5HHZA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with 6-(3-methylpyrrol-1-yl)-9h-purine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
492
structure length
457
Chain Sequence
GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAAEGLSLKHHSSVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytokinin dehydrogenase 4
publication title Cytokinin metabolism in maize: Novel evidence of cytokinin abundance, interconversions and formation of a new trans-zeatin metabolic product with a weak anticytokinin activity.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 147
structure length 457
sequence length 492
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hhzA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hhzA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hhzA03
4BCAA 1W1KA 4PVHA 1E0YA 1N62C 3EUB3 4PWBA 1ZR6A 4ZOHB 3TSHA 2O3GA 4UD8A 1W1JA 5FXDA 2MBRA 3S1CA 1ZXIC 5G5GB 3SR6B 3ETRB 1N61C 1W1OA 1N5XA 4PVEA 1RM6B 3FW7A 3AN1A 3W8WA 1FO4A 4DNSA 1DIIA 3PM9A 2P3HA 3NVYB 1VAOA 3TSJA 1FFVC 5FXEA 3DQ0A 2Q85A 2GQUA 3S1EA 1F0XA 5AE1A 4BC9A 1WVEA 1W1QA 3FWAA 1SB3B 1DIQA 4PYTA 4PVJA 1JROA 4JB1A 3AMZA 3FW9A 2BVFA 2P4PA 4BC7A 1VDVA 3VTEA 2E3TA 1DZNA 2P13A 2PLSA 2NQWA 2PLIA 2YVSA 1MBTA 3FW8A 2W55A 3LLBA 1E8FA 5ADZA 3KJMA 2RK5A 1UXYA 1FFUC 1N60C 3AM9A 3W8XA 3NVZB 1HSKA 1I19A 2Q4WA 1QLTA 2QPMA 2VFVA 2VFTA 2W3SA 3DEDA 2W54A 3NVWB 5FXFA 1T3QC 1W1SA 2W3RA 4EC3A 3HRDC 1FIQB 2R8DA 2OAIA 3LAEA 2GQTA 5HQXA 2R2ZA 5HHZA 3I99A 2AXRA 3S1DA 2VFRA 5G5HB 4PWCA 1AHZA 2VAOA 1JRPA 3B9JB 2EXRA 5D79A 1WVFA 3JS8A 3D2DA 1E8GA 2VFUA 5AE2A 2QKNA 1W1LA 4BBYA 3D2HA 3NS1B 3GSYA 1W1MA 4O95A 4ML8A 5HMRA 1AHUA 1WYGA 3BW7A 1MBBA 4HG0A 3D2JA 4PVKA 3NVVB 2VFSA 3NRZB 4PZFA 4XLOA 4JAYA 1QLUA 4MLAA 5AE3A 3S1FA 1N63C 1E8HA 1W1RA 2I0KA 3C0PA 3W8ZA 3TX1A 2BVHA 2BVGA 1V97A 5FXPA 1N5WC 4OALA 1AHVA
chains in the Genus database with same CATH superfamily
4BCAA 1W1KA 4PVHA 5K8EA 1E0YA 1N62C 3EUB3 4PWBA 1ZR6A 4ZOHB 3TSHA 2O3GA 4UD8A 1W1JA 5FXDA 2MBRA 3S1CA 1ZXIC 5G5GB 2Y3RA 3SR6B 3ETRB 1N61C 1W1OA 2UUUA 1N5XA 4PVEA 1RM6B 3FW7A 3AN1A 3W8WA 1FO4A 4DNSA 1DIIA 2Y3SA 3PM9A 5I1WA 2P3HA 3NVYB 1VAOA 3TSJA 1FFVC 5FXEA 3DQ0A 3POPA 2Q85A 2GQUA 3S1EA 1F0XA 3EJBB 5AE1A 4BC9A 1WVEA 1W1QA 3FWAA 1SB3B 1DIQA 4PYTA 4PVJA 1JROA 4JB1A 3AMZA 3FW9A 2BVFA 2P4PA 4BC7A 1VDVA 3VTEA 2E3TA 1DZNA 2P13A 2PLSA 2NQWA 2PLIA 