5HHZA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with 6-(3-methylpyrrol-1-yl)-9h-purine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
492
structure length
457
Chain Sequence
b'GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAAEGLSLKHHSSVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytokinin dehydrogenase 4
publication title Cytokinin metabolism in maize: Novel evidence of cytokinin abundance, interconversions and formation of a new trans-zeatin metabolic product with a weak anticytokinin activity.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 147
structure length 457
sequence length 492
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hhzA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hhzA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hhzA03
1N60C 1N5WC 2RK5A 1DZNA 2E3TA 4JB1A 4PVJA 2GQTA 1FO4A 1E8GA 3I99A 3FW9A 1E8HA 5ADZA 1MBTA 1F0XA 1N63C 2W54A 4MLAA 3AN1A 2VFRA 4DNSA 3C0PA 1W1OA 4O95A 1FFUC 2BVHA 1W1MA 2GQUA 1MBBA 2VFTA 3D2DA 5D79A 3VTEA 2O3GA 1RM6B 2OAIA 1W1QA 5HMRA 1N61C 5FXPA 3GSYA 2YVSA 1WVFA 5HQXA 2NQWA 3NVZB 5AE2A 1W1SA 1QLTA 3AM9A 3NVYB 2MBRA 1VAOA 2BVGA 4XLOA 3W8WA 3W8XA 2P13A 1W1RA 3LAEA 5FXEA 1SB3B 2Q4WA 4PZFA 5FXDA 2R8DA 1W1JA 2Q85A 4ZOHB 4EC3A 3SR6B 2AXRA 3D2HA 5AE3A 3EUB3 1W1LA 3DEDA 3S1EA 3W8ZA 2PLSA 1HSKA 4PVKA 2VFVA 2BVFA 4PWBA 1QLUA 3ETRB 3S1FA 1W1KA 4UD8A 3FWAA 3NVVB 2W3SA 5G5GB 5G5HB 5AE1A 3BW7A 2P4PA 3TSJA 1VDVA 4BBYA 1T3QC 3PM9A 1FFVC 3D2JA 3B9JB 1ZR6A 4PVHA 4OALA 1JRPA 1UXYA 1DIQA 2QPMA 2VFSA 1E0YA 3S1CA 3KJMA 4PVEA 5FXFA 3S1DA 4BC7A 1DIIA 1E8FA 3NVWB 3NRZB 4PWCA 1FIQB 3AMZA 3FW7A 3JS8A 2QKNA 1AHZA 1WVEA 1ZXIC 1V97A 1N5XA 4BC9A 3NS1B 1AHVA 2VAOA 2EXRA 2R2ZA 2W3RA 3TX1A 2P3HA 1I19A 3DQ0A 4ML8A 3FW8A 1JROA 2W55A 3LLBA 1N62C 2VFUA 2PLIA 3TSHA 4BCAA 5HHZA 1AHUA 2I0KA 4JAYA 4HG0A 3HRDC 4PYTA 1WYGA
chains in the Genus database with same CATH superfamily
1N60C 1N5WC 2RK5A 1DZNA 2E3TA 4JB1A 2UUUA 3HSUA 4PVJA 2GQTA 1FO4A 1E8GA 3I99A 3FW9A 1E8HA 5ADZA 3POPA 1MBTA 2Y08A 1F0XA 1N63C 2W54A 4MLAA 3AN1A 2VFRA 4DNSA 3C0PA 1W1OA 4O95A 1FFUC 2BVHA 2Y3RA 1W1MA 2GQUA 1MBBA 2VFTA 3D2DA 5D79A 3VTEA 2IPIA 1RM6B 2O3GA 1W1QA 5HMRA 3RJ8A 2Y3SA 1N61C 5FXPA 3GSYA 2YVSA 1WVFA 5HQXA 2NQWA 3NVZB 5AE2A 1W1SA 1QLTA 3AM9A 3NVYB 2MBRA 1VAOA 2BVGA 4XLOA 3W8WA 3W8XA 5I1WA 3RJAA 2P13A 1W1RA 3LAEA 5FXEA 1SB3B 2UUVA 2Q4WA 