5HHPA

Crystal structure of hla-a*0201 in complex with m1-g4e
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hhpA01
3RWEA 1A7QL 1H5BC 1IFHL 3HCVA 4IEFB 1YEEL 3EBAA 4JN1H 1DLHA 1FVCB 4YE4L 4XX1E 1MH5A 3FHAA 3PUCA 4NKIH 4QHLB 3T0WA 2MJWA 1I3GL 2EDWA 3OAYK 4YHZL 2Y7QA 2HRPH 4NDMA 4QYOA 3QIBA 2RHEA 3MMEA 3PV6B 3IAGC 4RISL 3ZT5A 1FFRA 5JOEA 1NAMH 2AJ3A 2PYEE 3JTTB 4Z7VE 3U1SL 1T1XA 3V4UL 1MFAL 5E9DD 2GT9B 4PJAA 1PX4A 2MKLC 3IS1X 1DVFA 3HUJF 5HDOA 4I18A 1MIMH 1YZZA 4ZD3H 3D48R 3L1OH 4M62L 2IBZX 1B9ZA 3GSQB 2DLEA 4HKBA 3VRIB 5E1HB 1MEXL 4G6KH 3HG1D 3RNKB 4DJMA 1GAFH 2K7QA 4PREA 2DIAA 4U6VL 3CVIL 1WZ1H 3P11H 4ZO6A 3WIIH 3DIFB 1HHHA 3IDYC 1JYWA 5BCAA 1IGYB 2B7DT 2IAMC 5JHLH 3CNKA 3TN0B 3VG0L 3I3EA 2EDQA 1FZKA 3MLUH 2VDNH 4LQ1A 4RQQB 5J57B 1KYOK 1RURH 4HUMB 4PP2A 4H5SB 4YQXH 4HHAB 5DJXA 1QTYT 3P73A 4WHYG 4F7CA 3BX7C 3HMXH 2EICA 4J1UA 4OSUL 1E27B 1NMBL 4U1JA 5I1KL 4PLKD 3AS0A 3MZGB 4JZOA 4WFGE 4U1IB 3GKZA 2CLZB 5F71A 5ISZE 5HHMA 2C1OB 3DI2B 1ITBB 1VGEL 2UYLA 1IGCH 5F3HB 2BX5A 3G5XB 2CLVA 4P46B 5D1ZC 3CSYB 1SJEA 7FABL 1H3XA 1IZKA 1Q9LA 2DJ4A 2OLDA 1AY1L 2GY7B 1T0PB 5CJ5A 5IVOA 2AK4D 4LHUA 4LVEA 3SDDC 1QSFE 3RDTD 5DS8B 4GAGH 1G6VK 1U8IA 4LVOB 3QAZB 3TO4D 2WUCH 4Y1AE 2DQHH 1CN4A 2JJTA 2CDFA 3EYOB 5C0AD 1K4DA 3OF6A 3QG6B 2FJHA 1S9VA 3MYJA 4HIHB 5T33L 5ID1A 4JDTL 1MFBL 2DQCH 3ZLQC 4FOMA 3G04B 3IGAA 5HY9A 1U8LB 5B39B 2RQ8A 1WWCA 1F5WA 1HWGB 2R2BB 4TUKL 5F9AC 3WIFB 1JNNH 2HJFB 3IS0X 1QO3A 5IVXE 1E4KA 1Z6JT 1S9YB 2FL5B 4PBVC 4Z76B 3VRJA 3OKOB 3PNWA 1ZVSA 5T1LA 1XGUB 4LSDA 1B4JL 1UM6L 4IRSC 1EA9C 4QXTA 5IKCB 4MXQA 1OTUD 3C8HA 4YR6A 4JHWL 1QSEB 2HAZA 2NW2B 4WI4A 3VXRA 1NGWA 4GSDH 3SCMD 1MWAB 1FO0H 4GXVL 4YIQB 3MGOA 3TVMD 1FC2D 1T66C 4N8PA 1Q0XH 1IBGL 2P7TA 4LSTH 3MRDB 1A47A 4R2GB 4JGUA 5ERWB 3CXHK 3GMQB 2FR4B 5DD6A 4E5XB 3ZTNH 1NEUA 4ZOAA 4MX7B 3WO4B 1LEKA 5C0ND 4ZUSB 5KVMC 2AEIT 1IKFL 2XQBL 3TZVC 1H8SA 4PBWD 3MCKA 4QRPA 2X4RB 3HE7B 2X09A 3OKDB 5T5NG 5TPWL 4EXPX 4M7ZC 2XXMB 1E4JA 2CDGB 4EJ1C 3GZKA 1U8PA 4Y5XB 3DO7A 5JLZB 1S7VB 5KVEH 1RFDL 5INCA 2VLRE 4C56E 1AGDB 1YDPA 1ZXQA 2AJVL 4AQ1B 1GPOH 4KKNA 1F6AA 3S4SG 2UWEA 3RBSA 2DTMH 2IMNA 4L3AA 5DEFB 4QHKI 3OR7B 1ES0B 5ILTL 1U8MB 1GOHA 5F88B 4L8SB 4JLRA 4M7KH 4NKIL 5GS2D 3VXSB 3VFVA 2HRPL 2Q6WB 1AR2A 2APBA 1T7XA 4JKKA 3NMEA 4X5XB 1ETZB 2NX5B 3ZE1F 5E9DA 2WP3T 4G9DB 3EZJB 4C54A 4HC1L 4MD4A 4R4FL 5F1OB 4D9LL 1KPVB 4ZD3L 3L1OL 1GGCH 1HYSD 4NKMA 1VFBB 4OLZH 1LQSR 1XEDA 4F37F 3IDMB 4FQJH 4G6KL 3MRIA 4I9WE 4V1DD 5CFHA 3U30C 3HG1A 2G9HA 3S34H 4UDUB 4WV1A 3NH7H 1WZ1L 3P11L 3WIIL 1BJ1H 1KTRL 1VFUA 3HA0A 1NEZA 3M1BA 4LCWD 1MLCA 1K85A 4HZLA 2VDNL 5GIRA 3IDJB 1YEJL 1RURL 2DI9A 4YQXL 5T1KB 2NY0C 3LKNB 4V2CB 3UMTA 1U58B 2NW3B 1I85A 1KIQA 5H94B 4Z77B 3FT2A 3OAYH 1CXEA 3G6JE 5CP7B 2WQRA 3K4AA 3F7YA 5C3TA 4B41A 3QI9C 1UENA 2R1WA 4YHIB 1UZ8B 2EKSB 3D0VA 3CD4A 4G8GB 4NNXA 4H1LB 4HS8H 5F70A 1IGCL 2B1AH 2VLJB 1TFHA 3EOAA 3IDIB 1EVUA 5L0QB 3C6SA 1Q94A 5C08D 2HLFC 1KPRA 3U0TA 4Z5RA 2JLLA 4X6CE 1YJDL 1H3TA 5CEZH 2X70A 3EYSH 3BZ4B 5I1IL 4KKAD 2AK4A 3L7FB 4O9HH 2NY2B 5HD8C 1U0QA 3I85A 1FNFA 3RDTA 2VXQL 4OLXH 3LHPL 4ZUUA 3MACH 4GAGL 2F8VA 3HRZA 1ZLSH 1FC1A 2PXYC 3D18A 4MAUL 4GG8B 2WUCL 2DQHL 1NGXA 3TO4A 2E9WA 4I0PC 4OAWB 3EHBC 4P2QB 4NQCE 4WO4D 3RGVD 5C0AA 3GMMA 3ARED 1J0IA 3QRGH 4CNIB 4ZFFA 5HHVH 3BGMA 3QDHA 1Q1JH 1R3IH 2OZ4H 4FTVE 4WWKB 3WKML 4DFIA 1YNKL 4M7JL 4MHHI 2BXZA 5KS9B 2XWBA 4XXDB 4QTHA 1RZJC 1CGVA 2Q86B 4LVHB 3IXAB 3ZT7A 4P3DA 3QA3B 3H9HB 3PHQB 1XF1A 3TWCH 2H45A 3FOMB 4XC3H 4IMLA 4W4OC 4FXGB 4G9FD 3LV3A 1OGAA 1KJ2B 2EKJA 4KRPB 4WU7A 1S7UB 5BO1H 5JZ7D 1N2RB 2PYEB 1XGQA 2AJXH 5AD0B 1J8HE 1BF2A 3VFMA 4LPUA 2E7CA 5HHNA 3GSVA 3CFBB 2UWEF 1G7IA 3VDCA 1HNGA 1R3JB 4PJEB 4GSDL 5D1QC 1FO0L 1AXSB 3SCMA 1Q0XL 4LSTL 3TVMA 5KSAD 3RTQC 4OF6A 3BHBA 2ERJC 3RL1B 3P9LA 4HC1A 4OQTH 1JV5B 4YEFA 2DYPB 3VFRB 2VLME 4DW2H 2WWMD 5A43C 5EC2A 3S5LA 2F8XC 3LIZH 5F1SA 2R0ZL 3EOBA 4PRNA 2Z9TA 3LN4B 5AWNL 3KPMB 4DUVA 2P48B 4LEOA 5KN5A 4PG2C 2MCPL 1PBYA 1INEH 3QPQD 4MCZB 3O6FB 4Q7DA 3F12A 1FLRH 4Y16B 5DEZA 5KVEL 5C86A 4G7VH 4ZTOL 2DN7A 3IT8D 1T0NB 3GIZL 1GPOL 2B39A 4U1NB 4XHQA 3PWUA 1RJZA 3RKDC 2DTML 2QR0B 4EIZC 3A6BH 4H20L 3QDAA 4D3CH 5J13C 5HDBE 5EOTA 4NHCL 3MR9B 4KV5F 3BUYB 4LCIH 4PG9B 3C9NB 4M7KL 4RA0C 1MRDH 5FUOH 1UWXH 4Y5VC 5L2JB 3QDGD 5B4MC 3CCHA 3U0PB 2ZKHH 4PV9B 1QSFB 2FZ3A 4XI5C 1UEMA 1A7RL 3C5ZB 3T0EC 1EBPA 5CEZD 3LY6A 3B83A 2ZG2A 4NWUL 3L3GB 4Y1AB 4R7NB 5IMLA 3DURA 1FVDB 2A0LC 5EOQH 1WWBX 3O3DB 4YHOH 4PRHE 5TDNB 2GJZA 4N0FA 3MYZA 4MDIA 5E8EA 5DMIH 4V1DA 4URTB 3RUGF 2E7HA 1Q72L 3T4AB 4JVWA 4G6ML 2BSRA 2QQQA 3V6OE 2HKFL 1NFIA 2OSLB 4LCWA 1YEHH 1LVEA 3EFFA 2F19L 4U33A 5EU7C 3BPCB 5IVXB 1RK1B 3RHWF 4HJ0C 5I76B 4XP5L 3N85H 2P43B 1U92A 3UJTH 4IDJH 4ORGB 4U7MA 2CKBH 4LRNH 1J8KA 4GUPA 1N64L 1BVKB 1OTTD 4F2MB 2DL2A 2P8PA 3TYFA 3SPVA 2SEBA 5BS0D 1CLOL 1XMWA 2G5BB 2XTJC 2GTZB 2ZOLA 5EUOE 5BXFB 5D7LE 4EVNB 1PZUB 4WVRA 4HS8L 5EBLB 5FGBA 5CBAB 5ITFA 4OF3A 4AL8L 3IFOB 3LKSB 1S78C 1OP9A 