2YVSA 1MBTA 3FW8A 2W55A 3LLBA 1E8FA 5ADZA 3KJMA 2RK5A 1UXYA 1FFUC 1N60C 3AM9A 3EJDB 3W8XA 3NVZB 1HSKA 1I19A 2Q4WA 1QLTA 2QPMA 2VFVA 2VFTA 3EJEB 2Y4GA 2W3SA 3DEDA 2W54A 3NVWB 5FXFA 1T3QC 1W1SA 2W3RA 4EC3A 2UUVA 3HRDC 1FIQB 2R8DA 2OAIA 3LAEA 2GQTA 5HQXA 3HSUA 2R2ZA 5HHZA 3I99A 2AXRA 3S1DA 2VFRA 3RJ8A 5G5HB 4PWCA 1AHZA 2VAOA 1JRPA 3B9JB 2EXRA 5D79A 1WVFA 3JS8A 3D2DA 1E8GA 2VFUA 5AE2A 3PQBA 2QKNA 1W1LA 4BBYA 3D2HA 3NS1B 3GSYA 5I1VA 1W1MA 4O95A 5L6GA 4ML8A 2Y08A 5HMRA 1AHUA 1WYGA 3BW7A 1MBBA 4HG0A 3D2JA 4PVKA 3NVVB 2VFSA 3NRZB 4PZFA 4XLOA 4JAYA 1QLUA 4MLAA 5AE3A 5AWVA 3S1FA 1N63C 1E8HA 2WDWA 1W1RA 2I0KA 2IPIA 3C0PA 3W8ZA 3TX1A 2BVHA 2BVGA 1V97A 5FXPA 1N5WC 5L6FA 3RJAA 4OALA 1AHVA
chains in the Genus database with same CATH topology
4BCAA 1W1KA 4PVHA 5K8EA 1E0YA 1N62C 3EUB3 4PWBA 1ZR6A 4ZOHB 3TSHA 2O3GA 4UD8A 1W1JA 5FXDA 2MBRA 3S1CA 1ZXIC 5G5GB 2Y3RA 3SR6B 3ETRB 1N61C 1W1OA 2UUUA 1N5XA 4PVEA 1RM6B 3FW7A 3AN1A 3W8WA 1FO4A 4DNSA 1DIIA 2Y3SA 3PM9A 5I1WA 2P3HA 3NVYB 1VAOA 3TSJA 1FFVC 5FXEA 3DQ0A 3POPA 2Q85A 2GQUA 3S1EA 1F0XA 5AE1A 4BC9A 1WVEA 1W1QA 3FWAA 1SB3B 1DIQA 4PYTA 4PVJA 1JROA 4JB1A 3AMZA 3FW9A 2BVFA 2P4PA 4BC7A 1VDVA 3VTEA 2E3TA 1DZNA 2P13A 2PLSA 2NQWA 2PLIA 2YVSA 1MBTA 3FW8A 2W55A 3LLBA 1E8FA 5ADZA 3KJMA 2RK5A 1UXYA 1FFUC 1N60C 3AM9A 3W8XA 3NVZB 1HSKA 1I19A 2Q4WA 1QLTA 2QPMA 2VFVA 2VFTA 2Y4GA 2W3SA 3DEDA 2W54A 3NVWB 5FXFA 1T3QC 1W1SA 2W3RA 4EC3A 2UUVA 3HRDC 1FIQB 2R8DA 2OAIA 3LAEA 2GQTA 5HQXA 3HSUA 2R2ZA 5HHZA 3I99A 2AXRA 3S1DA 2VFRA 3RJ8A 5G5HB 4PWCA 1AHZA 2VAOA 1JRPA 3B9JB 2EXRA 5D79A 1WVFA 3JS8A 3D2DA 1E8GA 2VFUA 5AE2A 3PQBA 2QKNA 1W1LA 4BBYA 3D2HA 3NS1B 3GSYA 5I1VA 1W1MA 4O95A 5L6GA 4ML8A 2Y08A 5HMRA 1AHUA 1WYGA 3BW7A 1MBBA 4HG0A 3D2JA 4PVKA 3NVVB 2VFSA 3NRZB 4PZFA 4XLOA 4JAYA 1QLUA 4MLAA 5AE3A 5AWVA 3S1FA 1N63C 1E8HA 2WDWA 1W1RA 2I0KA 2IPIA 3C0PA 3W8ZA 3TX1A 2BVHA 2BVGA 1V97A 5FXPA 1N5WC 5L6FA 3RJAA 4OALA 1AHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCA A;  1W1K A;  4PVH A;  1E0Y A;  1N62 C;  3EUB 3;  4PWB A;  1ZR6 A;  4ZOH B;  3TSH A;  2O3G A;  4UD8 A;  1W1J A;  5FXD A;  2MBR A;  3S1C A;  1ZXI C;  5G5G B;  3SR6 B;  3ETR B;  1N61 C;  1W1O A;  1N5X A;  4PVE A;  1RM6 B;  3FW7 A;  3AN1 A;  3W8W A;  1FO4 A;  4DNS A;  1DII A;  3PM9 A;  2P3H A;  3NVY B;  1VAO A;  3TSJ A;  1FFV C;  5FXE A;  3DQ0 A;  2Q85 A;  2GQU A;  3S1E A;  1F0X A;  5AE1 A;  4BC9 A;  1WVE