF 3MRRA 1DBJH 1XGRB 2B1HL 1C7SA 4HHAB 2JB6B 3I75B 4NO0A 5DRNB 3BI9X 3HA0A 3LSOA 1KTKE 2I9TB 3WFBH 1UWGH 3GZKA 3U0WH 3HC0A 3CX5J 5EBMA 3LPGA 4M5ZH 5D96C 4PP2B 3H9ZA 4MXQC 4MQ7B 3IDJB 1NAMH 1RZGA 3FAWA 3LEXA 3NABL 4WV1C 3RY4A 1U92B 4WI8A 5EOCH 3GJFA 1HXYA 1QSEB 3ARRA 3BPOC 3IXAA 2Q8AH 1OT1A 2LTQC 1QTYT 4NPYA 4YHML 1VPOL 1BD2E 3OJDB 5LBSL 1FFPA 4GRMB 1HYSD 1I7TB 3HC3L 1JWSA 3U83A 3KPMB 3VXSE 3IXTA 4TNWK 4H25A 5T5FH 4JPKL 1N8ZA 3NCYS 1CE6B 4G9FD 1DN0B 4FQ1H 1R0AL 5EPMB 1VENA 5DRZA 1HSAA 5EN2A 3F8UB 4QO1A 3BRDA 1Y18B 2WIMA 4GH7B 4JM2D 4K71C 3UJIL 1S7XA 3VRIB 1HH6B 4YIQB 3OGOE 3UZVB 3QPXH 5FAAA 5L2KB 2PO6B 4NO0D 3VD5A 3HNTL 1QR1B 1ZVHA 1ONQA 4PJDF 1RJLA 5DTFA 2V5TA 1MNUH 2NMSA 4DFIA 1P4BL 3J8F7 5D9SB 5BW7A 5GS0H 1SJHA 1HHKA 5DEGB 3WIFB 4OCYH 4ZTPH 4BUHA 4K3GA 3DX8B 1UG9A 3U30B 1MJ8H 3DURA 4NRZA 1EO8H 3SDXA 4ODXB 2EYRB 5C86A 3ZHDA 4QHKI 4WTZA 4XMLL 4PRHB 3UYRL 1HHGA 1G7MB 1MIML 3QA3B 1QSEE 3B5GA 1OW0C 1WBXA 2XFXB 2NY1D 3GSNH 5KS9F 2BVOA 5IEHB 3KR3H 2V7NA 2NPLX 3D39A 5I15H 1HK6A 2FL5A 1T2XA 2FJFA 1A1NA 4HH9B 3S3PA 4XZUB 3KAAA 5DR5L 4P23B 1GL4B 3RIFK 3GHEH 5ABDE 3NFNB 1JPGB 2EDRA 1J86A 2FECI 4PB9H 1X5HA 4P5MB 3HNSH 4DTGH 4OAWA 4KHXH 4I0PA 2R29H 3KNBA 3X12A 4J6RH 5K9OB 1S9YA 2VLJA 4ISVB 4HIEA 4YK4B 3MRBB 2X6MA 4Y8DC 4NKMA 3GM0A 5FXCH 2H8PB 3CLEH 3THML 4FQQA 4G43A 3X3GL 5EO1B 4KUCF 5DGQA 4X5LA 1JGDB 4LVHC 2EIZB 1AD9A 2BDNL 5IW6A 5IB3A 1KJVA 2V2XA 1E28A 3VXPA 5I1IH 4I77H 5HGBB 5H35B 4NNXB 4K94H 3FQWB 4LIQL 4N8CL 4FZEH 4EI5C 1BQUA 4PRHE 3KPNA 3QNXB 4O2EA 3VFNB 4G6AD 4XHQA 4D9QD 2Y07H 3D39D 3F7VA 2AQ3A 3GMLB 2CK2A 1SBBA 4U6HB 5E00A 3BN3B 3IU3B 3HNVH 4MMXC 2IEPA 4JHWL 1T83C 4EUPG 1DBBL 4YJZL 5J12C 3TZVC 2AXFB 2MNUA 1D5IH 4PJIB 3MJ8B 2OK0L 4MDIA 2PR4L 2X4PA 4K07A 4WWKA 3G5ZA 3HE7B 4I0PD 1DBAH 1IAIM 3H3KA 1FBIH 1AHWA 2FIKA 4NUJA 1ZGLP 4X0KA 3GMOB 4GKZA 1DTUA 3T8XB 1NDGA 4FMFA 5CGTA 2CR6A 3X3FL 1S7WA 3O9WB 4PJ5A 1MUJA 1T20A 4P9HH 1KXVC 5HHVL 1OL0A 1I3GL 4LCYA 1JYXA 1C5BH 4PJAA 2Z8WC 4ZODA 1KOAA 2W9DL 4DVRH 1TXKA 4KWUA 2Q76A 2ZPKL 2DQHH 5CJ8A 1JI1A 1UGNA 1YC8A 1RZFL 2F19H 2IAMA 5CSZB 4X6EA 4P4KC 3CD4A 3I2CL 2IH1A 3Q0HA 4LU5H 2X4RA 4JREC 3FQRA 4R0LB 2R1XA 3F12B 1NCDL 3NCYP 3ZE1F 1TVBB 3D6GA 1A6WL 1NQBA 4OGZA 4AIZA 1LO4H 1LO2H 2E8YA 3SQBA 4X6BB 1T1YB 2LVEA 4Z7OE 4HT1H 5FKAB 4WFGD 3W9EA 2AJZA 1DUZB 5HGDB 1EEYB 4WWKD 5JXEC 4JJ5A 1WEJL 1LK3H 4TTDD 4AEFA 4DVBA 4PJIE 2FRGP 4TUOB 4JO4L 2R4RL 4WDIB 1JZ7A 1C1EL 1I1AB 1JHKH 3MLXL 4ZG1A 3SKNA 4WNQA 1HINL 4PGJA 4YHKL 4PJ5D 5BZWB 1SHMA 3SJVE 1MPAL 2XZQH 2HT3D 4Y5VB 3EYUL 3GNML 1N59B 4RA3A 3CXDH 5DI8B 5CIPA 5JOPE 3DGGA 1CK0H 5HHOE 4AEHL 1TJHH 2IAMD 4S1RL 4NM8H 1FYHB 1NGPL 3CCHA 4OQ1A 4C59B 4D0BB 3TH3T 3D2UA 4ZAKC 5E8EA 4WI2A 5KVDH 1CU4L 3BKYL 2DDQH 4LCWE 1QVOB 5I9QB 1NAMB 3EOBB 3UZQA 4OCLC 5IEKB 2FX7H 2PW1A 1P7QA 3GKWH 3JTTA 2NQCA 4WW2A 3DETC 5IROA 1FNGA 3PJSA 1BQHA 1S78C 2GIYA 1FZJA 4QY8B 3HPJA 2I9LA 5CBAA 1GZQA 1U3HB 4P2RB 4ZYKA 2W91A 2HT2C 3T0EC 5D2NC 3MFFB 1U8LA 3ES6B 3I6GA 4AH2A 1WC7A 4L8DB 2H26A 3EGSA 1A22B 1EIBA 4XC3H 1FN4A 3MRPB 3BEWA 4PRAA 1T6VN 1LP9A 2X4QA 4JG0L 1QHPA 4YBHA 5C6PB 1BWMA 2V5YA 3EYFA 1HDMB 5CFHA 5GS2H 5FCUH 2BCKB 2UZYB 1X5YA 1YJDC 2BERA 4JPWL 4C83A 3D2UD 2VZ3A 1W72L 3MX0A 1EZVX 4JN1L 4ONHA 4OUUA 4R4FL 5IM7B 5ILTL 4Q97A 2A6IB 3TIDB 4ZPTB 5HYSA 5FO9B 5IKCA 1NMCB 5LG1A 1Q0XL 4O2FB 4JZNB 4M7ZB 2XQYG 5L2JA 4YDKL 5D7SL 1KIRA 1R6VA 1MLBA 1P7QD 2BVQB 1ZLUK 5JHLL 3CX5K 2ICEA 1A3QA 1NBQA 2XZCL 5J3HC 2VKXA 1QPPA 