5C08A 4XMLH 3QIUB 4P3CH 4RAUB 1U3HC 2FGWH 5LGHH 5CEZL 1AC0A 3LQZA 3EGSA 2CXGA 1ZAGA 5C0EB 5JORA 5DFVD 1BIHA 4LRIC 1WQVT 2R2EB 2V2TA 1FV1B 4OLXL 1GC1H 3TO2B 3KPPB 3MACL 2XZZA 1SQ2N 1T21A 4P23C 3GNML 5DJ6A 1ZLSL 1LD9B 2HT4D 2YXFA 5KSAC 1CE6B 4KTYA 5E2TL 4WO4A 1I1AB 3QRGL 4X98B 5E5MB 1TVHB 3AREA 3VXNA 4AG4H 1BWMA 2VLRB 4C56B 2R56H 4KKCC 1Q1JL 1ZA3A 1R3IL 2H32B 4UUJA 5IW1B 1A4JA 1K8IA 2A73A 1OLZA 3IXTA 4KK9D 5DDHB 15C8H 3BP6A 1CXHA 3O6KL 3LKRB 1S7XB 2XKSA 3UEZA 1J1PH 1G7MB 1S3KL 3SGDH 4F9PA 3BWUC 4HV8A 3GKWH 3T77B 1E28B 3TWCL 5FF6A 2O5XL 5J7CC 2NCMA 4XC3L 2DMCA 2HRLA 2DKUA 2ICEB 3AB0B 3EKCA 5IM7B 2VZOA 3RWJB 1T1ZA 4HXAH 4NWTH 3QIWC 1VENA 4G9FA 4WW1A 4WTWA 2HT2C 5BO1L 1Y6KR 2AJXL 3W39A 1BVLB 1FVEB 2MHAA 4IRJB 4U1MB 5IOPA 4BSWA 4WFHD 2MPAH 1L9MA 2X42A 3BVNB 5IBUG 4U1GB 1IC4H 2BVQA 4M6NH 1G0XA 5DMGC 3OZ9H 4L3CA 4P4KB 3IDGA 1S7QB 4GMTH 1KEMH 5D93C 2OI9C 4AH2A 2P45B 5JIPA 5TDOA 4Q9RH 2KUTA 3E3QC 3D87B 4OQTL 1IKNC 1UEYA 1WZMA 3QEHA 7CGTA 5H35A 2EXWC 2IEPA 5IVZA 2AXGA 1QBLL 5DJ8A 2GY5A 3LIZL 1HXYB 4DK3A 1WJ3A 2ZNWA 1Q9KA 1RU9H 5CMAA 4AT6B 3SDAB 4LP5A 2W07A 2VL5A 1INEL 1P84K 4R2GD 4X6DE 4ZPTB 1JGEB 1M7DA 2L4OA 1CL7L 3DECA 4G7VL 4YPGA 3FFDA 5EO9A 4NN6C 1YEGL 4TQEL 1T22B 4H26B 1YC7A 2JIXD 1ZHBB 5FA4B 3OKMA 3GGWB 5DQ9B 5HVWA 1DR9A 3C5SB 3A6BL 1LWRA 1JYXA 4D3CL 5TE6L 2HVKB 4LCIL 3MFGB 5K33A 4HIEA 4XBGB 3DUUB 4X6CB 4Z9KB 1EUTA 1MRDL 5FUOL 2BCKB 2APXA 4KKLC 3PDGA 4GG6A 2G2RB 3O4LB 5KG9B 3KPOA 3QDGA 5SX5H 5SX4I 1RUAH 2ZKHL 4UOW1 3WNOA 3RFZC 3ARQA 4LLVB 1J0JA 3LKOB 1CD8A 4KJQC 3LEVL 1FVCA 5E8DH 3S4SB 5EU3B 5EOQL 1QACA 1S7RA 4YHOL 1T5XB 4Z7NF 2AQ2A 4EBQH 5BOPA 4PJGA 3TBTB 3VXTA 3BZEB 1QHOA 3KJ6H 5TGBB 2H3NB 1CBVH 2EEAA 3JTTA 2BOBB 3HPLB 4FTVB 5GQBA 2YRPA 4LKXB 5D2NC 2WBJB 3B9VA 3O0RH 4HUNB 3EDJA 1MAMH 4AQOA 4KTEH 2PO6B 1CXFA 3L5HA 4KXZI 5C6TH 3UZQA 4GXUN 5GGSA 3VRIA 5JOFB 1HHIA 5E2VH 1YQVH 3PDDA 5H37H 3RNKA 4LRNL 2HFTA 5D9SB 3VI3E 5K9OB 2Q20A 5EC1B 1JPSH 1XIWB 1B0GB 2ADIB 2WIMA 3MLRL 1GOFA 1J8HB 2OL3H 3QXWA 5BS0A 3MLTB 5LXGL 2IBGA 1MY5A 1Q38A 3ZKXC 5T1KD 4LARH 4H5SA 1CFSA 4HHAA 5GRVK 5I75C 4OGYH 1QBAA 3IU3B 3L3HA 2DQFB 4XMLL 5EZIH 2FGWL 5LGHL 1LE9B 1G6RH 4U1SB 4U1IA 3VGFA 3L3OB 2CLZA 4U7SA 1PY9A 4J4PD 1GXEA 2C1OA 2NYYD 1GC1L 1CDGA 2VLJD 4S1SH 3VCLA 5IQ7H 8CGTA 2R29H 3G5XA 3DPBA 3NFNB 4ZS7H 3UPRA 2F5AH 5F7DA 3RVVD 1N0LA 3QXDA 5J9PB 2E3VA 3ROOA 1U6AH 5D1XC 1AGBB 1CI5A 2R56L 2DMKA 4ZO9A 3PQYD 1NDGB 3ALXA 5HHQB 5DS8A 3DBXB 1JPFB 5IG7B 15C8L 1YMMD 4QXUH 5L2KE 4XNXL 3WFZA 4PS4H 1IEBB 3UX9B 5GZNC 3OJMB 1J1PL 2EDYA 5T3XE 2KL6A 1AHWB 2F54E 3QG6A 4C83A 1BWWA 2EIZA 1UJ3C 2RAMA 1HSBA 1BJMA 4G8EB 1KLGB 5B8CA 2CJUH 2VLLB 4HXAL 4NWTL 5A3ID 1IGTB 4X8JB 3G04A 5B39A 1U8KA 3V0VA 3SGJA 5HYEA 4NQVA 5EU4B 5DUBA 3ARFD 2LE9A 4WIQA 4JRYE 3CVHB 4M6NL 1F6FB 1S9YA 3OZ9L 2FX7L 2E9JA 4C4KT 2R0KH 4PRHB 3VG9B 3MO1B 3K8LA 1KEML 4GMTL 1A9EB 4KRPD 3VGGA 3HMWH 3OKOA 3RVTC 1HINH 3SKOA 4Q9RL 5DD5H 4Q74A 4YXHL 1CGXA 4JFHD 5DWUH 5E99H 2BVOA 4U0RB 4TN9A 5L88H 1F6LL 1U8JB 1IAIH 1XF5A 1VEMA 2ADFL 4G8FB 2YOCA 3WBDA 5ACZB 2A6DB 1MWAA 3KYNB 5EDXA 1MREH 3MRDA 5I18L 5ERWA 1CDUA 1JGVH 4LHJB 3RWIB 2DYPD 2R15A 4FFEX 4N8VG 1IGIH 2FO1A 4ZUSA 1ZMYA 1QFPA 4QY8A 1HQ4A 2JIXA 2YUVA 4MXWH 4JEGB 4FZEH 5EUOB 1AFVH 5D7LB 4LVNC 4OFVA 4GXUM 2EH7H 3DVFA 2CDGA 3DVNB 1O0VA 2OJEB 5JLZA 3ET9F 4ISVB 4NPYA 1BQSA 1AGDA 4PJCA 4WFGD 3WHE0 5A2IH 4QWWC 5ISZD 1RUAL 2B0SL 4OKVB 3BKJH 1LK2B 5DEFA 5GSVB 1VFAA 5CILL 4V3EB 2DIBA 4TPRH 2K9UA 1K6QL 4CVUA 5E8DL 2P24B 5F88A 4ENEC 4L8SA 4ACPA 4P5KB 1SBBA 4K9EH 1WBZB 1S5IH 4EBQL 2Z31C 5J6GB 1EHXA 4X7CC 3KJ6L 1QSFD 2Z0BA 1RHHA 4XNUH 2VDKH 3C5ZD 3NA9H 4IJ3C 4JGMA 3T3PE 2HJKA 3TNNB 4OBRA 4XAWH 3ULSB 5ICXB 2VQUA 1MAML 3BFOA 4KTEL 3STLB 3JUYA 1KPVA 4KGLA 4QGTA 4O02H 5C6TL 1VFBA 3MUHL 4RNRA 1SVCP 1JBJA 2H2PC 3IDMA 1YQVL 5E2VL 5JW4Q 4N68A 1TZIB 4XNMB 2PN5A 3GMOB 3BZDA 4LPVA 1U8OB 3DO3A 2OL3L 4R0LB 2HG5A 3OXSA 5F6HI 1WV7T 2IH3A 3IDJA 5CAYB 4IOFC 4F9LC 4LARL 2UVFA 3FFCE 2VL4A 3BPLB 3LKNA 5T1KA 3P0YL 3PHOB 3INUL 4Z77A 5IJKC 4U1LB 4XVTH 4P57A 4KVNH 2Y25A 4LOUC 5IHUH 5EZIL 1NL0H 5CP7A 3VWJC 4QHUB 1XGYL 2ADJA 1YNLH 2DOCA 1W0YT 1TVDA 4OV5B 1T83C 1CXKA 5IQ7L 4YBHA 4H1LA 4J4PA 2DJSA 2EDDA 4KJWC 5FDYA 4HKXA 2JELH 2BC4A 2VLJA 3RY4A 3JWDC 1IILE 1U8QA 5EWIH 4ZS7L 2QHLA 2F5AL 3QIUD 3ARRA 4N5EC 1OCWL 2ZSWA 4CU6A 4X6DB 3BO8A 1X6LA 1U6AL 2VDMH 4H25A 2FWOA 3C6LB 3D69B 2R0LH 5AEAA 4LSQH 4M9OA 3LKQB 3K2UH 4I4WA 3OV6A 4NO3B 4QXUL 4JPVH 2BVPB 2GSIB 3QO1A 1YMMA 4NSKA 3SGEH 4GH7B 4JDVA 4TSBL 4GG8A 3ZMRA 3OKYA 2C26A 5JIHA 1I1AD 4LLDA 1JYVA 3UTPE 1RQ5A 2VLRD 3ZKND 2JB5L 2CJUL 1MVUA 5GGSY 1FZMA 2GK0A 2PUQT 2CRMA 4XWOD 5KS9A 3OAZK 4XXDA 4XPBL 2FJGA 4FZ8H 2Q86A 1IC1A 4UIMA 3U48A 3QEQD 3ARFA 3GDBA 5EIVA 4JDZB 3H9HA 3PHQA 3VFOA 4HX1B 1EV2E 2R0KL 1LGVA 1W72H 2DMBA 2AEPH 3MREB 4YXLL 3HMWL 1S7UA 3L7EA 5D72H 1GJIA 5I2IB 5EPMB 1J1OH 3MRJA 1N2RA 4HS6B 4Z7VA 3GB7B 3MXWH 5AD0A 4IRJD 4MNHB 5DWUL 2B1HH 2NXYD 2Y06H 5IUSA 3GK8H 3VMOA 4BZ2H 5L88L 2P1YA 1IAIL 1I7ZA 3LMJL 3WFBH 