5HHOE

Crystal structure of the jm22 tcr in complex with hla-a*0201 in complex with m1-g4e
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
240
structure length
240
Chain Sequence
GGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIRSSYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 49
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoE02
5D93B 4FQIL 5IGXL 4H1LH 2H2PC 3GSWA 3QIWC 4XH2A 2H1PH 1OQXA 1PY9A 3FTGA 5I1EL 5JTWA 1FHGA 2CRZA 5K59F 3AM8C 1MSPA 2QQQA 4MAYD 1XZ0B 3IETA 2UZXB 3EO9H 4LSUH 3TYGH 4H26A 1QSZA 3FMGH 3MODL 4Q7DA 4Z0BH 1KNOB 3C8KB 2F74B 4JZOB 4JRXE 1T0MB 4X4XA 3QI9D 3X11B 2MJWA 1KTKE 1KFAL 3F65A 2XQYK 2UWEE 4YDJA 4QHNB 3CVIL 3PIQB 2Y36L 2WBWB 4WI5A 3IJYB 4Z7UF 1KLUA 1YEDA 2H2SC 3IKKA 4J8RB 1MH5B 1RHHB 5SV4A 1G7IB 4L3CA 4EXKA 1JGUH 4NFCA 3FN0L 4JFOB 4HWEL 4MQTB 5IHUL 5DHVA 4LASH 3CUPA 5MEQB 1CGWA 5IFJB 4O02L 5IROA 5EIIA 3PWUB 3C60B 4GG6E 5LKNA 3SBWA 4TUJB 4UI2A 1R3IH 5J4MA 1AXTH 1YMHA 4MA3B 3FO1A 5CD3A 3QP3A 5JDJA 4YHOL 4OIIL 1YNKL 2ZJSH 5ERWA 5E7BA 5E7FA 5I1CH 5KBNC 1DVFD 3CLEH 4ZUVA 2OLDA 1EGJL 3IDJA 3RL1B 3ARDB 1CDJA 3V6ZB 3MJ7B 4NUGH 1ZLUH 5HHME 1JTPA 5KOVC 5IEKB 1YEKL 2N4IA 1W8OA 4UDUA 2IWGA 2OL3A 1UKTA 5ACZB 4OFKA 15C8L 3WJJA 4X6BA 2PF6A 4ZFFB 1DUZB 2VAAA 3O0RH 3IDIA 2HT4D 4H8WC 3PUCA 3B6SB 4KXZI 5I73B 5EU4A 4MQ7A 1U8MB 4NZTL 5DXWA 4JJ5B 4U2ZA 3I02B 3IDNB 3VFRB 1QFWM 4J23A 3A67L 4PJBA 1VEPA 5AZEL 3MOQA 5SX4H 1DUYA 1JHTA 4XAWH 4ETQA 4LLAA 3KYNB 2XZZA 2YD8A 5HHPA 4NHUB 5IQ9B 2BK8A 3EOAA 3U79A 4MHHI 1A0QH 2HT4C 3MRPA 1T04A 2BVOB 5LAXB 4V1DB 1K8IB 2FWOA 2ZSVA 2FHCA 4EI5B 4L4JA 2CIKB 4OGZA 4PRIA 5E2WH 1FNGA 1I4FB 3CC5A 3F58H 4NHCL 3D2UB 1OPGH 3O8XC 4EDXB 5GS0C 2JJTC 4HUWB 2G5RA 2QQLH 4NT6A 3BIKB 5EDXA 1GGBL 4P2OA 4BH8A 2PW1B 1OGAD 2I60H 4Y2DD 2FJHB 4H20H 1D5ZA 4KUZH 2QSCL 4R96A 2XWJA 1F8TH 1I1RA 2A6JB 4NZJA 3C5SA 1G84A 4M93C 3V2AR 1QRND 2AK4D 3WMSA 4TULL 5FF6B 1JNNH 3DX9A 4GRLA 3LQAL 4NBXB 4XC3L 1N6QL 1E28A 4HIIB 4WUUD 5T1DL 1OP5K 4C56A 3KR3L 1CLZH 2X4PA 3LMJH 2AV1A 1I9JH 2NCMA 4FTVA 2WWMD 5HY9B 3ARED 5SWQB 1BQHA 3IFNL 1JPFB 4FQXD 5F96H 1I3VA 2NY7H 5L0QC 3ARBA 3NIFE 3LPGA 5GS1C 4QHMB 3MPCA 4OZFH 4KAQH 5FECB 3FT2B 4R6UA 4HUXB 2NW3B 4G9FD 3OPZH 4OF0A 5BRZE 3LZFH 1H8OA 2X4NB 2NXZC 3AXLA 4BKLA 3MRNB 4P99A 3V5HA 1EHNA 1NGPL 1NCUA 5ITBH 2EYRA 5DRWA 1AXIB 5J6HA 2B4CH 1E4KA 5EPMB 5CEZL 2M8XA 3VH8G 2DD8H 2OXGA 1GGTA 1INEH 1XGPA 3N50A 1MCIA 3DOSA 5D6CA 3NIFF 4JRWA 2ZOKA 1Z2KA 3KPRE 3L3IA 3EFDH 3C5ZD 2P5WE 1W8NA 2CQVA 1PG7X 2F19L 2FB4L 2IANA 3I3DA 3FO1B 3MBEC 2XYCA 3GMRB 2ICWA 1FJ1B 5D1XA 3T8XA 4M7KL 5CEXB 3WNMA 1ZT1B 5E94B 3VI4E 5L2KB 4ELMB 2ATPA 3C60A 1OLLA 4OB5H 3BD3A 4F9PA 2VQTA 3X3GH 5FDYA 4FZ8H 1NBZA 2VLJD 4ALAL 3G6AB 3ULUL 1MLCB 3NFNB 3T2OA 1LD9B 1A7OH 2GTWB 3MOAH 1FIEA 2EDLA 4NP4L 2O5YL 4NYLB 4CAGA 3VFVA 2HFFA 3B2VH 1M4KA 4XAKE 2XV6B 3P11L 4PB0L 3BP4A 2Z0BA 3GK8H 3GZKA 1OP3K 1T0NB 3CNKA 3N1QC 4JM2F 3U4EB 3VXTA 3WLBA 3DMMB 1SJXA 4OQTH 3OJ2C 1U2CA 2C5DC 1CVRA 4K3DL 5K9JL 1TCMA 1X7QA 4OQTL 3VDCA 4K2UH 1QR1B 2X4QA 3OJMB 1W0VB 4RDQG 4EI6B 3QDGB 4ZSOB 5F1KC 2W0PA 2EDFA 4LNVA 1RPQA 1K4DB 3HUJF 3EHBC 5IFHH 3MRMB 3EO0A 4BKLB 4W4NA 5DVMA 3I6GA 1T5WA 4ZXBD 4L9LB 5GGSA 3SDCC 1G6VK 3LKQB 1GPOH 5ALCH 3EYFA 4HWBL 5CP7A 5D2LA 2K1MA 2B8OT 4LSRL 3G04B 4Q9QL 1KG0B 2FEDC 4BFIA 3K2MC 1H3GA 5HY9A 1BWWA 3GMOA 5T33H 1BX2A 4YC2C 5E8NA 4KVNH 3LS4L 3ZSTA 4QF1B 3TWCH 2LABA 1D6EA 2QKIB 4GKZA 4LCCA 2CH8A 5IHLB 3MBXL 4HKBA 4ZPTB 3WD5H 4JAMB 3E8UH 2A9MH 3OKDB 5F7DA 3MRIA 1NEUA 5ILTL 3OMZA 5D9SB 4ZO9A 5DD0L 3DRTA 2ZUTA 1IC7H 1GGBH 3OF6D 4Y5XC 3L1OH 2X70A 5C0AD 4M1CD 3RWJA 5JW4N 1BVZA 4XMLH 1CIUA 5MEOA 1WAAE 2HYMA 3EKCA 4ZUUB 2H3NA 1J8HE 3HE7C 4U6XB 5DEGB 2F53E 4OZGF 3B9KD 2F5AH 1CR9L 1CXFA 4PRIB 1Q0YL 3ARGB 1FFQA 3PV6B 4V1DD 2R2HA 3KXFA 1AGBA 4W6WB 2Q3AA 4UNUA 2EIZB 3UCRA 1XIWD 2R2EA 4JFQA 4OCWL 5FYKL 5TE4H 5KSBB 5EBLA 5DUML 2YPKA 5JO5A 1PZ5A 3BJ91 4DFIA 1S9XA 3PV7A 5D4QA 1JWSB 2D31B 3U4BH 2QADC 4B53A 3LN9A 3V95A 1K4CB 5FA4B 4HMCA 3VXNB 1MNUL 2NQCA 4L8DB 5FUZL 1NQBA 1EFXB 4GQPH 1SJVA 1D9KB 1JPSH 2EE3A 4X83A 5IW1B 4XPHH 2VIRB 4UQ3B 5DRZA 5GSVB 5D7SL 4RQQB 3PWJB 4LARH 4TULH 1F4YL 2AEWA 3T3ME 5I15L 1MI5E 3MRNA 3V5HB 2NY2B 3LN5B 2VQUA 3CK0L 5E4EB 1I1FB 4BH7B 4HZLB 4DKEH 2XIDA 4PR5B 4HUUB 1NFKA 3F7VB 5ENWA 3ROLA 1Z3GL 5F6HI 4HDIB 1DLFL 4H5SA 1A9BA 4F9PC 1IGIL 3O4LA 4PRIE 1KCRL 5TE6H 4LVHC 3PWLB 4U1HA 3ROOB 3VXSA 3G5XB 1HILA 1KJ2L 5IW6B 1HHKB 1HQ4A 1ZGLB 3D25B 5IKCB 5E8DH 3CFEA 3MA7B 4ZFZB 3U0PA 4U1MB 3DVNA 3OX8A 1D5XB 4ZG1A 3KR3H 3VXRB 5J12C 1JL8A 1X7QB 5IHBA 2GSIA 1DLHA 3BGFB 4J7RA 4PRPE 4KGJA 2JLLA 3OB8A 4X0KA 1PSKH 2IQ9L 4X6DB 3VFOB 1LDPL 2A6KB 2BVQB 2CGRH 3T4AA 3S8WA 4HQQL 2B0SL 5GJSH 1BOGB 1SQ2N 1GSMA 1C16B 1OTTC 4H20L 4KUZL 1W72H 2Q8AH 4DOHB 4X80H 1F00I 1WBXB 1J0JA 2R0WL 2OZ4H 1KCSH 4Z77B 2OJEB 5FO8B 3FRUA 3KJ6L 2WW8A 2H26A 4R90H 5T1KD 3UC0L 3BQUA 5DZNA 4LU5H 4OGXH 4RGMC 4UNTA 3DMMC 5DYOB 3C87A 1VGKA 4LPTA 2YD3A 4NGHH 3IJSB 3MUHL 3GSNA 4Q9RH 2AK4B 2VSDA 5IM7B 5I19H 1DUYB 4O9HH 2F5BL 3HE6D 2MCPL 3HI6H 