5HI4C

Binding site elucidation and structure guided design of macrocyclic il-17a antagonists
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
b'EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLIHGVTRNWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-17A
publication title Binding site elucidation and structure guided design of macrocyclic IL-17A antagonists.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/inhibitor
total genus 48
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hi4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hi4C01
2O5XH 1OTTC 2FSEA 1A1OA 5FGBC 1C8PA 3BJLA 5F93C 1KTKE 3QXDB 1NMCC 1KELL 1S7VB 1RK0B 3OV6A 4UDTA 2O93L 1EJOL 5I1KH 3BKJH 1BZ9A 4UV7H 1H15A 1XGYH 4NHCH 5IQ9A 1I7UB 2Q76B 1P4LA 5I66B 3IJYA 3SGJC 3GMPB 3VGHA 5KN5B 3B9DA 1Q0XH 4NUGL 1D5XA 5D71L 1K4CB 1RU9L 3VFMB 5ADOL 1MLCB 3D0LB 2J88H 5I19H 2VWEE 1FAIH 4MSWB 3W39A 4NCC1 4N0CD 3TZVA 3V4VL 3LY6A 3P2TA 2EIEA 1S9YA 4YE4L 5FO9A 5DEGA 1X5YA 3QEGH 5DRNB 2YPKB 4R97B 1YEDB 1J18A 2NY1D 4JHAL 1E28B 1EBAA 3O2WH 3WFDH 3UYOD 1G6RA 3MFFA 5ESQA 3JVGA 3JUZA 3AS2A 1XF4B 2JIXA 3OXSB 4JN2A 1QVOA 1BD2A 2COQA 4TQEH 4KK9C 2X1WL 3BPNB 4H8WL 4HH9A 3O3BA 2DB8A 2NNAA 2W92A 4PJEB 5EWIL 2HA1A 3DNKA 3BT2H 5BVPL 4C4KT 3U83A 1DE4A 2ATPB 3BN9D 3TVMB 1NLBH 1IKFH 2DKMA 3HZKB 4YHPB 3C6LD 5C2UB 5I0ZA 5JQHC 5J9PA 3ES6B 3U4BH 1L6XA 4I3SH 5CEZD 3RIAK 5E8PA 3S88L 5DDHB 5KVGH 2BHZA 5C86A 4QXUH 1YEJL 5GGTA 5IMLB 4K7PH 2IANA 1YY9D 4JM2F 3SQOL 3FQTA 5IF0A 2EH7H 3QPQC 3P30H 2GT9B 2VN7A 3F7VA 4OCYH 4BELD 1NBZA 2L7UA 3RNQB 3TO2B 5C09A 1A6ZA 3GBLA 3WDIA 3K1DA 3G5ZA 2P8LA 5I8CB 4Z77B 4HC1H 3SDAD 4DKAA 3BVNB 5ETUB 3VFPB 5JHLL 3D39A 2UYLB 1B0GA 4J12A 4U1GC 2C3VB 2ERJB 2RB8A 2A38A 1BQHA 4ZS7H 4L8SC 4ZOAA 5EU6E 2ZOLA 5FXCH 2G5RA 4N90E 3FFCE 2HT2D 4OUUA 3OKMB 1LO5A 3GMRB 1HNFA 3GJFA 5B38G 1A7QH 2VAJA 3V6FB 5JOPD 4YBLB 1HILA 4L5FL 2Z92B 1FC2D 4PIRF 1FG9C 3KS0H 2R56H 5JA9A 4NN7B 1YN6B 2ZKHH 5J57B 3WHXA 1C08A 1U8PB 5JOFB 4TULL 3SKJH 4BUGA 1I85A 1X5KA 4HJGB 3U79A 5H35A 4U6YB 3OF6A 3GNML 1FRGL 4FZEH 3ZT7A 3UEZA 1HSBA 3RZCB 4AH2B 1O0VA 4LNRB 1Q94B 4MAYC 2Z35A 5IVZA 4WI5A 5EFIB 5CZVH 1QFWH 5EA0L 1PKQE 1F3JA 3H9HB 5LG1A 4MNQA 3T1FA 5E8DH 2EYSA 1F8TL 3CSPA 4BFIB 2NY0C 4GRLC 5DJ6A 4ZPTA 3VWKB 4K7PY 1WWBX 3PP4H 3KHOA 1EVUA 4YNYA 1HKLH 3IXAB 1BZQK 3MXVL 5DHYA 4M7KL 1GHFL 2UUDH 4P5KB 1REIA 4OGXL 2BXZA 1U3YA 1D5BA 1NANH 4UBDD 4LEOA 3ECBA 3MLSL 4FQ1L 4HS8H 5F7EH 5SX4H 3ZKXB 3IXTA 1FO0A 1S9WA 4H26A 3REWB 2CKBL 4M6NL 1H3TA 1P4BH 2B20A 4M9PA 1ZEAL 4Z7UB 3OKNA 4X99A 2F5BH 2XOTA 4QHMB 3NCJH 1RV6X 3SDXE 5D7JC 2F8OA 3EJZC 4OZGA 5DJ0B 4PJIB 5D1XB 3RA7H 4AMKH 5FYJE 1I1AC 1DLHA 2Y23A 4GKOA 3L3IA 4I4WB 5GS0C 4MVBD 5HGDA 4WFGE 4GBXC 2A0LD 3H2WA 5DUMH 3ULUL 4OIAA 2VXTH 2Y25A 2X1OA 5FKAB 3OR6B 2HTKD 4G43B 3UJTL 3BP5B 4HKBB 2H6PA 5GS3A 1AXSB 3HE7C 2IBGA 1FSKC 9CGTA 1A14L 2ARJB 3D69A 2PW1B 4FQIH 1LO4H 1N4XL 4HF5L 4LRIA 1DN2A 2A6DA 4R2GB 3RL1B 5KSVB 1OWWA 5D2LE 3SDCB 2XWJA 5FOBB 5DYOB 4P2OB 4GW4A 5LGJB 3HMWL 1LP9E 3F5WB 3ZE2F 1V7NH 2K9UA 2DQCL 4M8VA 2BZDA 5HXMA 3WHE1 1BX2A 3S34L 2OS7A 3PGDA 2F53A 4APQA 4OB5L 5MEOB 5TFSH 2AEPH 3KJ6H 1NMCB 1W72A 3DROA 5FHAH 1UXWB 4TSCL 5C0DA 4ODTH 4YHKL 1AY1L 3UJIH 4PJBB 4PJ7B 1QFUH 1XH3B 1FAKT 3Q6FA 2QQNH 5TF0A 3TNMA 4AEIH 5HYFA 3WS3B 3LEXB 3LPWA 1ZLWH 2QSCL 1BBDL 3QI9A 2B7DT 2Y7QA 4FNLL 4RAVB 2PXYC 4LSUL 1J8HD 1SM3H 4DUWA 4M6OH 3FQRB 1UB6A 4PRDB 3WNPA 2P5WA 4L8BB 1G7JB 4HFUL 5F7DA 3DGGB 1I8KB 4XGZA 3E0GA 3WL9A 3SCMB 1DUYA 1WVZA 5C08D 4Z78A 3QIWA 5KS9F 2EC8A 5JIKA 2J5LC 3ARDA 3NN8A 1N8ZB 3PGCB 2W60A 4D3CH 2F74B 1FFPB 2DLEA 4YHML 3O3EB 3NTCH 2BX5A 1J1PH 1QKZH 1RFDH 2IEPA 4DGVH 4FZ8L 2YHGA 1JMZA 3KYNA 3ORJA 3T0EA 4FQ2L 1LWRA 1UACH 4J3VA 1CU4L 1NUDA 4XBGB 1A64A 3I9GH 4XNYH 3Q5OA 4DGIH 4X7TB 3VI3E 5IOPA 3DMMB 4EUPA 3RP1A 2P46B 4G8IA 4O2CA 2FX8L 2ZOKB 3CVIH 3KPRA 2Y72A 4UMGA 1MVFA 2YD4A 4DW2H 1GOGA 3B2UC 3HAEB 1I7ZB 1B9ZA 2R0WL 4PGDB 3ARBD 3RPKA 3WYRA 5JOEA 1KPUB 1T89A 2HH0H 3WKNA 3H9SA 3X17A 3GI9L 4ODVH 2F5AH 2KZ1B 3LEYL 3VRJB 1CTNA 3MRDA 2HLAB 4U7MA 4JDTL 4U1LA 4Y2DC 3TYGH 1CCZA 2A9NH 4Y5XC 1N0XL 4QNPF 5FYLL 3BESR 