4GRWH 1B4RA 5IBUB 2HFEA 3NBNA 3FQXA 2E6QA 1TJHH 2N7AA 2EYSB 3RL1A 1JGVL 3GM8A 3TA3D 3NN8A 1QG3A 2AJZB 1KJVB 1P4LB 2DYPA 1IGIL 1UGNA 3HNSH 5FYLH 4ZS6D 4MXWL 4FZEL 1AFVL 3LN4A 1CGSH 3KPMA 3WUWB 3DRQA 1CXIA 1AO7B 4OZGB 2LTQC 2EH7L 4MCZA 2D9QB 4DEPC 1UQSA 2FGZA 5J0BA 4RWHA 3CDCA 1MJJB 1T2QH 4PJIE 1C7TA 3TBWB 3EIFA 1BFTA 1XGTA 1T0NA 3ARXA 4O2EB 5ISZA 1JFQL 1BOGB 3CLFH 1RUPH 1EEYB 1N3NA 3BKJL 1T04B 5IFHH 4PGBB 4BUHA 1QOKA 4ZUTB 3WIHH 25C8H 3MR9A 3AC0A 3BUYA 4PG9A 1B3JA 4PUBH 4ZODA 4AYFA 4K9EL 3IB4A 5FAAA 1S5IL 1RIHH 3B9KD 1EERB 5EZJA 2HFGH 1PQZB 1CLZH 4XNUL 3O11A 1QSFA 1FYHB 4GQ9H 3NA9L 3F7PC 1HDMB 2VDKL 2Z91B 4MNGE 4RBPK 2GAZB 1O5DT 4LDEB 5K9QI 5L2KB 3C5ZA 3UC0H 5D7JB 1Q9OB 2F15A 4NQCD 2EO9A 3O3DA 1LDSA 1EO7A 2F54B 3TT1H 4CVXB 3W11C 2CO6B 1FGNL 5KW9H 2WBJD 3GMRB 4I3GA 1RZFL 4RGOH 1NCNA 4NC1E 2CIIB 1H9VA 2PO6D 5DRNA 2OSLA 2YD5A 5M95B 2H26A 5HSFA 1JGUH 3JTSB 3QUKB 3S37X 3BPCA 4JRYB 5FCSH 4JZNB 5I76A 2VQTA 1TVBB 4ZOBA 1OQOA 4XVTL 4ORGA 4DUWA 4KVNL 1N8ZB 4LEXH 4AEHH 5IHUL 3NCYS 1U91B 4ODUB 1BVKA 4WUKL 4F2MA 3OJVC 1DN0B 4K71B 3MSPA 3MXVH 4HBCH 1J8HD 4NBZB 4YBLB 1MHHA 2APFA 2GTZA 4WGWB 5BXFA 4HDIA 3QUXB 1NKOA 5EBLA 1ZV5A 2X7LB 5DQDH 3GSNH 2JELL 1ORSA 1NQBA 1I1YB 1XR9B 1RMFH 3IFOA 1LHZA 3E2HA 3LKSA 3QIUA 4RAUA 1BEYL 2WWKO 2XPGB 5K9JH 1JF6A 4LASL 5E95B 3BMVA 2VDML 4D0DA 1S9XA 1WISA 2VLMD 4HW6A 1FFQA 1CFBA 2CQVA 2QJDA 3A6CH 2GTWB 4HMDA 4LSQL 4WI8A 4XNYH 5E1AB 3K2UL 3Q3GA 5CJXC 1N59B 4MDJB 5I17A 1HZHH 4JPVL 1HSAB 1WWWX 3KPPA 1B0WA 1C5DB 2BFVH 2GQHA 4YDKH 2CRYA 4TULL 4NZTH 3QQ4A 1I3UA 5IB1B 4PJDF 5FYLD 1U42A 3UPAA 4ESKA 3BW9A 1I1AA 1TVHA 2MCG1 2VLRA 4C56A 2D2OA 3EO1A 4ZDHB 2FX8H 1EO8L 2H32A 1RUKL 3DYOA 5DDHA 5JMOC 2VXVH 1A6TB 1S7XA 4FZ8L 3CSBA 5D5ME 1G7MA 4O2FB 4MAYD 4F7MB 3GSUA 4P5TC 2CGRH 3STZB 1U8NB 4OT1H 2ICEA 3RWJA 5C6PB 1FNGB 2P5WE 2V6HA 4K8RD 3L5JA 1J1OL 1SVZA 1OAQH 4KI1A 3DETC 1SBSH 3MXWL 2D03L 5IIEA 4OCRH 3FOLA 2B1HL 2Y06L 1O7VA 3B5TA 4IRJA 4U1MA 4XRCB 5FK9B 3GK8L 2J7LA 5C07E 2C3WA 3CSPA 3BVNA 3WFBL 4QRTB 2WMPA 3ETBF 3ZE2F 5F7HA 4NJAH 2JTDA 1X5GA 4XCEB 3EOTH 1S7QA 2XQYG 5C0GA 2IFFH 3AM8C 3WYRA 1TJHL 1TJGH 1JPST 1AP2B 1OSPH 2R8SH 4HK3N 5TDPB 3IFPB 3TA3A 5FYLL 3VI4F 3OAZH 1CG9B 1OSZB 1I9RH 1HXYA 3CXDL 5IBTH 1Z2KA 1CGSL 3RVXD 3FFCB 3HPJA 1LE5A 2XN9E 3GSXB 5C0BE 2Y07L 3FRUA 4ODVH 1A7BA 4QXWA 1JGEA 3RPIB 2NNAB 3G6JA 2E7LA 1I1RA 3F7QA 4P2RE 2VITB 3VDBA 4HUXB 1T22A 4H26A 1ZHBA 4JAMB 5KAQG 4DVRH 3MOBH 4TNWK 4CJ1A 1SY6H 4DUXA 3ARWA 2D7OA 3GGWA 5DQ9A 4N8VB 2IF7A 1RUPL 5KOMC 3C5SA 3BWAA 5DT1H 4K8RL 5IFHL 1NCDH 2RGSA 3OKEA 3MRNB 4JE4B 3R0MA 5I1JH 1JNLL 2CUIA 1F4XH 5IEHB 3DUUA 3LOWA 4X6CA 1VDGA 4POZD 1A14L 2ITCA 4LCUA 1MFEH 4RFNB 5JOPE 4KAQL 2HFGL 3KAAA 4WHDA 4YJZL 4OLYH 4NM8H 1CLZL 5D7KE 4GQ9L 4YHMH 4QCIB 2EXYD 4N0CC 4NFCA 4PRAB 4HPOH 4HIIB 1YY8B 1PGRB 1E4XH 1A9BB 3S4SA 1ADQL 2BY1A 4NQCA 2YMXH 4OKDA 3TT1L 3TBTA 2H3NA 1G7JA 2DQUL 4W70A 2YWYA 3O4OB 2IBZY 3CUPA 3HPLA 2GJ6E 4LKXA 5I9QC 2BRQA 4IHOA 1DDHB 1S9WB 4RGOL 4UT6H 2WBJA 3REWB 3CPLB 1B90A 4PRPE 4RMRA 3OAUH 1MCWM 3GBMH 1JGUL 2PO6A 1BLNB 5H2BA 5BJTB 4LCCA 4C59B 1LP9F 1EJOH 43CAB 5L7XH 1K3ZA 3N50A 3LKPA 1CS6A 3FN0L 5H8DA 3UXFA 2X40A 5D9SA 2YPVH 1G9EA 4OLWH 1OD7A 2VKXA 2GCYB 3MXVL 4HBCL 2ADIA 1B0GA 1MHCB 1J8HA 5I1DB 5DZLA 4BQ9A 5FB8A 1G9NL 1OY3B 3DGCR 2UY7A 5DQDL 5JW4R 2GSGB 1RMFL 1Z9OA 3O3EB 2BY2A 2DQFA 2P46B 1NLBH 5K9JL 4Z8FH 1LE9A 1KNOB 5E2WL 3Q5TA 4Z7UF 1CIDA 3IETB 2YKLL 5HI3D 3L3OA 2H1PL 5EIIA 3A6CL 2XTLA 4XNYL 3FQRB 5D6DA 5IMKA 1HZHL 4PTTB 3WS6A 1P1ZB 1X4YA 1J7VR 2BFVL 1NGPH 3NFNA 3FCTB 5FO7A 1QUNA 4NZTL 3V6BR 5ICYB 2EIDA 5MEOB 5J9PA 1UCTA 3QCVH 4PJHE 5T3XH 4PJIB 4FABH 2AK1H 5FA3A 3A6OA 2Y5TB 3T0DA 5D7SH 4LLWB 4N1EA 3GMLB 3DBXA 5MI0B 1JPFA 4FFWD 5FCUL 1IEBA 1GGYA 1KELL 3O3AB 1IM3B 1FL6B 4BFEA 2C3VB 5MEND 1AHWA 4MAYA 4CL7A 1BIIB 5FYJH 3HI1A 4NRZB 1Z0MA 3GI9H 4D0CB 2IC2A 5D70H 1KLGA 4Y8DC 5MEPB 2Y36L 3CMGA 3KNBA 3BZFA 4X8JA 4O5LL 2P8MB 4YDIL 4IDLA 3T0EE 1OT2A 3BSZH 1SBSL 3NFPA 4MNGB 5DK0B 3FZUC 5TF0A 2OS7A 4E42B 3LSOA 4LP4A 1X5FA 4OUUB 4OZIB 4WFEE 5GSRB 5EU6E 3CFCL 2DM3A 1G84A 2VR4A 1P6AB 1G0DA 1ZVYA 5IB3B 3MO1A 3DSNA 1A9EA 4MQXD 4L8DA 5TFSH 5E6IC 3MUZ1 4MMZC 1OSPL 3HUJE 2R8SL 2AW2A 3WJLA 4S11A 4JPIB 4JM2D 3TEUA 5K9KB 3V6OA 4NQSB 4IIQA 1ADQA 1QBMH 3H0TB 5EU7E 5EZOL 1U8JA 3HZMA 1I9RL 4LHQB 1F58H 2W65B 4KK8C 4G8FA 5IBTL 3MRLB 5DGQA 5F1NB 1ZE3C 1F97A 4ODVL 2NY1C 1UACH 4I13B 4GAYB 4IRSB 3GJEB 3RWIA 3G5YB 3F58H 1HKFA 1U95B 4Q9BA 5IT2H 5FHBH 2XTJE 2EZ0C 4KHXH 2D7QA 3LVEA 5JXED 4DVRL 4X7FC 2IQ9H 1A64A 2DM4A 1H3PH 4DN3H 3H7LA 1A6AB 4FQ2H 2ATKB 1FYTE 1GHFH 2PR4H 1R5VB 3FONA 5LVEA 3I3DA 3NCJL 5ESQB 3W9EB 3EJYD 2NLJA 4M93C 3SGKC 1IEAA 1FSKC 2LAGB 3DVNA 1F4XL 2ZJSL 5DVKA 3UTSB 2A77L 1JTOA 3QCUH 2DJUA 3VFUB 4NM8L 3C87A 5IBLD 3PV7A 3KLHC 4OKVA 3LQMA 5GSVA 3B3IB 4ONFH 4QHNB 4M7ZB 3SHSA 1E4XL 5GS0H 1S7SB 3U83A 3V7MA 3K0WA 2YMXL 4X4XA 1WBZA 2IPTL 3NACL 1OWWA 4KJPC 1DANU 1P2CB 3LDBC 2M1KA 5LQBH 4X6FB 3ECBB 1EEUA 1WFNA 1P4BH 3TNNA 4UT6L 5D7JD 4GRWF 3DJ9A 