4QRPA 5HYSB 2VQ1A 5KZCD 1J11A 1LP9A 4U6HA 5IT2L 3JBG7 4OLVH 4P3WA 2BNRB 3RIFK 5D5MA 2FL5B 1QFOA 2R1WA 2B1AH 2KL6A 4N0YH 4PRDA 1JPTL 1CFNA 1P6AB 5KVEH 4NOBA 5CD5D 2J1KA 2YC1B 4K3JH 4YWGL 2XY2A 5TFSH 1T4KA 1JI1A 3MYJB 1GIGL 1DFBH 4NKMB 4EN3C 1K85A 2LQRA 4P2RD 2GT9A 1YMMA 1DFBL 4JY5L 1CE6B 1JTTA 4LVOB 4FXGB 2O5XH 1AGBB 2VKXA 2EKSB 4M61A 5LQBH 1Q38A 2ADFL 3HNSL 1INDL 4KI5D 2BXYA 2VL5B 1FSKB 1DSFL 5E2UL 4OGYH 5SX4I 1NLDH 5JZ7D 1QBBA 2WUCL 3ULSA 9CGTA 4AT6B 4OGAC 3OXRA 4YH6A 5EZIH 1FO0H 3Q3GB 3KPNA 3MRLB 3BZFB 1L9NA 5SWZB 3FCTB 5D5MB 2X70B 4KFZC 5FECA 2F53B 3HR6A 3SKJL 1ADQH 4JKKA 2HAZA 4RIRB 1ZE3C 3N1GC 2DQJL 4AMKH 1YNKH 2V7HB 5DJYA 5FOBB 4O58H 4LCIL 4M02A 1T2JA 5TH2A 3CSGA 4K2UL 4PBXA 4XHJD 3HS0B 3IGAA 3QUML 4L3CB 5GHWL 3L95A 3C5JA 5I74C 4OCLC 3HLAA 5D7JB 1B0RA 3AGVA 1WBYB 4HKZA 5I6XC 3QEHA 1QLEH 4LLMB 3WUZA 4NZRL 2VZTA 3SE8L 4YDJB 1AQKH 4YFDB 4NNXB 4HJJH 4JFFD 3VFOA 1TETL 4JFQB 5F6HJ 1NPUA 3CIQA 4XRCB 1KB9K 4U0QB 4GQ9L 4XCEB 4JCLA 5DJDA 1A6UL 4KJYA 4YO0B 3QULB 3MCKB 5EO0A 3JWDL 1FNEB 3KLHD 3CFIC 3PQYB 5GRYA 4KY1L 5A43C 5DLMH 1M05A 3CXDH 2W1NA 1HILB 2J5LC 3TO2B 3QUXA 1KBGH 4JVWA 4LIQH 4XNXH 1CFQB 3H0TB 1BHGA 3MXWL 3IFOB 3QDJA 3FO9B 3HZMA 4AIXA 2A83B 3GIZL 2E9BA 1JZ2A 1U6AL 5TGBB 4RNRA 2DMBA 3N9GL 5CMAB 2ATKB 3MTRA 5L8JB 5AYUH 3STZB 5IVXF 1SVZA 4DVRL 4JFDD 1Y6NR 2ZCHL 1MWAL 3W2DH 3UPCA 5FM4A 1P7QD 3RWCA 4WY7H 2B39A 3LEVL 1CICC 4XTRD 2VH5H 2FGZA 1IGJB 1NDGA 5C8JA 3QPQD 5IB1A 5IMOB 3MLYL 4XC3H 4YIQA 3PNWB 5FA3B 3W0WD 4MNGB 1Q9LA 2B2XH 4QY8B 5I6XB 4OAWA 3OGCB 2EE6A 4UT9H 3MRQA 2ILLA 4Y19D 2CLVB 4XWGL 1K6QH 4HFWB 4Y5VB 3FO2B 1KLGB 1IAOB 3V79C 3TH4T 2FECI 3KPPB 3PL6A 4CVUA 4Z7UE 2GY7B 3KXFE 5I0DA 1DR9A 4HIJA 1FYTB 2VKWA 3MO1B 4GXVH 4LVNB 3E6FA 5EU3A 3VWJD 3QDJB 3UXFA 4ZO7A 2NY3B 5ANMA 1RIHH 3FHAA 4PTUB 25C8L 2Z8WC 4J3SA 2GK2A 3NBNA 1NUNB 2DL2A 1L7TL 1YY8A 2HRPL 1TVBA 3DVGB 4G8GB 4HAGA 4NGHL 4EIGB 2NY4B 2WLZA 2R9HD 4CU8A 3BDYH 4KV5E 4NN6C 4UIMB 4Z6AT 3T0ED 1J86A 1Q94A 1DQDH 3LHPL 2XXCB 4J1UB 5GSRB 1MHCB 5E5MB 1YDPB 2R1XB 2X41A 5HI5D 2YZ1A 1K2DA 1C12A 1XGYH 5B4MD 4KTDH 3TIDB 3GJEA 5J56B 1PD6A 5HGAA 3SDDC 4HFUH 3RGVB 2CDEB 1RMFL 1S7WB 1J8HB 2G75B 4MLIA 2A6IB 3UYRL 2BFVH 2JB6B 4YHNB 3O2VH 3BUYB 3FB7A 2RJMA 4P46C 1HXMB 4WCYL 3MZTA 2DQCL 4HIXL 4OM1L 1AR1D 3VW3L 5CZVH 1GRWA 2IGFH 2LVCA 1IKNC 2DLEA 5F93C 3HMXA 1M6OA 1CF8L 4KQ3L 1KB5H 1AC6A 2VLKB 4Z8FH 4CUCA 3C9NB 3Q5YA 4C55A 5FB8B 2ICES 4NQCB 3SJVB 4LLYA 3RZWA 5F97E 1BIIA 1J05B 4PB0H 1XF2A 4YK4C 1E4WL 4L8BA 3RTQC 3LS5L 5ALBL 5HI3D 1AJ7H 4Y5YC 2VITA 3O2VL 5J06A 3QULA 2L4OA 2YRPA 3ULSB 2J88H 5KW9H 2PO6B 1G7LB 3PG2A 1UQSA 4K8RH 3MCG1 3L6FB 1A22B 5FEBA 5C08E 5EH1A 3ARFC 1JV5B 4LSQH 3ZL4H 5KAQF 4P2QA 4GAGL 3WIFA 2OP4L 1HOCA 2ED9A 1EAPB 3MBED 1T1YA 4M00A 2EKSA 1FFRA 4M61B 1YUHB 1T7ZA 1MCHA 1VACA 3C9NA 1MJ7H 5GGRY 1WAAF 3KPOB 1MJ8L 1UENA 4N8VB 1EHLH 2Q86B 5AG9A 2EYSA 1U8MA 5BS0E 2YSSB 1GPOL 3MJGX 1R3KA 1OB1B 3WFBL 3QCUL 2DM7A 1LDSA 3F12B 1HEZB 3PHQB 3QT2A 3D85D 3PQYE 4ZD3L 3BPNC 1FVDA 4PRBA 1ORSB 4JQIH 4MAUH 2DYPB 2CDGB 3GMQA 3O41A 3IFPB 2J8UB 3RWCB 1IT9L 2Y06L 1K8DB 3OKEB 3OKKB 2AXGA 3C08L 4TSAL 2G5BB 4X7TA 4H8WL 1ORQB 2IAMA 3BMWA 1QYGL 5HHMB 2VDQL 3QO1A 1RZFL 1TTGA 1DQMH 4P49A 4EEEA 1PVHA 3FQRA 1KBGL 3FO9A 1N26A 3T1FA 5T3XD 5FIEA 5JW3H 2YRZA 4GMSH 1O5DT 2OK0L 1F97A 1S9VB 3STBA 1I1AC 2R2EB 1HYRC 1AC0A 2GEEA 2VXSH 1SYVB 3LEYL 2QR0A 3BD4A 2DQGH 3PGDB 4FRWA 2YEZB 1C08B 5C0BE 3AU1B 1RU9L 1OF2B 1T3FB 2EZ0D 1M7IA 2HWZH 3VWKD 1IEBA 2H45A 4G9DA 4HUMB 4PB9H 3EDFA 1LEIA 1R3JB 1O7VA 3A6BL 1QHOA 1YEGL 2QSQA 4GBXC 5T5FH 2ZZUT 3TJEL 1P84J 4RGND 1R5WA 2EDXA 4K3HA 4U49A 1UVQA 2EDYA 4P3DA 4EUPA 5CILH 1EEQA 1J0ZA 3GDBA 1OM3L 3RUGB 1X5XA 4NRYB 3QO1B 5FYKE 2C3XA 4OZHF 4YXHL 4PS4L 1IKFL 4XCFH 1PEWA 1NDMB 3T2QA 3UTTB 4CVWA 4UT7H 4LAJH 4JRYB 1P1ZB 3MQIA 1ZHNA 3ZKMD 1Z5LA 4XVUC 3AS1A 4I4WB 1A6WH 3F5WB 4I18C 2JJUA 4RMSA 1YYLL 3WSQL 3EZ8A 1RUPL 5EWIL 5JPMB 2YSSA 2X9XA 1MFBH 5ACMA 1QOKA 1P6FA 5E9DE 5JMRA 3MX0A 4UIMA 3GMMA 3VXME 2MQCA 1WWBX 3ZDYE 1MCFA 3A6CH 1MWAH 3W2DL 1QQDA 4OZIF 4FOMA 3QWRA 3VWKC 5E1AA 4R7NA 5I18L 5SWSB 1HOCB 3L3DB 3FAWA 3SPVA 3X13B 2A77L 2R0ZL 1RUQL 2EIZA 1QFUL 5DRXB 3SDCB 4OCSL 5JHDE 1E27B 2HRLA 1AHWA 2GTZB 4HH8A 1IAII 1MRDL 3JVGA 3NABH 4PRNB 3QNZA 2CMRL 5KSAD 2APXA 2DIJA 5HTSA 4DN4L 3CFDA 1I1AD 4YDLB 2BNRA 1UB5A 4QKXB 3IKCA 4LSSL 1NBQA 2P5EB 4PFEA 4BK5A 3IVKB 4XCCH 1U91B 3BXNA 5FO7B 2BZDA 5F7FA 1J05A 5A16B 3B6SA 3BP6A 3ISWA 2ZCLH 5TQ2H 3QFJA 1A9EB 1LK3L 2UZIH 4RFNB 5EOTB 1ORSA 2JJTA 2CKNA 3M8OH 4R26H 4D0BA 3SE3A 2JF1A 4XP6H 5DVNA 1XF4A 3TBWB 2JIXB 3LB6D 4QRSB 5FGRA 4IRSB 1KELH 1B6UA 1KEMH 5DVLA 1T1XB 5JOPD 1TZHA 2A6IA 4ZPVB 5I19L 3ES6A 3TIEA 5ICZA 2EEBA 3L3IB 4PJXA 1U3HC 2HLFD 4Z0BL 2ZOKB 3BGMA 4YAQB 3D3VA 1T1YB 3EYSL 4ODSL 2ZG2A 5CZKA 1M1SA 1FH5H 4LGSB 4LOUC 4M7LT 3K74B 5C0GB 2OQJB 4ZS6D 3QXVA 2UWEF 2Q6WA 4HX1A 4NJ9L 3V52H 4ETYA 5DMIL 1OAYH 3TN0B 5I76B 1JWUB 4QRRA 4OM0L 5AUMB 5F9DC 5T1DH 4AENB 1A4KB 2ICCA 5F7EH 1H3WM 4KY1H 1L0XA 3ARFD 1ZT4A 2OI9C 1MY7A 3O2DA 1RJLA 4QHNA 2P4AB 