5HHZA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with 6-(3-methylpyrrol-1-yl)-9h-purine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
492
structure length
457
Chain Sequence
b'GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAAEGLSLKHHSSVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytokinin dehydrogenase 4
molecule tags Oxidoreductase
source organism Zea mays
publication title Cytokinin metabolism in maize: Novel evidence of cytokinin abundance, interconversions and formation of a new trans-zeatin metabolic product with a weak anticytokinin activity.
pubmed doi rcsb
total genus 147
structure length 457
sequence length 492
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hhzA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hhzA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hhzA03
4DNSA 2VAOA 3FWAA 1E8GA 4PZFA 4EC3A 4HG0A 5AE1A 1E0YA 2VFUA 1WVFA 1AHUA 5G5HB 2BVFA 1ZR6A 4PVJA 2OAIA 3SR6B 2EXRA 2VFSA 1N63C 2MBRA 4BC9A 2BVHA 3BW7A 3FW9A 4MLAA 4PVKA 3S1DA 1N60C 1E8FA 2W55A 1W1KA 5AE2A 3TSJA 2NQWA 3D2JA 1FO4A 1N61C 1I19A 5HHZA 2R8DA 1ZXIC 2VFRA 4UD8A 2E3TA 3TSHA 3HRDC 2VFVA 1T3QC 3W8ZA 1WYGA 1N5WC 3B9JB 1SB3B 2VFTA 1RM6B 2I0KA 4O95A 5FXDA 4BCAA 2P3HA 1FFVC 2QKNA 3VTEA 5FXPA 1JRPA 1DIIA 1JROA 1HSKA 2BVGA 5FXFA 3NS1B 2PLIA 5G5GB 2AXRA 3EUB3 1W1LA 1W1SA 2P13A 4PVEA 4PWCA 5HQXA 5D79A 4JB1A 2GQUA 4PYTA 4ZOHB 3S1FA 1DZNA 1N62C 1WVEA 1DIQA 3W8WA 3JS8A 4OALA 1FFUC 3PM9A 1AHZA 3S1CA 4BBYA 3NVWB 2YVSA 5HMRA 3DEDA 1QLTA 3DQ0A 2GQTA 1UXYA 1W1RA 3NVYB 3FW7A 3KJMA 2W54A 2Q85A 2P4PA 4XLOA 5ADZA 1VDVA 1MBBA 3AN1A 2R2ZA 1AHVA 3LAEA 2Q4WA 2W3RA 3AMZA 4PVHA 3NVZB 1E8HA 2PLSA 1N5XA 3GSYA 1W1QA 3ETRB 4BC7A 3FW8A 3NRZB 4ML8A 3C0PA 2O3GA 2QPMA 1W1OA 1MBTA 1VAOA 4PWBA 1V97A 1W1MA 2W3SA 5FXEA 3D2HA 3AM9A 2RK5A 1F0XA 5AE3A 3I99A 3NVVB 3TX1A 3D2DA 1W1JA 1FIQB 3W8XA 3S1EA 1QLUA 4JAYA 3LLBA
chains in the Genus database with same CATH superfamily
4DNSA 2VAOA 3FWAA 1E8GA 4PZFA 4EC3A 4HG0A 5AE1A 1E0YA 2VFUA 1WVFA 1AHUA 5G5HB 2BVFA 1ZR6A 3EJEB 4PVJA 2OAIA 3SR6B 2EXRA 2VFSA 1N63C 2MBRA 4BC9A 3EJBB 2BVHA 3BW7A 3FW9A 4MLAA 5L6FA 4PVKA 5I1VA 3S1DA 1N60C 3POPA 1E8FA 2W55A 1W1KA 2Y3SA 5AE2A 3TSJA 2NQWA 3D2JA 1FO4A 1N61C 2Y3RA 1I19A 5HHZA 2R8DA 1ZXIC 2VFRA 4UD8A 2E3TA 3TSHA 3HRDC 2UUVA 2VFVA 1T3QC 3W8ZA 1WYGA 1N5WC 3B9JB 1SB3B 5AWVA 2VFTA 1RM6B 2I0KA 4O95A 5FXDA 4BCAA 2P3HA 