5HHZA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with 6-(3-methylpyrrol-1-yl)-9h-purine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
492
structure length
457
Chain Sequence
GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAAEGLSLKHHSSVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cytokinin metabolism in maize: Novel evidence of cytokinin abundance, interconversions and formation of a new trans-zeatin metabolic product with a weak anticytokinin activity.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
molecule keywords Cytokinin dehydrogenase 4
total genus 147
structure length 457
sequence length 492
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hhzA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hhzA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hhzA03
1N61C 2Q85A 4O95A 3EUB3 2GQUA 1HSKA 1QLTA 3C0PA 1AHZA 1AHVA 2BVFA 2VFUA 1DIQA 4OALA 3S1CA 1N62C 5FXEA 4ML8A 4XLOA 4PYTA 3S1FA 3TX1A 3S1EA 4BC7A 3HRDC 4HG0A 4PWBA 1DIIA 2O3GA 1QLUA 4BBYA 2W55A 5HQXA 5FXPA 2P4PA 1WYGA 1ZR6A 2MBRA 4BCAA 2OAIA 1W1OA 1FO4A 4UD8A 2NQWA 1N63C 2VAOA 3NRZB 3LAEA 4BC9A 3FWAA 1W1SA 1V97A 2QPMA 2VFSA 3BW7A 3TSHA 3NVWB 4PVHA 2BVHA 4PVEA 2VFRA 1T3QC 1W1QA 3FW9A 3I99A 1E8GA 2RK5A 1N5XA 1JROA 2PLSA 1E0YA 1I19A 3B9JB 3PM9A 4PZFA 1AHUA 1N60C 1UXYA 4JB1A 2E3TA 4ZOHB 5AE3A 5AE2A 3FW8A 2P3HA 3GSYA 5HMRA 3TSJA 5D79A 5G5HB 3W8XA 3D2DA 1W1RA 1N5WC 1E8HA 3DEDA 3AN1A 2W54A 2EXRA 2I0KA 5G5GB 2R8DA 5HHZA 1ZXIC 3W8WA 3DQ0A 4PVJA 1F0XA 1E8FA 2W3SA 1MBTA 3SR6B 1RM6B 1VAOA 3ETRB 5FXDA 2VFTA 3D2JA 1WVEA 1W1JA 2R2ZA 3NVYB 2BVGA 2GQTA 4EC3A 1FFUC 3AM9A 4JAYA 2YVSA 2W3RA 2Q4WA 1MBBA 3JS8A 3NS1B 4DNSA 1VDVA 3FW7A 3NVZB 1DZNA 1W1KA 2P13A 1JRPA 4PWCA 3LLBA 2AXRA 5FXFA 4PVKA 1W1MA 3NVVB 1SB3B 2VFVA 3S1DA 3W8ZA 5AE1A 1WVFA 1W1LA 1FIQB 2QKNA 3AMZA 2PLIA 3D2HA 5ADZA 3KJMA 4MLAA 1FFVC 3VTEA
chains in the Genus database with same CATH superfamily
5I1VA 1N61C 2Q85A 4O95A 3EUB3 2GQUA 1HSKA 1QLTA 3C0PA 1AHZA 1AHVA 2BVFA 2VFUA 1DIQA 4OALA 3S1CA 3POPA 1N62C 5FXEA 4ML8A 4XLOA 4PYTA 3S1FA 3TX1A 5L6GA 3S1EA 4BC7A 3HRDC 4HG0A 4PWBA 1DIIA 2O3GA 1QLUA 4BBYA 2W55A 5HQXA 5FXPA 2P4PA 3RJ8A 1WYGA 1ZR6A 2MBRA 4BCAA 2OAIA 1W1OA 1FO4A 4UD8A 2NQWA 1N63C 2VAOA 3NRZB 3LAEA 2Y08A 4BC9A 3FWAA 1W1SA 1V97A 2QPMA 2VFSA 3BW7A 3NVWB 3TSHA 2UUVA 4PVHA 2BVHA 4PVEA 2VFRA 1T3QC 1W1QA 3FW9A 3I99A 1E8GA 2RK5A 