4WW1A 1MIML 4OD3L 5JORB 3SQOH 3AMLA 4NRZA 4UILL 3VWJB 3SO5A 1YA5A 1S8DA 4JRYA 2D7QA 5HDQH 3QDMD 2ESVE 3HZYA 1DQLH 4JFDB 3CSYB 2OXHA 4M7ZC 1IL1A 6FABL 4G6MH 4QRRE 4Y19B 3IFLL 3C09C 4CKVX 3TA3C 4OAWB 4WEUD 4NM4H 4BZ1H 4OB5L 4U6VL 4QWWC 1WFTA 1I8KB 1AI1L 2X9YA 3LS4H 3OKYA 3H42H 5EU6B 1UCTA 5KJRL 3SHSA 2IALA 2ESVA 3U7YH 5JOEA 3UEZA 1RJLB 3IDXH 1MHCA 3MLTB 5E5MA 1VB9A 1ZT1A 5E94A 3L3GB 1R0AH 2X4SA 4L4TD 1CQYA 4TNVK 3UJJL 5KS9F 1KPRA 3AU1A 4PJGF 3P9MB 4K94C 4ZSOA 1UM6H 1F5WA 4HC1L 1OARH 1BPVA 3QUYB 2MPAH 5MENB 4JFHD 4OM0H 3I6KA 4YHKH 3RY4A 1UH4A 5E9DB 4ZD3H 2HH0H 2YWYA 1X6LA 2UY6A 1QLFA 3K0WA 5IVXB 4JQIL 3HR5A 2BNQB 4O51A 3GIVA 1J1OH 3OXSB 5JDSB 5EU5A 3O3AA 4FQ2L 3RDTC 4O2CB 1R0AL 1ODAA 1R3LA 4LSVL 5DEGA 4PYHA 1U8HB 4JREB 4O5LH 5BVJA 3LRSA 3NACH 3EOYG 3QEQD 5MEPB 2ARJQ 2DBJA 2K3TA 3BWAA 3TBSB 2Z4QA 1U8PA 5I1HH 1YYML 1A8JH 1G1YA 3O9WA 5IB1B 4BZ1L 4JFYB 5J3HC 3UTTD 1DN0B 3VWKB 3DXAB 1WZKA 1U95B 2OL3H 3FAXA 3P4LA 1AGDA 4ZUVB 4RISL 4WO4A 4IM8A 1RUMH 3VXNA 4TNWK 1AY1L 1UJ3C 3TYFB 4LQ1A 4UBDC 5K93A 4MWFB 3H9SD 4GRMA 4S10A 1CICB 3KPSE 3HHRB 3S97C 4HWNA 3G04A 2YPKB 1QLFB 4MX7B 5EIVA 4U1NA 1NMAL 4LEOA 5D7IF 4X6DA 3L3DA 4PG2C 2FO4A 3ECBA 3OKLB 5CIPB 2FO1A 2P47B 4L3EA 5BV7C 3IXTB 2E7LC 4IEFB 1J5OH 1CGSL 3HNVH 3PHOB 1EAJA 5C0AB 5BVPL 1JYNA 4KDVA 3OB0H 3MCKA 4P46A 1MCSA 4NBYB 4YHZH 5FKPB 4M5ZH 3RNKB 1OAUH 3HPLB 3VFWB 4OZGE 1FZMA 4QHMA 4MYWB 4DUVA 5JHLL 4WFGD 1LO0L 5ECJE 1KEGL 3O9WC 2WINA 1BBJA 3NCMA 5IHZB 2DLFL 2IFGA 4PJCA 3ZKSD 1I8KA 3R1GH 1NCDH 3DVIA 5T1KB 5I1LA 1U42A 4ZNEA 3BP5B 1RAMA 4YDIL 5D1XD 2P1YA 3BZ4B 1EMTH 2PR4H 3WL9A 4OD1H 1IFHL 3HE6B 2VB5A 1IGIH 3RVVD 3OBAA 2YD4A 2EECA 1MI5A 1RUAL 4JHWL 3W11D 4DEPC 3WO3B 5DF0A 1INQA 4NJAL 3RJDA 1U8OB 4HUWA 4NNYA 1G0YR 1KTLB 3GB7A 1CICA 1D9KA 1DBBL 4XNQB 3PL6C 4M43L 5CEZD 3GI9H 3RGVD 3C6SB 4HHAB 3VCLA 2Z35B 2DQIH 4NN5B 1KB5A 2B20A 4PGDA 4W68A 5HDBE 4YEEA 1DTUA 5FUZH 2DS4A 1IM3B 3C8DA 3BO8A 5D93C 3KYNA 2KH2B 4EN3B 1F90H 1U3HB 5L8KB 4JPVL 5JA9A 4HJGA 5I8OH 3WE6A 1QZ1A 2FB4H 1LK2B 5DRWB 1T7XA 4XNMB 2WQ8A 5JQ6L 2DMCA 4K7PL 1KXVC 4YC2B 2VYRE 5D7LD 4P9HC 2HT3C 1ZHBA 4W4OA 4OV5A 5HYQA 4PV8B 1YJDC 3FT2A 4Y16D 1AFVH 3OAZK 4HCRA 4PYGA 1X6NA 2O26U 4PRAA 5SWSD 2JCCA 4L29B 2LU7A 3VFGH 1QRNA 2W38A 1VFBB 2J8UA 3NGBB 4P0DA 2JELL 3TO4A 1T7WA 3DTXA 2DQUL 2DYPA 5DYOA 4IDJH 4UV7L 3MA9L 4KJQD 4WWKB 4A6YA 3EJYC 1OGAA 2XA8L 4NJAH 3ZDYF 4XBGA 3S37X 1Q0YH 1WBXA 3B8YA 5D70H 4PS4H 3NZHH 4WU7A 2JJSC 3IJHB 3OL2A 2R15A 1IT9H 5TQ0H 3GSWB 3Q2CA 4OGYL 1DQJA 3DO3A 4JFEB 4F7PB 3SDYL 3V4UL 4L29A 2CK0H 3VH8B 4LCUB 1T0PB 3I75B 3VFWA 2ZKHH 2EC9T 5F9WB 4JPKL 2C26A 5FUCE 1IBGH 4OZ4B 2EYRB 1NFDF 3CFEB 3MA7A 5GRUH 5GS2H 5C07D 4NQEB 3IXTA 1WTGT 1KACB 3NCCB 5DJDB 1KIQB 1CCZA 2AV7B 5ISZE 3MJ8B 1A9BB 3P0GB 3O4LB 3UJTH 2P5WB 4HKXB 5CEYB 3P73B 3UDWC 4CW1A 3EJZC 1A7BA 5DJAA 1Y18B 3VXRE 4BQ8A 4EVNB 1N5YH 3U4EA 4NKIH 1GOFA 3X14A 3BFOA 2VRAA 4FS0A 5E03A 4KKLD 5IB2B 1N5YL 1IQDB 1DQML 1BF2A 2C7UB 1CVSC 2CUIA 3GHBH 4L4VD 2OYPA 2UVFA 2BSRB 3TBTA 5D2NE 2Q6WB 1XCTB 1WQVT 2J8OA 4PLNC 4KRNA 3BKJH 4I8DA 4Y4HA 3PF2A 2BOCB 3EOBB 3V0AC 4KMTL 4POZC 3RVWD 1I8IA 4J6RH 1A1OA 3N1MC 4P23B 5D1QA 1R3JA 3RKDC 3K7UA 5I1JH 5KVFH 1UZ6E 2DI7A 4MJID 4W81A 3OXRB 4HK3N 4MD5B 2Y4SA 4L8DA 4KROC 5DS8B 3STZA 5LWYL 2E3VA 3IU3A 3DXAD 1Q94B 1QFWL 1DBML 4PB9L 1XF3A 4WUKH 1SMOA 5GS1B 3V6OA 2ZSVB 4EI5A 4JFZH 3NCBB 1LO3H 3C5ZA 2R0KL 4UUJB 4KJWD 1IQWL 2VLLB 1CFQA 2WBJD 4OJFH 1G7HB 4ZAKC 4M1DL 2D03L 2I9TA 5EPMA 2C3HA 4NKOA 4Y1AB 3PV6A 4ZFOA 5C9KA 1IM9A 3RWFB 3VGHA 2P8MA 1M7XA 2B1HH 3CLFH 4IMLA 1G0XA 5C0AA 3W5MA 1P5VA 4D9QE 3VI4F 1BD2D 1FCCA 1NEZG 1BD2A 4RBPK 5CP3H 1FAKT 4ZQKB 2WSKA 3LD8C 5KSAA 1QFUH 4FXKA 2AI0H 5FB8A 5SWZE 4K7PX 2DD8L 2XKNB 2IQ9H 1MUJA 4HW6A 3TT3L 1P9MC 3VGFA 2QQNH 2EYTA 4QNPE 5C3TA 5K59E 4TRPH 3INUL 2E7HA 4YZFE 2OTWA 3SCMD 2VABA 4PGCB 5IUSA 4GUPA 1G7QA 4NWUH 1Y0LA 5B3JE 4F15C 2UV3A 5DVOA 5DLML 4HZAA 5GS0D 5I9QC 3QCTL 4PJEA 1N6QH 3NOIA 2XTJE 4N0UE 4OZFA 2AI0L 1KCRH 2EE2A 1XF1A 4XZUB 4C58B 2QHRH 5JHLH 5D7KE 2CLZB 4JLRA 4LNRA 5B38G 5E8DL 2F58L 4Z9KB 5EFIA 4YBQD 3SQOL 3VXUD 4F37F 5AUMA 1OP3H 5C0DB 3ULVH 4Y16B 4MA7L 2NW2B 2P45B 2I07B 3FQUA 2A9NL 2FWOB 3MV7D 1G9NH 2V5TA 1WC7B 3BRDA 1IFHH 4S1QH 4G7YH 5DMIH 4YX2H 4U2YA 1CL7I 5EOQL 5I8CA 3HC3H 4JO2H 4ENED 3HTLX 3AB0B 4Y5VA 4JFEE 5DJ8A 4BZ2L 1FNSH 4QXTB 1E6OL 2W0LA 2IQAA 2P8MB 2PYEE 2JB6A 4YHNA 4DGYL 4KK9C 4LASL 4XNZC 2XFXA 5E24E 5C0CE 2NY3D 3VXOB 5JIKA 5JXAH 3NA9L 5BS0B 4E41D 4DW2L 2ZUUA 4GMTL 2X1PA 4X6BB 1Z9MA 1NLBH 3TPUA 5JOFA 3D0LA 4JCMA 2AV1B 3QUXC 2WQRA 4PGEA 4TUOB 4PJ7E 4UUJA 3D2UD 2H26B 5KVGL 4J1UA 5E2JA 3CZFA 2ADJA 1ED3B 3GO1L 4F7TA 3FCTA 3LKPA 3T2NH 5I17A 1MCKA 3TC9A 3HZVA 2F5AL 1LWRA 4YPGB 2HLFC 5HYIA 4OZIA 3IU3B 5LCVL 4MD5A 2W0FA 4OGXL 1MEXH 3KPMB 5DMKB 3RWGA 4CN6A 5D6DC 4DN3L 4G43B 1A1OB 5D1QB 3O41B 5JORA 2GSIB 4I0PC 4LPUA 3UTQB 4YHIB 4D0CB 4WWKC 3Q6GL 3QIWD 1WITA 1DP0A 4HK3J 3QCUH 4FP8L 1N5AB 5GRVL 5CJ5A 1IAOA 2MMXA 1N2RA 1KOAA 5IVZA 4U6XA 1BVLB 3FQTA 4OV6F 4EKXA 4HF5L 1ZGLP 3AXLB 1HSAB 3ULVE 