4PRPB 4BH7B 1I8IA 2GTWA 3VE0B 1YY9C 5B8CA 5IHZB 5HD8C 3RPIA 2JCCB 1MFCH 3KS0J 1CFNA 5FOBB 1RUML 3GSNB 3LEVL 3TO2A 3HUJA 4ELMA 1V7NH 4P2RE 3FT4B 1NFIB 4BFIB 1ZHBA 4Q6IC 2HKHH 2NTFA 2NY0D 5DO2D 1I75A 1TLKA 1R24B 2KKQA 3VI3F 4NKIL 3LS5L 2Y36L 3VFTA 4Z7VB 3UAJC 1C08B 4Z9KB 12E8H 3O3EA 3SGJA 1F3DJ 3K4ZA 4G9DA 4NUGH 2DLFH 4NKDA 5F7DB 1NDMB 3ZYIA 3VFVB 1YEJH 4NGHH 3BAEH 4U1GC 3QUMH 1XGUB 3DXAA 4PRIA 5MEOB 1U8OB 4BQCA 3IDIB 3L7EA 1WIUA 5IBUG 2ZUQC 5C3TA 1JPTH 2VWEE 4WU7B 2KL6A 2UUDK 1GPOL 5A3ID 4L9DA 1IGIL 2IPTH 3HFMH 5D1ZC 3QULB 2AXGB 2Z92B 4UIKH 1KELL 1LO3H 5KSVA 4OD3L 1U2CA 4PLKC 4M8VA 3B2VL 5T1DH 1BVKB 5IB2A 3KPLA 4OZIA 5T1LB 4ORGB 1RD6A 4PRPE 2YK1H 3FFCB 4A6YA 1GGIL 3EO1A 4FABL 4O4YL 2JCCE 3EJYC 3R06B 4ZSOA 4NO2B 4N68A 3QUKA 1WFNA 3T3PF 5KSAA 3CLFH 4PJBB 1DQML 3QHZH 1S5HA 4UU9B 5ESAB 4WHCA 3I84A 3PDOB 1PKQA 5F96L 2CRZA 5F8RC 1X5GA 4HXAH 1TCRA 5MHSE 1A7QL 1R5VA 3FQXA 4Z7VE 3RNKA 4N0FB 4J3UA 4D0CB 3U4AA 1U42A 2ZOLA 3DXAD 4PRID 5D2LF 3SDDB 1CT8A 2E27L 4L3EA 5I1KL 3UC0H 4DGVL 1JV5A 4HSQA 4Z77B 5TGBA 3EDEA 1X5JA 5DFTA 5KAQF 4KZEL 4MQTB 4XP1H 2E9IA 4NCDA 5IK3A 1UZ8B 4HAGA 3WEXA 3KHQA 3CC5A 2QADB 1G9MH 2QQLL 4H26B 3HN3A 2VZ1A 4MDJB 4LAQH 2OJZH 3QQ4A 5HYFA 4PJXF 3E8UH 3RU8H 3ULVF 2VDML 4HUUB 3MNWB 5I16B 4KMTH 2VLME 3NAAH 3ELAT 3FZUD 1I1FA 3E3QC 5DHVH 5EZLA 4D9RE 1EHNA 3WL9B 2ENSA 2HT4D 2Y5TB 3C9NB 4LSRH 3ARGA 2NY4D 1T7VA 3U48A 5FOJA 1CVSC 5D6CA 5KSAD 3QIUB 4DN3H 1FPTH 3P77A 4G5ZL 2PW2A 3GJEA 4LVOB 1BQLL 1QKZL 4PJBE 1AGCA 2PTUA 1T7XA 3UTSB 4XWGL 4PJ9C 1A4JB 5F6HI 1K8IA 2C3HA 2R2EB 1A7RH 5TDNA 4IIQC 5DC9B 3I3EA 5F7KC 3HI6L 1L7TL 4LLAA 4L3ED 3VGDA 1RK0A 1NAKH 4JRXA 1M7IA 4Y5XA 5C0GA 2Z31B 4MJ2A 4LEXL 4MQXC 2CDGA 1AY1L 4P59H 4ETQA 4ODUA 2C3WA 1T1WA 1B2WL 4LDEB 5BS0A 1KENH 1TQBB 4LKCA 1FIGH 5C07B 3P4MB 3L1OH 3WLWC 1WBYA 1OTSD 2ZCLH 2GSGA 4JFEA 3C2AH 3ULVC 3MUZ1 4NWUL 5GGRY 5F70A 1N64L 4MWFB 2FBJL 4JFHD 3W39B 2LABA 1SYSA 4DKFL 1I9RL 4UTBH 2IFGA 3ARGD 4HXBL 3RL1B 3ZT6A 3ZKXB 5SX5H 4XNQA 2BOBB 4JFPB 4G7YH 4ENED 4OD1H 1OSPH 3EUUA 5I76A 3BWUC 4CAGA 4V1DA 3O4OB 2EDJA 1KCKA 4G6FB 3K8KA 2GY7B 3BKCH 3B6SA 4JLRB 3ZO0A 2XXMB 1CXHA 4YXKH 5J1SC 4U6XA 5CD3B 4JCMA 3UTSE 5J6HA 4U49A 4F57H 5KVGL 4JY5H 1L7IH 1MVUB 1R3JA 2EH8L 5HDQH 4Z76A 4GG6F 4ALAH 4FFWD 4JRXD 1V3LA 1F00I 1P6FA 4LEOB 4DEPB 1NBYB 4M6OH 2DQTH 3GBML 2B39A 2YPKB 3WV0A 1JPSL 4OFIA 5DT1L 5MERA 4GAGL 5BS0D 2EZ0D 4QRUA 4JPIA 5E6IA 3QNZA 1JRHH 4M6MH 4M7LH 4K7FA 2CLRA 4JFED 4L1DA 5FA4A 2IH3B 2BMKB 2OTUA 3V0VB 4HCRA 3F58H 4PJEB 3L3GA 3W11D 1LO5B 1EO7A 1VFAB 2ARJB 3KPRB 1JGUL 3UO1H 5CKAA 1BZ9B 4HGWA 9CGTA 5IQ7L 1EEZB 5J4MA 1TMCB 1FJ1B 5DVLA 3EO0A 4V1DD 1F4YH 25C8L 4UQ2B 3P0VH 3RFZC 3I50H 3RL2B 4NJAL 1ACYL 5DJ8A 1M71B 5A43C 1UM4H 3DI3B 4IMKA 2G2RA 1MCFA 1Y0LB 4TULL 5A40E 1RFDH 2WNGA 3BKMH 5IB4B 4WHYG 2CPCA 1B4JH 1AJ7L 1VADA 3CGTA 3FO9A 2XI9A 1V05A 3GJFH 3V4VH 5FHAH 3K2UL 3H7BA 4YGAB 3U46B 1VFBB 3GO1L 3V6ZB 2FGZA 4N1EA 5E6ID 2DMCA 3BW9B 3IJSB 4KMLB 1ZMYA 4W68A 5E8OB 1BJMA 4X5WA 4FTVB 2O5XL 4KMQA 4P57B 5JXAL 4MCYA 3MLUL 2DQIL 4M8QA 2WUCL 1WWCA 5KZCB 3ZLQC 3GB7A 5HJ3B 1EAJA 4IMLB 4PJEE 1FZKA 2G60L 3RVWD 4X4YB 1WZKA 4FQXC 4OGAC 4NC1E 3ARQA 4XH2B 1NGZB 2X9WA 3KPRE 3MRNB 2CO7B 3NA4A 4PLJD 1A2YB 1IC7H 4X4ME 5IFAH 1KJ3L 1Q9KB 2DQDH 3MLTB 3CFDA 5IVNA 4NM4H 4KK8C 2WAHA 5KANG 2FSEB 3H9HA 4XVUC 4C57C 2AW2A 2NXYD 3L7FA 2EYTB 1T0PB 3QQ3B 1NEZB 4PGDB 3BZ4B 1FNLA 2R0ZL 2FEEI 1T0NA 2NXZB 1KLUA 1HILA 2YKLH 1K4DA 5EZOL 1XCQA 4JAMA 1JN6B 