1FFVC 2QKNA 3VTEA 5FXPA 1JRPA 1DIIA 1JROA 1HSKA 2BVGA 2Y4GA 5FXFA 3NS1B 2PLIA 5G5GB 2AXRA 3EUB3 1W1LA 1W1SA 2P13A 4PVEA 4PWCA 5HQXA 5D79A 5I1WA 4JB1A 2GQUA 3RJAA 3PQBA 3HSUA 4PYTA 4ZOHB 3S1FA 1DZNA 1N62C 2UUUA 1WVEA 3EJDB 2Y08A 1DIQA 3W8WA 3JS8A 4OALA 1FFUC 3PM9A 1AHZA 3S1CA 4BBYA 3NVWB 2YVSA 5HMRA 3DEDA 1QLTA 3DQ0A 2GQTA 1UXYA 1W1RA 3NVYB 3FW7A 3KJMA 2W54A 3RJ8A 2Q85A 2P4PA 4XLOA 5ADZA 5L6GA 1VDVA 1MBBA 3AN1A 2R2ZA 1AHVA 3LAEA 2Q4WA 2W3RA 3AMZA 4PVHA 3NVZB 1E8HA 2PLSA 1N5XA 3GSYA 1W1QA 3ETRB 4BC7A 3FW8A 3NRZB 4ML8A 3C0PA 2O3GA 2QPMA 1W1OA 1MBTA 1VAOA 2IPIA 4PWBA 2WDWA 1V97A 1W1MA 2W3SA 5FXEA 3D2HA 3AM9A 2RK5A 1F0XA 5AE3A 3I99A 3NVVB 3TX1A 3D2DA 1W1JA 1FIQB 3W8XA 5K8EA 3S1EA 1QLUA 4JAYA 3LLBA
chains in the Genus database with same CATH topology
4DNSA 2VAOA 3FWAA 1E8GA 4PZFA 4EC3A 4HG0A 5AE1A 1E0YA 2VFUA 1WVFA 1AHUA 5G5HB 2BVFA 1ZR6A 4PVJA 2OAIA 3SR6B 2EXRA 2VFSA 1N63C 2MBRA 4BC9A 2BVHA 3BW7A 3FW9A 4MLAA 5L6FA 4PVKA 5I1VA 3S1DA 1N60C 3POPA 1E8FA 2W55A 1W1KA 2Y3SA 5AE2A 3TSJA 2NQWA 3D2JA 1FO4A 1N61C 2Y3RA 1I19A 5HHZA 2R8DA 1ZXIC 2VFRA 4UD8A 2E3TA 3TSHA 3HRDC 2UUVA 2VFVA 1T3QC 3W8ZA 1WYGA 1N5WC 3B9JB 1SB3B 5AWVA 2VFTA 1RM6B 2I0KA 4O95A 5FXDA 4BCAA 2P3HA 1FFVC 2QKNA 3VTEA 5FXPA 1JRPA 1DIIA 1JROA 1HSKA 2BVGA 2Y4GA 5FXFA 3NS1B 2PLIA 5G5GB 2AXRA 3EUB3 1W1LA 1W1SA 2P13A 4PVEA 4PWCA 5HQXA 5D79A 5I1WA 4JB1A 2GQUA 3RJAA 3PQBA 3HSUA 4PYTA 4ZOHB 3S1FA 1DZNA 1N62C 2UUUA 1WVEA 2Y08A 1DIQA 3W8WA 3JS8A 4OALA 1FFUC 3PM9A 1AHZA 3S1CA 4BBYA 3NVWB 2YVSA 5HMRA 3DEDA 1QLTA 3DQ0A 2GQTA 1UXYA 1W1RA 3NVYB 3FW7A 3KJMA 2W54A 3RJ8A 2Q85A 2P4PA 4XLOA 5ADZA 5L6GA 1VDVA 1MBBA 3AN1A 2R2ZA 1AHVA 3LAEA 2Q4WA 2W3RA 3AMZA 4PVHA 3NVZB 1E8HA 2PLSA 1N5XA 3GSYA 1W1QA 3ETRB 4BC7A 3FW8A 3NRZB 4ML8A 3C0PA 2O3GA 2QPMA 1W1OA 1MBTA 1VAOA 2IPIA 4PWBA 2WDWA 1V97A 1W1MA 2W3SA 5FXEA 3D2HA 3AM9A 2RK5A 1F0XA 5AE3A 3I99A 3NVVB 3TX1A 3D2DA 1W1JA 1FIQB 3W8XA 5K8EA 3S1EA 1QLUA 4JAYA 3LLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNS A;  2VAO A;  3FWA A;  1E8G A;  4PZF A;  4EC3 A;  4HG0 A;  5AE1 A;  1E0Y A;  2VFU A;  1WVF A;  1AHU A;  5G5H B;  2BVF A;  1ZR6 A;  4PVJ A;  2OAI A;  3SR6 B;  2EXR A;  2VFS A;  1N63 C;  2MBR A;  4BC9 A;  2BVH A;  3BW7 A;  3FW9 A;  4MLA A;  4PVK A;  3S1D A;  1N60 C;  1E8F A;  2W55 A;  1W1K A;  5AE2 A;  3TSJ A;  2NQW A;  3D2J A;  1FO4 A;  1N61 C;  1I19 A;  5HHZ A;  2R8D A;  1ZXI C;  2VFR