4F7TB 3NA4A 4W4OC 4X5XA 3HI1B 4NM4H 1DBAH 4U1GB 4XHQA 2BC4A 1UC6A 5DA0B 5IMKB 4JFQB 1PYWA 2F54A 4PGBA 1IGYB 3MZTA 3CJJA 1H5BB 5DHVH 5ICXB 2VIRB 4NKOB 5T1MB 3U9UA 5FYKU 4JGUA 2DWEB 3VFRA 2MPAH 1RUPH 5FHBL 1E6OL 1ZLVH 1TQBC 1KEML 1VA9A 3CFEB 4NO0B 1PKOA 1RMFL 5ESAA 2QADC 1R0AL 4RWHA 3BHBB 1KIRB 2AXGB 2F58H 2VJXA 5C9JA 3B5HA 5FO7A 2VC2L 5CP3H 2E6JA 2EDJA 3AM8C 5HYSB 5B39B 3QUXA 1OWRM 3QUZD 2YRLA 1FCCA 4M1DL 4PJDB 1IVLA 3DX6A 1D6VH 5IG7B 4DGYL 5DJCB 5B8CC 1QR4A 1T0NB 2R1YB 5FIEA 3S4SB 2ICWI 3LSOB 1Q1JL 1IGCL 1X5HA 4K2UH 4L4TA 4WO4D 4OFDA 1HDMA 4S0TD 4NC0B 4PUBL 2EDHA 3S35X 2XPGA 4GRLB 4P3CL 1T1YB 2DKSA 2X4PB 5C6PB 4KZDL 4HS6B 2WUBH 1T6WA 2A6JA 2QSQA 4OM0H 3DRQB 2EC9T 3MBEB 1T2JA 4OCRH 2AEWA 4UIKL 3U2SB 1A1NB 4HSQA 3MYJA 4G9FE 4LQFL 4QT5A 4CBPA 1KB9K 3CVHA 1XMWA 3H42H 3VFNA 1ZA6B 4Q58C 1PG7W 2OJZL 1OAKH 1CXEA 4QOKA 3HR5B 2YUVA 2EE6A 4OQTL 1OB1A 5F3BA 1V8HA 2YS4A 1IRAY 5DJ8B 1FFOA 3RVTC 3QBTB 1RULL 5TF1H 2Y9RT 5D7JB 5GRYA 3WEXA 3G6JB 2EDXA 4O5LL 1I1AB 3HLAA 4GT7A 4HIXL 4S1SH 4ZD3L 5CEZL 4E41D 4FG6C 1T3FB 1G7HB 1AGEB 4GBXB 4JKMA 4XVUC 3C5ZA 1GXEA 2FGWL 2OSLA 1LE9B 5SWSA 4C54A 4UU9B 3PIQA 2I5YH 5BVJB 1FSKB 1YN7B 4OLWH 1EERB 1QNZH 4OZHE 3BP7A 5DJXA 5IT2L 2EC9U 3EYUH 4DN4L 3GIZL 4H5SA 3WUZA 4WDIB 3BMVA 2AS5M 4ZO8A 1I9IH 3CLEL 2Z91B 3A67H 3HG1D 4WWKC 3MNWB 3VD3A 1IEBA 3CX5J 4HWNA 3EZ8A 4S1DC 1EHNA 3L3GA 3MLZH 4J3SA 4QHKI 4GXUN 1CFQB 1WWAX 2GTZA 4UQ2B 4XMKL 2EH8L 3KDMB 1I8LC 4Y4HD 1QQDB 2H32A 3QZWB 5DURD 1FL5B 4RAUA 4AM0B 4WHYH 5KSAB 1B6DA 4X8JA 2J12B 1GAFL 3S35H 3LN5B 4KHTH 4G6JH 1AGFA 1J8HE 1ES0B 4YXLL 1NAMB 1Y18B 3MGTA 3QUMH 4K3JL 4XX1E 1MQKL 4UUJB 4P57B 1C1EH 4IDLA 3QH3A 5IV2A 3O6FD 1GRWA 1ACYH 5EO1B 5C08E 2P47B 1ONQA 2M26A 3G5YA 4X9HA 2AXHA 1ZHNA 4XTRD 2AKRB 1K4DA 3BGAA 1AD0B 2BVPA 3SHSA 3HC4H 4ZO6A 3M17B 2J5LB 1XZ0B 4G42B 4NKIH 3UTSD 3QDHA 4WUKL 5D2NE 3FT3A 4QXWA 1LO3L 3BN9C 4ZUTB 1P1ZB 2ZUQC 4FFWC 3RWJA 3T4YB 1OSPL 5E6ID 5ICYB 2BSTB 1QFHA 2Z31D 4N1EA 5EO0A 4I18B 1NGPL 3IDJA 1KBGH 1KN4L 1XGPA 1EO8H 4OT1H 3MCLL 1OLZA 3FB5B 1PBYA 4PJGA 3B9KD 1YY9C 3FQWA 1KSRA 2EZ0D 3RY5A 4QRPE 1ZVHA 5TE6H 3QEHA 5GS1C 1R3IH 4Y7MA 1FN4A 4X6DB 1JGUH 1X5XA 3KYOA 5ENWB 5HDLA 1MHPH 3HZVB 3FT4B 2VDLH 1N64L 5K9JH 3R06B 3MNVA 2X9YA 2O61A 1MWAA 2IMNA 3LS4H 3DX9B 3D0VB 4GAFB 3ARED 3SDAC 1BJ8A 5ISZD 5L8JB 5J56B 2HAZA 5L9DL 3L3HB 1C5BH 4KRPD 1MRCL 4Y2DB 3I6GA 2HT2C 4NJAL 1A3LH 4Y5XB 3CXDL 1ITCA 2WINA 1W8NA 4O2FA 3KGRA 3B6SB 2EXYD 5MHSE 4WNQB 4I77L 3BZEB 1CVSC 2OLDA 5EU6B 3HZYB 4XPFL 3U0TA 4NM8L 1WFOA 3PWUB 1UKQA 5TH2B 1A7NH 4WFED 2Q7YB 5DQDH 2W0LA 4PTUB 1INDH 1DBML 2YPLA 1DN0A 1NLDL 1TQBB 4HKZB 1EGJA 1ZSDB 3MRFB 3QFJA 3WFBL 4KK5C 2HLFD 4C55A 4PJ8A 1X7QA 3QDMD 3RGVA 4HJ0D 4NO2A 4HG4J 4W6XB 1DBJL 1OQOA 3MRRB 2NLJA 4GRWF 3FN0H 4D0CB 5MI0C 4LCUB 2GFBA 4I0KA 1PEZA 1FL6B 5DFVD 3LKNA 4MAUH 1YQVH 4R4FH 3DVNA 2LAAA 3ZSTA 1PKQB 4X9GA 4I48B 3FB7A 2XZQL 4YXKL 3SJVD 1KELH 1FGNL 4OLZL 3ARTA 1S7VA 1X44A 1RK0A 3EOTL 4DCQA 3HHRB 1BGXL 2OL3L 2ZUTA 1RJYB 2X9XA 1BFTA 4G8EB 3M8OL 1I7UA 5I66A 3GMPA 4OLYL 4ODSL 5C3LD 5EU7E 4A2LA 4S1QL 1MF2L 1A6UH 3HZMA 3VFMA 1BQHG 3OZ9L 1MLCA 3DX8B 3D0LA 5E08L 3VD5A 3FQUB 4L3EE 1JE6A 4D9QD 4DN3L 3KPSB 4MSWA 1K6QH 1VFAA 4OZFB 2ENSA 4MVBC 3K80A 4X4XB 5DRNA 3WDHA 2A0LC 4NRXA 3SDXB 4KJYA 5D6DC 1ZTXL 2IPTH 1J7VR 1YEDA 3MJ9A 4MB3A 1GGTA 2HTKC 4YDLC 3IFLH 4M93C 4OZIF 1TETL 3LQAH 3PL6C 4XP5L 3VW3L 3KNBB 3P4OB 3STZA 1XF4A 3OXSA 2E9JA 4J6RH 4WEBL 1DCLA 3A0OA 1ZGLP 4PJEA 3K4DA 4Z7VA 1Q9KB 2X4NA 4I0PA 2C4FU 1KIUA 4ORGB 3PHSA 1H0DB 2ATPA 3TVMA 3GUTB 3GMOB 3VD9A 4KI5F 3TO4D 2YD3A 4YHPA 3DVGB 4YWGL 4N1CA 3ES6A 1I7TB 5DDHA 1MPAH 1Z3GL 1IGIH 2J8OA 1KPRB 2ZSVB 4MA8H 5IMLA 4MQSB 2O5YL 4HIJA 4YDKL 3SE9H 4EJ1C 3DOSA 1D5IH 1EHXA 2BDNL 1WIUA 3MLVH 3LKSB 1JGDB 4YEFA 2WM0A 3MCKA 1S9VB 2FLBT 4UB0H 4XNQB 3RNQA 3TO2A 3V6OA 1VEMA 3BMWA 5KVEL 4Z77A 3ARYA 2R69L 5ETUA 3VFPA 4JG0L 2UYLA 5CEYA 1BBJA 4X4YB 2Q8BL 2D7MA 3OKMA 1IE5A 3SGKC 1TIUA 2JKXA 3T0VA 5C3TA 3GMRA 2NY1B 2NQCA 3UTSE 5LWYL 3V6FA 2YA2A 3ULSA 1Z9OA 4UQ3B 5BOPA 2Z92A 3SQBA 1OGTB 1SEBB 3MJ8A 1MCOH 4PJAF 1YN6A 5BCAA 4ZS6D 5HD8C 5JOFA 1U8PA 3DURB 1EAPB 2J1KA 