1N5XA 1JROA 2Y4GA 2PLSA 1E0YA 1I19A 3B9JB 3PM9A 4PZFA 1AHUA 1N60C 3EJDB 1UXYA 4JB1A 2E3TA 4ZOHB 5AE3A 5AE2A 3FW8A 2P3HA 3GSYA 5HMRA 3TSJA 5D79A 5G5HB 3W8XA 3D2DA 1W1RA 2IPIA 1N5WC 1E8HA 2UUUA 3DEDA 3AN1A 2W54A 2EXRA 2I0KA 5G5GB 2R8DA 5HHZA 1ZXIC 3W8WA 3DQ0A 3EJBB 4PVJA 5I1WA 1F0XA 1E8FA 2W3SA 1MBTA 3SR6B 5AWVA 5L6FA 1RM6B 1VAOA 3ETRB 5FXDA 3PQBA 2Y3RA 2VFTA 3D2JA 1WVEA 1W1JA 2Y3SA 2R2ZA 3NVYB 2BVGA 2GQTA 4EC3A 1FFUC 2WDWA 3AM9A 4JAYA 2YVSA 2W3RA 2Q4WA 1MBBA 3JS8A 3EJEB 3NS1B 4DNSA 1VDVA 3FW7A 3NVZB 1DZNA 1W1KA 2P13A 1JRPA 4PWCA 5K8EA 3LLBA 3RJAA 2AXRA 5FXFA 4PVKA 1W1MA 3NVVB 1SB3B 2VFVA 3HSUA 3S1DA 3W8ZA 5AE1A 1WVFA 1W1LA 1FIQB 2QKNA 3AMZA 2PLIA 3D2HA 5ADZA 3KJMA 4MLAA 1FFVC 3VTEA
chains in the Genus database with same CATH topology
5I1VA 1N61C 2Q85A 4O95A 3EUB3 2GQUA 1HSKA 1QLTA 3C0PA 1AHZA 1AHVA 2BVFA 2VFUA 1DIQA 4OALA 3S1CA 3POPA 1N62C 5FXEA 4ML8A 4XLOA 4PYTA 3S1FA 3TX1A 5L6GA 3S1EA 4BC7A 3HRDC 4HG0A 4PWBA 1DIIA 2O3GA 1QLUA 4BBYA 2W55A 5HQXA 5FXPA 2P4PA 3RJ8A 1WYGA 1ZR6A 2MBRA 4BCAA 2OAIA 1W1OA 1FO4A 4UD8A 2NQWA 1N63C 2VAOA 3NRZB 3LAEA 2Y08A 4BC9A 3FWAA 1W1SA 1V97A 2QPMA 2VFSA 3BW7A 3TSHA 2UUVA 3NVWB 4PVHA 2BVHA 4PVEA 2VFRA 1T3QC 1W1QA 3FW9A 3I99A 1E8GA 2RK5A 1N5XA 1JROA 2Y4GA 2PLSA 1E0YA 1I19A 3B9JB 3PM9A 4PZFA 1AHUA 1N60C 1UXYA 4JB1A 2E3TA 4ZOHB 5AE3A 5AE2A 3FW8A 2P3HA 3GSYA 5HMRA 3TSJA 5D79A 5G5HB 3W8XA 3D2DA 1W1RA 2IPIA 1N5WC 1E8HA 2UUUA 3DEDA 3AN1A 2W54A 2EXRA 2I0KA 5G5GB 2R8DA 5HHZA 1ZXIC 3W8WA 3DQ0A 4PVJA 5I1WA 1F0XA 1E8FA 2W3SA 1MBTA 3SR6B 5AWVA 5L6FA 1RM6B 1VAOA 3ETRB 5FXDA 3PQBA 2Y3RA 2VFTA 3D2JA 1WVEA 1W1JA 2Y3SA 2R2ZA 3NVYB 2BVGA 2GQTA 4EC3A 1FFUC 2WDWA 3AM9A 4JAYA 2YVSA 2W3RA 2Q4WA 1MBBA 3JS8A 3NS1B 4DNSA 1VDVA 3FW7A 3NVZB 1DZNA 1W1KA 2P13A 1JRPA 4PWCA 5K8EA 3LLBA 3RJAA 2AXRA 5FXFA 4PVKA 1W1MA 3NVVB 1SB3B 2VFVA 3HSUA 3S1DA 3W8ZA 5AE1A 1WVFA 1W1LA 1FIQB 2QKNA 3AMZA 2PLIA 3D2HA 5ADZA 3KJMA 4MLAA 1FFVC 3VTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N61 C;  2Q85 A;  4O95 A;  3EUB 3;  2GQU A;  1HSK A;  1QLT A;  3C0P A;  1AHZ A;  1AHV A;  2BVF A;  2VFU A;  1DIQ A;  4OAL A;  3S1C A;  1N62 C;  5FXE A;  4ML8 A;  4XLO A;  4PYT A;  3S1F A;  3TX1 A;  3S1E A;  4BC7 A;  3HRD C;  4HG0 A;  4PWB A;  1DII A;  2O3G A;  1QLU A;  4BBY A;  2W55 A;  5HQX A;  5FXP A;  2P4P A;  1WYG A;  1ZR6 A;  2MBR A;  4BCA A;  2OAI A;  1W1O A;  1FO4 A;  4UD8 A;  2NQW A;  1N63 