A;  4UD8 A;  2E3T A;  3TSH A;  3HRD C;  2VFV A;  1T3Q C;  3W8Z A;  1WYG A;  1N5W C;  3B9J B;  1SB3 B;  2VFT A;  1RM6 B;  2I0K A;  4O95 A;  5FXD A;  4BCA A;  2P3H A;  1FFV C;  2QKN A;  3VTE A;  5FXP A;  1JRP A;  1DII A;  1JRO A;  1HSK A;  2BVG A;  5FXF A;  3NS1 B;  2PLI A;  5G5G B;  2AXR A;  3EUB 3;  1W1L A;  1W1S A;  2P13 A;  4PVE A;  4PWC A;  5HQX A;  5D79 A;  4JB1 A;  2GQU A;  4PYT A;  4ZOH B;  3S1F A;  1DZN A;  1N62 C;  1WVE A;  1DIQ A;  3W8W A;  3JS8 A;  4OAL A;  1FFU C;  3PM9 A;  1AHZ A;  3S1C A;  4BBY A;  3NVW B;  2YVS A;  5HMR A;  3DED A;  1QLT A;  3DQ0 A;  2GQT A;  1UXY A;  1W1R A;  3NVY B;  3FW7 A;  3KJM A;  2W54 A;  2Q85 A;  2P4P A;  4XLO A;  5ADZ A;  1VDV A;  1MBB A;  3AN1 A;  2R2Z A;  1AHV A;  3LAE A;  2Q4W A;  2W3R A;  3AMZ A;  4PVH A;  3NVZ B;  1E8H A;  2PLS A;  1N5X A;  3GSY A;  1W1Q A;  3ETR B;  4BC7 A;  3FW8 A;  3NRZ B;  4ML8 A;  3C0P A;  2O3G A;  2QPM A;  1W1O A;  1MBT A;  1VAO A;  4PWB A;  1V97 A;  1W1M A;  2W3S A;  5FXE A;  3D2H A;  3AM9 A;  2RK5 A;  1F0X A;  5AE3 A;  3I99 A;  3NVV B;  3TX1 A;  3D2D A;  1W1J A;  1FIQ B;  3W8X A;  3S1E A;  1QLU A;  4JAY A;  3LLB A; 
#chains in the Genus database with same CATH topology
 4DNS A;  2VAO A;  3FWA A;  1E8G A;  4PZF A;  4EC3 A;  4HG0 A;  5AE1 A;  1E0Y A;  2VFU A;  1WVF A;  1AHU A;  5G5H B;  2BVF A;  1ZR6 A;  3EJE B;  4PVJ A;  2OAI A;  3SR6 B;  2EXR A;  2VFS A;  1N63 C;  2MBR A;  4BC9 A;  3EJB B;  2BVH A;  3BW7 A;  3FW9 A;  4MLA A;  5L6F A;  4PVK A;  5I1V A;  3S1D A;  1N60 C;  3POP A;  1E8F A;  2W55 A;  1W1K A;  2Y3S A;  5AE2 A;  3TSJ A;  2NQW A;  3D2J A;  1FO4 A;  1N61 C;  2Y3R A;  1I19 A;  5HHZ A;  2R8D A;  1ZXI C;  2VFR A;  4UD8 A;  2E3T A;  3TSH A;  3HRD C;  2UUV A;  2VFV A;  1T3Q C;  3W8Z A;  1WYG A;  1N5W C;  3B9J B;  1SB3 B;  5AWV A;  2VFT A;  1RM6 B;  2I0K A;  4O95 A;  5FXD A;  4BCA A;  2P3H A;  1FFV C;  2QKN A;  3VTE A;  5FXP A;  1JRP A;  1DII A;  1JRO A;  1HSK A;  2BVG A;  2Y4G A;  5FXF A;  3NS1 B;  2PLI A;  5G5G B;  2AXR A;  3EUB 3;  1W1L A;  1W1S A;  2P13 A;  4PVE A;  4PWC A;  5HQX A;  5D79 A;  5I1W A;  4JB1 A;  2GQU A;  3RJA A;  3PQB A;  3HSU A;  4PYT A;  4ZOH B;  3S1F A;  1DZN A;  1N62 C;  2UUU A;  1WVE A;  3EJD B;  2Y08 A;  1DIQ A;  3W8W A;  3JS8 A;  4OAL A;  1FFU C;  3PM9 A;  1AHZ A;  3S1C A;  4BBY A;  3NVW B;  2YVS A;  5HMR A;  3DED A;  1QLT A;  3DQ0 A;  2GQT A;  1UXY A;  1W1R A;  3NVY B;  