4PZFA 5FXDA 2Y4GA 2R8DA 2OAIA 1W1JA 2Q85A 4ZOHB 4EC3A 3SR6B 2AXRA 3D2HA 5AE3A 3EUB3 1W1LA 3DEDA 3S1EA 3EJEB 3W8ZA 2PLSA 1HSKA 4PVKA 2VFVA 2BVFA 4PWBA 1QLUA 3ETRB 3S1FA 5L6GA 5AWVA 1W1KA 4UD8A 3FWAA 3NVVB 2W3SA 5G5GB 5G5HB 5AE1A 3PQBA 3BW7A 2P4PA 3TSJA 1VDVA 4BBYA 1T3QC 3PM9A 1FFVC 3D2JA 5K8EA 3B9JB 1ZR6A 4PVHA 4OALA 1JRPA 1UXYA 1DIQA 2QPMA 2VFSA 1E0YA 3S1CA 3KJMA 4PVEA 5FXFA 3S1DA 4BC7A 1DIIA 1E8FA 3NVWB 3NRZB 4PWCA 1FIQB 3AMZA 3FW7A 3JS8A 2QKNA 1AHZA 1WVEA 1ZXIC 1V97A 1N5XA 4BC9A 3EJBB 3NS1B 3EJDB 1AHVA 2VAOA 2EXRA 2R2ZA 2W3RA 3TX1A 2P3HA 1I19A 3DQ0A 4ML8A 3FW8A 1JROA 2W55A 3LLBA 2WDWA 1N62C 5L6FA 2VFUA 2PLIA 3TSHA 5I1VA 4BCAA 5HHZA 1AHUA 2I0KA 4JAYA 4HG0A 3HRDC 4PYTA 1WYGA
chains in the Genus database with same CATH topology
1N60C 1N5WC 2RK5A 1DZNA 2E3TA 4JB1A 2UUUA 3HSUA 4PVJA 2GQTA 1FO4A 1E8GA 3I99A 3FW9A 1E8HA 5ADZA 3POPA 1MBTA 2Y08A 1F0XA 1N63C 2W54A 4MLAA 3AN1A 2VFRA 4DNSA 3C0PA 1W1OA 4O95A 1FFUC 2BVHA 2Y3RA 1W1MA 2GQUA 1MBBA 2VFTA 3D2DA 5D79A 3VTEA 2IPIA 1RM6B 2O3GA 1W1QA 5HMRA 3RJ8A 2Y3SA 1N61C 5FXPA 3GSYA 2YVSA 1WVFA 5HQXA 2NQWA 3NVZB 5AE2A 1W1SA 1QLTA 3AM9A 3NVYB 2MBRA 1VAOA 2BVGA 4XLOA 3W8WA 3W8XA 5I1WA 3RJAA 2P13A 1W1RA 3LAEA 5FXEA 1SB3B 2UUVA 2Q4WA 4PZFA 5FXDA 2Y4GA 2R8DA 2OAIA 1W1JA 2Q85A 4ZOHB 4EC3A 3SR6B 2AXRA 3D2HA 5AE3A 3EUB3 1W1LA 3DEDA 3S1EA 3W8ZA 2PLSA 1HSKA 4PVKA 2VFVA 2BVFA 4PWBA 1QLUA 3ETRB 3S1FA 5L6GA 5AWVA 1W1KA 4UD8A 3FWAA 3NVVB 2W3SA 5G5GB 5G5HB 5AE1A 3PQBA 3BW7A 2P4PA 3TSJA 1VDVA 4BBYA 1T3QC 3PM9A 1FFVC 3D2JA 5K8EA 3B9JB 1ZR6A 4PVHA 4OALA 1JRPA 1UXYA 1DIQA 2QPMA 2VFSA 1E0YA 3S1CA 3KJMA 4PVEA 5FXFA 3S1DA 4BC7A 1DIIA 1E8FA 3NVWB 3NRZB 4PWCA 1FIQB 3AMZA 3FW7A 3JS8A 2QKNA 1AHZA 1WVEA 1ZXIC 1V97A 1N5XA 4BC9A 3NS1B 1AHVA 2VAOA 2EXRA 2R2ZA 2W3RA 3TX1A 2P3HA 1I19A 3DQ0A 4ML8A 3FW8A 1JROA 2W55A 3LLBA 2WDWA 1N62C 5L6FA 2VFUA 2PLIA 3TSHA 5I1VA 4BCAA 5HHZA 1AHUA 2I0KA 4JAYA 4HG0A 3HRDC 4PYTA 1WYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N60 C;  1N5W C;  2RK5 A;  1DZN A;  2E3T A;  4JB1 A;  4PVJ A;  2GQT A;  1FO4 A;  1E8G A;  3I99 A;  3FW9 A;  1E8H A;  5ADZ A;  1MBT A;  1F0X A;  1N63 C;  2W54 A;  4MLA A;  3AN1 A;  2VFR A;  4DNS A;  3C0P A;  1W1O A;  4O95 A;  1FFU C;  2BVH A;  1W1M A;  2GQU A;  1MBB A;  2VFT A;  3D2D A;  5D79 A;  3VTE A;  2O3G A;  1RM6 B;  2OAI A;  1W1Q A;  5HMR A;  1N61 C;  5FXP A;  3GSY A;  2YVS A;  1WVF A;  5HQX A;  