4G8GE 4TULH 1H9VA 1U8JB 5FYKL 2OP4L 4FQHB 4Z7OE 4Q9CA 15C8H 3RZCA 4J4PD 4LNRA 1Q94A 1H8OA 3I02A 2BSSB 3C6LB 1FNEB 1QSZA 5EFIA 4LSQL 5GJSL 4YDVB 2VO5A 5DQJA 1EMTL 2X5PA 1IAMA 1VPOH 3LIZH 3FOLA 2FX9L 5C0CD 5E8NB 3UPCA 1M4KA 1ZLUK 3RWGB 5GZND 5BRZD 3BKYL 3UBXG 1NJ9B 3IU3B 3VWKA 4P9HH 4DQOL 3ZTNL 2LU3A 2XFXB 4ENED 32C2A 2GSGB 1U8NA 3IXAA 1IC5H 1I4FB 3M07A 4MD4B 3ZDXF 3SDAB 1U95B 1TJGL 2YMXL 3LEVH 1WICA 5E4EC 5I1GL 5E0QA 4Y19A 3HI6L 5EO9B 3IKCA 3CSYA 2WIIB 3OKDB 4IBLT 4KPHL 4NQCD 4Z7UA 3RRQA 2BERA 1CT8B 1OHQA 4XMLL 4QHMA 4NQVA 3KYMA 4PJIA 5D1XA 2UWEE 5E2UL 4CDHA 4R4NC 3QDME 1OP3K 4L3CB 2X1XR 3LHPH 4M48H 3TV3L 1QBMH 4DAGL 4ZUUB 4V2BA 1FNGA 2DOCA 4IMLB 5I1LB 5KZCD 3FO2B 3ULUH 1F45A 5FKAA 4G43A 4HKBA 1AXSA 2ARJA 3WS6C 2VL4A 2PW1A 5HYJD 2XRAL 1N4XH 2R29H 5IVXF 5MI0B 3MA9L 4LCYB 3T0WA 3HPJB 1WAAE 1V05A 3LKOB 1A7PL 5F1KC 4N9GA 4WO4C 1YC8A 5FOBA 4ONHB 4UV4L 1KEGH 4P2OA 4DUVA 5LGJA 3BQUA 3GHBL 2HMID 1CGXA 2FCBA 1CGWA 5FUOH 3TPUB 1PD6A 5AD0B 3EO0A 1CFSB 1YEIH 5MEOA 4FTVD 1WZMA 4QHNA 5FGBA 1EEYB 4OB5H 4OFYA 5D7IB 4RA0C 4GAJL 5GRZA 2EEDA 1SJEA 4KRMB 1UXWA 2CLVB 3VGAC 3N85H 4NCDA 4R7DB 3QP3A 4PJBA 3IDMA 2DQTH 3TBTB 5IFJB 4YQXH 1XH3A 2VXUL 4D9QE 3WLBA 4OCMC 1YECL 2FJHA 2LTQC 3W9DB 4PB9L 3PHOB 3SGJA 3LEXA 4I5BB 4HV8A 1Q9OB 4PRID 3H8NA 5I8OL 3WFEL 3KWWB 3ZE1E 4XCYB 4RAVA 4FNLH 5DLMH 3K81A 1I1RA 1SJHB 3FQRA 4PRDA 2OXHA 2V9QA 4L8BA 2PTVA 1LDPH 3L5XL 4XPHH 5ALCL 3LD8C 1Z2KA 1L9NA 5INCB 3DGGA 1I8KA 4LK4A 4U2YA 5T33H 3HMXA 1JZ2A 2UV3A 4KAQH 5C9KA 5IFHH 1RZFL 4IDJL 3WIFA 3PGCA 1OAZH 2F74A 1FFPA 4DVBB 1U8HB 4P5TC 1CGTA 3O3EA 3WFZA 2VSDA 2NY5C 4Y5VB 4L1DA 5GJTL 5EOQH 3FTGB 5HHVL 1N2RB 4M6MH 3MLPA 1YZZA 4X7TA 1RUQH 4Z7NE 4MZ2A 4Y4HC 3MUY1 1DVFD 1V3KA 2LAGB 5LJYH 3IS1X 1HXMB 3ARPA 2AK1L 4WI7A 3B9AA 5I1EL 5J89A 2OI9C 3HAEA 1I7ZA 2VITB 1HZHH 3WKMH 1TVHB 4EXKA 3E3QC 4JO2L 3ZTJG 5DJDB 1IGFL 1G0DA 3O6FC 4G80A 5HVHC 3VRJA 4QRUA 1PFCA 2HLAA 4JO4H 1J8HB 4F7TA 3RDTC 1CQKA 3HI1A 3C8HA 3FL7A 2FHFA 5GGRB 2OL3B 5IMKA 4JFQA 4L8SA 1IGYA 1NAKH 4LSSH 5C08B 3NH7L 1NCDH 2VIRA 5T1MA 4KUZH 1KIQB 2DWEA 4JLRB 4KVCH 2WANA 5ILTL 3VFTA 1IZKA 3CFEA 4NO0A 5DMGD 2YPVH 1TZGH 5LCVL 1MEXH 2VLLB 1OPGH 3QIBD 3LMJL 1KACB 2F19H 5E6IC 2AXGA 4AIOA 4MJ4A 5D2NB 5FUZL 3ZL4L 3QDGE 3WIIH 5HYSA 4LHUG 4P5MB 5D9SB 2X2YA 3B9KC 5C0CE 4MAYA 2MFNA 2R1XA 3MXWH 2EZ0C 1MRDL 1OCWL 2P43B 4PJDA 4E5XB 4CU7A 5J3HC 2GUOA 1WK0A 2AV7B 3MQIA 1T66D 3X11B 2BNRE 4NO5A 2R1YA 3DYPA 3Q1SH 4M7LH 3ZYJA 4OLVH 5F89A 3FB6B 4MMZC 4JCLA 4HQQL 2GAZB 4HCRH 4GRLA 3ARBB 3WXVL 2X4PA 3MACH 3C5JB 2FJFB 1RIVL 4XC1L 4XT1C 5DUPL 1A1NA 1MFAH 5CZXD 5DS8B 5TGBB 2FD6L 5BQ7B 4NQCE 2W1NA 3BDYH 4AL8L 3V79C 3TH3T 4XP6H 4N0YH 5C2BL 1HH6B 3S9DB 4MHHI 1Y0LB 4JKKA 2JJTC 4XWOD 2ADGB 2N1KA 3RBGA 5JHDD 4Z6AT 4M61B 2QSTA 2ADIB 2ZUYA 1Q0YL 3O8XC 3DECA 3B8SA 3ARSA 6FABL 1MCKA 3T1WA 3IDYC 5DQ9B 1E0OB 5ID1B 3KLHC 3QCTH 3EDKA 5D7JA 4CVUA 5I30L 1A7OH 4BQ6A 2OTUB 3G6JA 5TE7L 3EYVA 5CWSB 1I1AA 4JRXD 4JFXB 2WK2A 3O11A 1RZKH 1T3FA 1G7HA 4GBXA 5HYJE 1ZK9A 2CDGB 4JRYB 2GHWB 4EBQL 4WFHE 3QUZB 1GVIA 5F7FA 1T03L 4P3WA 2YXFA 5BVJA 3VWJD 4MJ6B 3ET9F 3HE7A 2F9BT 5DHVB 1JNNH 1PLGH 1OM3H 4ZQKB 1BJMA 4KDWA 4UT7L 3EO9L 3C9NA 1X6LA 3BZFA 4FTVE 4WDIA 3BPCA 4WO4B 1NMAL 3ULUE 5L6YL 4UOW1 1MFDL 2Z91A 1F90H 1WCQA 1T7YA 2FIKB 3QQ4B 3MNWA 4PJXE 1P4IL 4PBWD 1CFQA 4Q7DA 2BVOB 1OAYL 4UQ2A 3NABL 3UPAA 1RJCA 3KDMA 5F97E 2BVQA 1BFVL 1IGML 1MHCB 3MV8D 2NZ9C 3QZWA 1FL5A 3MRIB 4AM0A 1N6QL 4OLXL 1VADB 1A9EA 1VFUA 4HFWA 4PRIE 1INQB 2FIRT 1RUKH 3LZFL 3IETB 1P5VA 1Q72H 3CD4A 3SOBH 1ADQA 1ES0A 43CAB 1NAMA 3X13B 1T4KB 3HNTH 4M5YL 3QUKB 5EC2B 4P57A 5CJOL 5F9OL 3GKWH 1PJ9A 1UH4A 5JW3H 3EIFA 3CFCH 2FO1A 3VA6A 2PXYA 5EO1A 4IJ3C 5KTEH 2VDNH 5D7KD 2PO6D 4N0RA 4PRAB 1T5XA 3DX7B 3LD8B 4E41B 5EORH 1I9EA 3G04B 2CKBA 2X70B 2RAMA 1QG3A 1YYLH 3QRFM 4PYHA 3M17A 1CFBA 4G42A 1UEMA 2H8PB 2BSRB 4N0FB 1DFBH 2CK2A 2OZ4A 4M4RA 5KSBE 1P1ZA 3T4YA 2P5ED 2DMCA 4NQUA 1MFNA 3MRNA 1CD0A 1MCJA 1OSPH 4JFDE 2BSTA 2FYYA 4ZUWA 1HYSD 2CRIA 3TJHC 3HG1B 3UO1L 1N5AA 5KOVC 5EUOA 1MCEA 4F15B 5KW9L 5CILH 2CQVA 4AZ8A 4BSVB 3FB5A 2AK4A 4PJHF 4H20H 5EIVA 4Y4HB 4C59B 5DURB 3S36X 