A;  1W1Q A;  3FWA A;  1SB3 B;  1DIQ A;  4PYT A;  4PVJ A;  1JRO A;  4JB1 A;  3AMZ A;  3FW9 A;  2BVF A;  2P4P A;  4BC7 A;  1VDV A;  3VTE A;  2E3T A;  1DZN A;  2P13 A;  2PLS A;  2NQW A;  2PLI A;  2YVS A;  1MBT A;  3FW8 A;  2W55 A;  3LLB A;  1E8F A;  5ADZ A;  3KJM A;  2RK5 A;  1UXY A;  1FFU C;  1N60 C;  3AM9 A;  3W8X A;  3NVZ B;  1HSK A;  1I19 A;  2Q4W A;  1QLT A;  2QPM A;  2VFV A;  2VFT A;  2W3S A;  3DED A;  2W54 A;  3NVW B;  5FXF A;  1T3Q C;  1W1S A;  2W3R A;  4EC3 A;  3HRD C;  1FIQ B;  2R8D A;  2OAI A;  3LAE A;  2GQT A;  5HQX A;  2R2Z A;  5HHZ A;  3I99 A;  2AXR A;  3S1D A;  2VFR A;  5G5H B;  4PWC A;  1AHZ A;  2VAO A;  1JRP A;  3B9J B;  2EXR A;  5D79 A;  1WVF A;  3JS8 A;  3D2D A;  1E8G A;  2VFU A;  5AE2 A;  2QKN A;  1W1L A;  4BBY A;  3D2H A;  3NS1 B;  3GSY A;  1W1M A;  4O95 A;  4ML8 A;  5HMR A;  1AHU A;  1WYG A;  3BW7 A;  1MBB A;  4HG0 A;  3D2J A;  4PVK A;  3NVV B;  2VFS A;  3NRZ B;  4PZF A;  4XLO A;  4JAY A;  1QLU A;  4MLA A;  5AE3 A;  3S1F A;  1N63 C;  1E8H A;  1W1R A;  2I0K A;  3C0P A;  3W8Z A;  3TX1 A;  2BVH A;  2BVG A;  1V97 A;  5FXP A;  1N5W C;  4OAL A;  1AHV A; 
#chains in the Genus database with same CATH topology
 4BCA A;  1W1K A;  4PVH A;  5K8E A;  1E0Y A;  1N62 C;  3EUB 3;  4PWB A;  1ZR6 A;  4ZOH B;  3TSH A;  2O3G A;  4UD8 A;  1W1J A;  5FXD A;  2MBR A;  3S1C A;  1ZXI C;  5G5G B;  2Y3R A;  3SR6 B;  3ETR B;  1N61 C;  1W1O A;  2UUU A;  1N5X A;  4PVE A;  1RM6 B;  3FW7 A;  3AN1 A;  3W8W A;  1FO4 A;  4DNS A;  1DII A;  2Y3S A;  3PM9 A;  5I1W A;  2P3H A;  3NVY B;  1VAO A;  3TSJ A;  1FFV C;  5FXE A;  3DQ0 A;  3POP A;  2Q85 A;  2GQU A;  3S1E A;  1F0X A;  3EJB B;  5AE1 A;  4BC9 A;  1WVE A;  1W1Q A;  3FWA A;  1SB3 B;  1DIQ A;  4PYT A;  4PVJ A;  1JRO A;  4JB1 A;  3AMZ A;  3FW9 A;  2BVF A;  2P4P A;  4BC7 A;  1VDV A;  3VTE A;  2E3T A;  1DZN A;  2P13 A;  2PLS A;  2NQW A;  2PLI A;  2YVS A;  1MBT A;  3FW8 A;  2W55 A;  3LLB A;  1E8F A;  5ADZ A;  3KJM A;  2RK5 A;  1UXY A;  1FFU C;  1N60 C;  3AM9 A;  3EJD B;  3W8X A;  3NVZ B;  1HSK A;  1I19 A;  2Q4W A;  1QLT A;  2QPM A;  2VFV A;  2VFT A;  3EJE B;  2Y4G A;  2W3S A;  3DED A;  2W54 A;  3NVW B;  5FXF A;  1T3Q C;  1W1S A;  2W3R A;  4EC3 A;  2UUV A;  3HRD C;  1FIQ B;  2R8D A;  2OAI A;  3LAE A;  2GQT A;  5HQX A;  3HSU A;  2R2Z A;  5HHZ A;  3I99 A;  2AXR A;  3S1D A;  2VFR A;  3RJ8 A;  5G5H B;  4PWC A;  1AHZ A;  2VAO A;  1JRP A;  