C;  2VAO A;  3NRZ B;  3LAE A;  4BC9 A;  3FWA A;  1W1S A;  1V97 A;  2QPM A;  2VFS A;  3BW7 A;  3TSH A;  3NVW B;  4PVH A;  2BVH A;  4PVE A;  2VFR A;  1T3Q C;  1W1Q A;  3FW9 A;  3I99 A;  1E8G A;  2RK5 A;  1N5X A;  1JRO A;  2PLS A;  1E0Y A;  1I19 A;  3B9J B;  3PM9 A;  4PZF A;  1AHU A;  1N60 C;  1UXY A;  4JB1 A;  2E3T A;  4ZOH B;  5AE3 A;  5AE2 A;  3FW8 A;  2P3H A;  3GSY A;  5HMR A;  3TSJ A;  5D79 A;  5G5H B;  3W8X A;  3D2D A;  1W1R A;  1N5W C;  1E8H A;  3DED A;  3AN1 A;  2W54 A;  2EXR A;  2I0K A;  5G5G B;  2R8D A;  5HHZ A;  1ZXI C;  3W8W A;  3DQ0 A;  4PVJ A;  1F0X A;  1E8F A;  2W3S A;  1MBT A;  3SR6 B;  1RM6 B;  1VAO A;  3ETR B;  5FXD A;  2VFT A;  3D2J A;  1WVE A;  1W1J A;  2R2Z A;  3NVY B;  2BVG A;  2GQT A;  4EC3 A;  1FFU C;  3AM9 A;  4JAY A;  2YVS A;  2W3R A;  2Q4W A;  1MBB A;  3JS8 A;  3NS1 B;  4DNS A;  1VDV A;  3FW7 A;  3NVZ B;  1DZN A;  1W1K A;  2P13 A;  1JRP A;  4PWC A;  3LLB A;  2AXR A;  5FXF A;  4PVK A;  1W1M A;  3NVV B;  1SB3 B;  2VFV A;  3S1D A;  3W8Z A;  5AE1 A;  1WVF A;  1W1L A;  1FIQ B;  2QKN A;  3AMZ A;  2PLI A;  3D2H A;  5ADZ A;  3KJM A;  4MLA A;  1FFV C;  3VTE A; 
#chains in the Genus database with same CATH topology
 5I1V A;  1N61 C;  2Q85 A;  4O95 A;  3EUB 3;  2GQU A;  1HSK A;  1QLT A;  3C0P A;  1AHZ A;  1AHV A;  2BVF A;  2VFU A;  1DIQ A;  4OAL A;  3S1C A;  3POP A;  1N62 C;  5FXE A;  4ML8 A;  4XLO A;  4PYT A;  3S1F A;  3TX1 A;  5L6G A;  3S1E A;  4BC7 A;  3HRD C;  4HG0 A;  4PWB A;  1DII A;  2O3G A;  1QLU A;  4BBY A;  2W55 A;  5HQX A;  5FXP A;  2P4P A;  3RJ8 A;  1WYG A;  1ZR6 A;  2MBR A;  4BCA A;  2OAI A;  1W1O A;  1FO4 A;  4UD8 A;  2NQW A;  1N63 C;  2VAO A;  3NRZ B;  3LAE A;  2Y08 A;  4BC9 A;  3FWA A;  1W1S A;  1V97 A;  2QPM A;  2VFS A;  3BW7 A;  3NVW B;  3TSH A;  2UUV A;  4PVH A;  2BVH A;  4PVE A;  2VFR A;  1T3Q C;  1W1Q A;  3FW9 A;  3I99 A;  1E8G A;  2RK5 A;  1N5X A;  1JRO A;  2Y4G A;  2PLS A;  1E0Y A;  1I19 A;  3B9J B;  3PM9 A;  4PZF A;  1AHU A;  1N60 C;  3EJD B;  1UXY A;  4JB1 A;  2E3T A;  4ZOH B;  5AE3 A;  5AE2 A;  3FW8 A;  2P3H A;  3GSY A;  5HMR A;  3TSJ A;  5D79 A;  5G5H B;  3W8X A;  3D2D A;  1W1R A;  2IPI A;  1N5W C;  1E8H A;  2UUU A;  3DED A;  3AN1 A;  2W54 A;  2EXR A;  2I0K A;  5G5G B;  2R8D A;  5HHZ A;  1ZXI C;  3W8W A;  3DQ0 A;  3EJB B;  4PVJ A;  5I1W A;  1F0X A;  1E8F A;  2W3S A;  1MBT A;  3SR6 B;  5AWV A;  5L6F A;  1RM6 B;  1VAO A;  3ETR