2IH3A 3ARBD 4LRIA 1KT2B 3QZWB 4P2YA 3ZT6A 1ZLWK 1DBMH 5IW3A 3JV6A 3E8UL 5F7LB 2MFNA 1MQ8A 3RIAK 2MTPA 5KSAC 1L4IA 1A4JA 1LILA 2OR9H 2WNGA 4JAMA 1AQKL 4PP2B 1KEGH 4NM8L 4PJEB 1IGFH 1IM3A 1XGQA 3UJIH 3U4AA 1G6RH 3GSXB 5CSZB 3SGKA 5D72H 5GGUA 2FYYA 3MJ9H 4MNQB 5M94B 1OD7A 4GO6B 3WN5C 5EU4B 2Y5TB 1IAKB 1HN1A 1YEHL 2OTWB 3OAUH 4RQQA 3ARBC 3N0PB 4MNQD 2V7HA 3QA3B 3BZEA 3SKJH 1Q1JL 1BFVL 2AEQL 3GRWL 4IIQA 4QCIA 3H3PL 1YECL 3PP4L 1LQSR 5C92A 4GW1A 5KVDH 5ELIA 1WCQA 3VJ6B 1YECH 2J6EA 3KYMA 3O3EA 3KPMA 1FORL 3DV6B 1M71B 2PYFB 4Y88A 1AD0B 4JM4L 4WRLA 3PWPA 1F13A 3CJJA 4PJGE 4ZFOB 1PKQB 2YEZA 4XXCC 3V6OE 3QDGA 2I26N 3KAAA 2A0LD 1OWWA 3H7BA 4N0CD 1ZLVK 1KB9J 4DTGH 2ZUYA 3PWNB 3O8XD 3PABA 4LLUA 5DI8B 4NNPL 3C2AL 3QH3B 3AY4C 1SBBA 4IOIB 3WLBB 3EHBD 1ADQA 3O4LE 4K7PY 1JPTH 5K9KA 4G6KL 4MXWH 1MQKL 4Z7WF 3TLRA 3DROA 3GBMH 4YNYA 5FDWA 3KLAB 3RPIB 3MBEA 2IMNA 4MJ2A 1SY6L 5JMOC 4YGAB 2AJUL 4NQDE 1C5CL 4UTBH 4RAVB 2FDBP 4WI8A 4F33B 3BKML 1CD8A 3I2CH 4A6YL 1J0YA 3O3BB 1G9MC 5IM7A 1EHXA 3OG6B 3WE6B 1FFNA 4OCNC 3LOWA 2QBWA 5DUBA 3B9EA 3MXWH 1N0XH 4OCXH 3ARZA 3EYVB 3L5WB 1VESA 2WWKT 4FFYH 3FQUB 4OCXL 2IANB 4EQ2A 3S96B 4F2MA 2BX5A 2B0SH 3H9SA 3I6LD 4R0LC 3WIHH 1IZJA 1FPTL 3NN8A 3OPZL 4UINL 3RNQB 2L7JA 1SBSH 1HKLH 2VO5A 4LPVA 2BRRH 4NO2A 5EFIB 4L8CA 1BZQK 1CGXA 4JZJA 1RV6X 3VJ6A 4Z76B 3CZFB 5CJQL 4F7TB 2ZUQC 1JRHH 5GGQH 5F9OL 4RAUA 2R4RH 4QLRA 2VDKL 5A3ID 1EDQA 4H0IA 3TZVC 1MJ8H 4XPTL 2IPKB 5AWNH 1FFNB 1MI5B 1NCCL 3HCVA 1UYWL 4M7ZB 3NCJH 3L6FA 1EVUA 2C3VA 5C07A 3H9YA 1DDHB 4F8QA 5AAMA 1RHHA 2BNUA 4H1LB 2ERJB 3BZ4A 3TBYA 1PZUB 3GSUB 2PN5A 4NQCD 3SJVD 5GRUL 1WWAX 3G9VA 4DUWA 4ONGH 4DAGL 4G6AC 3RZCB 2M1KA 3MV8E 4LP4A 4YX2L 2VLME 4S1DC 4L3ED 2VDNH 2BCKB 1B4RA 2CLRA 3HI6L 4P9MH 1BIHA 4IRJB 5BQ7A 1CN4A 4OCYL 3QIBB 1VKXB 1I8LC 4N90D 1A7RH 3GGWB 3PQYA 5FUOH 1KB5L 3MUJA 3QXUA 1I1CA 1A7RL 4U7KA 3QUYC 4MNHB 2KBGA 1OOAA 2WK2A 4DK6A 2YD9A 4IRSD 3QHFL 1MLCA 1Q9OB 3NFNA 5JUEL 3NGBC 4XRCA 5INCB 5HGGS 4M6NH 1TJGL 2LE9A 2WM0A 1JZ3A 3UYRH 2NY6B 2I5YH 2ARJA 4JY6A 1WIOA 4G5ZH 2OR9L 1IAKA 3GNML 1LO2H 5TDNA 4P2QE 3H3KA 4TUOA 5I1KH 4ZDHA 4BELD 1BLNB 5KVEL 3D39D 1YJDH 4JB9H 2E7CA 3DPBA 4E42A 4DOHE 4OIBA 1EAPA 1OARL 4EN3A 3BJLA 3MO1A 1FYTA 1ETZB 1XR8B 1FIGH 2V2XB 4WNQB 3T0EA 3B9AA 3B2UC 1WFNA 1FC1A 4ONHA 4URTB 4OBRA 5IVNA 2OR7A 1AO7D 2MHAA 3QSKB 4PJAB 4D94A 4P2OC 1F58L 3O2DH 3V0VB 1L6ZA 2BNQE 4L8BB 5FDWB 5EU5B 5E8PB 1N5AA 5IVXE 4ORGA 4MAYC 5EUOF 4DGIL 4CJ0A 3LQMA 3T0BA 3ARRA 3GSOA 3KG5A 1ZTXH 1MCJA 1TJIH 3OKDA 5F7DB 3EBAA 1FV1A 4LRNL 1OM3H 3KPQB 4GKZB 3VE0A 1T20B 5HGDA 3DYOA 3CDFA 1E28B 4HIIA 2Z8VC 1I9IH 1I8MA 4OF5A 2C4XA 5DJCB 1X5AA 1AD0A 2ZNWA 2FSEA 1PZ5B 3AAZB 1YMME 4QO1A 4TNVF 5ITFB 4XMPL 4TVPH 4YR6A 3DARA 3QCTH 3P30H 4YHYB 1U8LA 3BH8A 5KSVB 3ULVF 5HGAB 3RY5A 3M17B 5BO1L 4ZOAA 1C12B 1JNJA 1ZVHA 4F80A 2ENSA 2XACC 4Q9CA 5D5ME 3BZEB 3OGOE 5EC1A 4BQCA 5C2BL 1FP5A 1PX4A 4ODTL 4H25A 5C2BH 5C0CB 2C7UA 3CK0H 4QYOB 5J6GB 5LVEA 2EH8H 2Q8BH 4XCEA 4XCFL 1FCGA 2ERJC 5FM5M 4TN9A 3ZHLA 2FLBT 3JV4B 5BRZA 3VWJA 1E6JL 2HT3D 4K23L 2C4FU 1ZSDB 3RL2B 1JHTB 5HYJB 2AEQH 3RP1A 3IETB 3TNMA 4GKNA 1QBML 3GBML 1KN2L 2EDJA 1X5IA 2I07A 1K3IA 3NAAH 3GSUA 3TZVD 5CGTA 5J57B 3MLWL 5FYLD 3FOLA 5JA8B 2OMNA 4P2RA 2HWZL 4NKDA 2X40A 5EC1B 5A40E 2ZUQB 5JIPA 5DK2B 4FFWD 5CHNA 4QY8A 2FZ3B 1JZ4A 4Z7VF 1G6RL 3HCVB 1JGDB 4WGVB 3M17A 4JM2D 1T2QL 3PXJA 4TTGA 5DURB 3BKYH 2GKIA 2VZUA 1L0YA 4R96B 3MRCB 1CK0H 2F19H 4L4TB 4ERSH 3QDJE 3LS5H 2B1HL 3CLFL 1D6VH 4U1GB 3KLSA 4OKVB 4N5UA 3L3KB 3ARXA 3QHTC 1UH3A 4JANA 4M6ML 5C0EB 5D7SH 4XVJH 2ZCKH 1C5BH 2P5ED 3I50L 4HGKC 4MNGE 1XGTB 1BGXL 1N64H 3P4NA 5IP4A 3R0NA 4XVTL 5FO9B 5GZND 1ZA3B 2AABH 5E6YA 4PY8J 3OKMB 5DO2C 2ED7A 4RZCA 2AJXH 3T08A 5HPMA 4DFHA 1ZK9A 4FG6D 1A7PH 1H8SA 3HE6C 1M7IB 2EDBA 1TQCB 2Z92B 4HUXA 5EO0B 3QNZB 4JG0L 1LE9A 5IBUG 5D1ZC 1UGNA 2IG2L 4M7JH 3VFTA 5C0ND 2C3VB 1FNFA 3D1MC 1E27A 1NC4A 5DD5H 2K7QA 1AH1A 5IQ7L 1S9VA 1U58B 4HLZH 4LGPB 4HT1H 2X4PB 5HYJD 3SKNA 2ITCB 4M4PA 2DQEL 1IGML 3P3YA 5IBUB 1QUNA 5IHUH 4HWEH 1JGVH 2DDQL 1KJ2B 4K94H 4JY6B 1HSBB 3IF1A 1OAKH 3ZLQC 4YXKH 1IEAA 3LKNB 5DHYB 4JRYD 1MRCL 4KH2A 4G6FD 4M7KH 4D9LL 1MCPL 3QFJD 2EDWA 1P2CA 1QSED 3WKNA 1D5ZB 1KCSL 2C4FT 4D9LH 1RIUL 4LSTH 3ETBF 3PGCB 3ARYA 1I7UA 1CZ8L 2GSGA 5CSGA 2F53A 3SE4C 3UDWA 4WU5A 1NGQH 5CZXC 1H5BC 5HHOA 2XTJC 3CLEL 3TH3T 5GRWA 4P9ML 3RVTC 1AR2A 4NKDB 2DLHA 2VLKE 3SE3C 4B0MM 5GGUB 5HHVL 5ADOH 1W2KT 2FIRT 2W59A 3HFML 4MNQA 1JWMA 1UYWH 3IB4A 1GOGA 5I1HL 5C0GA 1ZT7A 3QRFM 1NEZB 1RZGA 1BFSA 1D5IH 1UM4H 5MHSD 1A4JB 3BN9D 4MJIB 3WIIH 3U83A 5DEFA 3KJ4C 4YXLH 2I9LA 3WFEH 2YD5A 3MZGB 3QR2A 5ICZB 1YEIH 2R56H 1EJ6A 3VXSD 5D1ZA 5DQJA 1XIWA 4P5TC 4HULB 3UTZB 5J6GA 5DTFB 3MRMA 5B4MC 1CFTB 1PQZB 3CDYA 2WBJB 2VZOA 1N2RB 1HHIA 1DUZA 2OJZL 1MWAB 4ODVH 3ZYIA 4XWOC 4WTZG 4FQHA 5FUOL 1G9ML 1BFOB 1LO5B 1MCOH 4RAUB 4KRPC 2R9HC 4YK4B 3SKMB 1U3ZA 4JRXB 5HVHB 1KXTB 2H8PA 4G6JL 4APQB 5HHQA 1T7VA 3OG4B 3C6SA 4HHAA 3MRGA 5ERWB 5MERB 3WFDH 7CGTA 4JO1L 2ZPKL 3DI2B 3VA2C 4Y4FD 3GMNA 1RJZB 