1QSFE 1SYVB 4Z7UB 4NO3B 5IHLB 1MCPL 4P46D 4UILH 2VKWA 5DJDB 1BZ7A 1K6QL 3EOTL 1X5FA 3RX7A 3QDAA 2NY2C 3R8BB 1MFAL 4FTVE 1QBMH 3O3UN 5M94B 4XB7A 3IAGC 1KT2A 3D18A 3PGFH 1NBZB 3L3JA 3RX5A 3REVB 1CLZL 3O41A 5FYKL 3LKOA 4XPFL 4I2XA 1T04B 4UDUA 3GUTB 4P5TC 3RVVD 3U6RA 3RWGA 3BPCA 5A2IH 3E6FA 1P6AB 3QXAA 2HTKC 1NUFA 5EFIA 3AGVA 3EYVA 5JW4M 5FKPB 3BT2H 1MWAL 4YX2L 3BUYB 2ITDA 1GC1L 3ARUA 4QYOA 3WHE0 1HHJA 4S11A 4Z7WA 1Z9SA 1HCFX 1BP3B 3LKRA 4XWOD 3C5SB 1WICA 4KHTL 1CFSA 2ITCA 4MSWA 3V9FA 1EV2E 4XAWH 4OZ4B 2QV2A 1CFVL 2O5YH 1XGYH 1Z9LA 4RWYH 5GJTL 1S8DB 1F4XL 1UA6L 4Z7UE 2VXQH 4OZFB 5IVXB 5I17B 4LSTL 43C9A 1UACH 3DVFA 1IAOB 3ARYA 1U8HB 1TETL 1MCQA 1YY8B 4R9HA 3MBXL 4DGYL 4Y5YA 3LIZH 3M07A 4MA3A 5KG9A 1SEQH 2X4OB 3GSOB 2NZ9C 3TBTA 4D9LL 3AM8C 2YA1A 4R7NB 4LRNL 3T0VA 2Z9TA 3WDIA 4IRSC 1JK8B 3MLSL 2D7OA 4XNZB 3JWOC 5IGXH 1A6AA 4M9PA 2RQ8A 5AD0A 1MAKA 4G80B 5E8DH 1JWMB 4PYHA 2Y7QB 4G6KH 4RFNB 4EDXB 4HG4K 4GJTB 3MRLB 5CJXC 3FN0H 3U4EA 4P2OB 2V7HA 1HYRC 3CIQA 1QEWB 3L6FA 1RK1B 3PP4H 1T21A 1AR1C 3EFFA 3S3SA 2LU4A 3L5XH 4S1SL 5J57B 3ET9F 3PGDB 3L3IA 1G7JA 1FZOB 3MV11 4U1MA 1P4IL 1ZXQA 5HYIA 5HDBF 2J8UF 4OQTL 3AXLA 5IVXE 4ZPVB 4JANB 2CLZB 4LNRA 3KLAA 4MXVF 5GRJH 5F71A 1HH9B 3DBXB 2EDFA 5EZJA 5DVKA 1HHIB 4GAYB 1DBKL 1II4E 4O5LH 4N5ED 4WTWA 5CZKA 1OARH 1PZ5A 1QA9B 3S36L 1G9EA 2EDBA 2W92A 3ULUD 2MQCA 5FM4A 1DBML 1GGTA 1IILE 4XCYA 3SOBH 1UM5L 4G9FB 5HHPA 4TPRL 4RZCA 3QCVL 4R3SA 2KPNA 3E2HB 1EVTC 3C5JB 2HVJA 4JM2B 4KJPC 3ZDYF 1LNUB 5FGSA 5CIPH 1AFVH 5TE7H 1OAXL 2ATKB 3MRRB 3BP6A 3QQ9D 3TBYB 2NY3C 5KN5B 1TZGL 2YD4A 4KH2A 1GAFL 4NO0B 3SKJH 4YEFA 3LHPH 1YC7A 1JZ3A 1BBDL 2QEJA 3CSPA 1OP5H 5FUZH 3ILQD 1IVLA 4LQFL 4OM1L 1YYMH 3DTXA 1ROWA 4RRPA 3LEXB 3HLAA 1T66C 5B38G 5JQ6H 1CXIA 3SE8L 1OTTC 2XTJC 1HXYB 4GFTB 5CEZL 3QZWA 1LO0H 4QGYA 4NPYB 1Q38A 3PIQA 2OTWA 3WD5L 3QO1B 1H3WM 1NCAH 2Q8BH 1JWSB 1O5DT 3LQMA 3MGAA 4D94A 4NT6B 1A3LL 4WIQA 1N6QL 3IXTB 3TYGL 4H25B 2NY1B 3FRPG 1N8ZB 5F1KC 5C9JB 3JV5A 5CHNA 5CBAB 4DUXA 5DRZB 2G5BA 1HSAB 5EN2B 4G9FE 1NCNA 4JGUA 2I24N 4N0CD 1TENA 3C08L 4Z18A 5EORL 1YEIL 2AK1H 2YD5A 4YGVB 4L8SC 4JPVH 2JJTA 5LGHL 5HHQA 1RJLB 3WKNA 5DTFB 3O6MH 4YE4L 3S88H 4F7EA 1SJHB 1HHKB 2XWBA 4LKXA 5K9QI 5ADPH 1MFEH 2D7NA 4G6JL 4NRZB 2NYYC 3WS3A 3SDXB 4WV1A 5DF0A 1HHGB 4UUJB 7FABH 4Z7QF 3P30L 1UXSA 4Y4HA 1RIVL 4ONGH 1RU9H 1CZ8L 1EEUA 1T1XA 1KB5L 2BVOB 2ID5A 4OV5A 1QACA 2V7NB 3D39B 2FL5B 2FJFB 1HOCA 5HHXH 1VKXA 1FC1A 5BZDA 1GHFL 2W38A 3HS0A 1A3RL 1DUYA 1TVDA 2JB5H 1QYGH 2HRPL 1EHLH 1WVZA 4QNPE 3BSZH 4OAWB 3O2VH 4I0PB 2XQBL 3IDXL 4MJIB 5HVWA 5B4MC 3KNBB 3X12B 5F9OL 3BMWA 1S9YB 3JXAA 4AMKH 4HIEB 4POYA 4NKMB 4KRPD 1SY6A 4FQQB 4G43B 2ZJSH 4MVBC 4OIIL 4TUKL 1AD9B 5IW6B 1MRFL 5IR1A 1KJVB 1QZ1A 2V2XB 1E28B 1EAPA 3VXPB 3F7RA 3QEGL 3SDXE 4OFVA 4GAFB 4Q0XL 4OCRL 4Y4HD 1T2QH 3N0PB 3KPNB 2FX8H 4KTEL 4J3XA 4A6YH 4OLWL 4XBPA 2DKMA 2HLFC 5C0DA 1MLCA 1VEMA 3F7VB 2VLRA 4I3SL 1TJGH 4ZS6D 5E00B 2P5WA 3FL7A 4WO4A 4D9QE 4PBWD 3D39E 4M1DH 4YXHL 5I1JL 2VRAA 1A7OL 4PJ8A 3LPFA 5F88A 2Z4QA 3QDJA 4MDIB 4YAQA 2X4PB 4WWKB 5GZOC 1NGQL 3KYNA 3OV6A 2BRQA 1O7VA 3OKNA 1AHWB 2FIKB 4NUJB 4X0KB 2R0WL 3U9PL 1QLEL 4Q2ZA 4BFEA 4GKZB 4PJDA 1NDGB 1WIPA 2DM2A 3NFPA 1IL1A 5D70L 1S7WB 4JZJC 4LCUA 4PJ5B 1MUJB 1T20B 3ZE0F 3Q6GH 3B9AA 4LCYB 3CFEA 3BP4B 3MRDA 5DUPH 4WY7L 2Q76B 1EUUA 4PJHF 3O2WH 4HJGA 2IAMB 4X6EB 3H9YA 2IH1B 1W8NA 4HGKC 2H32A 3VA2C 3B5HA 2X4RB 4AM0A 5MI0C 1YPZF 4BUGA 4R97B 3MA9L 1TFHA 2R1XB 2XPGB 