B;  5FXD A;  3PQB A;  2Y3R A;  2VFT A;  3D2J A;  1WVE A;  1W1J A;  2Y3S A;  2R2Z A;  3NVY B;  2BVG A;  2GQT A;  4EC3 A;  1FFU C;  2WDW A;  3AM9 A;  4JAY A;  2YVS A;  2W3R A;  2Q4W A;  1MBB A;  3JS8 A;  3EJE B;  3NS1 B;  4DNS A;  1VDV A;  3FW7 A;  3NVZ B;  1DZN A;  1W1K A;  2P13 A;  1JRP A;  4PWC A;  5K8E A;  3LLB A;  3RJA A;  2AXR A;  5FXF A;  4PVK A;  1W1M A;  3NVV B;  1SB3 B;  2VFV A;  3HSU A;  3S1D A;  3W8Z A;  5AE1 A;  1WVF A;  1W1L A;  1FIQ B;  2QKN A;  3AMZ A;  2PLI A;  3D2H A;  5ADZ A;  3KJM A;  4MLA A;  1FFV C;  3VTE A; 
#chains in the Genus database with same CATH homology
 5I1V A;  1N61 C;  2Q85 A;  4O95 A;  3EUB 3;  2GQU A;  1HSK A;  1QLT A;  3C0P A;  1AHZ A;  1AHV A;  2BVF A;  2VFU A;  1DIQ A;  4OAL A;  3S1C A;  3POP A;  1N62 C;  5FXE A;  4ML8 A;  4XLO A;  4PYT A;  3S1F A;  3TX1 A;  5L6G A;  3S1E A;  4BC7 A;  3HRD C;  4HG0 A;  4PWB A;  1DII A;  2O3G A;  1QLU A;  4BBY A;  2W55 A;  5HQX A;  5FXP A;  2P4P A;  3RJ8 A;  1WYG A;  1ZR6 A;  2MBR A;  4BCA A;  2OAI A;  1W1O A;  1FO4 A;  4UD8 A;  2NQW A;  1N63 C;  2VAO A;  3NRZ B;  3LAE A;  2Y08 A;  4BC9 A;  3FWA A;  1W1S A;  1V97 A;  2QPM A;  2VFS A;  3BW7 A;  3TSH A;  2UUV A;  3NVW B;  4PVH A;  2BVH A;  4PVE A;  2VFR A;  1T3Q C;  1W1Q A;  3FW9 A;  3I99 A;  1E8G A;  2RK5 A;  1N5X A;  1JRO A;  2Y4G A;  2PLS A;  1E0Y A;  1I19 A;  3B9J B;  3PM9 A;  4PZF A;  1AHU A;  1N60 C;  1UXY A;  4JB1 A;  2E3T A;  4ZOH B;  5AE3 A;  5AE2 A;  3FW8 A;  2P3H A;  3GSY A;  5HMR A;  3TSJ A;  5D79 A;  5G5H B;  3W8X A;  3D2D A;  1W1R A;  2IPI A;  1N5W C;  1E8H A;  2UUU A;  3DED A;  3AN1 A;  2W54 A;  2EXR A;  2I0K A;  5G5G B;  2R8D A;  5HHZ A;  1ZXI C;  3W8W A;  3DQ0 A;  4PVJ A;  5I1W A;  1F0X A;  1E8F A;  2W3S A;  1MBT A;  3SR6 B;  5AWV A;  5L6F A;  1RM6 B;  1VAO A;  3ETR B;  5FXD A;  3PQB A;  2Y3R A;  2VFT A;  3D2J A;  1WVE A;  1W1J A;  2Y3S A;  2R2Z A;  3NVY B;  2BVG A;  2GQT A;  4EC3 A;  1FFU C;  2WDW A;  3AM9 A;  4JAY A;  2YVS A;  2W3R A;  2Q4W A;  1MBB A;  3JS8 A;  3NS1 B;  4DNS A;  1VDV A;  3FW7 A;  3NVZ B;  1DZN A;  1W1K A;  2P13 A;  1JRP A;  4PWC A;  5K8E A;  3LLB A;  3RJA A;  2AXR A;  5FXF A;  4PVK A;  1W1M A;  3NVV B;  1SB3 B;  2VFV A;  3HSU A;  3S1D A;  3W8Z A;  5AE1 A;  1WVF A;  1W1L A;  1FIQ B;  2QKN A;  3AMZ A;  2PLI A;  3D2H A;  5ADZ A;  3KJM A;  4MLA A;  1FFV C;  3VTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...