5ICXA 4PP1C 2LQRA 5D5MB 3OAUL 3VFWA 3GBML 5T3XD 5KANI 4JFFE 2ARWA 3BKMH 1EJOL 3MLPA 5D7IF 4YBQD 5L7XL 5MP6H 2EEDA 3VA2C 1TZIA 4XNMA 1I7RB 3UDWC 4OFPA 4F7TB 2P5WB 3IDNB 3NIDF 2XA8H 3MJ8A 4OLWL 5C1MB 1JF5A 3VJ6A 4NN7C 2HN7B 3IU4H 3QJHB 3OB0K 5C07B 1VEOA 3WN5C 4QRRE 2XZCH 1T80A 2W59A 3PHOA 2YUWA 1BFOA 4LPYA 4PV8B 4JO4L 3E3QE 4OD3H 3U30B 1CIUA 3MJ9H 3MFFA 1KOAA 5HJ3A 5I0ZA 3TBSB 1NLBL 4Z8FL 4UTBL 2LAAA 5KOVC 5GRUL 1IE5A 4OZFG 4WW2A 4OV5A 2VE6B 4K3DH 1PD6A 1X9QA 2NY0B 1IL1B 3DGGA 4EDXA 4MS8D 1FNSL 1NGPL 5HGBA 2XN9B 5C0BB 5JIIA 1T0MB 3ARGC 4KVCH 4X6DA 1Q9WB 3IDXH 2F74B 1YEDA 5T3XL 1DFBH 2AK1L 4CBPA 1U8HB 5D7SL 3T2OA 3LKQA 4H88H 3MPCA 5SWSE 4NO3A 4RGNE 2BVPA 2GSIA 3IF1B 4J6RH 5ICZB 3MNZB 4IM8A 2J8HA 4X4ZA 5DLMH 1LK3L 1F3DH 4ORZC 3EW3B 1KN2H 3GI9L 5D70L 4BFGA 2NTSP 5L9DL 3OL2A 1CWVA 1CDJA 5IF0B 3ZDYF 1EXUB 3DXAB 4X9HA 3VXOB 3BSZL 4FG6C 4N0RA 4NO0D 5I74C 1G9ML 3TF7C 3RIFK 4LCYB 2A83B 4ZYKA 5JPNB 1TJIH 3CDGB 3TYGL 4HFWB 4KUZL 2XWJB 4JDZA 2ICWA 3Q6GH 1BD2B 1EDQA 1ZLWH 3MREA 3ZE1E 4FQXC 3Q0HA 2QSVA 4XPFL 4UDTB 5GS3A 1JRHI 5TFSL 1RJLB 3I9GL 3TCXA 3LB6D 4S1RL 5D2NE 5HI4C 1BX2A 5BV7B 4DZBA 1WZLA 4PD4K 2GJ6B 3KPTA 4ZO7A 1XH3B 1D6VH 4HGWA 5GGQH 4JM2A 4PRPB 2YRZA 4JHAH 2BSSA 4HS3B 3VU2A 3FT4A 5ESAB 4NKQB 1W0VA 3CFKB 3UAJC 3VGDA 1INDH 4ETQB 4JFXB 1UACL 5J6HA 5CZXD 1U9KA 3T4YB 4K3JL 1CFNA 3O8XD 5DJZB 4JHBA 4ODWB 5IT2L 1KJVA 1NAKH 1P4LA 5FHBL 3OJDB 4KHXL 3PP3H 1XFPA 4MA3A 2WBKA 2IQ9L 5JXEA 1H3PL 4DN3L 3GEWB 1OL0A 3QBTB 3VMPA 5D1QB 5LCVH 1GHFL 4TUJB 3MRQB 2PR4L 1G7PB 4UINH 4HULB 5KZCD 1W8OA 5C0CB 3QNYB 3AS2A 3ZYOA 4TOYH 2Y23A 4OJFH 1MCNA 3D9AL 3C60B 1MJJA 5FDWB 4D8PA 1ACYH 5GRJH 1UJTA 3GI8H 4NO2A 4G42B 1BZ9B 1JUFB 4YX2L 1ZT4A 5J12C 4FQLL 2A6IB 3UJJL 1QYGH 1BOGA 3K81A 1QQDA 3PWLB 4WNQB 1EEYA 2CRZA 5F3BB 4L3EE 4PGBA 3KYAA 2AJYL 2HKHH 3KVQA 4ZUTA 4ALAH 1VA9A 1I8KA 3P77B 1NDMA 2A74A 5GZOD 1OAKL 4F8QA 1EHLL 1HH9B 5FYKH 4O58H 1PKQA 3UO1L 3H3BC 4JN2A 5LQBL 1DQLH 2Z91A 5ELIA 2GAZA 3EJZC 5F7YC 5J13B 4N9GB 3SN6N 3CX5J 4YGAB 5D7JA 4RWYH 4WW2F 5KSBB 3RX5A 5FKAB 5DSCA 4KI5D 3UTPD 3CU1A 4EDWL 3WEXA 4Y89A 1R6VA 2H8PB 1ZA6B 3S37H 3ZE0E 5DUMH 5HVHB 3X11A 4LAJH 2PW1B 3HTLX 5LJYH 5E8NA 2XA8L 1WVZA 4NUGH 3UTOA 1BVZA 1TLKA 1FL3B 5FO9A 5CSGA 1RIVH 3DMMC 4QRPE 5CINL 5DJ2A 2CIIA 5DRXB 4AENB 4DTGH 1F3JB 2OTUA 5CGYC 3ULVH 2JCCF 3QUKA 1P7KB 4JRYA 2NY6C 3LQAL 2XZCL 1PFCA 1T6WA 1VADA 1F4WH 3O9WB 3S7GA 3EDFA 3C09B 1TVBA 4HIJB 4POYA 3OX8A 4NQUA 3ZDXF 4OD3L 3MJ9L 3UPCA 3HE6C 4R3SB 1IQDA 1U91A 1KPUB 2NZIA 1X7QA 1DN0A 1B88A 3FQNB 3HUJB 2UWEE 3DUSB 1N6UA 4LBEB 2FD6L 5I1LB 3WDHA 1MCOL 3IKCA 2X7LA 2WW8A 1I1YA 4MS8A 1XR9A 2OMNA 5B3JF 4NO5B 4Z6AT 1Z9LA 3QWOB 3IDXL 1DFBL 2IAMD 3DX9B 1JWUB 3BQUC 4LF3A 4PGDA 3DNKA 2GTWA 5E1AA 3W5MA 1XGPA 2W9LA 4LLUB 3DWTA 1E6OL 5JDSA 4JFPB 3NZHH 4J3OC 1JZ8A 1C5DA 4K9EC 4PJXB 1FYTB 3OB0H 4JM2F 4NP4L 4UQ3A 2DAVA 1U3HB 3KDMB 5IB1A 4WEMB 5D71H 4G43B 4YFLF 5HYIA 1KN2L 2DBLH 2J6EL 3JVGA 2WLZA 5CGTA 3JUZA 5DHVB 4Y2DB 1FCCA 1NC2B 4JVPA 1HI6B 2J3SA 3RWHA 4HWUA 1MCQA 2QL1A 4F80A 2BOCB 3MLYL 1MJUL 2NY3C 5D1ZD 4KV5E 3TNMB 4NO0A 4X99B 4D9QE 1TJIL 3M45A 4O2FA 1QP1A 3Q6GL 3V52H 1HHGB 4FQQB 1U8NA 5TE4H 2J8UB 4NQED 5EN2B 3SDDD 3WSQH 3WJJA 3WFCH 1FNGA 3BP5A 4XWGH 3MBEC 2X4PA 1B6UA 4UT9L 1AXIB 1N0XH 2X4NB 4HMCA 2VN4A 5FK9A 5GGQL 4EIGB 2VSDA 4NT6A 1FG2B 4QT5B 6FABL 1HHJB 4NC2B 3QCTH 4JFFB 2OM5A 4PFEA 2EC9T 4MGXA 4XB7A 3RUGE 5CWSB 4FQHB 1CFVH 4O51A 4HJJH 3B9EA 5DA0B 2AK4E 2PKDA 5JNYA 1AP2A 3PDOB 5DC0A 5FGSA 2ENYA 1NFDF 3O8XA 3IFPA 2OR9H 3G6AB 3FO1B 4B53A 4OM0H 1CG9A 1OSZA 3IAPA 4KY1H 1KTLA 2G75A 1NLDH 3VGHA 1INQA 5FM8A 5D8JL 5C0AE 3T0VA 3GSXA 3UZVB 4WFFE 4X9BA 3NIFF 4HWNA 4IRSD 4TOYL 4OJFL 3QUYB 2DQIH 2R2CA 3RPIA 1MCKA 1ACYL 2R1YB 3CFDB 3ARDB 2VC2L 1T03H 3JWNC 4X0KB 3GI8L 4UILH 3O2VH 4HUXA 4LSUH 4PJBF 5EFIB 4JAMA 3DTXA 1BECA 1QYGL 3MRRB 4N8VA 2VISA 2ADGB 1M4KA 1OB1B 1I8LC 1HEZA 4ALAL 4OFDA 2Y7QB 4NDMB 3JV0A 4QYOB 1JNJA 3S96B 4RIRA 3VD3A 2OMBA 3VWKC 3MMEB 4M61A 4GAFB 5IEHA 4NN6B 1NCBH 2YUZA 1A7PH 1T1XB 3PWPE 1MFDH 2YD9A 4JKPL 4XTRC 4KQ3L 1N6VA 2WSKA 4TSCH 3M8OH 1DVFB 4QCIA 2YUXA 4RGNB 3ESVF 4I18B 2AV1B 5ITBL 3WE6B 4Z7QF 5JQ6H 4RWYL 1YY8A 1A3RH 4AEEA 1A7OL 1D5IH 3VH8G 3KWWA 5CIPH 4PREB 3HAEG 3S37L 5DUML 5BW7A 1WFOA 2F5BH 4GBXC 4NUGL 1M05B 1DDHA 4JQVC 1FZKB 5M94B 5AYQA 3P0GB 3REWA 4PP2B 4Y5YC 4CADB 4DTGL 2YR3A 1JPTL 1ZANH 2HA1A 1AH1A 2J6EA 1KG0B 1LNUB 3PWVA 1S5HA 2UV3A 3V5KB 1RZ7H 43CAA 1F4WL 1JHTB 4J1UB 5F9OH 4RSVA 4U1JB 4Z0XA 4R7DA 2P5WD 1SEBB 4JZOB 4K7PH 2VJXA 3N1GC 5CUSH 4GS7C 1IT9H 3OGCB 5HHMB 3VRLF 1HE7A 1FZOA 2HTKC 1MHCA 1KB5L 5KSVA 5F9WC 3QWRD 5I1DA 2ZWLT 2UYLB 1H8OA 8FABA 4HIXH 1AXTH 3C5JB 2GSGA 1T6VN 4GMSH 3LZFL 4Q58C 4E41E 1DBAL 3O3EA 4QEGA 2LV4A 4LHUB 1KNOA 4CVZB 5J3HC 1YY9C 2LABA 2AEQH 3BEVA 3LCYA 2IAMA 2BVUA 1G0YR 4NNPL 4P5MB 2MQ0A 4MNQD 2NY0D 2OTWA 4ODXB 4PTTA 1P1ZA 3NZHL 2IWGA 1T7VA 5E94A 2BSTB 2CDFB 1A6UH 3FCTA 4ZOEA 3CFIC 5HI5C 1S9VB 5E00B 1YEFL 1PDKA 1EFXD 4CN6A 3RNQB 3KYMA 5ID1B 2V2WA 5MEOA 1KGCE 4CVWA 