3VXMA 5F89B 4YHLL 1AFVL 3VE0B 1CXIA 3CXDL 5EULV 5LWYH 4PBVC 3SKOB 1RULL 4A2LA 2EO9A 1MCBA 1IGFL 3KNBA 3CUPB 4KI1A 4ODWA 4MDJB 5CGMA 1A0QL 1TJIL 4R7DB 1RUKH 1SM3L 2BC4A 5C2UB 2GY5A 5AWNL 1CXLA 5D2NC 4ZFZA 3LMJL 3MBEB 3ZKNC 2DQJH 1E4XH 4CNIA 1BVLA 1S7UA 2GJZA 3P0YL 3V5KB 4TVPD 2DBLL 4R0LB 2DWEB 3NFPB 1OQOA 4Y16C 3QG6B 4UINH 2XN9A 5C0FB 1IVLA 1D3CA 1DBBH 1OAYL 2NMSA 2VMFA 3O0RL 4ACPA 2AGJL 4G80B 3S36X 4QHUB 1OTSD 5I66B 2VXTL 2O61A 5AZ2L 1FBIH 1OPGL 2EXWC 3KPRA 4KK8C 3HMWH 4ZNCD 4KC3B 2DYPD 3I50H 4X6DE 1I7TA 1S78D 2Y07L 5LBSH 1U3JA 1GCFA 5T1LD 4F15B 5CBEA 3LPWA 1KTLA 3PNWA 5DRZB 5FA3A 5D71L 3NVQA 1XF5B 3HG1E 3M45A 5D7JC 3QIWB 4LAQH 1OSZB 4XVSH 1BECA 3EZJB 1ONQA 4IMKC 4IOFC 4DUXA 1MRFH 4GRWH 4X9FA 5BVPH 3TGXA 2DLFH 4FQ1H 3IJHA 3WL9B 1T1XA 3DX9B 3DO7A 2X1QA 4NWTL 4ZO8A 4X98A 1TCRA 5DA4A 3F7YB 1JPGA 4PGBB 5EZOH 4WO4C 5JXED 4EBQH 1KCUL 3BRFA 3FONA 2FJFB 2XKNA 2YWZA 1Z3GH 1MUJB 1JGEA 2CK2A 2I60L 1HCVA 3STLB 4PJ8D 1T66C 2PW1A 2BJML 2ZNXA 4AG4H 3V5KA 1FNAA 5ICYB 4RAVA 4UZGA 3G5YA 1WBZA 2ZOLB 1QSFE 3CC5B 1SYSB 1JF1B 2WIMA 2XZQL 4TPRL 2NYYC 2I27N 4N0CC 1RZKL 5AZ2H 3OKKA 1FZOA 2BNRD 1JPST 5L2KD 1VFMA 5IQ9A 2FH6A 4LHUD 2VDRH 4LMQI 2F58H 1ZLWH 2DIBA 4XBEH 1ZHLB 2DTML 2YKLL 3EYQC 4NUJA 5H8DA 2P24B 5D7LA 1HXYA 4YWGH 3DURA 3TYFA 3I84A 4FQXA 3I02A 1G7PA 3MR9B 4OLUH 5IOPB 3FB5A 1VGEH 3X17A 2O5ZH 2VDPH 4XNUH 1GZPA 4XVUD 5TDNB 2H8PB 3H9SB 5E56A 3QPXL 2VDOL 1XCQB 3WS6A 4WUUA 2JIXA 2NY5C 4JPVH 4C56D 4P23A 2ARJB 5I8OL 3CVIH 2PYEA 2EDOA 2X4UB 4UILH 1EO5A 2ZCKL 3TT3H 3MJ7A 5KS9B 2MCG1 4XNYH 5F8RC 4G9FB 4FN0A 4QXTA 3Q3GA 4PJ8C 3ZE1E 3KPRB 4UV7H 3UTZA 4WFHE 1X5LA 4ODVL 1FVCB 1CICD 3QQ4A 2ZUXA 5F1SA 4MDIA 4NZUH 4X99B 3S5LA 1KGCE 2YXFA 3L1OL 5J1SC 2DTSA 1XR9B 4P5MB 4QHKJ 2APFA 4WW2F 1KJ3H 3QG6A 4BSVB 2Z9TA 4P48A 3RDTD 4EOWH 3P9LA 4JQVA 3ARPA 4D0DA 3MBXH 1P69B 5GGVL 5H37H 3Q5TA 5KTEH 3BPOC 5HGBA 3K8MA 3E6HB 2GIYA 4TSBL 4WHTA 1T6WA 4CMMB 1A2YA 3KDMB 1V3JA 3O6FD 4Y2DB 4JLRB 4LNRB 4TQEL 1JFQL 1OT2A 2MQ0A 5D72L 4MVBD 4WGWB 1VGEL 4KK5D 4LHQB 4CMHB 3N9GH 1GAFL 5KSVA 5MENE 1D5IL 4ZO6A 3BIKA 2G60L 3DUUA 4GRLD 5FHAL 1A02N 2WAHA 5GQBA 4AEHL 3TBTB 5JNYB 5DR5L 4YFEA 1WEJH 4PJ7F 5B38A 4X7CC 4IRSA 2E7LA 1P4BH 3ULVC 1RZ8B 2PXYB 3P4MA 1T20A 5C3LD 1OGAB 4JRXD 5BOPA 4JRXA 1KULA 1AY1H 1V7ML 1DVFA 4NRYA 5FGBC 3E2HB 3PP4H 1F2QA 5JOFB 4BSVA 1S7XB 1FV1B 4PTTA 4M6OH 5D6CB 2HMID 5C09D 1S7TA 5C0FA 1V7NH 3BE1L 4DQOH 4MD0A 1NMAH 1TVDA 3JSSA 1Q0XH 1CBVH 2R23B 1JCKA 5J6HB 1BQHG 3V0VA 2XQYG 5JHDA 3D18A 1MFDH 2EDTA 4LF3B 3MUY1 5IVOA 3NIDF 3FQTB 2FHBA 3L7FB 1ZAGA 4XNMA 1GOHA 3L3HB 5DFTA 3DROB 3VU2A 3QUYD 4KMTH 4QHKI 1ES0B 4PJHA 5C86A 2J4WL 4HG4K 4IMKA 4X9IA 2P48B 3SDDA 3V7AG 5FK9A 2PO6D 5IQ7H 4PG9B 3BVNA 3RWGB 1I1FA 4XMKL 4BH7A 3H7BB 3HPJA 4JANB 3MSPA 4WU7B 4UIKH 4PJXF 2BSTA 3PGFH 4RNRB 5HHMD 3H6JA 3RDTA 2P24A 4UDTA 1I85C 1WSST 1PSKL 3PGFL 3CVHH 5EU7C 5EZJB 5F3HB 2I24N 3P0YH 5D2NA 3OHXB 5CBAB 1ZLUK 1MAJA 1INQB 4HS8H 1U41A 4QCIB 4HIXH 4OM1H 1NBVL 5I0ZA 1A9EA 4HMEA 4JKPL 5T3ZD 4NT6B 4ZS7H 5C7XL 3UMTA 3G08A 3QA3A 1OGTA 3RIFF 5GGSY 4Z5RB 3FOLB 4E5XB 2ZOLA 4XBPB 4LCYA 3W9EB 4KDTA 1ZANL 4KK5C 3QIUD 5GISH 1FFPB 5E2TH 1DBJH 3O4OC 1PX3A 3OKOB 2ZWLT 4GMTH 1JZ5A 1X5ZA 1S7WA 1U58A 2J6EL 3X11A 4UT6H 4R2GC 4XP1L 4HSQA 5IT2H 2UY7A 1WTLA 2XA3A 1QO3A 1FGNL 5EOQH 2MNUA 4X5XA 3RNKA 3HPLA 4ZQKA 1UB6B 4X6CE 2E9IA 2BY3A 1F4YH 5GZOC 4P5KA 3NFSL 5IFHL 5J13C 2A1WH 2VXUL 4HUNB 5HGBB 4ZUUA 3JV5A 4I3RH 2RCSH 4MZ2A 1KJMA 3WBDA 2A74B 2R69L 2VDLH 4XB8A 1FGVH 2QV2A 3DLQR 3FQXB 4ZUTA 4IIQB 3P4NB 1T7YA 2LU3A 35C8L 4MGXA 4PJDB 5CCKL 4J3XA 4X4ZA 1Q8MA 1QKZL 1NUGA 4CMHC 5LGHL 2EO1A 3WDJA 4WENB 4LLQA 3TA3A 4ZPTA 2EDKA 1A7NH 4ELME 1CI5A 2CIIB 3V6BR 3HPJB 3FT3B 3HI1B 4UTBL 2J8UE 1SJEB 3MNZB 2RCSL 3RAJH 1A14H 1FL5B 4XPAL 2X7LB 1D5BA 4U1JA 3KPLA 3QRGL 4N5EC 5IMOA 1I7RA 3GSOB 4K9EC 4PIRF 4R4BA 4Z7WB 4Y4KB 4JHAH 4I9WE 3IDGB 2XQBL 2DAVA 4QOKB 3PHQA 1NMCC 5BRZD 3GM0A 3L9RB 4W6XB 3O3BA 2OZ4A 3BYYA 1GGIH 3N1FC 2DN7A 3QPQC 1C1EL 2DTMH 2KPNA 5HDQL 4JFZL 4HGMA 4I0PD 5BVJB 1DANU 3CU7A 2FLRT 1N59B 3RWHB 4YQXL 3RUGE 4HPOL 4WTXA 2ORBH 3M8OL 2GK0A 2NY1B 4QRPB 3IDUA 4JGUA 4MAUL 4MDJA 4YHIA 3BPCA 4XP6L 1S7TB 2VDML 1DVFC 4FQQA 4P2QB 3WIFB 5IJKC 3D9AH 3V6FA 5T1MA 2APVA 4OZHE 2W07A 3O2DL 3QUXD 1HDMA 4PRPA 4RMWA 4H25B 3WS6C 1NMBH 4R2GD 4IBLT 3KPTA 2ADJB 3K80A 4HJJL 1ACYL 1W72L 5IBTL 2Q8AL 3BKCH 5I1IL 2VLJE 4NC1E 4P59H 5DUPL 4N0FB 5GIRB 1MCRA 3BDBA 4CU7A 3VWKA 2Q3ZA 1KIUA 3QXTA 4KI5F 1BJMA 4EUPG 3KS0J 3QUMH 1U0QA 1J18A 4JHAL 2Z4QB 1A64A 4KZDL 1PQZA 2NX5B 2DF3A 3ARWA 1J1PH 4U7SA 1H3PH 5DTFA 4A2MA 3O2WH 1NMBL 1Y0LB 4KHXL 3GHBL 5CUSH 1YYLH 2X1WL 5K33A 3RX8A 2B4CC 1LO4H 1NANI 2V5SA 1CGUA 1JNLH 3ARGD 4EUPB 1U6AH 5HYSG 3DIFB 2HG5B 3B9VA 2FBOJ 3WN5B 4JGMA 3QDGD 4R4NC 3BAEH 2A74A 4M3JA 4WV1A 1T66D 2IH3B 3O6KH 4TTDD 4LOUD 3KPNB 3LN5A 5E00B 4ZYKB 2PO6A 4L5FH 3OKNA 5C0DA 3Q0HA 1XT5A 1WFOA 4PUBL 5CKAA 2NTFA 4DVBB 1HQRB 4ZXBC 5BO1H 4HS3A 1HNFA 3V0WL 1QFPA 1HHHB 1QG3A 2BHUA 4KXZH 5FGCB 3VXPB 4OGAD 4J3OC 1TVHA 1X5JA 1WWCA 4X6FB 3TJEH 1D9KC 