3FW7 A;  3KJM A;  2W54 A;  3RJ8 A;  2Q85 A;  2P4P A;  4XLO A;  5ADZ A;  5L6G A;  1VDV A;  1MBB A;  3AN1 A;  2R2Z A;  1AHV A;  3LAE A;  2Q4W A;  2W3R A;  3AMZ A;  4PVH A;  3NVZ B;  1E8H A;  2PLS A;  1N5X A;  3GSY A;  1W1Q A;  3ETR B;  4BC7 A;  3FW8 A;  3NRZ B;  4ML8 A;  3C0P A;  2O3G A;  2QPM A;  1W1O A;  1MBT A;  1VAO A;  2IPI A;  4PWB A;  2WDW A;  1V97 A;  1W1M A;  2W3S A;  5FXE A;  3D2H A;  3AM9 A;  2RK5 A;  1F0X A;  5AE3 A;  3I99 A;  3NVV B;  3TX1 A;  3D2D A;  1W1J A;  1FIQ B;  3W8X A;  5K8E A;  3S1E A;  1QLU A;  4JAY A;  3LLB A; 
#chains in the Genus database with same CATH homology
 4DNS A;  2VAO A;  3FWA A;  1E8G A;  4PZF A;  4EC3 A;  4HG0 A;  5AE1 A;  1E0Y A;  2VFU A;  1WVF A;  1AHU A;  5G5H B;  2BVF A;  1ZR6 A;  4PVJ A;  2OAI A;  3SR6 B;  2EXR A;  2VFS A;  1N63 C;  2MBR A;  4BC9 A;  2BVH A;  3BW7 A;  3FW9 A;  4MLA A;  5L6F A;  4PVK A;  5I1V A;  3S1D A;  1N60 C;  3POP A;  1E8F A;  2W55 A;  1W1K A;  2Y3S A;  5AE2 A;  3TSJ A;  2NQW A;  3D2J A;  1FO4 A;  1N61 C;  2Y3R A;  1I19 A;  5HHZ A;  2R8D A;  1ZXI C;  2VFR A;  4UD8 A;  2E3T A;  3TSH A;  3HRD C;  2UUV A;  2VFV A;  1T3Q C;  3W8Z A;  1WYG A;  1N5W C;  3B9J B;  1SB3 B;  5AWV A;  2VFT A;  1RM6 B;  2I0K A;  4O95 A;  5FXD A;  4BCA A;  2P3H A;  1FFV C;  2QKN A;  3VTE A;  5FXP A;  1JRP A;  1DII A;  1JRO A;  1HSK A;  2BVG A;  2Y4G A;  5FXF A;  3NS1 B;  2PLI A;  5G5G B;  2AXR A;  3EUB 3;  1W1L A;  1W1S A;  2P13 A;  4PVE A;  4PWC A;  5HQX A;  5D79 A;  5I1W A;  4JB1 A;  2GQU A;  3RJA A;  3PQB A;  3HSU A;  4PYT A;  4ZOH B;  3S1F A;  1DZN A;  1N62 C;  2UUU A;  1WVE A;  2Y08 A;  1DIQ A;  3W8W A;  3JS8 A;  4OAL A;  1FFU C;  3PM9 A;  1AHZ A;  3S1C A;  4BBY A;  3NVW B;  2YVS A;  5HMR A;  3DED A;  1QLT A;  3DQ0 A;  2GQT A;  1UXY A;  1W1R A;  3NVY B;  3FW7 A;  3KJM A;  2W54 A;  3RJ8 A;  2Q85 A;  2P4P A;  4XLO A;  5ADZ A;  5L6G A;  1VDV A;  1MBB A;  3AN1 A;  2R2Z A;  1AHV A;  3LAE A;  2Q4W A;  2W3R A;  3AMZ A;  4PVH A;  3NVZ B;  1E8H A;  2PLS A;  1N5X A;  3GSY A;  1W1Q A;  3ETR B;  4BC7 A;  3FW8 A;  3NRZ B;  4ML8 A;  3C0P A;  2O3G A;  2QPM A;  1W1O A;  1MBT A;  1VAO A;  2IPI A;  4PWB A;  2WDW A;  1V97 A;  1W1M A;  2W3S A;  5FXE A;  3D2H A;  3AM9 A;  2RK5 A;  1F0X A;  5AE3 A;  3I99 A;  3NVV B;  3TX1 A;  3D2D A;  1W1J A;  1FIQ B;  3W8X A;  5K8E A;  3S1E A;  1QLU A;  4JAY A;  3LLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...