4P2RD 5F7KC 1MNUL 3D3VD 4PJIA 3QI9D 5HY9B 2Y5TA 3RVUC 3TT3H 4LLWA 3U0WH 3GMLA 5J56B 4TNWF 3D25B 3KJ4B 4YC2C 2HLFD 2J2ZA 4L3EB 5F1IA 2XZAH 4QOKE 5C9JB 3T1FA 1FIGL 2X6MA 3VRJB 1AR1C 3PNWB 3V52L 1ZVSB 4D0CA 2B4CH 5T1LB 1PLGH 5JOPD 5HD8D 5MEPA 2BERA 4NQEA 4QXTB 3SDDA 3MOAL 3AY4A 2I60H 2YK1H 5D7KD 5EU5B 1F90H 1N0XL 2PXYD 4GW5A 4MNGA 4PYHA 5DK0A 2Q76B 4I0PD 3ARZA 3T65B 3EHBD 4Z7NE 1NGWB 3KPNB 1NANH 5GSRA 3MGOB 2GHWB 2P7TB 1UJ3B 1K5NB 4HJJL 3CVHH 3FO0L 3D1MC 2Q8BH 1EMTH 1Y0LB 3NAAH 4K2UH 3TC9A 2GJ6D 3SDCC 1ZHKB 5CBEB 1IAOB 5A2LH 5F7EH 4JPIA 2OR9L 5K9KA 4QRPB 3MCKB 4PRPD 2W9DH 2XRAH 3EYUL 3NOIA 3CH8A 2BDNH 4ODBD 2WNGA 1NLDL 2W65A 3ZYJA 3MODH 1YYLL 3CZFB 1WITA 3DO7B 3MRLA 4TYUA 2FEDC 2NY4C 2BJMH 2BHUA 1LDPH 1A6WL 4ZQKA 1RZ8A 2R69H 2DQIL 1GGBH 4IRSA 3BESR 3SKMA 1T03L 3G5YA 3LPFA 4JB9H 1AJ7H 4KI5F 1U95A 1L7IH 1UA6H 4LSUL 2UWEB 4RAHA 1G7LB 4PB0H 4MSWA 3VXQA 4FNLH 3AFLA 5GRZA 5D1QD 3U9UA 2ATKA 2QEJA 3DVIA 1TQBC 5DC9B 3MCG1 1V5JA 4K23H 3RTQD 3VFVB 2VDOL 3ALWA 3JBG7 4KMQA 4MZ2A 3MV8D 1GGTA 4M7LT 4N90E 1YNTA 1KB5A 1NCBL 2MQCA 5MHSE 1A7PL 1MFDL 2HP4A 4H8WC 3BDXA 4OZHF 4I3RL 5E9DB 3MTRA 4TSCL 3IVKA 3M8OL 3QDME 1QRNE 2OXGA 5D6CA 1P4IH 5GRYA 2J5LB 1IGFL 3B3IA 5HHOD 3IFNH 3RL2B 3VD5A 4QHNA 2BVEA 4JY5H 5JQ6L 1RZJL 1FHGA 1S7SA 4CGTA 4YWGL 4EN3C 2E6PA 1JPGA 3I75A 3MRIB 4UV4H 4W68A 3UTZB 4LNRA 4XVJH 2EIBA 1P2CA 2F5BL 4J3VA 4NM4H 3RKDD 3WL9B 1JHLL 4YHPB 1NEZB 3M1BB 1EJ6A 2HTLC 4MQSB 4HZLB 1CT8A 5GIRB 5D96B 2R4SH 1TMCA 2E5EA 4TNVF 5D5MA 2X4UA 1ZANL 5EORH 1HIMH 4BFIA 4TUOB 3D2UD 4K3EH 1MOEA 3VGAB 1RZ7L 4FP8H 3FT2B 3GRWA 4FFZH 3BAEH 2OBGA 4PJEF 1DUYB 4HXBL 2RB8A 3L3JA 2DQDL 5B4MD 3SKJL 1I7RA 4XP1L 4XI5D 2P5WA 4IJ3B 3T0ED 1KC5H 3D0VB 3H3KA 4DOHE 2HN7A 1Q8MA 4NNXB 2DDQL 2A9MH 4G6FB 2A0LD 5EU6D 5C07A 5BVJB 1NCTA 1P5UA 3H3PH 4MA8H 4PIRF 4KJYB 2FLRT 4Z5RB 1RIUH 4OGXL 4GMSL 3B9AA 3AXLB 4L4TD 3QP3A 3SE8H 4PV8A 1CR9H 2EE2A 3GHBL 2AK4B 3TBSA 4TRPH 1ZT7B 4DGVH 2AEQL 2XXCB 2W38A 4WEBL 2VIRA 3HRZB 2VE6A 4HJ0D 5C0FA 1M7IA 5CEZE 2EECA 1NGXB 3ERYA 4U6XA 1KENH 3BRFA 3MRFA 4GRLC 4XCNA 5C0AB 1JI1A 2XN9A 5C0BA 5IQ9B 1EFXA 1QPXA 1KCUL 2EE6A 3BGMB 3HB3C 3VWJB 1ULVA 3ZYZA 5CD5C 4P2RA 2XTJD 3D3VA 3QI9A 3FQWB 1NC4B 2V9RA 4TTGA 3U0WL 4QTHB 5IHBA 1FE8H 5E2UL 2MMXA 4F7PB 3IF1A 3UYRL 3MNZA 4I77H 3CMOL 1S78D 4ZPVB 2OJZH 2XZAL 1MJ8L 1U3HD 4ZAKC 2XZQL 1U3ZA 2VAJA 1JNHA 3LV3B 5CEYB 3IFLH 4WU7B 4M4RA 1PLGL 1NC2D 2Q7YA 4QXGH 4YDVA 4XMPH 2R9HC 3VFMB 5IF0A 2ZCHH 2VNCA 2YK1L 4BZYA 3O3BB 1F90L 5SX4H 3GO1L 4KKBC 2KH2B 1EPFA 1G7IB 2A83A 1SJXA 2PXYA 2G5RA 3OKKB 5BQ7B 3ULVF 3CDGA 2MKWA 4M5ZL 1GH7A 1T7ZA 1V3MA 3P3YA 4HFWA 4PB9H 2H2SC 4I0PA 2DRUA 4B5EA 3EFDH 2FBOJ 1TZGH 4JFYA 3SCMB 2UUDK 3L6FA 5EG6C 3TBVA 4KKCD 4M1GH 1UB6B 1FNAA 2CUMA 4UDTA 2DLFL 1KACB 2Q8BL 1EMTL 1RJLA 3AS1A 1IC5H 3NAAL 4K2UL 1RUMH 5HGDA 5CP3A 5IGXH 5EC2B 2A9NH 2GJ6A 5ACLA 3OKLA 5F7EL 1XH3A 3S5LB 3TN0C 4CKVX 1U3YA 3EOBB 2W9DL 4MXVF 4YFEA 1OAXH 4PRPA 1XF4B 1Y6MR 1PG7W 4LEOB 5I8KL 4JREB 5ESAA 1BFVH 4ETQA 4W4OA 5HYSG 3QIWD 1PJ9A 4UQ2A 2A6KB 2HT2D 1E6JH 1G1YA 1LDPL 2R69L 1GGBL 3T4YA 3SOBH 4M43H 5DJ0B 5DJZA 1AJ7L 3PWUB 1L7IL 3IKKA 4EUPG 5F7NC 2EEBA 4PB0L 3RZCC 3T0XA 1UCBL 5DMGD 3BXNA 4QKXB 4BELD 5EOTB 3LRSB 1TTGA 1KCGC 3L5WB 4P46C 4QRRD 4M8VA 5D1QA 3P30L 1G7PA 1CL7I 3G6DL 2UZYB 5AZ2H 3MV8A 3ARDD 1T2JA 4LNVA 1UZ6F 3SKNA 4MLIA 3CCHB 2EXWD 4G42A 4NNYA 2K7PA 4DGIL 4KZEL 2FZ3B 3U6RB 2A6IA 1QFWH 3PWLA 4FRWA 1JIBA 4WNQA 4ZXBC 1CVRA 1KN4L 4GW4B 4P9HH 5F3BA 3QAZC 3IFNL 4PG2A 5IMLB 1Z5LB 5ANMA 5HHOA 3CX2A 2XKNA 3ZO0A 4MDIB 1DQMH 4V1DB 1HH9A 4XVJL 4PJHA 2BSRB 5GGRA 4X7TB 4ELMF 5SWSD 4TVPH 3RZWA 3FN9A 4LCWB 4N9GA 2R4SL 4Y19E 2ILLA 3S98A 5EORL 1HIML 3O6ML 4DGYL 1J0YA 4QOKB 5HYQB 3QZWG 5FKAA 1NKRA 3D2UA 4KKLD 4MQ7A 5DEGA 1ZSDA 4FFZL 3BAEL 1X4XA 3LS5H 2XIDA 5DVLA 1MUJA 1ZA6A 2CUHA 1K8DB 1Z3GH 4PRIE 3VH8B 4Z7WA 3SO3B 1E4WL 3SPVB 1HQRB 4E0RA 2ZOLB 2FCBA 3T0EA 2QADC 4JG0H 2PTVA 3RIFF 4KJQD 3F5WA 5DRXA 4YHKH 1MAJA 1F3JA 1R3KB 3DLQR 3K7UA 4NZDA 4U3HA 5ITFB 3TJHC 5EU6A 4MA8L 5C08B 1JGLH 1RIUL 4HIJA 3SE8L 3LEYH 5GHWH 3EGSB 3K74B 4R3SA 2QBWA 4XPGH 5ADOH 3K80A 4TRPL 1C5CH 1TDQA 4G5ZH 4DGVL 3HZVB 5JORB 3WO4C 3HUJA 3QHZH 2V2TB 1EVTC 3DUSA 1FO0B 2WP3O 2NQCA 4LBEA 4CAGA 1T21B 5DJ6B 1MCPL 5I1LA 1UWGL 3HE7C 3FMGL 5EA0H 4XBPA 2UZIL 1KENL 4Q0XL 2FBJH 4KPHH 3KYOA 4WO4B 4Y5XC 3RGVB 3T0BA 3VXNB 3QQNA 4M6OH 2ICWJ 3QWOA 2D7PA 4Y88A 3CC5B 1FZJB 1K8IB 3BDBA 4LSVH 3DX9A 3IXTB 1JWUA 2D7TH 4GO6B 1F8TH 2IQAA 1C8PA 1CQKA 1U2CA 5GS0C 3RY5A 4ZSOE 3PE9A 4I77L 3UROR 1FYTA 3OR6B 2VZUA 5A1AA 5FF6B 2OJZL 5FXCH 1U3HA 3KDMA 4G43A 2QLVB 3QXAA 4OI7A 4KTDH 4WW1B 4Z0BL 5J89A 1CGWA 4OI9A 5DHVA 2BZDA 4QXGL 1NC2A 5AG8A 1HI6A 4XMPL 4LMQE 3EAKA 2ZCHL 2MHAB 4EOWH 1SYSA 4MJ2A 3SGDI 5IOPB 5DJYA 3K1KC 3QDMB 4BSWB 2FJFB 4LMQI 4GOSA 4X99A 3VFNA 3WXWH 5JMRA 4PB9L 5CJQH 5KSAA 3IDGB 5D1XD 4AH2B 5DK3A 1HHGA 4FQQA 2P4AB 4M1GL 3HC3H 4B50A 4QTIH 5H37G 2J12B 5GZND 5IVZB 2AXGB 3G5VA 2X4NA 1QEWA 4S1QH 2B5IB 1QVOB 2APTA 1Q9KB 5JR1H 1FG2A 1WIPA 1OAXL 5CMAB 