1S3KH 4YFLF 2VLRD 3BESR 4HH8A 5GSVA 5KS9A 4AIZB 1MCJA 2P5WD 4WO4D 3QNYB 2HLAA 2I07A 4EN3C 4LSVH 3TLRA 1UB5A 4HC1L 5FM5O 1FSKC 3KWWA 3W9EB 2AJZB 3GI9L 4PJ8D 2G5RA 3NACL 1T83A 3QDJD 1D5XA 4DOHE 4JJ5B 1NSNH 4WFGE 4OZGA 3UDWA 3S5LG 1T7YA 1DANT 3GK8H 1VA9A 3BPLC 3TZVA 1RY7B 4M4PA 3QDMA 3PDDA 1E6JH 2FEDC 4Y4KA 1H3PL 3SKNB 5F7HA 4WNQB 1MJUL 3V5HA 4I3RL 2AKRA 1NMAL 1NBVH 4RGND 2UZIL 4ZOEA 3OPZH 1I9EA 4M6NH 4PJ5E 1A6PA 1NUGA 4HF5L 3QUXA 1CXEA 3DGGB 1DBJL 4PJAE 3KDMA 5DVOA 1ZSDA 1I1RA 1N5AA 4UZGA 3CCHB 2FGWH 3WFBL 3U0WL 3D2UB 3HMXA 2ZUVA 4JG1H 5E8EB 3CNKA 4M5ZL 4PGCA 4WCYH 1PAMA 4YDIH 5F9JB 3CAFA 1S9WA 3T08A 1NAML 4U1HB 2O5ZH 3OL2A 5ICXA 5GZND 5EOCL 2PW1B 1P7QB 3QEHA 2Q8AL 2FJHA 4GRLB 2GHWB 4WW2B 1FNGB 4JKPH 1IAMA 2EICA 4Q9BA 3WN5C 2RAMA 1BQHB 4PR5A 2C1PA 2Y1VA 1FZJB 5D4QA 3TZVD 1KULA 5F7YC 3HPJB 2CUMA 2I9LB 2C3VA 3K81A 1U58A 1JCKA 1GZQB 1KGCD 1FAIH 3QDMD 4N9GA 4ZYKB 5T5FL 5AG8A 3IRZA 4Y4KD 3MCG1 1KIPA 2NR6D 1U8LB 3I6GB 2WIIA 1Q9WA 4FQ1L 4AH2B 3O6LH 4MAYC 1WC7B 2H26B 2NY0B 2BOCA 3EGSB 3UPRA 1FN4B 3U0TA 4DZBA 3BEWB 4PRAB 3QUXD 3QPXL 1LP9B 2X4QB 4KUCD 3RWHA 4QXTA 4ZO8A 2CMRH 1FLTX 3EYFB 5I71B 4CBPA 2X1WL 4PGZA 4HCRH 4OIAA 1CI5A 1WQVT 5IUSA 1MNUL 4C83B 4OUUB 5GS0L 4F80A 4Q6YA 4U1NA 4OCYL 2DQEH 5HYSB 1NL0H 1HQRA 4KV5F 5IKCB 3G5VB 1YA5A 4ZTPL 4N0UA 1MJ8L 1EO8L 5IFHH 5L2JB 2R0LH 4W4NA 1V8HA 1JZ6A 2ICEB 4CKVX 7CGTA 5DD3H 1CGVA 5B8CB 1I8IB 2GTWB 2B1AH 2ERJC 5JZ7C 4LSSH 1AI1H 4YC2B 3GSNL 4YHZH 4N9OB 3KR3L 3TO2B 4FS0A 3MJ9A 2NZIA 3HUJB 4ONFH 4UMGA 5I15L 4LVNC 4ELMB 1SVZA 3ARSA 1ZHBB 3LPWA 4ZQKA 2P7TA 5E2VH 2NTFB 1FVCA 2DYPA 2WINA 3SDAA 1B0GA 3ARPA 3O4LA 2B20A 2BVYA 3GHEL 3P9LA 3T3MF 3VFTB 2BVPA 4WVRA 3VWKA 1DANU 3O3EB 4PB9L 1Z3GH 3GRWA 4G9DB 1F58H 1LP9E 3HNSL 4DTGL 4NKDB 4KHXL 2R29L 3KPSB 2CLVA 3GMMA 4J6RL 4KAQH 4PRIB 5E94B 1MFBH 5SWQA 4ZUTA 3CLEL 3L7EB 2UYLA 1EPFA 2X9YA 3OWEA 2X89A 2AXHA 2X7LB 4GXUM 5ENWA 4I77L 5I1IL 5I8EA 1R5IB 4LP5A 1ZT4A 5LWYH 2DLTA 2OJEA 4FFZH 4K94L 3RVXD 4FZEL 1ZT7A 3KPLB 4OZIB 4K3HA 1EFQA 3DETD 3DNKA 1F90H 1S78D 1D5ZB 1OQXA 4A6YB 3CFIC 3EO1B 4RMVA 3LB6C 1C12A 2Y07L 3ALPA 3BGFB 1FL6A 2HT2D 3WHE1 4KK6C 4ZSOB 1DVFC 1N7MH 2NY4B 3QUKB 2ZUTA 3HUJE 3K7UA 3HNVL 4ELME 2DYPD 3HZKA 3N85H 1BM3H 3SDAD 3VJ6A 5KSAB 3O4LD 1S5HB 1OQOA 1E4WH 3S4SG 1PKQB 3VWKD 1D5IL 2AP2A 4JKLA 3F7PC 1KJ2A 1TCRB 3IJYB 1R5VB 3FQXB 1DBAL 1FBIL 4R8WH 2ZOLB 3R8QA 2JF1A 4XTRC 2A0LC 4E42A 2HH0H 1CT8B 2ICCA 4L3EB 5JHDA 3VI4E 4QF1A 3TN0C 3FMGH 3L3OA 2DMBA 2PYEA 5DDHA 5C0RH 5CEYA 3DXAE 4P9HL 4PRIE 5TGBB 3SBWC 1CGSH 2Q1EA 2V5SA 2W60B 2IBZY 2X89D 3PL6C 4WW1A 1C5BL 3O11A 1IZKA 4DVRL 3WEXB 2DQHL 5D1ZA 2F19L 4IJ3B 2N7AA 1T4KA 1A7NH 4DKDC 3FQUA 3HAEA 3NCJH 5J3HD 1O0VA 4M93B 2H2SC 1MHHA 1RZ7H 1YY9D 4OZIE 1I1FB 3MRIA 4NQTA 2VZUA 1G7HA 2EDOA 2VABA 1VGEH 4IM8A 5E5MA 3WIIH 3SGKC 2VXSH 3ARGB 1QNZH 1LO4L 2APXA 4NWTH 1LO2L 5CCKH 4PB0H 5BV7H 5D6CB 2M2DA 1NKRA 1UC6A 4ZSOE 4HT1L 2MHAA 5ESVB 3P77B 3TCLB 2PW2B 3GJEB 3LDBC 1AGCB 3JV4A 5E99H 1LK3L 3ULSA 3FO2A 2HJFA 1PKQE 2DQUH 3UAJD 1K8IB 1UKQA 1NCCH 4HLJA 5TDNB 4RFEA 1JHKL 4RSVA 3WNMA 5JHDD 1RK0B 2PYED 3D69A 1NH6A 4JRXB 4S10A 5C0GB 1JI2A 1RSFA 2XZQL 4L3EE 5C08B 5I1EH 2CDGB 4XVJH 3CXDL 3DX9A 2A9MH 4ODUB 1X4XA 1T1WB 1CK0L 3MNVA 4MD4A 3M17A 5DD1H 5BS0B 3CH8A 2C9AA 4LKCB 5D1ZD 1TJHL 2VLKA 2YRPA 2AEQH 4W4OC 1WBYB 3H0TA 4NM8L 2GSGB 4JFEB 3ULUH 4N1CA 4PLKD 1CQYA 2GW5A 1FNAA 4XBEH 1SYSB 4QCIA 5KVDL 3P2TA 5TE4H 1NANI 5AYQA 2DDQL 4JFHE 3T0BA 5H2BA 5I76B 2FX7L 