2NQW A;  3NVZ B;  5AE2 A;  1W1S A;  1QLT A;  3AM9 A;  3NVY B;  2MBR A;  1VAO A;  2BVG A;  4XLO A;  3W8W A;  3W8X A;  2P13 A;  1W1R A;  3LAE A;  5FXE A;  1SB3 B;  2Q4W A;  4PZF A;  5FXD A;  2R8D A;  1W1J A;  2Q85 A;  4ZOH B;  4EC3 A;  3SR6 B;  2AXR A;  3D2H A;  5AE3 A;  3EUB 3;  1W1L A;  3DED A;  3S1E A;  3W8Z A;  2PLS A;  1HSK A;  4PVK A;  2VFV A;  2BVF A;  4PWB A;  1QLU A;  3ETR B;  3S1F A;  1W1K A;  4UD8 A;  3FWA A;  3NVV B;  2W3S A;  5G5G B;  5G5H B;  5AE1 A;  3BW7 A;  2P4P A;  3TSJ A;  1VDV A;  4BBY A;  1T3Q C;  3PM9 A;  1FFV C;  3D2J A;  3B9J B;  1ZR6 A;  4PVH A;  4OAL A;  1JRP A;  1UXY A;  1DIQ A;  2QPM A;  2VFS A;  1E0Y A;  3S1C A;  3KJM A;  4PVE A;  5FXF A;  3S1D A;  4BC7 A;  1DII A;  1E8F A;  3NVW B;  3NRZ B;  4PWC A;  1FIQ B;  3AMZ A;  3FW7 A;  3JS8 A;  2QKN A;  1AHZ A;  1WVE A;  1ZXI C;  1V97 A;  1N5X A;  4BC9 A;  3NS1 B;  1AHV A;  2VAO A;  2EXR A;  2R2Z A;  2W3R A;  3TX1 A;  2P3H A;  1I19 A;  3DQ0 A;  4ML8 A;  3FW8 A;  1JRO A;  2W55 A;  3LLB A;  1N62 C;  2VFU A;  2PLI A;  3TSH A;  4BCA A;  5HHZ A;  1AHU A;  2I0K A;  4JAY A;  4HG0 A;  3HRD C;  4PYT A;  1WYG A; 
#chains in the Genus database with same CATH topology
 1N60 C;  1N5W C;  2RK5 A;  1DZN A;  2E3T A;  4JB1 A;  2UUU A;  3HSU A;  4PVJ A;  2GQT A;  1FO4 A;  1E8G A;  3I99 A;  3FW9 A;  1E8H A;  5ADZ A;  3POP A;  1MBT A;  2Y08 A;  1F0X A;  1N63 C;  2W54 A;  4MLA A;  3AN1 A;  2VFR A;  4DNS A;  3C0P A;  1W1O A;  4O95 A;  1FFU C;  2BVH A;  2Y3R A;  1W1M A;  2GQU A;  1MBB A;  2VFT A;  3D2D A;  5D79 A;  3VTE A;  2IPI A;  1RM6 B;  2O3G A;  1W1Q A;  5HMR A;  3RJ8 A;  2Y3S A;  1N61 C;  5FXP A;  3GSY A;  2YVS A;  1WVF A;  5HQX A;  2NQW A;  3NVZ B;  5AE2 A;  1W1S A;  1QLT A;  3AM9 A;  3NVY B;  2MBR A;  1VAO A;  2BVG A;  4XLO A;  3W8W A;  3W8X A;  5I1W A;  3RJA A;  2P13 A;  1W1R A;  3LAE A;  5FXE A;  1SB3 B;  2UUV A;  2Q4W A;  4PZF A;  5FXD A;  2Y4G A;  2R8D A;  2OAI A;  1W1J A;  2Q85 A;  4ZOH B;  4EC3 A;  3SR6 B;  2AXR A;  3D2H A;  5AE3 A;  3EUB 3;  1W1L A;  3DED A;  3S1E A;  3EJE B;  3W8Z A;  2PLS A;  1HSK A;  4PVK A;  2VFV A;  2BVF A;  4PWB A;  1QLU A;  3ETR B;  3S1F A;  5L6G A;  5AWV A;  1W1K A;  4UD8 A;  3FWA A;  3NVV B;  2W3S A;  5G5G B;  5G5H B;  5AE1 A;  3PQB A;  3BW7 A;  2P4P A;  3TSJ A;  1VDV A;  4BBY A;  1T3Q C;  3PM9 A;  1FFV C;  3D2J A;  5K8E A;  3B9J B;  1ZR6 A;  4PVH A;  4OAL A;  1JRP A;  1UXY A;  