1BPVA 3GFUA 2VL5B 4P5TB 1HHJA 1PZ5A 5EOCL 4JFFA 3JV6B 1BFVL 4S0SD 3U46A 4OFYD 1KB9J 3CH1A 1M7DB 2WWKT 2AI0H 4JM4H 4YPGB 2FECL 1E6JL 3FFDB 3QIWA 5EO9B 5HVFB 1JZ5A 3SOBL 3NCYP 3PL6C 4M43L 3PDOA 3PQYE 3KLDA 3L95A 4PYGA 5JTWA 4F8TA 2PNDA 4DOHB 1G7QA 1A5FL 3U36A 1GZQA 2A1WL 1L8JA 1JYNA 3MRGB 4QRRA 3OBAA 4OV6F 4RA3A 3RVTD 2OI9A 3S36X 2UUDH 4NN5C 1A6VH 4BM7A 1KIRA 1L4IA 1WICA 4OB5L 3E3QA 3MV9D 1WFTA 1IKNA 2F8OA 3CFDA 2VDQL 3ARDA 4MA1C 4N0YH 5IW6B 4X0KA 4F57H 1DL7H 4KZDH 4DKFH 2NY2C 1I7TA 1F00I 5EFIA 4Z7WF 5CJOH 3F6LA 3AMLA 4I2XE 4UIKH 3MRRA 4DKAA 1QFWL 2ADGA 1OB1A 2QQKH 1L0QA 2DWDB 4LPXA 1FORH 2AKRB 1S7RB 5SWZD 4X6EA 1FH5H 2RCSL 4XPTH 3DYMA 3L3IB 2VERN 4PJGB 3R8QA 3S96A 3VXTB 1D7FA 1N4XH 2DI8A 5BRZE 4WWKC 4JFHE 1A22B 2VXUH 5SWSA 3RI5K 2AV1A 4LVHC 1I1CA 2A38A 4PJDE 3WE6A 5DK2B 1ITCA 2OK0H 1ND0B 1A0QH 1JTTA 5GGSB 1FP5A 3SE4C 4CW1A 4K55A 1UM4L 1HHIB 12E8H 4AEIL 2GFBA 4BZ1H 1KLFA 3LS5L 4UOW0 4NRYA 1UWEL 1X5HA 4QWWD 1LO2H 1KCRL 1HXMA 1Z3GL 5CD3B 5ALBH 1JWMB 3X12B 1M05A 4JKWA 5C2BL 5BS0B 3S3JA 3VFTA 4JG0L 4XBEH 4D9QD 4LLYA 4J3XA 5E4IA 4CADA 4ENED 1CFSB 4GKOA 1B6DA 3D39E 1KG0A 3L3KB 2E8YA 2ZPKH 1LNUA 2OXHA 3V79C 1C1EH 3L3HB 2Z31D 3V5KA 2FSEB 5I6XB 1JGLL 1JHTA 3X3FH 5F44A 2B2XL 5F7FA 4RZCB 4MQTB 5E56A 4LSSH 4YNYA 3LEYL 5GHWL 3OMZA 1SEBA 5DD0H 1Z9SA 3U7AA 4B7IA 4U0QB 1C5CL 4G5ZL 5D2NA 5JIKA 3OGCA 3UBXG 3S35L 3ZE2E 5GJTH 4G6FD 4X83A 2FRGP 3VCLB 1GZPA 1M71B 4N0UE 4HGKC 3C5JA 3UPRB 4UI2A 5F7DB 4Y4HC 4BH7B 2QQLH 3ORJA 2QSTA 5CZVH 5GGVH 3ULUH 4RFOH 3QXDB 4PLOB 3O6FC 4KPHL 2CDEB 3OKNA 4Y16C 3ROOB 4OGAC 4LGRB 2V5RA 4M6OL 3VI4E 4I3SH 4CVZA 4LSVL 5JXAH 3RWFA 4U1HA 4HWEH 3K2MC 4JCLA 1OF2B 4IOFD 3TPUE 5BVPL 4P5MA 5IB4A 4ODXA 3U4AA 1C5BL 5GGRY 1QZ1A 2BSTA 3MV11 4OZFA 3TP4A 2PCPA 4P49A 4LOUD 4C83B 2H41A 4WFFD 5E00A 3GSOB 2Z8RA 2EIZB 3RNQA 3VWJD 5CCKH 1HSBB 1CDCA 5B8CB 4B0MM 4KTDL 4NCC2 4Y4KC 3BPNB 1NC4D 3TM6A 3QEGH 2X5PA 1U8KB 3V0VB 2FATL 3LH2H 1JN6B 1YA5A 4NQVB 4OCXL 4KJWD 5DUBB 5DRZA 4XGZA 2UY6A 4DVBA 1DBMH 4PR5B 3VD4A 3D25A 4LLMB 5F6HJ 4N5ED 1JCKA 2ZUSA 3WXWL 4L3EA 3LAFA 3HAEH 5KSUA 3J8F7 5CJQL 3GSRA 4OBSA 1FLTX 5C9JA 5FHAH 4D2NA 4FQIL 5D1XA 3SKOB 3HC3L 3HR5A 3ARPA 3PWPD 5FECB 5E24E 4YO0B 2YPLE 1FQ9C 4K3GA 1UH3A 5IV2A 2R23A 2BVOB 4RMSA 1DBKL 5EU5A 3ULVC 5I8EB 1X5AA 1J9CT 3QR2A 1XF5B 2FIRT 1WIUA 2Q76A 3T65A 5JR1L 1A3LL 3KPNA 1PYWA 4N8CH 3UJIH 1NGZB 4M00A 4PJ5E 4YGVA 4ERSH 2E9IA 2N4IA 1UJ3A 1M6OB 1K5NA 4OFYA 1CE1H 5JA8B 3RY6C 1CVSC 3NFSH 4PRIB 1Y0LA 5CBEA 2I5YH 1ZHKA 5L8JB 1IAOA 5ESVA 1IAII 4MWFA 5L8KB 4QY8B 1HQ4B 2JIXB 5DHYB 3NIGF 5GGTL 1LP9E 3BI9X 2X89D 2WUBH 4WGVB 2CKBB 4HUWA 5F9DC 3WV0A 4F15B 2XY2A 3CZFA 5HGHA 2FIKA 5DD3H 3JWDL 4NPYB 1A6VL 1OPGL 4PJCB 1EZVX 5E6IB 4KH2A 3MV9A 5HYSB 4F57L 2YD6A 1DL7L 3N1QC 3RGHA 4KZDL 3CDYA 2HWZL 4DKFL 1NUFA 1G7LA 5CJOL 2Q8AH 3ZHLA 4HWBH 1VFAB 3I2CH 4UIKL 3GJFH 2D7MA 1EHAA 2G60H 1WBYB 4JN1L 3O2DH 3QEQE 1Q0YH 3C8DA 4Z7OF 1FORL 4E41D 1TQCB 1FH5L 1JZ6A 4Y4FC 4Z7UE 2ED9A 5F7WC 2WK2A 1N4XL 3I50H 5B22A 1NAML 5EBWB 1RHHB 4LAQH 3I84A 4UMGA 3DX7A 1X5JA 1JWSA 2HJKB 1AD9A 1FCGA 1WT5C 3S6CA 2AABH 2BNRE 1FNHA 1CD0A 4ZSOB 1AIFA 1MIML 2LU3A 3RL2A 2E7BA 4KFZC 1A0QL 4RNRB 1RY7B 1ZEAH 2LU4A 2I26N 12E8L 1KGCD 4BZ1L 5CSZB 3AB0C 3UTZA 4AM0A 1GAFL 5DJDA 1XGRB 1ZK9A 1LO2L 3H6JA 4XH2A 4KDTC 2W0PA 3WL9A 5ALBL 1J1XH 2P44B 4YHPA 5JHLL 5DFWH 3BIBX 2HG5B 3OXSB 2DWEA 4I8DA 1IGMH 3MLUL 2PTTA 2IH3B 2D4DA 3BP4B 3TV3H 3F65A 1PEZA 1BGXH 1XT5A 4WY7H 1R5IA 4U1GC 4QOKD 4RFEA 5IMOB 4TUOA 4PJFA 3BRDA 2ZPKL 4P4KC 4P57B 1C1EL 4FXLA 4KRNA 3HMXL 2DLTA 3MGTA 1DUYA 2E7LE 4LSSL 4GRMB 3RWGB 4R97B 3QZWB 3U79A 2ADJB 4S1DC 2GUOA 1HHKA 5AAWA 4HKXB 1RVFH 2BC4B 1U8QB 1JE6A 1MHEA 5BVJA 3SDAC 3U9PH 2ZSWB 4KJYA 5DMJB 5GGVL 3RUGA 4RFOL 3AXLA 3BO8B 3W11D 4OZGF 3BIAX 4H25B 2FWOB 4M8QB 1VPOH 1ZT7A 4Q9QH 4I4WB 3PQYB 1IJ9A 4O4YH 5FKPA 3QO1B 1YMMB 4NSKB 1ZGLB 3K3QA 4JDVB 3BPOB 2BRRH 4F9LA 3WN5B 2FB4H 1IC7H 4QO1A 4XXCC 5IJKA 2HH0H 4HUVA 4JJ5A 4LLDB 5IQ9A 1OP5K 3RBGA 5I15H 3BOVA 3MCLH 3VWJA 3T2NH 1H15B 1MVUB 5GGTA 1FZMB 2DQCL 3QEGL 2GK0B 4KK5C 3FQWA 3SGEI 1NC4A 1NUDA 1AD0B 1T83A 2FJGB 1JNNL 1QLEH 2YPKA 1KTDB 1DBML 4I2XB 4F7PA 4UIMB 4XCCH 3HHRB 3KPSE 3MRCA 3GHEH 3ARFB 3QNXB 3VFOB 4ZPVA 4N5EA 4MB4A 3LPWA 1A4KB 4N90D 3FT3B 4JR9H 4L4JA 5CEYA 4XVUC 1NUGA 3L7EB 5MHSD 3MROA 3MRJB 4WDIA 4Z7VB 3PWPA 4OGZA 3MUGA 3QDMD 1QRND 2DI7A 3O3BA 4G80A 2WBJC 4IRZH 4APQC 3IYLW 1I7ZB 2MQ3A 1AE6H 5BQ7A 3OKKA 4FHBD 4IBLT 5L8LB 4M3KB 4PJDB 2YZ8A 3OWEA 5HVGB 5K59F 4N8CL 4YAQB 4Z18A 3UJIL 1T3FA 1NAMA 4ERSL 5JUEH 2HFEB 4OD2B 3FQXB 1UB6A 4HZAA 1HOCA 3NN8B 3ZTNL 1LQVA 4ZUVB 2J4WH 2VZ3A 4GRWE 1JHKH 2EYRB 1XIWC 5I74B 3QHFH 2WAHA 3VGEA 1CTOA 5D7IE 2WUBL 2F53E 4HEME 4P5TD 2X89A 1XF4A 3DRQB 5C8JA 4UTAH 1UQSB 3NIDE 4FQXB 4X4ME 3SDXF 5DD3L 1ZWIA 5FYLE 1AQDB 2A6KA 1CFQA 2OL3B 5AZEH 5DTFB 3DETD 4YH6A 2BY0A 1XGTB 5DJ0A 1D6EA 5ISZB 1S8DA 2XWTB 3QDJD 4CU7A 1N3NB 5I66A 2Q8AL 4TVSa 1JL8A 4HWBL 3I2CL 4L1DA 3HMXA 1UH2A 5F21B 3LRSA 3QFDB 4P0DA 5SWQB 1LO4H 3L5WA 1Q0YL 