1WTGT 2X4OB 3CX5K 4HT1H 5F7KC 3O9WD 1IC1A 4X6DA 4UOJA 5ENWA 1AIFB 3IKKA 4ZFOL 4Y1AD 2OI9B 3FT4A 1FNSL 1L9MA 2P24B 3R06A 4JAMB 3DX9A 3D0VA 3RNKB 4LLYB 1MCBA 3TP4A 1OVZA 3L3HA 3O6FB 5L9DH 3L9RB 4FMKA 4Y2DA 3RPIB 4Y5XA 4LPVA 4V2CB 3QIUC 1WQVT 4W4OA 5ICZB 1K5NB 3B6SA 2JTDA 5AG8A 4WNQA 3BZEA 2DQIH 25C8H 3FO0H 4XPFH 4CUCA 3ZHKA 3PWUA 2YD9A 1M7DB 4M4PA 5TH2A 3U36A 1S9XA 1JK8A 4U31A 2Q7YA 5D4QA 4ZS6C 3VI4E 4PTUA 1EH9A 2VXQH 3C8DA 4H0GA 4KGJA 3UTSB 1BJ1J 1D5ZB 4JQXC 3QUMB 3IFPB 5DD6B 4FQJH 4YGVB 4HIIB 2PKDA 1ZSDA 1AI1H 4J4PC 3P0VH 4S2SA 4EQ3A 5C0JB 4YDIL 5E6IB 2Z31B 1OAXL 4XNXL 3MRRA 3AM8A 1B4RA 4D0CA 1QPPA 4LCUA 5BXFB 4F7EB 3B9KB 4LAQL 3KVQA 1J11A 3O6LL 4DKDC 3O41B 5GZNC 1JNHB 4JFOB 4XCNA 2ATKA 3L7EA 1PKQA 3NGBC 2JB5L 5T1DH 4ENEC 4I48A 2VDPH 2AJUL 4N8VB 1I3VA 1RUML 4XPGH 1WFTA 1K8DB 2EDTA 4HX1B 4Y4KD 5TE4H 1I75A 3AREB 4IRZL 4IRJC 4AJ0A 1T5WB 5ISZB 1RJYA 4KRPB 4X7SL 5DD0L 3V5DB 1A21A 1NCWH 4WHCA 4GH7B 4JB9H 4BZ2H 5D8JH 4G7VH 3GMLB 4WU7B 1FHGA 4XBPB 1JPTL 4ODSH 3E6HB 4ZAKC 4Q6IC 3MREA 4NZDA 4P9HC 3W81A 4A6YL 3OX8B 2YEZB 2NY7L 5IEKB 1J8KA 3FQUA 2WQRA 2R4SH 3KPSA 1RHHB 1QR1B 1WIPA 3VRIB 4L29B 1YPZA 4OZFA 2OMBA 4JRXE 4U6XB 4OUOA 2A6KB 3IDYB 3KG5A 3SDXA 4J8RB 1CICC 1QA9B 3V6BR 4M00A 1GC1L 1CN4A 1OF2A 3U7YH 2UWEB 2VR4A 3T0AA 3C6SB 3AFLA 3B2VL 3QDMB 5SWZD 5TJWK 4TSBH 4POZD 2N56A 3P4OA 3INUL 4M03A 4ZXBD 3V0WH 4YHIA 1JRHI 4ESKA 3T2NL 4OLUH 5L8KB 2R2EA 1OP5K 2WLZA 1CE6B 2A74A 1JPSH 3BGFC 4G5ZL 5GGUA 4HG4K 1NGYA 4OCWH 5D5MA 2IFGA 3GUTA 3GMOA 1T83C 3HNVL 1R3LA 5GIRA 1NGQL 2B4CL 1I1YA 3SJVB 3EYSH 3MV8E 3JWOL 4KKLC 1I7TA 3QDJD 4WWKA 1FFQA 2ZSVA 5F3HB 5AZ2H 2DQUH 2WWMD 1OARH 3TBSB 5DUBB 1KC5L 1I8LA 3RIFF 3LKSA 3VGFA 3RU8L 4HLZH 1JGDA 3NCCB 5D7LE 3BO8B 5I1IL 3CCHB 4NC2B 4XNQA 4JY6A 4X5LA 5E95B 5EBWA 2NR6C 3T8XB 2HT3D 1ND0B 4HMEA 1UFUA 5J06A 4I3RH 5D7KE 2GKIA 1TNNA 1FVEA 1WLHA 5EOTB 5FOJA 5MEND 4OD3L 2HFFA 5DWUL 4MXQD 4IJ3B 1IARB 2D3VA 3QYCA 1P6AB 3SEPA 5SWQB 1KJ2H 2HWZL 1S78D 4NJ9H 2OTWB 1ZWIB 2XKUA 4JY4A 3TIEB 5IB2B 3GSVB 4UQ3A 2AEQH 3S3JA 3SGDH 3AAZB 1SEBA 4GQ9H 3MRMB 4ZFGH 4LSTL 5HYQB 2P5EE 4OQTA 1KCKA 5CJ8A 1MFEH 1EAPA 2BFVL 4YUEH 1U8JA 4I0CC 2V5YA 4RDQF 3D9AL 4FQHA 1PSKH 2PCPB 1BM3L 1T04B 2OP4H 4OZGF 2DQHH 4ORZC 1JFQL 1GC1C 3QEQD 1UJ3B 4OZ4B 3TO4B 2BSSA 3C6LA 3JZ7A 4L8DA 5GRUL 4LPYA 4HBCL 4R96B 1UQSA 1DVFC 5HHOA 4BH7A 1HWGB 4LSQH 4YDVA 1T2QH 4Q0XH 2H41A 5F88B 3P0YL 2AERT 3MODH 3EW3B 3L3JB 1TMCB 3G6DL 4ZYKB 1GZPB 3RWGA 1A0QH 2EIZB 4FFZL 1NJ9A 3TIDA 3R1GL 5GS1A 5T3ZL 5C0AD 4JPVH 2CRMA 3JWOC 3MNZB 3OGCB 4BYHA 4MD4A 2CIKB 1DL7H 1U95A 3SDAA 4F57H 5MEQA 5J12B 2OCFD 5I73C 5C0GB 3BDBA 1U6AH 2WIIA 3OKDA 4WI8A 3GSNH 2NXYC 3GSUB 4F8QA 2DYPD 5E94B 1JI2A 3CMOH 1VFOA 1KN2H 1AC6A 2AABH 3CH1B 5DMGC 4NDMB 3AU1A 3K7UA 5LGHH 3TN0D 1CF8H 2BY2A 4LHJB 2HP4A 1JWSB 4HK0B 4L3CA 3I6LD 4YHOL 1UB5B 4HC1A 1I3UA 5I1LA 2QEJA 1F3DH 4OBSA 3BISA 1UM4L 3JSSA 5K59F 3HNSL 4ALAH 4F2MB 4BSWB 3OTTA 3VD4A 5DSCB 4Z0XB 2XA8H 2PYEE 1T66C 2VLJD 2V17L 4LCYA 1CDIA 3LKOA 5C0CB 2BNUB 4OSUL 2ID5A 3F7QA 2A9ML 2J6EH 2G5BB 5BRZB 3VXNB 2AXFB 3GHBH 5KG9B 3QUYD 2VN4A 3NGBB 1DBBH 3EDJA 2V5TA 3TPUA 5AD0A 3TBWB 5CKAA 1EEYA 1S3KH 1AXTL 5D7IA 2CRYA 4X5WA 2ZUXA 2GK0B 3DHJA 1UA6L 2D0GA 2MQ0A 2VZOA 5DEFB 2NYYC 3EO1A 4R7DA 1VERA 3FQNB 3GBNH 3TBTA 5DJAB 2C3HA 2ESVD 1MCWW 4NP4H 1YECH 3V7AE 3W9DA 3PHOA 5KSUB 2XA3A 4KJWD 4I5BA 2CMRH 1KJVB 2E3VA 4UINH 4Q6IB 4RAHA 1NCTA 1AE6H 3KWWA 1DEEB 4KQ3H 2R2BB 1IC7H 5H37H 4XCCL 4ZFOB 2CSPA 1Y6NR 3S7GA 2CJUH 1SJHA 1GPOL 5I6XC 5SWZE 1DQMH 5INCA 5CJQH 3UBXI 4ZTPL 4NNYB 5IK3A 5KZCB 3L7FA 5D6DA 5DMIL 3WDJA 4RGND 1KOAA 4HXAL 1F4YL 1MUJA 1LEIB 4CMHC 3VWJC 1L7IH 2ZNWA 3H6JA 3PL6A 1X5IA 1FV1B 5ANME 1TZHB 2IQAB 1PY4A 5E5RB 4ZUSB 4XVSL 4DVBA 5HYJB 1U8HA 1ZVSB 1MVUA 3HRZA 4M62L 3T2QA 2A2QT 5HYSG 5B39G 1JN6B 4QLRA 5DD3L 4NGHH 2XY1A 2E5EA 1L7TH 4TPRL 1OTSD 4RSVA 4Y5VA 5EBLA 5CBEA 1I8MA 4OCSL 3QDJE 2DD8L 3NIDF 3FTGA 1CXFA 2P44B 5TDNA 1N2RA 5E03A 1MNUH 3ZE2E 3S4SG 3IU4L 4FTVB 4JPIB 1ZLUH 5HPMB 4PB0H 5DD5H 5T5FH 1B2WL 1DQJB 1G1YA 3K8KA 3DXAE 5JUEH 4PJXB 2EICA 1HXMA 4XHJD 3AXLA 4U4BA 4EI5D 3EOBA 4GMSL 4O4YH 3GB7A 4WTZA 1B4JH 2EDBA 