5IW1A 3ME0A 3LB6C 3IAQA 5EZOL 4ZUSA 3H2WA 1BLNA 2VLLA 5I74B 4UT6L 3ZTJH 4PLOB 1WZ1L 4HUVA 2VLJB 3ARDD 4NSKA 3ZDZF 4OZIB 1S7SA 1GAFH 1G7QB 2YC1A 5D71H 5E2TL 5D7JD 3B3IA 5HBBA 4PJIB 2VZ1A 3MC0A 1H3UA 4JN2A 3HNTH 4UOJA 3EJJX 3QUKA 4UQ2A 4XI5C 1KLFA 1Z9OA 3DI3B 2VR9A 5FOBA 1U8QB 1WAAA 1PG7L 4N8CH 4LIQL 4JKPH 4IJ3B 3NACL 4OFPA 1CWVA 3HE6A 4KI5C 1J8HD 5D7IB 4M93B 2F53D 4MCYA 5EZJA 3NCYS 4S1SL 1SYSA 3MACL 4KRPD 3WDHA 5T3XH 4R9HA 3MLZL 4QHLA 1ZHBB 3BP5A 3NMEA 4GBXD 4IRJD 3RWDA 3EO1A 3ZKQD 4I77L 2CSPA 1NAMH 4ONFH 3WIHL 1RZIB 3QDAA 4NZUL 3H0TA 3MLUL 1N0XL 5TF0A 2MKLC 3SDCA 4NQDA 4XNZB 3T0EB 4DW2H 4MXQC 4POYA 2OCFD 3Q6FA 4R7NB 4PRHE 4XP1H 4R8WL 1KENL 4PTUA 4Z7NE 1HWHB 1QQDB 5HI3C 1J7VR 2HTLC 1YPZA 1YMMB 3SE9L 4Q6YA 5FYJD 1MHEB 1R5IA 4PG2A 1MF2L 4YJZL 3DO7B 4JREC 1ROWA 2ZUWA 5T1LA 5J1AB 2C9AA 5EN2A 3GIZH 4M9OA 1V3KA 3DMMD 4ZYKA 1BAFH 4ZTPL 4CRPA 2XWBB 3U7WL 4OQTA 3S37L 1U36A 4O9HL 4DVRH 2PXYC 1MJ7L 4D0BB 4EQ3A 4Q6IB 5D2LB 5C9JB 4PJBE 4MJIA 4Z7WA 3K1DA 1I9EA 4Z7NF 3BSZH 3MLVH 4U1JB 3FFCA 1TZIA 4HD9A 4KV5F 4JKMA 5IV2B 4L8CB 5BV7H 2CKBH 3G6DH 5EG6C 3LEXB 5TF1H 2FJGA 1CZ8H 3LAFA 1J0KA 2WBJC 1K4DA 3HZYB 2ATKA 2FD6L 5TH2B 1NLDL 4XBGB 1JF5A 1P4BL 5HHOB 1YEEH 3RUGA 5I1EH 4OUOA 1P4LA 4BA8A 5JW5B 1CU4H 3T0EC 3P73A 4KZEL 3EYSH 5KSUB 4X4YA 1QRNB 5I1AB 2BSSA 1PY4A 2F54D 5TJWK 5FUCC 3EOTL 3TN0A 4K3JL 1FO0B 3RWFA 1U92B 1Q72L 1SEQH 4RDQF 4ZFGL 4PRPD 3TT1L 1GC1C 3MFFA 2N56A 3WFEL 2E7BA 3D3VD 4YXLL 3K8KA 5JR1L 3BD5A 4BFEA 4HLZG 1RQ5A 1I3GL 4X4XB 3TF7C 1U3HA 5DMKA 4NKMA 1U2HA 3TIEB 1FZKB 3RBSA 4ETQB 3QEUA 3HUJB 5E95B 1FFPA 3OB0K 5HDOA 1PKQA 3P9MA 3UTPE 4K71C 3SCMA 1NAMA 1UJTA 2VNCA 3PHSA 3FO2A 2UWEA 2BMKA 3QJFA 4ODHL 1AXTL 2W60A 3LRGA 1QHPA 3KYMB 4PGEB 2DKUA 3MOBL 3T65A 1VEOA 5DRNB 3NIDE 3AY4A 4YHPB 2IALB 4C57C 4OZIE 1I8IB 1T21A 4KKCD 5H2BB 3UBXB 3MOBH 4CN4A 4HK0B 3GSQA 3T4YB 5EU6A 1ZA3A 4X6CB 4UQ3A 4XP5H 1OTUD 2IPUG 4FG6C 4Q6IA 5DC9B 43C9B 4M1GH 4BUHA 3ARDA 5EUKA 3K4ZA 2VE6B 1MREL 3B3IB 1MVUA 1NH6A 3D69B 4Y19A 3RJQB 1LO2L 5BZDB 3VFGL 2R0LL 4ONHB 4M5YH 1IQDA 4MA1B 1K5NB 2PW2A 4ZUSB 4WI7A 4Q58C 4WNQA 3FOMA 1DL7H 1VFAB 4X5WA 1UA6L 1FZKA 2IADB 3ABZA 1TVHB 4PJCB 4KI5E 3MV11 4KRMB 1XEDA 3QDMB 1BQHB 2DB8A 2ZPKH 1MFBL 1UQSB 4I0PB 1IKFH 3MRDA 4C83B 5GZNC 4GRLB 4PJEF 4OZ4A 3VFSB 2HVKA 5ESAB 5FF6A 2VITB 4XXDB 5JXEC 1UWXH 1U8KA 2DQTH 4BQ9A 4LU5L 1S5IL 3L3GA 2OQJA 3MLZH 4QOKE 2DQHL 1G9MH 4ODHH 5H94B 2NXYC 2P7TB 2Z31B 1ZMYA 5C0RL 2V5RA 3K81A 3ROLB 1PKOA 4PJ5D 1MRDH 4LCWB 3O6ML 1F6FB 4ERSL 4L4VA 4CVXB 2XPGB 4WW2B 4CDHA 4G6KH 2A38A 4Z7UB 1JGLL 3CX5K 3F12A 1CE1L 3OAZH 5HI4D 4PGCA 1F4XH 5TE6L 5GJTH 43C9A 4JHZA 4E0RA 1P4IH 2NXYB 3QNXB 1N0LA 3G6AA 5HHPB 2CDEA 3CGTA 4ZTPH 2RFXB 1EUTA 2VISB 5D1QC 2YHGA 1DLHB 3AB0C 3MUGB 5DJXA 4K9EL 4PGJA 3U1SL 5ITFA 3KPSB 4OLXH 5FKPA 1U8PB 4IIQC 2BY2A 1BOYA 2AK1L 1T3FA 2AJYL 5FCUL 3RDTB 4XC1L 1E0OB 3TBYB 3O8XA 2DQGL 3T0DA 3D25A 5IKCA 32C2B 2YN3A 4XWOD 4QHUA 4YHZL 1UM5L 5IB5B 5B3JF 5CJXC 1RIUH 4ZFFA 1Z0MA 4GBXB 3FFDB 4LLDB 1BEYL 4Z78B 2LAGB 1AD9A 2GJ6B 2CKBL 3G6DL 4X7SL 3EYUL 5GS2D 2FEEI 2ADFH 4KPHL 5MENA 3ES6B 1FO0A 2NLJB 4GRWB 4XVJL 3U0TB 3WXVH 2QADB 2O5YH 3CFKA 4WFFE 1AGEA 4AEEA 3PJSB 1HXMA 3BOVA 4G7VH 3RWIA 2NXZB 3GB7B 4JB9L 3MCLL 5KOMC 4C54A 4Y4FC 4DCQA 3NA9H 1DN0A 3AREB 3FZUD 5JPNB 1G7MB 5EOTA 4J12A 3GSQB 4HIEB 4BYHA 1RUQH 2C3GA 2LU4A 3GEWB 1PW3A 1BJ8A 4WUUB 4JEGB 2W91A 4KJPD 1NGQL 2J88L 3UTTA 2HFGL 2VLRA 2H32A 4BFBD 3O3DB 3UTOA 2FJGB 3TT1H 3THMH 4OLEA 4PJ8B 3AREC 1FE8L 4QRTA 3U9UB 2F5BH 2R2BB 2A83A 1HIMH 1S7RA 3BEVB 1AD9B 3GSRA 1MCOL 2FX9H 4XGZB 1CIDA 3GFUA 5DZLA 3SBWC 1AE6L 4NQEE 4RWHA 3VD3A 1FSKC 3T0EE 3FFCE 4EDWH 5I18H 3EO0B 1FYTE 4YGVA 1AJ7L 2X2YA 2PCPA 5E8OA 3GMMB 4OBSA 5J7CC 3BN9C 1D7FA 3QIUB 3VRIB 1BZ9B 3MROB 2D3VA 5LQBL 4EI6A 4K7FB 3SDAA 2QHRL 3SO3B 1CDIA 4QGTA 4MQXD 4HX1B 3E3QC 43CAA 4M8QA 5D7IE 3E3QE 2FEEL 2D7MA 3DMMA 5CD5C 4DZBB 1OAXH 1ZOXA 1MCNA 2DWDB 2YD1A 1GZQA 4JPKH 3VFMB 2KZWA 5D9SA 1IC5H 3IDXL 4JDVB 3AAZA 2EDNA 3HG1B 3U36A 3HFMH 3X3FL 2Y5TA 3RI5K 4MDIB 4Y4FA 1IRAY 2YA1A 1WT5C 3DX6A 4G7YL 5KAQG 1MVUB 3D69A 1PLGL 2VZVA 3GHEH 4ZAKA 4K8RL 4PJCF 1RI8A 2DKSA 3LN4B 1F3JB 4KK8D 1UVQB 4LSTL 2VJXA 4KHTH 2V9QA 4K71B 1T2XA 3QXWA 3V6OC 1OGAE 1KCLA 3CDGA 5DR5H 3ARTA 3KGRA 3KYAA 4DN3H 3BT2H 2R1YA 3IDMA 4Q9BA 2X4RB 2DJ4A 1OHQA 2NTSP 1QRNE 2BHYA 4HC1H 2AK4E 3IKCB 4NSKB 1K4CA 4LP5A 3BGFC 4I0PA 3CFBB 5DJ2B 3GJFK 1HINH 5EA0H 5CD3B 5HI5C 5D6DA 2BVOA 4TVPL 3TP4A 3EGSA 1SEQL 4G43A 3MJ9A 1AR1C 1T83C 5F9WC 3VDBA 1NGPH 1RJYA 4KROD 5HYFA 1NC4B 2PW2B 3N85H 3CCHB 3TZVA 2IPUK 2AJ3A 2VLRE 4NBZB 2E6PA 2BVTA 1N7ML 2IH1A 1RK1B 1UC6A 5GGTL 4GS7B 1PAMA 2X5PA 1RU9H 1CLZL 3WSQH 3O3UN 2YR3A 4O2FB 1EJOL 4OLYH 3UO1H 3PQYD 1Q9LB 2X4SB 1CL7H 2PXYD 3HB3D 2VTFA 3MV9D 2VDQH 5F7WC 2ARWA 5EUOB 3T2PA 12E8L 4FTVE 1JHLL 2A0LC 3QWOA 3HC4H 4WHYH 2JE8A 4XVTH 4XMLL 1QLRA 2EH7L 3SOBL 3SDXA 1NJ9B 1NC2B 3MGTB 1CGYA 1G9NL 5L7XL 4P4KC 2IPTL 4L1DA 5HGHA 1EH9A 3VXMB 1E4KC 1UZ8A 3KPRD 2KQMA 2BSTB 5JNYA 2B5IC 1R3KB 3QUMA 3KHOA 5E6IC 1KUMA 3BT2L 5T3XE 4HLJA 