5IK3B 1G6RB 4LKCB 5IESH 4XC1H 3VFPB 5IR1A 4E41A 4MYWB 4PJFF 5EZJB 4LIQH 4Z95H 1K9TA 1OT1A 3I50L 5KVFH 3K4DA 5EBMA 2Y9RT 3O11B 1UKQA 3U6RA 3TPUB 4RMWA 3HFMH 5LWYH 3F8UB 4PJ8C 1UKTA 4GW4A 3DHMA 1GGCL 1Z5LA 3W82A 2B4CC 1ZEAL 4LL9A 4OLZL 2ARJQ 1TPXB 4FQJL 4U4BA 1FDLH 5I16A 3S34L 3IJSB 4LGPB 5BOZG 4DCQA 4QNPF 3TCLB 3NH7L 1F42A 2QQNH 4ZFOL 3TFKC 1FBIH 2VLKE 4P4RA 4X7TA 1J1XL 3T8XB 2MSPA 5DRNB 2RJMA 2H26B 1IGML 3P9MB 1FJ1B 3TV3L 3EO9H 1YECH 4ELKA 1A6ZA 3TBYA 5J11B 1BGXL 1LEIB 3ARVA 3ELAT 2ZSVB 3UCRA 4HSQA 5C92A 1WCQA 4HK0B 4QOKA 5HYQA 3QUZC 5F96H 3ZDYE 5L6YH 4OCYH 4HH9B 3SKUD 4YHNB 3ILQC 4WCYH 1K8DA 2YPLB 3VH8A 5DA4A 1MHHB 1HQRA 4N0CD 4U0RC 4HDIB 3PGCA 1D9KC 1QKZH 1RVFL 2B1AL 1ORSB 1R3KA 3E2HB 4YUEH 4PJ5B 2YD3A 1I4FA 3EYSL 4EUPH 4D0DB 1S9XB 4RGMB 3QQ9C 3V6FA 4O9HL 1MPAH 4Q9QL 1ZLUK 3DMMB 3HZVA 3VDAA 3WFEH 3Q3GB 5I17B 3H7BB 1L6XA 1FO0A 2I25N 4G3YH 2FB4L 1IC7L 2NY6B 3B2VH 3QQ4B 2KBGA 5T3ZH 3RAJH 5DO2C 1T89C 2HH0L 1VFOA 2FNBA 2CRIA 2X1PA 3BW9B 3RGVA 3PGFH 5HHVL 3BMWA 1H3VA 3ARBC 3MCLL 4NQDE 3VXUE 3NCEB 3EO1B 3T2NL 1P7HL 3CC5A 1FZJA 2OZ4L 4YK4C 5B38G 3HNVH 3SE9H 5DUPH 3SE3C 3CJJA 3KPRE 3QH3A 1MHPH 3MLVH 2OX5A 5C0DA 1U2HA 3GHEL 4QRQA 5E03A 3QEQB 3OR6A 3GSUB 3F7VA 3Q2CA 3SBWC 3RX8A 3L3DB 2YD7A 1I7UA 4AIXA 3PXJA 2BMKA 4JR9L 4OCWH 3BQUB 4FFVC 1T20B 4HWBA 5IIEB 4UNTA 3FOLB 2EDFA 5CJXA 2R2HB 1M7XA 2NXYB 1A1NB 3QDMA 1QRNA 3ME0A 1V3LA 3C08H 2FJFA 4WTZG 4DZ8B 2AS5M 3HZKB 2X9XA 3PHSA 3K46A 1URLA 3K1DA 1EEZB 4OCNC 5C0GB 5JUEL 2NPLX 2GKIA 2JJWA 2IANE 2VXTH 1CF8H 3L5XH 4L4VE 1YMHA 5I19H 1K3IA 3HI5H 3TA3B 4WUUE 3V7AG 4FMFA 4DW2L 5E8PA 3RIAK 3QHFL 1I9JH 3QXVA 3FO9A 4R0LC 4PGCB 1A2YB 4Y19D 2DTSA 3K8MA 5EZLA 1QVOA 3JV4A 3HPJB 5BZWA 3ZSTA 1LE5B 4P5TA 3ULUF 3FRUB 3JV6A 5ENWA 1FLRL 1HK6A 3FQUA 2ESVE 1P9MC 3G6JB 4BUGA 4LU5H 4PRID 4RMQA 2V17H 1CD1A 2WINA 4N9OB 3FZUD 3T09A 3S36H 2JCCE 1DEDA 4P2OC 5BZDA 2DKSA 4UT7H 3BWAB 1JK8A 4G59A 4Y8AA 3FL7A 3MLXH 3OKEB 3ZDXE 1DCLA 1QR1A 3KXFE 1KCKA 1LO4L 2FEEL 2OQJB 4U3XA 3QUMH 3VXME 3MRGA 1DSFH 3DUHA 5MENE 5IESL 1GGIH 4XC1L 5E6ID 1JMZA 1SM3H 1XR8A 2ITCB 4LCUB 3B9KB 4R90H 4OZ4A 5KVFL 3C6LC 4TTDC 5IW6A 3SQOH 2C3HA 1ZLVK 1LO5B 4KK8D 3HC0B 5B3JE 4HF5H 2CK0H 3HFML 5LWYL 2DWDA 4FXKB 4XP6H 2AKRA 2NY1D 4J3TA 4NQCB 4YZFF 4DFHA 2YD8A 3L3IA 2ICWI 2HMIC 1KCVH 2VO5A 1FDLL 4WJ5B 5DMIL 2EZ0D 1G7JB 1ZHLA 4P9MH 1R0AH 5INDA 4WENB 3CUPB 1DBBH 3FB7A 2QQNL 4MCYA 4IHOB 4JKLA 5T3ZD 1FBIL 3H9ZA 2X4TA 1E4XI 3B2UC 2D4FA 1YEHL 2N1KA 1R5WA 3E6HA 3EO9L 1YECL 2PYFA 4LCCB 5H2BB 5DK2A 1LO3H 1ND0A 3N85L 4HKZB 4ZFZA 2OZ4A 3UJTL 4OZIF 4IDJL 3VWKB 4UBDC 3LKPB 5F96L 4HUUA 2CKBL 1KJ3H 3MC0A 4BA8A 4OCYL 1WFUA 5I1GH 1MY7A 3KLHD 3NPSB 2DQEH 4NC0B 5CD3A 1NCCH 1JWMA 3X12A 5FB8B 3E6FB 3P4NA 4N0CA 3PJSA 3V7AE 4U1KB 1QKZL 3RHWK 1JTPA 1NJ9B 4J7RA 1UB5B 2ZCKH 3L3KA 3MQIA 4YUEL 2FSEA 1QLFA 4KJPD 4P3CL 2AGJH 4RZCA 5DC4B 4XCYB 4GBXB 4L5FH 3I6LE 1S7WB 5EIIB 4OCSH 1MPAL 4GRWB 3WFEL 5IMKB 4PP1D 4UU9A 3O81A 5TE7H 1DEEA 2YC1A 1EAJA 3RVWC 1M71A 1NGYB 4G3YL 5FO7B 1NCAH 1VFMA 3B2VL 2P8LA 5T3ZL 3RAJL 4OQTA 4BH7A 3BH8A 4OM1H 1PKOA 2AJSH 3B8SA 3ROLB 5GGVY 2CDEA 3ILPB 1NFDE 3RX7A 3PGFL 3X3GH 3S97C 5FA3B 1PKQE 4AG4L 1D5ZB 1NCUA 3CFEA 3ES6B 3HNVL 2FHCA 2QSCH 3SE9L 5F9WB 5DUPL 4C57C 4P9HC 3LEXA 1OF2A 4JPKH 3FB5B 2Z92B 2O93L 2NR6C 4WRLA 5C7XH 3NIFE 1KBGH 3GKWL 4L9LC 4MAYB 1F2XK 5DR5H 3HI1B 3GSOA 1HH6B 4PJBE 1MCBA 4YDJB 1MF2H 5HBBA 3KNBB 3BZFB 1F4HA 5CZKA 3NFPB 3V4VH 3IJYB 1JN6A 2IADB 1ZLUH 3DV4A 1J0HA 3SO5A 4PR5A 5FYJE 3LSOB 3C08L 4LLMA 2MPAL 4MJ5A 2NY7H 1IC4L 5GRXG 3HI6H 3ARGD 1DQQB 1Y18A 2Q7NA 5JW5A 5B3NA 3S88H 4WU5B 4L8DB 3PIQA 2VXTL 1CF8L 3GIVB 5BRZD 5FECA 4YO0A 3DROA 5IWLA 4RDQF 5I19L 4F33B 2VLKB 4Z7QE 3QJFB 3VD7A 4YC2B 3BH9A 4IIQB 1YEEH 5I8EA 3HZMB 3RI5F 1YN7A 4YE4H 4Y19A 4O2CB 1RU9L 1WC7A 1I3GH 2HYMA 4YHZH 1NGZA 1J18A 2ICES 3KPQB 1M6OA 3B6SA 3U1SH 3C2SA 4EI6A 3V4UH 1J87A 1MFAH 2V17L 4K71C 4FG6D 4PRIA 1A1OB 1X5LA 3S36L 3UP1A 1IAMA 4NUJB 1QSEE 5DHYA 4UT7L 5F89A 3WLWC 3QUXC 3VXPB 4M62H 2CKBA 3D39D 3MLXL 3FONB 1MEXH 2NLJB 1EEQA 1IEAB 3OXRA 3QUML 4FQXD 4EI5C 1SM3L 4KUCD 1FIEA 5HI4D 2OR7A 1MCEA 5E6IA 3CVIH 3SDCB 4R90L 4G6JH 5HYSA 3SQOL 5HHXH 3DX6A 3WDJA 2O5ZH 1W8NA 4X4YA 3AAZA 4HF5L 2EDKA 2CK0L 3UAJD 1WBYA 4OI8A 1WCBB 2APWA 4EUPA 1VB9A 4XP6L 3VD9A 5D2LF 2NY4B 4OSUH 5I1KH 4S2SA 4X4XB 3MJ7B 1KCVL 3OHXB 3VE0B 4NQDB 3VXUB 4CUCA 1KXTB 5EBWA 3NA4A 1CBVL 4PRBA 3FRPA 1DP0A 2RFXA 3KPRB 1C12A 5E70A 3O0RL 3VFWB 1EO5A 4ZSOA 7FABH 1LO3L 3VXSE 4JGJA 3SGKA 5C6WH 5E6ZA 2KPNA 3N1MC 2CSPA 4LSRH 4MJ6B 4LLQA 2LVEA 5CSZA 3BD3A 3WJJC 1XGRA 4LGSB 1RZGB 2NX5E 3MJ8B 1ZTXH 3VJ6B 1AKJD 2X1QA 1JPSL 3W2DH 2DQEL 4HWZB 1NCCL 2VAAA 1X5KA 1ZLVH 3ABZA 2EYTB 3EYFB 1BAFH 3BP4A 1KULA 1QD0A 2Z93B 5EOCJ 4EN3B 2WV3A 5IMOA 4OGYL 3UTTE 1BFOB 4IMKC 3MFFB 5HJ3B 4D9RD 2AGJL 4GRMA 4JFEE 3RWGA 5DMKB 2IALA 2YPLD 1K2DA 1G6RL 3QZWA 5IROC 3P4OB 1FN4A 3EJZD 3QSKB 4WW2B 1YPZA 4I48A 5AUMA 5FV2A 3H9YA 4S1SL 1ZGLM 4YHLH 3DGGB 4EDXB 2CR6A 2R29L 1NCAL 1PG7X 2ZCLH 4LPTA 4PJ5D 4QLRA 5HGBB 