3GKWL 1HE7A 4V1DB 3F5WA 1ZLUH 3OKOA 4BZ1H 3EFDL 4J3OC 3JTSA 4NQEA 5AAWA 3U2SA 2Y5EA 4U6XB 4ZFOL 2I25N 2HMIC 5J6HB 4W6WB 3CSGA 3VRLE 2CIIB 3K8MA 1GZPA 2IBBA 3SDCA 1R3JB 4UBDC 3RNQA 3FRUA 3DX6A 2ICES 4R90H 4U1JA 4XC3L 2V5RA 5HGAB 4JRXE 2VXUH 2RIKA 4QRUB 4JPIB 2F8XC 2VLKD 1XF1A 3D0VA 4H20H 5E6IB 3QNZB 1WITA 2VSCA 4LP4A 4K7FB 2CLRB 3MRJA 4HFWB 5FCUL 5FUOH 5BS0E 4M7KH 5FA4B 2OTUB 1A1MB 3ZDXF 3L3GB 5MP6H 4JFEE 1TTFA 2XIDA 2J2ZA 3Q5OA 2VC2H 3IVKA 5GGTA 2XV6B 1MF2H 2ZOKA 1QG3A 4HGWB 5GS3A 3O6KH 1CG9A 2PCPB 4HIJA 3OAUH 3EO0B 5C0AA 5KOVC 4C58B 1UJ3C 4P2QB 5DJ8B 1TZHA 4V1DE 4NQED 5B22A 5I74C 5I1CH 3B2UC 2G2RB 1MFCL 4RISH 3BDBA 2EEBA 2NXYB 1RIHH 4FXLA 3SDCD 1CDGA 1V7NL 3K2MC 3UPAA 2HKHL 3FO9B 4PV8B 1VEOA 1ZOXA 1QFWI 1KCRH 4JQIH 4PD4J 1RURH 3HMWH 3MV01 3REWB 12E8L 2VL4A 4NUGL 2BP3A 4P46B 2DLFL 4CMHC 4X5WB 2Y4SA 1YEJL 2YPVH 1MJJB 3G04A 4MCYB 4NGHL 3BAEL 3KVQA 3WLWD 3QUML 1SJVA 4M8QB 4GBXA 1QBAA 3QIWC 3JWDH 3GB7B 4MXWH 3X13A 3ULVD 2IFFH 1FZKB 2W0FA 5DHYB 3AREC 3PDGA 1JPTL 1I3RA 4JY6A 2IPTL 4UT7H 3HFML 5H94A 3QI9A 2HFEA 1L0YA 3BQUC 5C0AD 4NQSA 4UIKL 1LO3L 1JFQH 2YRLA 2YSSA 2O61B 5EC1A 1GXEA 1S7SA 5T1DL 3CFDB 3QHFH 1U95A 2BHUA 3H9HB 3LS4H 4H8WC 3W0WA 2YK1L 3VFMA 3L7FB 3V0AC 4MMZC 5EUOA 1N6UA 3ISWA 2D7TH 1I9IH 2VO5A 1KLUB 2EDLA 3CLFL 1HILB 3MFGB 1K4DB 1XCQB 1UWEH 4GG6A 2BZDA 3QHZL 4JAMB 4QRTA 3EJJX 1NLDH 3L3KA 4ZO9A 3O2DA 3TA3A 1RV6X 4H1LG 4HXAL 1P9MC 1BZ7B 3O6FC 4YZFF 2Q3AA 1WIOA 2QLVB 2X1QA 3ZKNC 4GBXD 3WMSA 4PJCF 1T7WA 1KT2B 3DV6A 4KTDH 3UC0L 3D18B 3L3JB 2B4CC 2MOVA 4FQLH 3QI9D 4I2XB 2Z8VC 4K3DH 4UDUB 4XP1L 1RZJC 4I13B 3U6RB 1T89C 1RPQA 5TDOA 3O3AB 3RWGB 1G9ML 3BPCB 3E6FB 3QXAB 5HVFB 3BH9A 5EFIB 4LAQL 2OJZL 1N0LA 1VGKA 5LAXA 1MCLA 3E8UL 4TRPH 2F8OA 3EYVB 3RU8L 5HYEA 5JW4R 4KMTL 5CGMA 2AXJA 3W0WD 3NAAL 5D8JH 2YZ1A 1T1ZA 2ITDB 2ZP0T 1SY6H 1KACB 4LSRL 1RZ8A 5HVHB 5JW4N 3D1MC 2DTMH 1HHJB 4Z7WB 2XY2A 5BV7B 5IMLA 5KVEH 3LKRB 1CD1A 2GTZA 1ETZA 1CFSB 1PY9A 4DN3L 1FPTL 2ITCB 4MSWB 3TA3D 2QQNH 1LK2A 4QHNA 1K3ZA 3RI5F 1M05A 2NX5B 3PV6A 4NCC2 1U2HA 1A7RL 43C9B 5EU7C 4JFDB 5IFJA 3TYFA 1NAKL 2MQ3A 2GKIA 1MQ8A 2AJUH 4Y5YB 4GKSA 2M8XA 3T2QA 2A83A 4P59L 5KG9B 5IV2A 4LCCC 3ZDZF 4NP4H 1A6ZB 3TBTB 3L5JA 2J12B 3TPUA 3QG6A 3VG0H 1KENL 1ZWIA 4I2XE 2JJSC 1FIGL 1J1PH 3L1OL 5C6WH 1H3XA 4LBEB 4P5TA 3QBTB 2GEEA 3A6BH 2ZCLL 4JFOA 4YNYA 3C2AL 3WUZA 2ORBH 1A6AB 4YHPA 3QIBA 5DJ6A 4QOKB 5AD0B 1ZHLA 4L8CA 4HAFA 4UTBL 3MUY1 2OBGA 4OCNC 2IPUK 4G7YL 4MA1C 4LHJB 4BZ2H 4OD1L 1KIQA 1OSPL 3B5TA 3U4EB 1UH2A 1OP3H 2V7HB 3K0WA 4NNPH 4Z7WE 4LQ1A 3L6FB 4HW6A 3BKCL 4WTXA 3INUH 1T21B 3EFFB 2PXYC 4RBPH 2BSSB 4YXKL 2H32H 3IDYB 1G7JB 1ZVYA 4U1MB 1ITCA 1JNNH 4F57L 4JY5L 4IRJA 2DQFA 3LVEA 1L7IL 1J87A 3AXLB 4F8QA 2NY2D 4QT5A 4F58H 4LNRB 4XCFH 4ALAL 2EDQA 5HDQL 2J88H 3KLAB 1NPUA 1Z2KA 4M6OL 2DQTL 1OOAA 5EZJB 5C0FA 3RWFA 5IP4A 3VFPA 3MZGB 4P5TD 1JRHL 2VTFA 1K2DA 4M6ML 4M7LL 3U9UA 3AM8A 1RMFH 4I48A 3UROR 2HTKD 1ZV5A 1CDUA 1IAII 3LRGA 4XCYB 5GHWH 3QIBD 1AGBA 1DDHA 2P48B 3ULUE 1IFHH 3UO1L 3WNNA 5HHPB 1OCWH 4RZCB 2GT9A 4U6TA 3RWEA 2HVJB 1OHQA 1MI5B 5CZXC 4OZHF 1F4YL 3RVUC 3NIDF 3P0VL 5JW4Q 3RA7H 3BP6B 3I50L 4HLZH 3T0WA 5GS1A 3TVMC 4QRRD 5D1QA 5CINH 1YEKH 2P45B 3W5NA 1UM4L 2IADA 1AH1A 2YPLA 3HMXH 4IRJD 1RFDL 3WFHA 3BKML 5A2LH 1B4JL 4U2ZA 3QJHA 3DTXB 3VXSA 2ESVA 3BP5A 4LOUD 3V4VL 5FHAL 5F7FA 4OV6F 3SEPA 3QZWB 1DJSA 3UBXG 3PIQB 2OTWB 2D7MA 3FT2A 1H0DA 3HC4H 5I73C 4ZMAT 4GRWF 4YFDB 4O58H 4DCQA 3IDUA 4CUCA 4O51B 4H5SA 