3B9J B;  2EXR A;  5D79 A;  1WVF A;  3JS8 A;  3D2D A;  1E8G A;  2VFU A;  5AE2 A;  3PQB A;  2QKN A;  1W1L A;  4BBY A;  3D2H A;  3NS1 B;  3GSY A;  5I1V A;  1W1M A;  4O95 A;  5L6G A;  4ML8 A;  2Y08 A;  5HMR A;  1AHU A;  1WYG A;  3BW7 A;  1MBB A;  4HG0 A;  3D2J A;  4PVK A;  3NVV B;  2VFS A;  3NRZ B;  4PZF A;  4XLO A;  4JAY A;  1QLU A;  4MLA A;  5AE3 A;  5AWV A;  3S1F A;  1N63 C;  1E8H A;  2WDW A;  1W1R A;  2I0K A;  2IPI A;  3C0P A;  3W8Z A;  3TX1 A;  2BVH A;  2BVG A;  1V97 A;  5FXP A;  1N5W C;  5L6F A;  3RJA A;  4OAL A;  1AHV A; 
#chains in the Genus database with same CATH homology
 4BCA A;  1W1K A;  4PVH A;  5K8E A;  1E0Y A;  1N62 C;  3EUB 3;  4PWB A;  1ZR6 A;  4ZOH B;  3TSH A;  2O3G A;  4UD8 A;  1W1J A;  5FXD A;  2MBR A;  3S1C A;  1ZXI C;  5G5G B;  2Y3R A;  3SR6 B;  3ETR B;  1N61 C;  1W1O A;  2UUU A;  1N5X A;  4PVE A;  1RM6 B;  3FW7 A;  3AN1 A;  3W8W A;  1FO4 A;  4DNS A;  1DII A;  2Y3S A;  3PM9 A;  5I1W A;  2P3H A;  3NVY B;  1VAO A;  3TSJ A;  1FFV C;  5FXE A;  3DQ0 A;  3POP A;  2Q85 A;  2GQU A;  3S1E A;  1F0X A;  5AE1 A;  4BC9 A;  1WVE A;  1W1Q A;  3FWA A;  1SB3 B;  1DIQ A;  4PYT A;  4PVJ A;  1JRO A;  4JB1 A;  3AMZ A;  3FW9 A;  2BVF A;  2P4P A;  4BC7 A;  1VDV A;  3VTE A;  2E3T A;  1DZN A;  2P13 A;  2PLS A;  2NQW A;  2PLI A;  2YVS A;  1MBT A;  3FW8 A;  2W55 A;  3LLB A;  1E8F A;  5ADZ A;  3KJM A;  2RK5 A;  1UXY A;  1FFU C;  1N60 C;  3AM9 A;  3W8X A;  3NVZ B;  1HSK A;  1I19 A;  2Q4W A;  1QLT A;  2QPM A;  2VFV A;  2VFT A;  2Y4G A;  2W3S A;  3DED A;  2W54 A;  3NVW B;  5FXF A;  1T3Q C;  1W1S A;  2W3R A;  4EC3 A;  2UUV A;  3HRD C;  1FIQ B;  2R8D A;  2OAI A;  3LAE A;  2GQT A;  5HQX A;  3HSU A;  2R2Z A;  5HHZ A;  3I99 A;  2AXR A;  3S1D A;  2VFR A;  3RJ8 A;  5G5H B;  4PWC A;  1AHZ A;  2VAO A;  1JRP A;  3B9J B;  2EXR A;  5D79 A;  1WVF A;  3JS8 A;  3D2D A;  1E8G A;  2VFU A;  5AE2 A;  3PQB A;  2QKN A;  1W1L A;  4BBY A;  3D2H A;  3NS1 B;  3GSY A;  5I1V A;  1W1M A;  4O95 A;  5L6G A;  4ML8 A;  2Y08 A;  5HMR A;  1AHU A;  1WYG A;  3BW7 A;  1MBB A;  4HG0 A;  3D2J A;  4PVK A;  3NVV B;  2VFS A;  3NRZ B;  4PZF A;  4XLO A;  4JAY A;  1QLU A;  4MLA A;  5AE3 A;  5AWV A;  3S1F A;  1N63 C;  1E8H A;  2WDW A;  1W1R A;  2I0K A;  2IPI A;  3C0P A;  3W8Z A;  3TX1 A;  2BVH A;  2BVG A;  1V97 A;  5FXP A;  1N5W C;  5L6F A;  3RJA A;  4OAL A;  1AHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...