4TOYL 1H3VA 1PYWA 3KPOA 1LO3L 4WDIB 2HN7A 4XMKH 4ODUA 4P5TD 1B4JL 5C0BD 3DYPA 1ZANH 1MCDA 3C09B 4NFBA 1YDPA 2R1XA 3GMLB 5A2LH 5C9JA 1ES0A 3IU4L 4OT1H 4BZYA 4Z95L 4O4YL 1DL7L 3QYCA 2DQEH 4PJCE 4U1MA 1HQRA 1D5MB 2WBJA 3MNVB 4IS6A 1L7IL 5EBMB 1A5FL 3RVUC 5F3BA 1FGNH 2DRUA 4LF3A 2YUZA 5EN2B 1KN2H 4QT5A 3ZMRA 4UU9B 1MQKH 5KW9L 1NBVH 1TVBB 3DVGA 1Q72H 3TO4C 4XAKD 4KDWA 3BPLC 3LKOB 2MKWA 3LSOA 4MXVF 3KYKH 2E8ZA 3MRBA 1YC7A 3I3EA 3L7EA 3J7HA 4ZXBA 4D9RD 4UOW0 5IMKA 2HFEA 1S5IH 4ZUWB 4NQDB 3SDAD 4S1SH 4NIKB 2JJVA 4Z7QE 1AQDA 3QB7C 2N1KA 4NO2B 4JG1H 4QXGL 4WO4B 3SN6N 3O3DA 1BP3B 1HWGB 3HNVL 3KVQA 5IESL 2C1PB 2R69H 2VDLL 4Y4KD 3EO9L 4LSUL 3TYGL 5TPWH 4YBLC 3H3BC 1IAMA 1BBDL 5HGHB 1CLOH 1ZV5A 1QACA 1QR4A 3VFNA 1R3IL 3PDOB 1G9NC 3UTQA 2OX5A 3DRQA 2QADD 4LSPL 3VGGA 5AAWA 2R39A 1PGRB 2QQKL 3ULUH 3BP6B 4NDMA 4EXPX 4XPBL 1FFOA 3RWEB 4LCWD 4MHHG 4Y5YB 2AW2A 4R4ND 3ZYZA 1FJ1A 5D1XB 3VXMD 1QEWB 1EXUB 2HTKD 2D7TH 3S7GA 3U7WH 2ITCA 1I9RL 5MI0B 2QEJA 4PJDA 2J2ZA 2NYYD 3HE7A 3KPQA 3WHE1 5IHZA 2PTUA 2HKHL 3SKMA 2P49B 5JHDD 2A73B 4WFEE 5DHVH 4LKXA 2DI9A 3EGSB 1XGPB 1A6TB 3EJYD 4NQVB 1SBSL 1YN6A 3HI5L 1DE4A 2DM4A 1OD9A 2VXSL 4P46B 5E08L 2ZJSL 3RAJL 3WJLA 4QRPE 4M43H 5EB9A 3FO0H 3VRJB 4JO1H 1C7TA 1YQVH 3MV8B 2CXKA 1MCLA 4Y5YA 5EU6E 1IARB 4Q9RL 4G8IA 3BH9A 4GXUN 4PD4K 4U1IA 1JZ6A 5CP3A 4XP9H 1ZA6A 1R3HA 3C60C 4F3FA 4V1DE 5GZOD 1URLA 3DECA 4GLRI 4X6CA 1Z5LB 4YHKL 1OTSC 5JW4Q 4HKBB 3S34H 4X8XA 4F57L 1UM6L 2FR4A 1IKNA 3G9AB 4KK6D 4N9OB 4RMUA 4E5XA 1NDMA 5F88A 5IGXH 4JFXB 4L9LC 1NCBL 3DNKA 1IGCL 3SGDI 1XGQB 4NM4L 3UBXG 1S7VA 2Q7NA 4LCWA 1EJOH 4OLYL 1S78C 3UO1L 3O6FB 3MRHA 3DXAA 3JTTB 3DUUB 3L7EB 3QIWA 4CN1A 5H94A 4I2XB 3UTSE 4QNPF 4QRQA 1R24A 3Q1SL 1UM4L 3C5ZC 1LEIB 3EDDA 3RWIB 1UJ3A 1KT2A 1Q0XL 1CBVL 4JN1H 4ODXB 1Z9SA 1I7TB 4FFVC 1JZ8A 5C0RH 4EDXA 3MREA 3QG7L 1SMAA 3TVMC 4OSUL 4KKBC 3MUZ1 5IVZB 5D70L 2RIKA 1U8IB 3E6HA 1DLFH 1CR9H 3IFLH 1DANT 1HDMB 2FNBA 1DE4B 2ZCLL 1JGLH 3PIQA 4UTAH 5HYJA 3DIFA 3DBXA 5FFLA 4ORZC 4AEHH 4JKLA 1MCCA 3IS1X 2NY0D 4MJ5B 2AQ1A 2CO7B 3JWOL 4GRLC 1TCRB 4PRID 1RHFA 1B0RB 3T1WA 3D87B 2Z8RA 4P23D 3SDDD 3B4NA 4QRSA 5BW7A 1I1YB 2BC4B 5IROC 1CTNA 1FFOB 3IGAB 5CJ8A 5HYSA 2NR6C 3L3JA 4XH2B 2R0KH 5JLZB 3GSNH 2VC2H 3IFNH 4RZCB 1NBZB 4XBEL 2VAAB 3GSNL 3VD4A 4ODSH 3IDGA 4LMQE 4O58L 3PDOA 1B90A 1F4XL 3QUKB 4UQ2B 5FV2A 1JNNL 1EPFA 4MA1C 5L2KA 1AP2B 2P5EA 3BZDA 3IVKA 2IFFL 2C1PA 5SWZA 4BSWA 5JQHC 3C60D 4OF6A 1JP5A 2NY5L 1KELL 3FB5B 4PRHA 1JYXA 3SGKC 5HVFB 5JO5B 3S96A 4F2MB 5ICXB 3D48R 4OCYH 1LEKB 3MNWA 2VL5A 3LHPH 5CJBA 4K55A 1KIPB 1NUFA 3U9PL 1N64L 5DFWH 3DSFL 4EBQL 2AABL 5GXBB 4OF7A 4P4RA 3DETC 3I9GH 3LSOB 3LKOA 2X44D 2FH8A 4NFDA 4U4BA 3R8QA 3QCVH 1T0NA 5IB5A 4ONGL 2QLVB 1PG7W 3L3HA 3LY6A 4Y89A 1QRKA 1G7LA 1T22A 5E6IB 4U7MA 3SDXE 3O2WL 3BRGC 3NA4A 1U8NB 4HXAL 4S0TD 3TO4D 4LKCB 1X5GA 3H42L 5C8JB 3H8NA 1N8ZA 3WXVL 1F11A 2W9DL 3QWQB 4HKXA 5EBWB 5SWQA 4UNVA 1JPFA 1S7VB 3GM8A 2FJFA 2HTLD 3BQUD 3P4MB 1JFQH 1H3XA 3S6CA 3KPSD 2FR4B 5B8CB 4PV9A 1P7QA 5D2LE 1SVCP 4EDWL 2EYTB 2NY2D 3NCEB 4FQCL 2SEBA 4M3KB 5F9OH 5L2JB 2A6KA 4I0KA 1ITCA 3RGVA 3U48A 4CADA 3GJEB 4M8QB 4BZ2H 4L9LA 5GGSB 5F7EL 4KPHH 2X9WA 4FQIH 4WW1B 1VSCA 5FAAA 3FO0L 2DL9A 3VXRA 1NC2D 1OP5H 3ULVL 4P4KD 4KDTC 2BVPB 4R3SA 1BD2B 4XPGH 4Y2DA 5ADPH 3AUVA 4IMLB 4X4ME 3BUTA 3SGEH 2D31A 4I2XE 2GFBA 3NPZB 2AXHA 1ZGLA 3CX5J 5ISZA 5C0NC 1FH5L 1EA9C 5ESQB 5LAXA 5C0IB 5F6IC 5T1MB 4M62L 4N68A 1H8NA 1L7IH 2BCKA 4G8GD 4M7LL 4LEXH 4LEOB 1FL6A 1VPOH 3T1FB 5FGCE 4X9GA 4AYFA 1QBAA 4V2BA 2Z31C 3DX7B 4GRMB 4JFFE 4M8VA 3N85L 2CD0A 3UTSB 1T4KB 3MMEB 4NCC2 5GGVH 3BX7C 2CR6A 2EXYD 1RIVL 3O4OB 4LRNH 1KC5L 3B9KB 4X4YB 5FKAA 1MVFA 4M62H 3V4UH 1ETZA 1XR8A 5GSVA 1T1ZB 4U1SA 5TPWL 2D7OA 4DCQB 1KENH 2J7LA 2FJHA 4X4MA 2GJJA 4PGBA 4IDJL 3GUTB 5CEZE 5CEXA 3AS2A 2DQFA 4TSCH 3FQWA 2GUOB 5K9OB 4LDOB 4JM2B 4ISVA 1E6JH 1RZ8A 2PXYA 2Z8SA 3DX8A 2FCBA 5CAYB 3TA3B 3BP7A 4WWID 3P11H 2W65A 1YUHA 1GZQB 3P0VL 3EDKA 1VFOA 3GRWA 4X0KB 2D9QB 5DA0B 1RUKL 3NCYP 5C0IA 3ZSSA 4JY4A 3TJHC 4U33A 1IEBB 1F2XK 1IILE 5AYUL 1HHIB 2VR5A 3D18B 5I66A 2O61B 3T3PE 4NC1C 5K9QI 4KKCC 1ERNA 2NZ9C 1WBZB 4XMPH 4Y7MA 3PGDA 5C08A 1W0VA 3ALPA 1FNSL 1KCVH 3CFCH 4QGYA 2BSSB 3DWTA 3ZKXC 1N6VA 2XN9B 4YDVA 2OR8A 2WINB 3IDYB 3CSPA 4LPWA 1ZXQA 3VXTB 4BK4A 2DWEA 1A3QA 2C1OA 3U9PH 1P7HL 5F1NA 1M6OB 1ZEAH 3X12B 3MACH 2A1WL 2VXUH 1JPGB 3QUZC 4XBPA 1U93B 4M1DH 3DETD 2H6PA 1FQ9C 3PP3K 1SJEA 3MNZA 4MSWA 1CG9A 1BVKA 1RY7B 1RSFA 3FTGB 4AM0B 2GTWA 1S3KH 2CIIA 1MIEH 1I1AA 2VWEE 4F7CB 3WO4C 1R5WB 3VD5A 3TPKA 4U1NB 1DQQB 1NCAL 1RUML 5EUOA 1JE6A 2AEPH 4ZUTB 3P77B 4X9HA 3RHWF 3HRPA 3VGDA 1U8KB 4MWFA 4YFLI 1RZ7L 5KANI 4F58L 1LO0H 5GRXG 1JBJA 3VFSA 4AH2B 4PRPB 5ISZD 5HXMA 1A1MA 1YNTB 5JIHA 4ISVB 1UACL 3QRGH 3GSXA 1WUNT 5CSZA 3IJYA 3WNNA 1CXEA 2FIKB 1I9JL 4G8GA 4OUUA 4CL7A 4PREA 1NGZB 4NWUL 3TNMB 2OK0H 2D7NA 3GBNL 4FQQB 4X7FC 1TDQA 2KKQA 5KSBA 1KIRB 2XRAH 2E7MA 4JFYA 3IAGC 3A67H 4NO3A 4EIZC 4PJXB 4C4KT 2HRPH 1KFAH 4RFNC 2E6JA 3BESR 3CSBA 5CJQH 4HWZA 4HS6B 4IOFD 4L4VE 