3KLDA 3V2AR 2DL9A 3RWIA 2GJJA 5CHNB 2G5BB 1XGRA 5CS7A 4R2GC 4O9HH 4PFEA 1Y6MR 2HFFA 5DFWH 5IVOA 1IC7L 3JUYA 2I9TA 2BRRH 5IFAL 3ARFA 2DQDL 3VMPA 5D1QD 1FL3A 4NM4L 3I85A 5HHQB 1AR1D 3OAYH 2OP4H 2YPLD 5JW5A 2BC4A 3N06B 4F7EB 1JF1B 3OJVC 2XWBB 4LKXB 4CU8A 2GY5A 5GISH 4KRPB 2J8UA 2ESVD 3OJDA 4WEUD 1XF4B 3HTLX 5D96B 3WS3B 3IYLW 2YKLL 2GFBA 4U1SA 4WV1B 4XCEA 3K4AA 4OLUH 4UILL 5F7WC 4OTXH 2N7BA 1UXSB 2XWTA 4Y4HB 2LTQB 3C60C 1NC2A 2Q6WA 3O8XA 1T1XB 5HI4C 3T2PA 1S9XA 3MJ9H 1QBML 1Y18A 4PD4K 5C2BH 5L8KB 5FCSH 1CDYA 3PGFL 5I8CB 1HOCB 3WJLC 4YR6A 4BQ9A 1VKXB 5L2KA 4FG6C 3HS0B 2E8ZA 1DUYB 4K71B 3ARFD 1VACB 5FGRA 3GRWH 4HIHA 4C54A 3QFJA 2GCYA 4DUVA 4H0IA 1L0QA 4L8SA 1WTLA 3HB3D 4LPCA 3BT2L 1YJDH 3QO0A 1PQZB 3VMNA 1A6TB 3K1KC 4ZO6A 3EKCA 3SGEI 2XZAH 4QKXB 5IR1B 1EAPB 1E27A 5JIPA 1T66D 3QAZC 4KKBC 2XA8H 2XTJD 5L6YH 1EJ6A 4XAWL 3VXQA 4L9LC 4OFPA 5DLMH 2O5YL 1WJ3A 1XGYL 5JR1H 2YEZA 1NC2D 1RVFH 1GSMA 3O8XD 2AI0H 2VXQL 2VMFA 3P4LA 1UACL 4XBPB 5HYJA 2VOTA 4LSUH 1MLCB 2VLRB 1C5DA 4FFVC 4RIRA 5DJCA 5TDPB 1HWHB 3VXRA 2P5WB 4WO4B 5L2KD 3NFNA 1NC4A 1JPGA 3LIZL 4CN4A 1F11B 5D72H 1SEQL 3P73A 2BHYA 2J3SA 4LHUB 3OG4B 1XZ0B 1JGLH 4PJ8B 3RHWK 5F88B 2Z4QB 1KJ2H 5ACZA 1RHHA 3QFJD 3QDJB 4YAQB 3KYNB 2WBWB 5T5NG 4HMEA 5IGXL 2H8PA 1LGVA 3OKNB 4Q2ZB 4JO2H 2EIZA 4PJDB 5B3JE 1M7DA 1PBYA 3NFPB 3VXUA 5E8DL 3ZYOA 5H35A 4LCUB 5AG9A 1MCRA 2CH8A 4JFFA 3OJ2C 4G6KL 3B3IA 3CFEB 3FN0L 2HWZH 4P0DA 3MRDB 3MR9A 4LVHB 3PP4L 2ZCKH 4HJGB 3L5XL 2WWKT 3HAEH 1JYVA 4RMRA 4YFLI 2H32B 3RVTC 2Y72A 4E41A 2HJKB 4E5XB 5J06A 5HYJD 1H5BC 1YN6A 3RDTC 1OVZA 3IU3A 4BQBA 3RPKA 4F8TA 5KS9B 2E9BA 5DD5H 5GRJL 3VXRD 4EUPA 3WIHA 1NC4D 2AXFA 1SEBA 2VLRE 1WWAX 2NLJA 2JJVA 1QFOA 3W2DH 2P5WE 4O5LL 4BA8A 4F7MA 5GRWA 5EU6D 1OARL 3GMOA 1QUNA 1RJZA 1D5XB 4KVNH 3T8XA 4OZGB 5J12B 5CP7B 3TZVB 4YLQT 4XVTH 1NCWH 3QDJE 3WBDA 3SOBL 2X4SA 4Y4KB 2FECL 2OM5A 5FIEA 3VXUD 1EBPA 4OI9A 3V5HB 4QXUH 1S9VA 4HPOH 2AKRB 3BRGC 1PJ9A 4BYHA 4JFFD 3F7YA 2FZ3A 4KVCH 4PJDE 1H3GA 3N1FC 1DN2A 4JZJA 2AEWA 2NNAA 3LQAC 5FB8A 1AFVL 2EYSA 2VISA 4UNUA 3QUXB 5TE7L 3MTRA 4RGNE 3KDMB 3GSUB 3SKJL 2GITB 1ZSDB 4IOFC 1N5AB 3LHPL 1TVBA 2EE6A 4E41D 5GGSA 4AEIH 2AJYH 5FUZL 1BMGA 4X6BA 3H6JA 4PGCB 4U1KA 1U8PA 5DC4B 1YYML 4JREB 3AU1A 3NBNA 5JQ6L 5ICXB 2VQ1B 3EZJB 2ZG1A 2BSRA 5KS9E 4HWEH 1OGAB 5D7LA 3QEHB 3IAQA 2FJHB 5J56B 5HI5D 4TUOA 4WDIA 2DTSA 1NCAL 2Q8BL 5CGYC 4PR5B 2C1PB 5EBLA 5KBNC 1I85C 1G0XA 4N8VA 1U58B 4N9GB 3ZT7A 5GZOD 4OZGE 1KIPB 1D6EA 4TOYH 2WIIB 1N59A 4K55A 4OGXH 1K8DB 2IMMA 4HD9A 3QDME 1KGCE 4LCIH 3S36X 1CVRA 5DK0A 1HNGA 5EWIH 3DVIA 5HXMA 4DZBB 5CWSA 2AK1L 3ZSTA 2VDNH 3MMEA 5C09A 3RWHB 4D0BA 1AQKH 4QXTB 2NY5H 4JPVL 3P4OA 4AYFA 3LEYH 3OGCA 1KN2H 4HJ0C 2Z35A 3O6ML 4MAUH 4PJHA 3S88L 3FO0H 3OTTA 3ULVH 5GGTH 5I30H 4U1NB 5ADPL 1R3HB 1MFEL 4P49A 1HQRB 1YPZA 4HKJA 2FHCA 4NQDA 3MCLH 4BFGA 3DHJA 4N0UB 4JDZA 3IRPX 5D7LD 3BVNA 3MREA 4FXKB 1MQKH 7FABL 1PZUB 1U3HA 3TT3H 5JOEA 4UAOC 4NN5B 1W0VA 1BFVH 2E3VA 3EIFA 3NH7H 4ONGL 1RU9L 2IG2H 4LSDA 3WN5A 1PGRB 1MCSA 1IQWH 4GMTH 4MA8H 5I8OH 3H3PH 4NSKA 4Z95H 3D9AH 3CDGA 3QUZA 1N2RA 2FEDD 5HHXL 4ZQKB 2P7TB 1L0XA 3LRSA 5L9DH 1FVCB 2DYPB 2WINB 4MAYA 1B0GB 3MPCA 3O4LB 5D7KD 5C09D 4J8RB 3P9LB 2JB5L 2BVPB 1QYGL 5F72S 2BVUA 3IB4A 4NKOA 1EHLL 4J4PC 1J0JA 3WXWH 3BSZL 5BMFH 3LN9A 4M1CC 2X1XR 3O2VL 5DC0A 5FO9A 1UYWH 2CLVB 3GMMB 1UZ6F 4S1QH 5J1AA 4AMKL 4YDLC 3OKYA 4R7DA 4L3AA 5SWQB 3DRTA 4ZUTB 2KZ1B 1QFHA 2UYLB 4NQDD 1IGMH 2ZJSL 5FECA 3CH1A 1GRWA 