4PRIB 4LOUD 5C0ND 5DJDA 4MD0B 1IGFH 5IP4A 3M1BB 5E56A 2DBLH 2R15A 2HFTA 1A22B 4M5ZH 4LMQI 2Q20A 1J0HA 4L4VE 3V4UL 1IGTA 1ZANH 4JRWA 2UZIL 4LPCA 2CUHA 2OL3A 5I1HL 4GG6A 4MQXC 5BW7C 5A3ID 4MJ2A 1A7BA 3BFOA 3SGKA 1XT5A 4ONFL 5IHUL 1XGUA 3VFGH 1SQ2N 1KIQA 1UH2A 1OP3H 5KS9E 2XN9E 4MS8D 1XCQB 4JLRA 2ADJB 4JO3L 4WENB 5C07D 2VH5H 1Z0NA 2VOTA 1TTUA 5DVLA 3OJDB 1FQ9C 4JCMA 1HYSC 3BXNB 4P0DA 2DQJL 5D2NA 1DLFL 3CH8A 3DO7B 1KB5L 4U6VH 4MJ5B 1FE8H 4M1GL 5D9SA 3V52L 3ZHDA 3RIFK 2Z8VC 4E5XA 1DVFB 2AV7A 1XIWC 4KK8C 4Z0BH 3BEWA 4NWUL 1LQSR 4U1KB 4Y0GA 5DZOA 5KJRH 5FYKE 5HSFA 3FB6A 4LU5L 3MLUL 3WXWL 2GAZA 4MQ7B 3ARBA 3QZWG 4HGKC 2FJFA 2NX5D 2G9HB 4XC1H 2AAVA 5E2WL 1JRHL 1LMKA 3VXSB 3IDGA 4K9EH 4HWEH 1KXVC 3SGEI 1CL7I 1YEFL 5DS8A 2XTJC 4QNPE 5TGBA 3S36L 5BQ7A 2XQBH 1I7RB 1WJ3A 1ZLSL 5ABDE 3AGVA 2VDKL 5I73B 4ODBD 4NUJB 2C3GA 1Y0LA 4JM4L 1G0YR 1U8OB 3SE8L 3MRKB 2Z9TA 2XICA 4LSDA 3I6LE 3QJFA 4M61A 2ADIA 4O51A 1YEKH 5LQBL 4GRWH 2Z93B 4WUUD 5ID1A 2W0KA 3LQZB 2OTUA 1AQKH 3QIBB 5CWSA 5TPWH 1H8SA 4JFXA 2R0KL 2WMPA 2H26B 2JJSC 3PUCA 4V1DA 3DUSA 4JRYA 4NWTH 3U4AA 3QUZA 3KPQB 1EIBA 3FRUA 3P3YA 1P7KA 4HWBL 5HTSA 5DHVA 3T04D 3WS6A 4Y4FC 4YR6B 1HHKA 3FB8B 1LNUA 1IAIM 2B1AH 4PRNA 4BM7A 4C83B 4ETQB 4KUCD 4OGAD 4WO4A 5HDQL 4Y4KC 4OTXL 5GGTL 1MFDH 4J3WA 3QQ4A 2WBJD 3OG4B 4TUKH 5DVOA 1P4IH 1JYWA 1IMHC 3IVKA 5CP3A 2BVOA 3WIHL 5EG6C 2BK8A 5L0QB 4GS7C 3L3KB 4N0UA 2ESVE 1IGMH 3UC0L 2BVUA 4F9LC 4ISVB 4PY8J 1VADA 3U4EA 1IL1B 1I9JL 4PJGF 1F02I 2Q86B 4D94A 1INQA 2HVJB 4H88H 3IETA 3CFBB 1RZ7L 2AEIT 1INEL 3O3DB 1BLNB 43CAA 4P99A 3X13A 5IGXL 2M8XA 1T4KA 5ITBH 3QUKA 5EC2A 5JHDB 2HKHL 2ZWLT 3HCVB 2XIDA 1BWMA 2W65A 4L8CA 1MCHA 1CFTA 4NRZB 5E2JA 4JQVC 3ARRA 3QG7H 4KHXL 4QHUB 3TCLA 2ZZUT 3GHEL 5I6XB 3SE4A 4PRAA 4FN0A 4JRXB 3DX7A 4EI6B 4E41A 4POZC 4MYWB 3ULVL 3G04A 3ILPA 2X70A 3BUTA 4H25B 4TOYH 1FFNA 4AYFA 3VE0B 4CMHB 1LO0H 3VWJB 2H8PA 1U8IB 2BSRA 4MQTB 4MJIE 4N0FA 4M43L 3WCYA 2RIKA 2EYTA 2ZNXA 2X4SA 4P5TA 4PFEA 4R7NB 1HSAA 1BVKA 1FVCB 3ZDZF 1SJXA 3LRSA 2BY0A 5J1AA 4JE4B 2OTPA 3CDYA 2H2PC 1NUFA 2YK1L 3HG1A 2I9TB 2FH6A 2WWMC 4BSVA 5HHNB 4DTGH 1ULVA 4FP8L 3U1SH 3VXOB 5EUKA 4OV5B 1HI6B 4LFHD 4Y4HA 3MV8B 3I2CL 4RMVA 4Q9QH 4JG1L 1YNKL 3A6CL 4EVNA 3P77B 4CRPA 2X4OA 1JPFB 5CCKH 4F37K 1AIFA 4PJCE 5IBLD 1G7LA 3I3DA 2P24A 4LCWD 4XP1L 1H3VA 1FO0L 4X4ME 1A2YA 3RNKA 4LLYA 3R4DA 4XXCC 1WTLA 3O6FA 4OKVB 4MXQC 3ESUF 2E7LC 2Y06L 3RDTA 1K5NA 2PO6B 5CLTA 5CFHA 1S78C 4TVPL 2VLKD 4OZFG 2AI0H 1CBVH 4RFOL 1TPXB 4TTDD 3VXUA 4PJFE 1WFNA 5F44A 2IAMC 2ZPKL 1MFBL 4GKZB 1H8NA 5CGYD 1IAII 4MNGE 1WBYA 2J4WL 2YUXA 1UYWH 3FZUD 2KL6A 1D5ZA 1UCTA 5MERB 3QUMA 4OIBA 3IFPA 4JKPL 1U41A 4NBXB 5IBTL 4FXLA 1NKOA 4P48A 2QJDA 5DD6A 1X3DA 4HIIA 4YGVA 5BO1L 1KCUH 2P5EB 2NY4D 5C0JA 2KZWA 5E6IA 2DQEH 2ARWA 4P9MH 5I18L 2OJEA 4KKBC 4FQXC 3ARVA 3DV6B 3ULVC 2QHLA 1UZ6F 1UVQB 5BXFA 4F7EA 2XZZA 4PRPD 3BRGC 3B9KA 2VL5B 4WI3A 1JGLL 3RWIB 3BEVB 1JNHA 1H3WM 4G6MH 4JFOA 1UWEH 3FKUS 5I17A 2VZ1A 1KCVH 3O9WB 4PJEF 2NX5E 4Z7VF 3KXFB 3ZZ1A 4KTDH 4Y1AB 3DUHA 4LLDA 1K8DA 3E8UL 2ED7A 3LS5H 5EU4B 5JXED 4WIQA 1D5MB 2RR3A 3RKDD 4GO6B 4FQLH 5ISZA 4XPBH 1S5IH 3V5DA 2C1OB 3GMLA 4WU7A 3EBAA 4XBPA 2ZUUA 4WUUE 5IFAL 3OX8A 5CEXB 2W9EL 2NY7H 3LPFA 2JJTA 4HPYH 3VRIA 1E4XH 4QRRA 5IR1B 1JZ3A 3P11L 5F7NC 4WCYL 5D70L 3O8XA 4U6XA 4HKJA 2XZCL 2A6KA 1JTOA 4R4BB 4J8RA 1QA9A 4YAQB 5D1QD 1VFBB 5GSRB 5J13C 2XT1B 3CLFL 1PGRB 3L6FB 3C8KB 2V5RA 3C6SA 3DRTB 3G5XB 1IEAB 1QZ1A 4QTIH 3QDMA 4IRSC 3HTLX 3W0WD 2EEBA 4U7KA 2YD2A 4XVTH 5EPMB 3OKKB 1U2CA 3KAAA 4GRWE 4FQCL 4NRYB 1I3RB 1S7XA 1BFSA 5JLZA 3CFKB 1CE6A 1N7ML 2QQLL 3FAWA 2OQJB 1CDCA 3CDGB 1G7MB 4NBYB 2PYFB 3H7BB 1SEQL 4J3TA 5EH1A 1WGOA 3U9PL 2N7AA 2YWYA 4Y4KB 3SJVA 1DANT 4I2XE 3HRPA 4JHWL 3HC0B 1RZJH 4XCFL 4I3GA 5F3HA 2X44D 1RI8A 1EHLH 3EOAB 3LPGA 2VXVL 3TBSA 1BOGB 2EKJA 5FO8B 3STLB 1BWWA 1S5HB 4KZEH 2J8UE 3EZJB 5A43C 3BO8A 3SKOB 3LH2L 1MCCA 4RRPA 4OD1L 1HOCB 1IBGH 4XP4H 1GGBH 3BW9B 3T8XA 1ND0A 1UM6L 4ZOEA 1U92B 4C56E 2DRUA 3NACL 2XKNA 4NQSA 3JV0A 2VE6B 4PJ5E 2X7LB 5K9QG 2JJUA 4YX2H 2E7CA 4JZOA 1FYHB 4LLUB 1QBAA 2DQGH 4R90H 1U3HC 4RGNC 1UWGH 3GRWH 5SWQA 1KFAH 