1DIQ A;  2QPM A;  2VFS A;  1E0Y A;  3S1C A;  3KJM A;  4PVE A;  5FXF A;  3S1D A;  4BC7 A;  1DII A;  1E8F A;  3NVW B;  3NRZ B;  4PWC A;  1FIQ B;  3AMZ A;  3FW7 A;  3JS8 A;  2QKN A;  1AHZ A;  1WVE A;  1ZXI C;  1V97 A;  1N5X A;  4BC9 A;  3EJB B;  3NS1 B;  3EJD B;  1AHV A;  2VAO A;  2EXR A;  2R2Z A;  2W3R A;  3TX1 A;  2P3H A;  1I19 A;  3DQ0 A;  4ML8 A;  3FW8 A;  1JRO A;  2W55 A;  3LLB A;  2WDW A;  1N62 C;  5L6F A;  2VFU A;  2PLI A;  3TSH A;  5I1V A;  4BCA A;  5HHZ A;  1AHU A;  2I0K A;  4JAY A;  4HG0 A;  3HRD C;  4PYT A;  1WYG A; 
#chains in the Genus database with same CATH homology
 1N60 C;  1N5W C;  2RK5 A;  1DZN A;  2E3T A;  4JB1 A;  2UUU A;  3HSU A;  4PVJ A;  2GQT A;  1FO4 A;  1E8G A;  3I99 A;  3FW9 A;  1E8H A;  5ADZ A;  3POP A;  1MBT A;  2Y08 A;  1F0X A;  1N63 C;  2W54 A;  4MLA A;  3AN1 A;  2VFR A;  4DNS A;  3C0P A;  1W1O A;  4O95 A;  1FFU C;  2BVH A;  2Y3R A;  1W1M A;  2GQU A;  1MBB A;  2VFT A;  3D2D A;  5D79 A;  3VTE A;  2IPI A;  1RM6 B;  2O3G A;  1W1Q A;  5HMR A;  3RJ8 A;  2Y3S A;  1N61 C;  5FXP A;  3GSY A;  2YVS A;  1WVF A;  5HQX A;  2NQW A;  3NVZ B;  5AE2 A;  1W1S A;  1QLT A;  3AM9 A;  3NVY B;  2MBR A;  1VAO A;  2BVG A;  4XLO A;  3W8W A;  3W8X A;  5I1W A;  3RJA A;  2P13 A;  1W1R A;  3LAE A;  5FXE A;  1SB3 B;  2UUV A;  2Q4W A;  4PZF A;  5FXD A;  2Y4G A;  2R8D A;  2OAI A;  1W1J A;  2Q85 A;  4ZOH B;  4EC3 A;  3SR6 B;  2AXR A;  3D2H A;  5AE3 A;  3EUB 3;  1W1L A;  3DED A;  3S1E A;  3W8Z A;  2PLS A;  1HSK A;  4PVK A;  2VFV A;  2BVF A;  4PWB A;  1QLU A;  3ETR B;  3S1F A;  5L6G A;  5AWV A;  1W1K A;  4UD8 A;  3FWA A;  3NVV B;  2W3S A;  5G5G B;  5G5H B;  5AE1 A;  3PQB A;  3BW7 A;  2P4P A;  3TSJ A;  1VDV A;  4BBY A;  1T3Q C;  3PM9 A;  1FFV C;  3D2J A;  5K8E A;  3B9J B;  1ZR6 A;  4PVH A;  4OAL A;  1JRP A;  1UXY A;  1DIQ A;  2QPM A;  2VFS A;  1E0Y A;  3S1C A;  3KJM A;  4PVE A;  5FXF A;  3S1D A;  4BC7 A;  1DII A;  1E8F A;  3NVW B;  3NRZ B;  4PWC A;  1FIQ B;  3AMZ A;  3FW7 A;  3JS8 A;  2QKN A;  1AHZ A;  1WVE A;  1ZXI C;  1V97 A;  1N5X A;  4BC9 A;  3NS1 B;  1AHV A;  2VAO A;  2EXR A;  2R2Z A;  2W3R A;  3TX1 A;  2P3H A;  1I19 A;  3DQ0 A;  4ML8 A;  3FW8 A;  1JRO A;  2W55 A;  3LLB A;  2WDW A;  1N62 C;  5L6F A;  2VFU A;  2PLI A;  3TSH A;  5I1V A;  4BCA A;  5HHZ A;  1AHU A;  2I0K A;  4JAY A;  4HG0 A;  3HRD C;  4PYT A;  1WYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...