4OD2A 4FA8A 3WO4C 4BH7A 3U4BH 5ENWB 1T3FB 4HK3N 5I8EB 4X9BA 1JZ8A 1ZT4B 4N0UE 1NANH 4JDTH 1I1AC 3LQZA 5D6DC 4XAKD 2A38A 2OJEB 5FOBA 1YEGH 1ZT7B 5JMRA 1T2QL 1YZZA 3CFKA 2WK2A 4GXUN 3RI5K 2FX8L 1G9NC 1KEGH 4A6YL 2BNRA 4JRYA 1JGEA 3MV7A 5DEFA 2QSTA 1C12B 3CZJA 3QUZD 1FL6B 3VFSA 4QLRA 3OB0K 1TJGL 2R0KH 4NYLA 2X41A 5INCA 3HZKB 4M1DL 5IQ9A 4MAYD 3VJ6B 4Q9CA 1DQJA 3ARDC 2YZ8A 4LARH 4TNWF 3SPVB 3O2DH 3U7AA 2VDOH 3TWCH 4JGMA 1RQ5A 3O4LE 1A02N 4AIXA 1KJ2B 1RZKH 1U8OA 2J5LC 2XICA 1IC4H 4KJWD 3RGVC 1KBGH 3ALWA 4WU7A 4E42B 1W8OA 1T5XA 3D87B 4ZTOH 5JHDB 3QULA 4QF1B 4U1GB 2PYEB 5DDHB 5CEYB 3G6DH 3QWQB 1HIMH 3O11B 3T0AA 2ZUQB 3HG1B 2EDYA 1A6UH 5DUPL 1VB9A 1JYWA 1F97A 5L8LB 3FFCA 5D1ZB 3O2WL 4ETYA 2AAVA 1T4KB 2WV3A 4U1LA 3FQUB 2BNRD 4JRYD 4HWNA 1IGJA 3MV7D 5CKGA 5ALBH 3MRIB 1S3KL 4FFYH 2VABB 4AEEA 5ESAA 3RBSA 5FA3A 4LPTA 3B43A 5CJBA 4LSVL 5AAMA 1DVFA 2J7LA 5F6IB 5B39G 2MHAB 1T0MA 3SE3C 3GI8H 2OCFD 2VWEC 1AGFA 1NSNL 3S9DB 3ULSB 3BPNC 2V2TA 1NMCC 2YA2A 3FO2B 2HJFB 1QFWH 3GK8L 4OLEA 1SBSH 3DMMC 3ETBF 4M7ZC 3BN9C 4PTUA 5D93C 1E6JL 4RFEB 4MA7H 3MLVH 1IBGH 1AP2A 2N56A 3MROB 3D69B 1NBVL 5JHDE 5L0QB 3TN0A 2XWJA 2PYEE 3DX9B 3OPZL 4M6NL 2AEIT 3SBWA 1FFOA 4MD4B 3M17B 3PL6A 5DUBB 3FFCD 1YMMA 2VLKB 5E9DA 3H0TB 1NCBH 2FGWL 2Y5TA 2Z91A 3RGHA 4U6YA 4JG1L 1A14H 4WCYL 4YDIL 4QCIB 3D3VB 1M7XA 3ZMRA 5TFSH 2O5ZL 4XX1E 1KPVA 3LKPA 5H2BB 4KK6D 3SGKA 1DVFD 3VFOA 2P8LA 3F5WB 2R56H 3OKOB 2R2EA 4JKPL 3QXTA 3JTSB 3RRQA 3QR2A 4NQEB 3U2SB 4B53A 4NC2B 4XPAH 5DMYA 3VI3E 1FAIL 3PWJA 5GQBA 1GZPB 3SDCB 3O6LL 2V17H 4O00A 2OTPA 1YDPA 2A0LD 3FRUB 2N4IA 3RNQB 5DHXB 3DX6B 5D2LB 5A2KH 4K94C 4U1JB 5C07A 3TN0D 5FF6A 4PLNC 2IQAA 5EOCJ 1ZHKA 3T2OA 3PL6D 4F9LC 1YMMD 3DLQR 3D0VB 1OM3H 1BWWA 2CMRL 2VIRA 5E9DD 3VD4A 5ISZB 2A74A 3H9SA 4YHIB 3MRJB 5H37H 4HCRL 2VLKE 1U41A 4JFPA 5BVPH 1RULH 3GEWB 3JWOH 4HV8A 4PJXB 3O81A 3IVKB 5KANI 3GBNH 2DQEL 3MA7A 1NL0L 2ZOKB 4HMCA 4KRMB 2EE9A 1CG9B 1AO7D 4HIJB 4PYGA 5IFHL 2R0LL 3B4NA 3E3QE 5C0AB 3U0PA 4EKXA 5DD3L 3IDGB 1XMWA 3T3PE 4OBRA 2B1AL 3DV4A 5ID1B 4POZC 3AROA 1X7QA 4LSSL 1AI1L 5KVFH 3Q5YA 2V5MA 4NQEE 4YHZL 4ONFL 3ILPA 4L4VA 3FCTA 3EJZC 2FNBA 5E2VL 1INDH 5C07D 3MRMA 4JKMA 1NUNB 2AJSH 2APBA 1PY4A 3MXVH 2RCSH 4HDIA 2EXWD 2ZUXA 4XT1C 4OF7A 1MCCA 2ARWA 2IH3A 5CJQH 3V0VA 3T4AA 4LSQH 1Z3GL 1F58L 1LO5A 3H9SD 3G04B 4N5UA 5DJXA 4GBXB 3Q3GA 5FUCC 4KAQL 1MFBL 3X13B 1R3IH 4WI9A 3FFDA 3S8WA 3HZVA 3UMTA 1XF3A 1BOYA 4LVOC 1KLFA 4Y0GA 3ULVE 1I3RB 4JY6B 3BISA 4R26H 4NQSB 3KYAA 2YSSB 2DLGA 3JWNC 5LWYL 3I3DA 4FFZL 3UXFA 1S7SB 1KC5H 2FHBA 4KKAD 4K2UH 5C0AE 1XEDA 2H6PA 1U95B 1F90L 5TF1H 1MFNA 3SCMC 3MGTB 3W0WB 3VFMB 1AGDA 3RUGF 1KUMA 1KV3A 4L4VD 4L8BA 4CDHA 5DVMA 4JB9H 2HMID 2UWEF 4X6CF 1N7ML 3BHBA 3OKLA 4GKOA 2P24A 1FNSH 5JW3H 15C8L 3N85L 1BM3L 2P44B 4G6MH 4GG6B 5E8OA 3L9RA 1E4XI 2QQKH 4QRTB 4K9EC 1E4WL 2ENYA 3L3KB 4P3DA 5HTSA 4P57A 3T0DA 1OAQH 3TA3B 3STBA 4HUKB 1J0IA 4PJGF 2E7CA 2VITB 2IQ9H 1RUKH 2WANA 1KCSH 1CLCA 1C8PA 4R8WL 2JJWA 3N1QC 4HMDA 1NGXA 2DJUA 4WI7A 2HH0L 3R0NA 3DV6B 3U82B 3FMGL 1A9BA 1X4YA 5C0RL 1LE9B 5DD6A 5ICZA 1CGSL 4MZ3A 1IAIH 3GMRA 1DZBA 4X4ZA 4NC0B 3AREA 4LMQI 5TDOB 3QUYC 1TITA 3PABA 2D0HA 3BH9B 2EIBA 3GSQA 1VGKB 5LAXB 1A7NL 3NCJL 5EU3A 2XRAH 4URTB 4DEPC 2WW8A 1RZ7L 1QFUH 3G6JF 1G6RB 1T1ZB 3GM8A 2IANA 2VQTA 1VGEL 2HJLA 3WIIL 3W0WE 1RZ8B 2VXSL 3CSYA 1VEPA 4NDMA 1JN6A 4NWTL 5CCKL 3VWJC 5EUOE 2QJDA 4PB0L 5JDSA 5BV7L 4NO3A 1K5NA 3WFEH 5IMLB 3K74B 2EDKA 2GTZB 3BDXA 5ADOH 