5SWZB 2HWZH 1ZWIA 2OTWA 4LLWB 3ZKMD 4XCEB 5IB2A 3GSVA 1XR9B 4OZIE 1V5JA 3LKQA 5FF6A 1JUFB 3HUJB 5HYQA 2R8SL 3MSPA 5IQ7L 3MA7B 3PWPD 4Z7UF 2ZCKH 3RHWF 2L4OA 5C1MB 5ANMB 2PCPA 1T04A 3HE6D 4NZTL 5DGQA 4PJIF 4M7JL 4K8RH 5IW1A 2D03L 2CLZB 2G60H 1DSFL 3DBXB 4BQ9A 1XAUA 4HUUB 4KY1L 1WZLA 4BZ1L 4EIZC 3MLXH 4KI5E 2OR9L 4R96A 4HBCH 3Q3GB 3QDJB 2AP2A 2VDRL 4LVOC 5DHXB 3L3JA 2BNQE 1HINL 2DWDA 4ZYKA 1GZPA 1IQDB 1V3JA 1PG7X 4ZSOB 2EIZA 4LCWE 1MRFL 5HVWA 4FFZH 4KQ4H 1LK2B 3R1GH 2NY2D 4LOUC 4CADB 1CXIA 2RHEA 3BIKB 4K8RD 4LSRH 2ZCLH 3CVHL 2CIKA 1G84A 1H3GA 2VLKE 2KKQA 4WVRA 5MENB 1WF5A 3LRHA 4HUNB 5B3NA 4ODUA 5C0GA 1AGDB 2EIBA 3PWLB 1HHGB 2YBRA 3QIUA 4G3YL 1MHHB 3GSUA 4EOWH 3V6ZB 5IVOA 4JFHD 4PJBF 5CJBA 5GRVL 2QR0B 2CDFB 2FDBP 4EN3C 4JQIL 1FFRA 2ED8A 3CH1A 1FJ1B 1HKFA 4NDMA 4QTHB 5JORB 1ZLWK 4MDIB 4HK0A 4YPGB 4HHAA 5KS9B 4KXZI 1HIMH 4JQXA 4K07A 3O2DH 1U8LB 1F4WL 1UB5A 5DF0A 5EIQA 4BH8A 5A2IH 3B5TA 4JR9L 4OIIL 3F58H 3QEQB 4J4PA 3TT1L 4PRPE 1YYMH 1S7QB 1WWCA 3HNSH 4F2MA 4BSWA 5DSCA 1T1ZB 4Z0XA 1KJ2B 3HC3L 5T1LD 2ITCB 4IOIB 3KYKL 3OHXA 4QXTB 5FV2A 2BNUA 2G5BA 5BRZA 5D1ZD 3VXNA 5F7UA 5KG9A 5E1AB 1DQLH 5EULV 3TBWA 4Q2ZB 5C0AB 2LQRA 4X0KA 2CIIB 1NEZG 3WE6A 4IRJA 1OT1A 3ZDXE 2IH3B 3V5HA 1L0YA 4NQED 5DJAA 1FH5H 2R0ZH 5I76B 5KSUA 1CLOL 4DEPC 4YDJA 2W9LA 4XX1G 2DYPB 4LRNH 5E2TL 3S37L 4E42A 5HBBA 3WNNA 4Q6IA 2MOVA 4Y16D 1DEEA 2R2BA 4ZFOA 4X80L 1G0XA 4N9OB 3IF1B 5AYUH 3TN0B 3SO3B 3T77B 4B41A 3IFNL 4Z95L 4X6FB 3W0WE 1NFDB 3HFMH 2EDKA 3CDFA 4NNYA 1MJUH 2LVCA 2E7BA 1CICA 2NY3D 2UVFA 5J13B 3A6OA 4LSPH 2VAAB 3UJJL 3WNKA 1LEIA 4JKLA 1FV1A 3GSNB 1TZHA 2IQAA 3T0XA 3QNXB 1U91B 1ZVSA 2VLJB 3FMGH 1YMMD 3OAZH 3ROLB 1KENL 12E8L 5D7SL 5DEZA 5MEPB 5IVXE 4TPRH 5GRJL 3BIBX 5IESH 4PS4H 5IJVB 2OK0L 4IS6A 5GHWL 4ZFFB 3THMH 1MLBB 2YA0A 2EDQA 2WBJC 1U8MB 1T83A 4XNMA 2Q7NA 5C6TL 2NZIA 2B8OT 4BSJA 5BV7H 4JPIA 2VZUA 4N8CL 5E6YA 2I24N 3D3VD 5HPMA 4HIEB 4XZUB 3N1FC 4D9RE 3T08A 1IAIL 4JFFD 1DQJA 1YNLL 1MAML 3TCXA 4PJXA 2Q8AL 3H7LA 3QHTC 1MREH 4NT6B 4NKDA 5EZLA 3GBML 1WT5A 1MWAL 5JW4N 4GUPB 3WNOA 3SKNB 3PXHA 2ESVB 3BPLC 3UAJC 5CSZB 5JXAL 2NW2B 4XRCB 4U1MA 1LGVA 3KPTA 4HBQA 4PRIA 1TZIB 2ZJSL 4M8QB 4MD0A 2DQDH 2A83B 4LEXH 1QSEE 3UDWC 3MLRL 4Q9BA 4QHLB 5DT1H 3U7WH 4BFEA 1Z6JT 3MOAH 1IGJA 4CW1B 1CGSL 1QLEL 5CKGA 5I1HH 5IJKC 1R5WB 5FUCE 1OOAA 3JV4B 4NN5C 3QNZB 4RGNB 5B4MC 3PWPE 5F72S 1KXTB 3MV7D 4X98A 2X6MA 3EDDA 1XCQA 2CLRB 3KPNB 1QBLH 3OAYH 4UT6L 4RX4D 4LKCA 3OJDA 2QQKL 4JPWH 3O81A 2MCPL 3BXNA 1HN1A 4UIMA 4LDOB 1R3JB 3T3PF 3DO7A 2YN5A 3G6JF 4MJ5A 3QQ3B 3EFDL 4URTB 1ZA3A 3E6FB 1YEHH 3MRJB 1DVFA 3NAAH 5L88H 5IKCA 1NCCH 2E6QA 3DJ9A 5H2BB 1MIML 3WFCH 4U1KA 4UT9H 4EI5B 4C4KO 2FJGA 3P9LB 1DQDH 3W5MA 4JANB 1F58H 3FOMB 3IDXH 4KWUA 2Q3ZA 5DR5L 4PV9B 4UAOB 3KLDA 1KCSH 1W0VB 2G9HA 1XCTA 4PJCB 3E2HC 3VXSA 1CR9L 4PRBB 4LVNC 1XFPA 4JN1L 1J5OL 1GIGH 1URLA 4MXWH 4JFHE 4TN9A 4NZUL 4YGAB 4TTDC 4NQDD 2DJ4A 5IB5B 4GAGL 1VSCA 2D9QB 3EYFB 1AHWC 1KTRL 2RJMA 3K2UL 1U8OA 3GSRB 1B88A 5T3XH 2YZ1A 4TSAH 3FZUC 3MROB 1FLRL 1CDGA 4G6AC 4PJFB 5C07B 3MJ9L 2XWBB 3REVB 4F58H 1W0WB 3LQZA 2H2SD 1CLZH 1ZT1A 4Y5YB 1A4KB 2X4QB 1G6RH 5CUSL 1PVHA 2RQ8A 2PW2B 4YIQB 2AJXL 1CLCA 1EEUA 2BOBB 4GW1B 5CHNA 3V0AC 1RIHL 1VKXB 3QWQB 3S97C 3TZVD 2MTPA 4X7DC 2JE8A 1A9BB 5T3XD 1K2DA 3BYYA 4LP4A 3WD5H 4C83A 4ETQA 4JKWA 2NXZC 1SVZA 4AIZB 3RY4A 5JXEC 4QRQB 4YHZL 3AY4C 4MWFB 2JIXD 1EXUA 3ZSSA 3NCMA 2PTTB 1J12A 1HE7A 2IGFH 2NX5B 1HQRB 2WZPD 2HKFH 3L3KA 4NQEE 1SY6A 4BFBD 5TQ0H 4ISVA 3PP3K 5EUOF 4PP1C 5IM7B 2Q86A 1AFVH 4U6HA 2HVJA 2LVEA 3KYAA 3U6RB 2EDOA 4NNPH 2G75A 2ICCA 1BLNA 1RZ7H 3RVWD 2B39A 5E1HB 1QP1A 2O26U 4KGLA 2BY1A 4DEPB 5JHDA 5FEBA 4X6DF 1JF5A 3HCVA 4QY8B 4X7CC 4WHYG 4WUUB 1S7SB 5D1QC 1NCUA 1MFCL 2D2OA 4UI2A 5ERWB 1FGVH 3DUUB 3GHEH 4JRXA 4NFDA 3ZT5A 5GISH 5ADPH 3FO9B 1M1SA 2EIDA 3HPLB 4AEFA 3QISA 1YMME 2HRPH 2DDQL 5HHPB 4H25A 3DVIA 4WTXA 4YXHL 3RWFB 3VFSA 5CLWA 3VE0A 1AR2A 1IJ9A 3VWJA 4DKFH 1KCRL 3HI5H 1U8IA 3WBDA 4E0RB 4LARH 2G2RB 3V95A 4HJJH 3MO1B 4GRWB 4R7NA 3L5JA 4CMMB 3D3VE 2C7UB 2P8MA 1C5CH 2R23B 4JFFE 3BPNC 4GMTL 2I9TA 2WBJB 3MRLB 5F6IB 4ZG1A 2RCSH 2D7TL 5HHNA 2R0LH 