4PJ9D 2IF7A 3EO1B 1ZHKA 4POUB 2E27H 1NFDE 5ANME 5I2IB 3QZWG 1RZKC 4HBCH 1JF1A 3KJ6H 4FQXC 2V9RA 2YS4A 2UZYB 5C6TL 4HBCL 3IDIB 5TQ0L 1B0GA 2GJ6E 4Y1AA 5KS9A 3B5HA 1QSEB 2G9HA 3WUWB 4QOKA 2YMXH 3VA6A 3NZ8B 5E6ID 3RZCD 3OKMA 3TVMD 3QHZH 3ARFA 5J11C 4O2EA 1U8QA 4OD2A 5CLWA 4YBQC 3EUUA 3DUSB 2X4TA 3WLWD 1VEMA 2W60B 1D6VL 3F7YA 2B1AL 4FQXB 5DJCA 2OSLA 4PRNA 5A2JH 1EXUA 4K3EH 3QPXH 4LFHG 5BS0D 2NX5E 5E8NB 4HUVB 1NMCB 2QQKH 1VPOL 2IAMC 4XX1E 2NNAA 4RGMB 3HZKB 1WGOA 3TPUB 1FG2B 2YRLA 4BFIB 3TO2A 4JQVC 3MRCA 3FN0H 3HE7D 3LV3A 1FBIL 1KJMB 5DC0A 2RR3A 4U1KB 1MCQA 1JV5A 2XICA 5IESH 2W92A 3O11A 3B9DA 1WJ3A 2BDNL 3CAFA 5KVMC 5JIIA 1BQUA 4V1DA 5BV7L 2EE9A 4X5XB 3SDXF 1SEBA 1NCNA 1FL3B 1CFSA 3BSZL 5IIEB 3RPKA 2UYLA 3E1F1 3AC0A 5FGBA 2CXGA 3BKMH 1EHAA 3I2CL 4AL8H 3O45A 4F8TA 4CW1B 1GGCL 2IEPA 2H2SD 3UJTL 3JTTA 4PJFB 4Y1AD 1XGRB 1RZGB 4KVCH 1FZJA 1CGTA 3HAEB 3VW3H 3KPPA 3PL6B 2AS5M 3GI8L 1IC7L 4KU1A 1A7OL 1WCBA 1YNTA 2CLVA 1V3LA 3QEQA 1JWUA 4OFVA 4L8SB 2APBA 3FFCB 1IQWH 4PJDE 3WIIL 2NZ9D 2BOBA 1S9YB 2OI9B 2X89A 4LLWB 2XWTB 4OLZH 3SY0A 3UAJC 3S88H 3AREA 3SGJA 5IEKA 2VIRA 1DQJB 4JFEA 1E4JA 4NQUA 3VXUE 1VA9A 3CMOL 4PD4J 1F8TL 3IYLW 4LHUG 2H2PD 2A6DA 1IGYA 4RGNE 3ULUE 5C09B 3MV9B 5KVFL 2MCPH 4AM0A 2XNAA 3QNYB 5DK0A 1I3RB 3VRJA 5J1AA 4GUPB 4JJHA 5SX5H 4O2CA 5TGBA 2J5LB 2H32H 3V0WH 3ZZ1A 4MCZA 3QIBA 3MLRH 4L4TA 5GS0H 2HP4A 3X12A 5E2WL 5KS9E 4Z78A 3OAUL 1YY8B 4HEME 5EIIB 1AGCB 1PDKA 1JPSL 4P4KA 5GRJH 1TMCB 5CWSA 1F42A 4MB5A 3SDAC 3UYPA 3WFBH 3OZ9H 5FHAH 3WKMH 1NGXB 4KQ4L 2R8SL 4PLKC 3RUGF 3QBTB 1X5FA 1DEDA 2XZCL 4H0HB 4PJAA 2BVUA 2DOCA 5D96C 5I2IA 2VZSA 2R23A 4E41E 6CGTA 3VMPA 4FQ1L 5C6PB 4N9GA 4MJ5A 5E9DD 1YJDL 3RTQB 1IC1A 2BY1A 5JW5A 1SJHB 1SM3H 3U6RA 2YPLD 4JFPA 3ARBB 2CRIA 2RBLA 2ICWJ 1F45A 4OLZL 5ESQA 5EWIH 3JUYA 4FABH 1D5BB 3W9EA 5BOZG 3HLAB 5D7JA 1QVOA 4POZD 1RVFH 3K2UH 1BMGA 3CFBA 5EUOE 3UP1A 3MGOA 3I9GL 2V2TA 2QSCH 1XIWC 5IMMA 4UAOB 1LE5B 4BFGA 3U0WH 4C59B 3ZDXF 4Z18A 1WEJL 4S1QL 5C0AE 4I4WA 1UADC 2D0HA 5TF1L 1MFEL 5E0QA 3MRJB 5FYJU 3OX8B 3B9KA 4WW2C 5HJ3B 1ND0A 2KDGA 5GGVY 2FZ3A 3TCXA 1ZEAL 3FB6A 2UUDK 4MJ4A 1EZVX 1F4WH 1RZJL 5DMGD 3ROOA 3A6BH 1QTYT 3S37H 2CO6B 2ICEA 3EOAB 2O5ZL 2VDPL 4XNUL 1EBAA 3LZFL 5EU7E 4DZBA 5IWLA 1RMFH 5BRZB 5IIEA 1CDBA 1JVKA 4I18A 2LTQB 4IOSD 3RU8L 3RZCA 3KHQA 3OKOA 4DGVH 1BZ7B 3OAYK 4ELMF 4OCWH 3K1KC 2MOVA 3BDYL 3JWNC 5E8EB 4MXQD 1RUPH 5DVKA 1XH3A 1AXSB 4GG6B 2VDKH 1NFIA 4ZFOL 3LDBC 2ZSWB 3C5SB 5F6IB 1YN7B 3O6LH 4KZEH 3T04D 4U05A 4FFZH 2A2QT 2Y7QA 4LKXB 1QLRB 2RAMA 4N0FA 5GIRA 4BH8B 4YHPA 3GK8L 3HZKA 4FFZL 3T0AA 4K07A 2W0FB 1DN2A 5J11B 1MI5D 3C6LB 4PRHB 2PUQT 4PJ5A 3RQ3A 1KTDA 3MRLA 3SCMB 1UM5H 3QDME 1PJ9A 3LPFA 4DAGH 2XN9E 1BJ1H 1REIA 4QRRD 3D6GA 4XWGH 2AJ3B 3KYOA 2X4TB 3RWEA 4XI5D 4EN3D 3D0LB 4OI8A 5JR1H 1NCDL 3R1GL 3WD5L 2ZUVA 2ZG3A 5F7NC 5FCSH 4OFDA 2WWKO 5C0BA 5HVHC 1T1ZA 2Z91B 1FVDB 4PRBB 2X1XR 2CJUL 2YUVA 4OLWL 1T5XA 1U8NA 3QEGH 3MRFB 4WI6A 5CHNB 4J4PA 1G0DA 1A7NL 5E00A 1YEJL 4WI2A 2APTA 3GNMH 1ZKAA 1G1CA 4GW4B 1KN4H 4W70A 2ADIA 2BRRL 2NZIA 2HJKB 1NDGB 5BJTB 1QNZL 2M2DA 3H3PH 1A6VH 1RURH 4I5BB 4IOIA 3QUZD 4R97B 1G9EA 4X99A 1XGUA 3UX9B 2FX9L 2OTUA 3S36H 4CVZA 2IAND 4OUUB 1EEYA 1OL0A 2FRGP 4Z7VE 1A3RL 5DD0H 1FE8H 4UU9A 4NO5B 1KB5B 4PGDB 4OKVA 1QYGH 5SV3A 4NKQB 4NQEA 3AM8A 5GS0L 2MPAL 2DJUA 2JCCE 4NO0A 1TZIB 1EZVY 5LXGL 5EOCH 5D1ZD 1IE5A 2PYFA 2OL3L 3GSVA 2PETA 4UB0H 3I75A 4UBDD 1BIIB 4GQ9H 3WXWL 4JO3L 4AK1A 2LAAA 1CDHA 5IK3A 4LGRB 4L8SA 1Q9WA 4YR6B 1Q9OA 4KJPC 3UTTE 4JFOA 5DURD 3P4OB 2AKRB 4NQCE 3SJVE 4CJ1A 1I3GH 1G7PB 3MR9A 5IOPA 3H7LA 3JV0A 4MSWB 1RULH 1C5DB 5IW6A 2R0LH 4NO5A 2CUHA 3Q6GH 1A6WL 5C0JB 3FRPG 3ZHKA 1BBDH 1AIFA 3H9SE 3RTQA 1T0MA 4Z7VA 5JUEH 3U0WL 3MLPA 1ADQL 4GAGH 4HF5H 1B6DA 1TLKA 3MLXH 1FLRH 4N90E 2W9EL 1RFDL 1N3NA 4H26B 3GJFB 1A6VL 1RURL 4HUKB 5HHOE 1LE9B 4KQ4H 1MOEA 5DFVC 2F8VA 1CDYA 3UZVB 1FVCA 2BNUB 2MWCA 2X6MA 1A6TA 1K3ZA 3K4DA 4H88H 2AJZB 3IFPA 1H15A 3RGHA 4L9DA 5FO9A 5CJXA 2GITA 3BISA 3V7MA 1UA6H 4IRZL 3MJ9L 1I7UB 5BMFL 2WUBL 1O0VA 3V6ZA 2G60H 1TNMA 4P2QD 4N1HB 3LIZL 4NN6B 2ENYA 4PJIA 4NRXA 4DKFL 4QTIL 1GZPB 2W9LA 3EIFA 3RNQA 5D1QD 1NGYB 1E4XL 2J12B 1EO8L 2YPLB 3CMOH 4JFXA 1MREH 3CFJB 1UXSA 1JWSA 1KTDB 3LQAC 3OTTA 4K3EL 4BJLA 1W72B 3P77A 4UV4H 1CD1B 3L5WA 4IHOA 3AS3A 4LVNC 5L9DH 1MJJB 4M6OL 1IGJA 3NZ8A 4JZJC 3PWPD 1MWAA 5HI4C 3MLRL 5DD3L 5DJ6B 3RIAF 4OT1L 5F70A 5HSFA 1JUFB 1ACYH 1ZWIB 2GCYA 4MZ3A 2NTFB 4WJ5A 4XCYB 3VFTB 3L3JB 4DTGL 3ILQD 2BNQD 4DN4H 1MH5A 1BVKB 1OVZA 3A6OA 5E4IA 1TENA 2EDHA 3ZO0A 2R2CA 4XPHL 1N3NB 4NKOB 1B88A 4S1RH 4IRJA 3GJFA 4ZUWA 5IJVA 2A77H 4LLYB 1VDGA 3AS0A 1FVEB 3ELAT 4KK6C 2Q87A 2R0ZH 2GJZB 1S5HB 3VFPB 3QUYA 1A1MB 4C56B 4AH2A 1TPXC 3NPSC 4KKAC 3HA0A 5IG7B 3EYOB 3ZKMC 2VC2L 3S3PA 5I1KL 1GGIL 3MV9A 4FZEL 5JPMA 5DS8A 1T83A 4D3CL 3SEPA 1A5FH 2XPGA 4L3EB 4WW2A 3WFZA 3T4AB 1OAXL 4ODXA 5GGTA 5I1AA 1DQQA 1FNHA 3KNBB 4I77H 4LIQE 2ESVB 5INCA 3W0WE 4Z95H 3SGEI 4WDIA 4F7MB 2EICA 1FPTH 2UZIL 4Y19E 3FT4B 1W0YT 4JQXC 3B2UD 3GSVB 4R8WH 2CRMA 4Y8DC 2SEBB