4IOSD 2EC9U 3ZDZF 1CXLA 1H3GA 2HLAA 1YEDB 3UDWA 4NOFA 5EH1A 2VQ1B 4M8QA 3O2WH 3DMMD 2VDLH 3R0NA 2QSCL 4PTUA 2GYSA 3PQYA 4JHWH 2JCCB 5CGYD 3VXRD 2HT3C 4JPKL 4PS4L 1ZGLA 3ZKMC 2NY6D 3OG6B 3KG5A 1N7MH 3WN5A 4YHYC 5C7XL 4GXVH 4NHUE 1KBGL 1IBGH 2J8OA 5MENB 3HNTH 1H3UA 1ZHNA 3HE6D 4KI5E 2FYYB 3PWJB 1TZHB 3VMNA 2YZ1A 1QNZH 1H15A 4PGEB 4A6YH 3KS0J 5FO8A 3QB7C 1IKFH 1AGFA 1AD0A 4ZYKB 2ARJA 1KTDA 4I2XA 4P2QE 4GRLB 2ICWB 3QNXA 3HI6L 4ONHB 4JRWA 2W0FA 1MQKH 2VZTA 3S88L 1A4KA 1RFDH 3VFSA 3FT3A 1ZT1A 5KSBF 2PF6A 4KDVA 4NOBA 4OZHE 3BIKA 32C2A 3BQUD 1HINL 1MCDA 2VDPH 3BKYH 5DD5L 1DE4B 2KDGA 5BW7C 1BX2B 2YA0A 4DZBB 1IAKB 3O4OC 5BRZA 1XAUA 5E99L 4HGWB 3DX8A 4JM2B 2BNRD 1SJHB 5ILTH 1WAAF 2BSSB 3FT4B 2UZXB 1W0VB 4PJDA 4ZAKB 4YAQA 1HCVA 2EH8H 2O26U 1F4YH 3L9RB 1MREL 4PY8I 5FYJU 5J6HB 3W81A 4OD2A 4GJTB 5ABDE 1CFNB 4JFDD 3VA6A 5FOJA 1VGKB 5GXBB 1CGTA 4ZUVA 2NY3D 5J4MA 2EYRA 4MA3B 4HC1H 3TF7A 3QHTC 4R4FH 4D9LH 2R4RH 3ULUC 4PJEE 3BGFB 6CGTA 1EAPB 3D39A 2BVTA 4CRPA 2ATPB 4FQXA 4ONOA 4JG1H 1R3HB 3MBED 4D8PB 1AQDA 2I9TB 2OL3A 2VDRH 4NO2B 5DTFA 2XT1B 1ZT4B 2H9GB 4XMKH 3QG7H 4G6JL 5AG9A 5I30H 4JQXC 4ZUWA 4NCDA 5HHXL 1QQDB 2XWTA 1YEJH 2O5ZL 4N0UA 2ZUXA 4TPRL 3QFDA 5SWQA 1RZIB 3EO0B 2WY3A 1I8KB 5IK3A 1XCTB 1NDMB 2A74B 1G6RA 2IH1B 4LKCA 3R1GH 4PJXF 4W4NA 3H42H 3VFPA 4U6YB 4V3DB 1NFDB 3RQ3A 4NQEE 1PKQB 1A1MA 5GS2H 3C2AH 4JN2B 4PJ9C 3RA7H 4CN1A 5EUKB 3RZCB 5MI0C 3TPUA 4XAWL 3QXTA 1RZKC 1X5YA 3DRTB 1O7SA 1YPZF 2HJLA 1X4ZA 5FYKE 1FPTH 4O02L 1ZOXA 2C3GA 5DSCB 1MCSA 2C7UA 1YJDH 2X1WL 3WEXB 5ACMA 4I5BA 5I1IH 1C16A 4LSRL 1TTUA 4HJGA 4PJBB 1VEPA 3X11B 3IJSA 5E8NB 2VYRE 2J8UF 3TCLA 3JZ7A 2YD4A 5I73C 4WI5A 1ZTXL 3AY4C 4PY7A 3W2DL 2VXQH 5FO9B 4CMHC 3LHPH 4G7YH 5DJ2B 1AKJA 3T8XA 4ZXBB 5CLWA 2OTUB 3KPSD 3P9MA 4MAUH 1FJ1A 1BAFL 3NCMA 1CDIA 1LEIA 1VADB 2ZSVA 3VWKD 4HK0A 4NYLA 3OX8B 3WHXA 1NCWH 5GGUA 4PJ7F 1IQDB 1I8IA 4HH9A 4YHNA 1KXQE 1GSMA 1NL0L 4XTRD 1X7QB 3CDFA 3WKMH 1YNKH 1IAIM 2CPCA 2YPLA 4M7JH 3ULVE 1YNLL 3TJEH 4MLSA 4NC1C 1KV3A 2YSSA 4YHLL 3IKCB 4S0UC 3BN9C 4MD5B 5EWIL 2ZCLL 1FRGH 4PJ5A 1OGAD 5IB5A 1BBJA 4GBXD 3REVB 2I07A 2R0LL 3O2WL 2ZUQC 4LF3B 4MXVE 2ZUTA 4PGDB 2DS4A 2VDLL 5FOBB 3KLAB 2QADB 1XGPB 3DMMA 5JDSB 3D6GA 3H7BA 2BK8A 2F53D 1LP9A 2Z4QA 3I6KB 3UBXA 1IRAY 1N7ML 4UQ3B 5GRVL 3TGXA 2JJSC 1UWXK 3HNTL 1KT2A 3DARA 2FO4B 3MUY1 4XPHH 3HE6A 1X5XA 4XHJC 1IGJA 4QRUB 1QNZL 2HTKD 3RWHB 3QRFM 4A6YL 1VKXB 3CGTA 1PX3A 2K1MA 3DVGA 2R0ZH 2A6JB 4NO0B 4H8WH 1JFMA 4PJAF 3QXUA 5AWNH 5HHPA 2MCPH 3QEQA 1UZ6E 4L1HA 3QULB 1BOYA 4R4NC 1MQKL 1W72L 3L3DA 1CGYA 1UM5H 2AEPL 4Z7UA 2YS4A 4ZTOH 5J3HD 1YY9D 3NGBB 3BP5B 3DV6A 3BKYL 2VDPL 5D72L 3GIZH 4QRSB 1IM9D 3BQUA 2X4PB 1T20A 2CD0A 1J0ZA 1X5ZA 4KUCF 1D5BA 4H20H 5DF0A 2R2HA 3X13A 4BZ2L 1A1NA 4NT6B 4DZ8A 5HI5D 2BNRA 4NHCH 3HZKA 2PTUA 1EEZA 1OP3K 4MHHG 4O51B 1A21A 2EH8L 1F4YL 3U4EB 3IJHA 1BJ8A 2AP2A 3GMNB 5JNYB 2MNUA 4ELME 3RVUD 1GGUA 2VLKD 5JO5A 3O8XB 4JFDA 2EDBA 1A7RH 3HNSL 1UVQB 3HKFA 2DIJA 4MNQE 4PGCA 4ODTH 1A2YA 1KTLB 2G75B 4WEUD 5JW4N 3ARYA 1INQB 4NWUH 2R4RL 5EBGA 1I8MA 1AR1D 5IHLB 3UTTB 4NIKB 1F2QA 1UXSA 3QNZB 5KZCB 4K3HA 4Q6IC 4JG1L 2I27N 1T2QL 5FUCC 1BMGA 1Q72H 2RR3A 2VDRL 3D3VE 3MBEA 4JFEB 4G6MH 3M07A 4XMKL 4I0CC 3QG7L 2AXFB 2HKFH 5I30L 3DTXB 5JPMB 3CLFL 2VISB 2F19H 3G5ZA 3AGVA 4XP5H 1HEZB 2OQJA 3WIHL 1RUQH 25C8L 4RIRB 1T5WA 3PG2A 3R1GL 4M61B 4PUBL 3H42L 3QO0B 5DXWA 1ZKAA 2ED8A 1H8NA 1N64H 5I1EH 1RIHL 1X44A 3SDCD 1IMHC 5CS7A 4LQFH 4YDLB 5LGJA 3PL6B 3B9KA 4WI3A 1JZ3A 2CLRA 3C2AL 1CLOH 5DURB 3RA7L 2ZG1A 1P5VA 5C09E 1LO5A 3TH4T 3H9SD 3UC0L 3HC0A 4HEPG 1F11A 4ZMAT 4AL8H 2FEDD 2NY4D 2E7MA 4FXKA 1FPTL 3HLAB 5F93C 4NHUB 4NN5B 4JY4B 1QBBA 3KWWB 5GS1C 1GIGH 1P7QD 1S7TB 3O4LE 4NQDD 4WJ5A 3VXUD 4BKLA 4MA1B 4N1HB 3JV5A 3AMKA 4F7EB 1H5BB 4PLJC 2V7NA 3KPRD 5KW9L 1UXWA 2VWEC 4G7YL 1X6NA 3CX5K 4G6AC 3QEUB 4G8IA 1YN6A 3GNMH 1I8LA 1MI5E 1VACB 3KPSA 3PWVB 1S5HB 4K94C 4QHMA 4HKZA 5FGRA 5E2TH 2CO7B 4Z0XB 4A6YA 3VWKA 4R7DB 1L0YA 1NCWL 2AERT 4M1CC 4LEXL 4AEHL 4OZHB 5FYKU 3WNMA 2UVEA 5I1AB 3I6GA 1SMOA 2D31B 2IJ0C 1FZOB 2DM2A 5BV7C 5KSVB 1EHNA 3O6KH 3ZE0F 3TJEL 4RBPH 3E6FA 1S3KH 8FABB 2GJJA 1Z0NA 3HZYB 4EN3D 1W72A 4U1KA 4U2ZA 4K7PX 4WI9A 3GSNL 1NJ9A 4U6TA 1UB5A 3MRHA 5I8OH 2O5XH 1FRGL 1MCLA 4UAOC 5IJVB 3MV8E 5EULV 1LO0H 3MLSH 3CSGA 2IAND 3NCBB 5DVNA 4L4VD 3QWQB 3IDYB 1ED3A 3BEVB 4XCYA 3RJQB 4GBXA 2HTLD 4WUUD 2IAMB 4MB3A 1S7WA 5E6YA 3EYQC 4JQVA 3RIAF 2OTWB 4Y5YA 5E94B 4Z78A 1NGYA 1OARH 5D7IA 5DFTA 5ANME 5HHOE 2F53A 3Q6FB 4YDKL 3ZYIA 5F8RC 5F72S 1TITA 1KLUB 3KYMB 2V2WB 2ESVD 3ROLA 3WD5H 3ILPA 1DN2A 4X4MA 2Y6SC 4XPHL 4HG4J 3ZT6A 3C60C 2VB5A 5SX5K 4UNVA 1D5ZA 2FX8L 3ES6A 1QBLH 2VXVL 3FB5A 1N6QH 4H8WL 5D1ZB 5JW4M 2YHGA 1PY4A 2Z92A 5F1IB 3ZTJG 4P3WA 3KXFD 4Y4HB 3VXMD 5E4EC 2LU7A 2V7HB 3T1FB 4J12A 1DUZA 2ITDB 2CGRL 3NVQA 1HH6A 1CL7H 1ONQA 1UM5L 4OT1L 4BJLA 5CHNA 4YDJA 4Z7WE 4NQEB 3SDDB 1YEGH 4TQEH 1OGTA 2P49B 1BJ1J 4D0BB 3B5HA 3P0VH 1OAQL 1IM9A 4IS6A 4GW5B 4OCRL 3IJYA 2IADA 1KJMB 3WIHA 5TE6H 3B8YA 4GRLD 2OP4H