1UJTA 4N8VG 3TWCH 4OV5A 1RZ8B 1HI6A 2FECI 4WHTB 3TVMC 3MV8A 4I2XB 2VR5A 4JHBA 1YNKH 1NC4D 1JPFA 1YJDL 4UTAL 1Q9LB 5EZOH 1I1CA 5C6WH 2W9DL 1Z9MA 3BPLB 2VDQH 3OKYA 2J8UB 3K4AA 3X12B 1FORL 3G9AB 3NCEB 3CFJA 5L7XL 5B3JF 4OKVA 3MUJA 3G6AB 1LO2H 3MV7E 3HS0B 1CK0H 2IG2H 4JO1L 3ZKMC 4MD5A 5BW7A 1E6JL 2J8HA 2JCCF 4NN5B 4GKZA 2ERJC 5C0FB 3RAJL 2M1KA 3BKML 5MERA 2VDMH 2ICWJ 3VMNA 1J05A 2QHRH 3QWOB 4OZIB 3HE6C 3UYRH 4R8WH 3QHZL 1YPZF 2IQ9H 5I9QC 3TNNB 1HHIA 5JQ6L 1PZ5B 1CDUA 3H3PL 3FFCD 2H1PH 4X6CA 2CUIA 5BMFL 1UVQA 1SBSH 2V2TA 1JGEA 1RIUH 1ORSA 2VL5A 1U8KB 3RWIA 2FBJL 3CK0L 4PJHE 1J1OL 4BZYA 5FA4A 1XIWA 1BIHA 4NZJA 4HUVA 1TJHH 5I8KH 4ZUVB 1MIEL 1W72H 3KXFA 4Y1AA 4U2ZA 4K8RC 5D5MF 4LCWB 4KV5F 4FA8A 1AO7E 4N8PA 4PGZA 1P7QD 3QXVA 2VDOL 2DMBA 4NQDE 5JNYB 4FQQB 4KKAC 3IDIB 3E2HB 1XR8B 3ARUA 3ISWA 2R9HD 4XP9L 1JMXA 4LGSB 1PG7L 4O2EB 2E6PA 4LVNB 2C1OA 2D4DA 2VLKB 1YJDC 2B1HL 4O9HH 2I60L 4HUMB 3C2AH 1NDGB 5CEXA 2AJSH 5JR1H 1CE1L 5E9DD 3KPLB 5GGVH 1WBXA 3RUGB 4KVNH 3ZKXC 1FDLH 3G08A 3GI8L 4LLAA 5IR1A 3IAPA 3BI9X 5EIIB 4Z7WB 5CGMA 4R4BA 1HXYB 4YAQA 5DC0A 1VFBA 5HHXH 1DBKL 4XNZC 4YHYB 2VRAA 2ADFL 2NY4B 4YPJA 3C8KA 3MV9A 3V5KA 3DRTA 3G5XA 1IEAA 3SE3C 4WI9A 1QYGH 4P2QA 1NBVL 4AG4H 2JJSA 5EPMA 1JHLH 3OKKA 4RISL 5HVFB 4X9BA 4NRYA 1JBJA 2Y36H 4PRPB 4CJ0A 1TJIH 3O45B 2VR9A 1JV5A 3CFKA 3TBVA 3SDDD 4Y4FA 3BYTA 4YHLL 3BPOB 3JWDH 5FYJD 1G7MA 1BD2E 1IM9A 1VGEL 3BSZL 1AJ7H 2IBZX 3IRPX 2GTWB 2PYFA 3H7BA 4HGMA 4O58H 4EUPH 3ARDD 1YEEL 3Q5YA 5GQBA 1KLUB 4Y4KA 4R2GC 3HC0A 4GSDH 1RJLB 1KB5A 3MLTA 3SDCC 2VQ1B 4YHNB 1VFMA 4P2OC 1R6VA 3CUPB 2VXVH 1BOGA 2PR4L 5FO8A 3STLA 1DQQB 2Y1VA 3NCYS 3I6KB 1FZMB 1MJ7L 1S5HA 3KPPA 4F9LA 4FRWA 2YRPA 1GOHA 4PYGA 5HHQB 5FB8B 1CIDA 1HOCA 1WZ1L 4Y16C 5D6CB 3UYPA 4BK5A 1MI5D 3BW9A 5L2KA 3ZO0A 3IJHB 4CU8A 1KIPB 3O0RH 1J0ZA 1I1FB 5TQ2L 2W0FA 3GO1L 1JZ4A 3V2AR 2VE6A 4WY7H 2ORBL 2X7LA 5C09E 1OAUL 1V3LA 1A3RH 4LSVL 4LLUA 4JQVA 2NY3C 5D1QB 1MJ8L 4PG2C 1HCFX 4RGMB 1T21B 3QRGH 4LL9A 4P46D 3H9SD 4LLWA 4CN4A 3RGHA 3C5SB 4XCEA 3W0WB 2YRZA 1XR9A 1JUFA 3HUJA 1UCBH 3N9GH 3PWVB 3MA7A 3SCMC 1T20A 1U8QB 7FABL 1TENA 2GY5A 5E8EB 1EJ6A 3NFNA 5ANMA 1S7WB 3WFHB 4MCYB 1I3GH 1EZVX 3DBXA 2GJJA 2BXYA 1BQLH 4HUUA 4KY1H 4CAGA 1G9MH 5F96L 3DV4B 3B43A 1JHKL 4WI2A 2V5MA 1KJ3H 3Q3GA 4N5UA 3QDJA 3NCBB 1IC4L 4BQCA 3GSXB 4Z8FH 4MX7B 1QFWM 2UY6A 5DRZB 1MELA 2BJML 1QSFA 5ALBH 3KLSA 4HWBA 3FAXA 4DOHE 2IFFL 4ZSOA 3S96B 5KAQF 1LK2A 1WCBA 4PLKD 1DR9A 5LXGH 4DKEH 35C8L 4MNQE 5JW5B 4OAWB 3DMMC 2HTLC 4LP5A 2W38A 5BV7C 1WZKA 1D9KC 1X5JA 5MENA 4XXCA 5D7IF 3WIHA 4G6KL 4HEPG 4L4TD 5KVDL 2E7LA 2JJWA 4XWGH 2Y4SA 1CXKA 1HHGA 2MHAB 3PWLA 1MHHA 2AGJH 3LN4A 3DIFA 2NTFB 2QR0A 4D2NA 2FATL 2B5IC 4FABH 1AQDA 2VMFA 3VXPA 1FJ1A 2IAMA 3KPMB 2VSCA 5JORA 1RURH 1BVLB 1P9MA 5GS0L 3B5GA 1I9RL 1OW0C 1UM5H 4MDIA 3PWPB 1P2CA 5KS9A 1J1XH 2JELH 1BJ1H 1U8LA 3GEWB 2B2XL 1H5BC 3HR6A 2CGRH 1H3PL 1A6WH 3HE6B 3UTTA 3RX5A 3O6KH 1WISA 4OZGE 5HHME 3D6GA 3MRPB 1TTGA 3DSFH 3QEQA 4NOBA 4NZRL 1S7QA 1NMBH 5I9QB 1E4WL 2VQTA 4FQXA 1T1ZA 2WUCH 2ZSWA 2FB4L 5JIIA 3OAUL 4ODHL 3RVUD 5H94B 1ZXQA 3DETD 5K9QI 2ITCA 4RWYH 3ZYIA 2WLYA 4QXTA 1XEDA 4TNWK 1LD9B 3F6LA 4KTEH 5E99H 2CH8A 1Z5LB 5E1AA 5C8JB 3C5ZD 5DZLA 2E27L 2NY2B 4Q2ZA 5C0AA 3X3GH 5FGRA 2H32H 3MOQA 4FFYL 5AZEL 1RVFH 1ZOXA 2BOCB 1IFHL 1I8IB 5GGQH 2IBZY 5JW4R 5M94B 1KTDA 5DXWA 4OD2A 4MLSA 2CIIA 5E00B 4CNIA 1ADQL 3MOBL 1FZOA 1NAML 2DTML 3EJYD 3W9EB 2A1WL 4U3HA 3BAEL 4XVJL 5E9DE 1QLRB 1AGCB 2ZCHH 5EOCL 1IQWL 2Q1EA 4EDWH 3MBEC 2D4FA 1Q9WB 5C70A 1HWHB 3UTQA 2K3TA 5HGHB 3SY0A 1FZKB 3IF1A 1WC7B 5FDWB 2H2SC 1NGWB 2X4TA 4HK3N 4ZPVB 3T77A 5CINH 2OR7A 1BEYH 4GG8B 4Z95H 4DWHA 1NFDA 3DTXB 4ELMB 2Y5TB 4G9FD 3NFPB 2PN5A 4XNZB 4DFHA 1GH7A 1ETZB 2VAAA 1QFWI 1EUUA 2OZ4L 5F9AC 3CFDB 5I1JL 4DZBB 5K59E 4IRSA 2P5WE 4GG6F 1PQZB 3GSNA 3LV3B 3QNXA 4FFVD 4XPTH 2VLJA 5CMAA 5DO2D 5T1LB 2KQNA 3ROLA 4JY5H 3QHFH 3QQ9D 3WSQL 4X7FC 4MDJB 4AEHL 4QXGH 1IAOA 5D1ZB 5IJVA 2A77H 4ZFFA 1FCGA 1U8MA 4LQ1A 1NANI 5JMOC 1EZVY 5SX4I 4JZNB 3W2DL 2Z8RA 3IDNB 5K9OB 4ZTOH 5CIPH 1Q38A 1S8DB 1MAMH 2O5ZH 1IAKB 4NT6A 1LE5B 1MI5E 1GGUA 3I3BA 1BHGA 3ARGD 4NQEB 1WEJL 