4NC1C 4GG6E 4KY1H 2R9HD 1LK2B 4QHNB 1TZIA 5E99L 1M05B 2ATPA 4JY4B 2DQUL 3X14A 3PV6B 4Y19A 1NCCL 4L3CA 4PJ7F 4IDJH 4OLVH 3TYFB 4Y88A 1T04A 4GOSA 1WSST 1FYTA 2NY2B 1BX2A 3TT1H 1FFNA 1Q9OA 1V3JA 4GKSB 4U2YA 5FYJD 4ZDHB 1VHPA 2VB5A 4QTIH 5I1EL 4XVJL 2A83B 4LLDA 2A9ML 4PY8I 3ARED 3STLA 4X7DC 3HCVA 3V0WH 5IV2B 1Z5LA 3SO3C 3TPUB 3QG6B 1M4KA 4OF8A 2WP3T 5DD1L 2AEQL 4P5TB 1T89A 4EI6A 3ULUL 4M62H 4JFOB 3KLSA 5LGJB 3S34H 4QRQA 4YHPB 1VSCA 2Y6SC 4X6FB 5DJ6B 2IAND 5CMAB 3PP3H 1ZHLB 5AWNH 3T1WA 2V9QA 4XBEL 1S7QB 4L8CB 4OF0A 5TE4L 1CD9B 4Z7UF 3DYPA 3C5SA 3UPCA 5EA0H 4S0SD 1KIQB 4RWHA 4Y2DC 4TVSa 1S8DA 1X5IA 1XGTA 3ROOA 4OZFA 4JR9H 4BZ1L 1FAKT 5I17A 4NHUA 1UT9A 1IAOA 1U8HA 2FEEL 1F6AB 4QRRB 5GRUH 4Y19D 4G8FA 1FLRH 3C6LC 4M9OA 4QHLA 3B9KC 5LJYH 3ARVA 4IRJB 2C7UA 3MQIA 2DQFB 3QRGH 4G8GA 2X4TA 3ZKND 1FYTD 3GSOA 4QT5B 4EUPH 4XRCA 3WIHH 4PJCA 4R90L 3HKFA 4XNYH 5EIIA 3RKPA 1CICC 2VXUL 3EYQD 3G08A 1EH9A 3VFPB 4H20L 1WZ1H 1K2DB 4JQVC 3U9UB 2AS5M 5FUOL 4I48B 2KDGA 3K4DA 4M7KL 4I5BA 2JJSA 4G80A 2VZVA 2NXZC 5MP6L 4IRSB 4A2LA 4EDXA 4B5EA 1DDHB 3HE6A 3TGXA 2VC2L 5I1LA 1MF2L 1QEWA 4M4RA 2GT9B 3O6KL 1GGUA 3OAUL 2ZWLT 4WFHD 4I18C 3C09C 4BSVA 3SGEH 3GSVA 5GS1B 3GMNA 3F6IA 5D1QB 5I1CL 1EDQA 4D3CH 4ZPVA 2IADB 1L4IA 2YPLB 4RISL 3ZKSD 5CILH 1RIHL 4QRRE 4G8GD 3WFHB 1Q72H 5EUKA 1T2JA 1WAAF 3TPKA 5C1MB 2EE3A 4U6VH 4YHYC 4K8RD 3BP5B 3LD8B 1HHHB 3H42H 1KCRL 4JQIL 5IMMA 3LKNB 1OB1A 3OG6B 1Z0NA 1RURL 3HMWL 3GIZH 1GOGA 2BVTA 1CF8H 1H0DB 2DD8H 5GPRA 2WBKA 4DCQB 2YPVL 5SWSA 4H5SB 2MPAH 3HE6D 3JWDL 4OJFH 4HS6A 4MXWL 2IFFL 3RWIB 4J1UA 2ZG3A 3MYJA 2ATKA 4RX4A 3TBYA 1IEBA 5E08H 3VFGH 5KN5A 4UT7L 3SDYH 2VNCA 2JE8A 4I9WD 1LEIA 4F33A 4OCMC 4IEFB 1VFOA 2HFFB 1JFQL 4Y2OA 3ARFB 3TH2T 1EXUB 4OSUH 3QHFL 1FL3B 1UKSA 1KCLA 4U0QB 2AVGA 2FJGB 2UY7A 3LS4L 3H8NA 5JW5B 2BC4B 3TVMA 1N26A 5I1AA 5TPWH 5DXWA 3FKUS 5B38A 1JL8A 4CMMA 3RAJH 2YPLE 1E4KA 4B50A 5EO0A 2J8UB 1I9IL 3QO1A 1BECA 2XN9A 4HEPG 1BREA 5F1IA 2GFBB 1UWEL 4FQJH 3EDJA 4NT6A 4U1SB 1NLDL 4XCEB 2ESVE 1DQDH 3D5OF 2FX9H 2FB4H 1G7IA 3HZYA 2XTJB 1B9ZA 1XFPA 4U7MA 2XWTB 3FRPA 5FGBC 1NC2B 2Q6WB 5SWSD 5C9JA 3O8XB 2P8PA 4APQC 1S9XB 4UT6H 4KTDL 5ID0A 3WUWG 1TQCB 3VH8G 4YGVA 4RX4D 4YR6B 4FQLL 3VD7A 4R96B 5T5NF 1J7VR 3DUHA 4K3DL 3JVGA 2WZPD 3MOAH 3OX8A 5CZXD 1J12A 4HIHB 4OZHA 3WCYA 2I27N 3QFJB 3RVUD 1U8KB 4TRPL 2GCYB 1UB6A 4L8SB 4AENA 4CADA 3TVMD 4PP1C 5D8JL 5IESH 1U3ZA 2GAZB 3QO0B 4PV9A 2J6EA 4CVUA 1SY6L 2A73B 2EH7H 3J7HA 3ZKMD 4UUJA 2DTML 1HYSC 2XN9D 2H45A 5KVEL 1KSRA 5HDBE 1IM3A 1E27B 2J8UE 2PR4H 4DQOH 5F21B 2QQNL 3VXQB 2CUHA 2KBGA 4N8PA 4MXVE 5IOPA 2YEZB 3KYKH 3E2HC 1JTPA 2XTJE 3TBWB 4C4KT 2DMKA 4Y4FC 2XNAB 5HYJB 1ZT1A 1IKFH 3C60A 2EXYD 4RAUA 1D5BA 4RIRB 1C5DB 1JTTA 5DJCB 1HWGB 2AJUL 3VXRB 1NC4B 4J3TA 3SKUD 4NP4L 4MHHI 3WJLA 3P73B 5L2KE 4MJIA 3VG0L 1OY3B 1G1YA 5ACZB 1J1PL 5EU6B 1RHHB 3A6BL 3DUSA 4QXGH 2Z8RA 3QEQA 3ZHLA 3M45A 3G5XA 2ORBL 3V6BR 3QFJE 3CSBA 4WI3A 1M7DB 4Y16C 3VXUB 2X4UA 4JFFB 4DWHA 4JE4B 3VU2A 2DWEA 1C16A 3B3IB 4BZ2L 1BOGB 3V95A 4NNPL 4B7LA 3MR9B 3INUL 4YO0A 4HKBA 5F8QC 1A7PH 4J2XA 4NO5A 4P48A 3NA9H 2ADJA 4E41B 4L9LA 4ZOBA 2JELH 1JNNL 3RWCB 3TBSB 1YN6B 3C60D 5F1NB 2FO1A 4F58L 4XCFL 1QR4A 2J88L 5HYJE 1A6VH 4K23H 1BJ1H 4NNYA 2YOCA 4EUPB 5ITFA 2EKSA 1SEBB 1SMAA 4X9HA 2BK8A 2Q7YA 3O0RH 2NLJB 5EU5A 3VXRE 3QCTH 4MJID 4F7MB 5BW7C 2W59A 2HA1A 1GIGH 4S1DC 1S5IH 1HSBA 4GO6B 1RJZB 4FG6D 4Z0XB 2ZZUT 4FQCH 3QEQD 5DFVD 5IMKA 1RMFL 5I75C 3WDJA 4OGYL 5EU6E