5I75C 2ESVA 3BP4B 3RVWC 5HPOA 5CSZA 2IBBA 2NW2A 3RQ3A 2J6EA 4PGEB 4XRCA 1YC7A 2DLGA 1NSNL 3RWEB 1F97A 1TZIA 4LGRB 3GK8H 3KPRE 4P4RA 4M8QA 3UBXA 4Y16B 2Y07L 5DD1L 5KSAC 3VG0L 3CPLB 3VJ6B 3N1GC 3FN3A 3QCUL 4XAWH 3ETBF 1NH6A 3H9SE 4XXDB 1YDPA 3NCYP 4CW1A 3GKZA 3QXUA 1M6OB 1QLEH 1GGCL 1R5WA 1U58B 2NY3B 1U3HA 4ERSH 4CJ1A 1EGJH 2AQ3A 2VWEC 3WMSA 1EO5A 3QAZC 1MJJB 3QNYB 3KPNA 2F54E 3O2VH 4G7YH 4GOSA 1A1MA 1YMMB 1FPTL 4UT6H 5E2VH 3RTQD 2AJVH 3U0WH 3QQNA 4MMXC 4NSKB 5FV1L 1JNLL 1R3JA 2EDRA 4RGOL 3BD4A 3NIDE 3QQ3A 2CR6A 1TVBB 3X3FL 3V0VB 3D3VB 3D2UA 3P73B 5BZDB 4JFFB 5HI5D 5I1CH 5H2BA 4RFEB 1BPVA 4WW1B 1N6UA 4CVZB 5EN2B 4I18C 3A6BH 5DGRA 3ALWA 4K94H 5D72L 4WTWA 2R4RL 3RGVD 3VFUA 3JWNC 4WW2C 4PV9A 4XBEH 1OAQH 3AC0A 5ID0B 3BP6B 1W0VA 4L4TE 4PJCA 5JDSB 4JPKH 5BV7B 4PRBA 2FX7L 4J3XA 1CLYH 5GGRY 2C5DC 3BE1L 1D9KB 3MCG1 4D9LL 3RWHB 1PEWA 4QRPD 3TT3L 3EYFA 3ZT6A 4Z7QF 1YEGL 1FIGH 2CD0A 1CZ8H 1JWMB 3GSRA 3MV7B 5F9WC 5BS0D 2AW2A 5F6HJ 3MROA 3V8CA 1PAMA 2B5IB 4PJFA 4EN3A 5C07A 1OGAD 5C0RL 5FYJL 2XWBA 3REVA 1W0WA 2C1PB 4RMTA 3BH9B 5HY9A 1KUMA 2B0SH 1A4KA 1VACB 2X4QA 4UTBH 1QRNA 5F1SA 3GSOA 2I9LB 2IADB 3W11C 4RFNC 4K3EH 2APBA 2A73B 2PW2A 1LK3H 4YIQA 3MUGA 2HFGL 1JVKA 1R3KB 2BOBA 4IIQC 4L4JA 2SEBB 3V9FA 5MHSD 8FABA 4XC3L 5F9DC 3ZDYF 1BMGA 1A9BA 1MCPL 2AJZB 2X1PA 3HB3C 3NZHH 5MP6H 2BHYA 5BOZG 5HGAA 5I8EB 1ZHKB 5ACZB 3MBXH 3Q6GH 3ESVF 4R26L 1AH1A 4BKLB 3O6ML 3TJEL 3JTTB 3EYQD 2PTTA 3NIFF 4P2RA 5EZIL 1CXLA 4GXUM 2R9HC 4I0PD 2L0DA 3MLYL 2O5XL 2VUOA 1MCDA 5FK9A 3ILQD 2JB6B 3U6RA 4NQDB 3QA3A 5F8QC 1N0LA 4AT6B 5KANG 3IFOA 1FG2B 3ZYZA 4X8XA 3P4LA 5HDBF 2ZG3A 3F8UB 2IPKA 4WUUA 5I1KL 4QCIA 3BKJL 3BGMB 4UV7L 1XGYL 2EDNA 4NHCL 1BZ9B 1S7SA 1Z0MA 5KVFH 3TBYA 5ERWA 3DUUA 3IYLW 1Q0XL 3K46A 1UADC 5AWNH 3O4LD 3HPLA 2J88L 5I19L 3FQXB 1FAIL 5HHPA 3ALPA 3W39B 3PDOA 5ECJE 3RWFA 3TZVB 2VXSH 1QPXA 3SDDC 4L3ED 3QEGL 5FO9B 2XI9A 3NPSC 4HUWA 1IT9H 3FT2A 3SKMB 3MO1A 5FGCB 4LCIH 2D7PA 2C7UA 1G9NH 3O2WL 4JFYB 3WFDL 2R23A 3BIAX 3EFFB 1G6RB 3MFFB 5ESQB 1V7MH 2JIXB 2WBJA 3MRLA 3KHQA 4JN2B 1QVOB 4TQEL 1RSFA 1JPGA 3TC9A 2HT4D 4OF7A 4HH9B 5FA3B 3O3BB 1BF8A 4LHUA 4OCXH 3BT2L 4U1HA 1F6AB 5AAWA 3MMEB 5LVEA 4KXZH 1NLBL 4HDIA 1Q9LA 1TFHA 3DHMA 1IKFL 3JWDC 4PJGE 2W9DH 3QG6B 3U4BL 5I75B 4I3SL 1BAFH 5J9PB 1ZAGA 3FO1B 5E8PB 3VFVB 4QXUL 1B3JA 5KVGL 2J8UA 3L3OB 3ARFD 4W68A 4K7PL 1NL0H 1GGYA 5I15H 3UDWA 5KOMC 2EH7L 3FQTB 5IF0B 3V4PH 3P30L 4LIQH 4OCYL 4BK4A 4KMTH 3HS0A 1F6FB 4HWZB 3VFWB 5DJZA 5F1OB 5IJKA 2DBJA 4N0CC 4IM8A 2EDEA 3D5OF 4RMRA 4HC1L 5C0FA 2WAHA 2FZ3B 1UT9A 4H0HB 1B0GB 1A6TB 3QAZB 4ZS7L 3QWOA 3RJDA 4OZIA 4Y19D 2NY1C 4J2XA 1LO5B 3PQYA 4S1RH 5F70A 3UZVB 3OL2A 1PZ5A 1A7QL 5DK2B 1T7WA 2R56L 5DI8B 4MA7H 2ZKHL 5E5MA 3QFJE 3MRGB 1C08B 1U8KA 3SKJL 4QWWD 2XQYK 3CK0H 1LDSA 2R2HB 2XZAH 4FZEL 4MA3B 1EO7A 3C6LC 1NC4B 4G8GD 1FBIH 4ZUVA 1VGKA 2C4XA 4P59H 3J8F7 4Y8DC 5IVZB 4DOHB 1M05B 5CZVL 1QFWL 3PP3H 4TNVF 3PGFH 1J0JA 4WW2B 1GGIH 3BKCH 4LASH 1F3RB 2HJKA 5JNYA 4WEMB 5E8DL 3IDIA 1XR8A 3VXTB 3BQUD 3MJGX 4Z76B 4QRTA 1HHJB 5CZKA 4ZPTB 5BS0E 1NCBH 3PP4L 1BIIB 2VLKA 4O02H 1XGRB 1OTTD 1HKLL 3I50H 4YNYB 1OGAE 3P4NA 5DHYB 4OFYD 5JO5B 1AHWA 5IWLC 4JEGB 3RUGA 1D5BB 5SX5K 5F9WB 3NA9H 4HS8L 5F7EL 3ECBB 4Z7WA 3HMXH 1P53A 3TA3D 1DTUA 4RIRB 4UILH 4PP2B 1HXYA 5DMJB 4HULB 1P4BL 4G9DA 4OGYH 1T80A 3FFCB 1WIOA 3P4MA 4RFNB 3QPXH 2F5BL 2P49B 3PJSB 5LBSH 4Z9KB 3NCJL 4KMQA 3E1F1 4OZGB 4IIQB 3RA7L 4AMKL 4E9LA 4PRPA 1M7IA 1UZ6E 4U0RC 2Q87A 3O45A 3VFOA 3QO1A 1RQ5A 3L3IB 4Q97A 2XXCB 3JXAA 5DUML 4GXVH 4HXBH 2VXTL 5ELIA 1CFVH 5EZJB 1KLUA 4Z7VE 5GPRA 1RUAH 5JXEA 2EO1A 4FQIL 3SDYH 1LO4L 3AY4A 4B5EA 1K3IA 1P7QB 3PXJA 1TCRA 3K2MC 3CUPA 1DQQA 3I6KA 1IM3B 1FZMA 3F65A 1EAJA 1V7NL 3WV0A 2W07A 4PD4J 3QXDA 4EIGB 2NCMA 2EDDA 3PGDB 5D6CA 5TFSL 1GL4B 2AEPL 1LILA 3C60D 3IJHA 5E9DB 3GGWB 1KIPA 4UBDC 1I1FA 5CP7B 1W72B 5FHAL 3AROA 1EJOH 4ODTL 3QXTA 2CUMA 2Z0BA 4GW5B 3UJIL 3O4LE 2Q76A 4WHDA 4TUJB 4HLZG 1U3JA 1TXKA 2DIBA 1QFUL 3B8YA 2QQNL 5D1QA 3V6OE 5KN5A 3Q6FB 3QPQD 4AEIL 4NUGH 5D71H 1K4CA 1RU9H 5ADOH 1T21A 2MQCA 1JI1A 3C5SA 3W0WA 4FFVC 3DYOA 1SM3L 3LRGA 3V4VH 3QQ9C 5HGBB 4DVRL 3PWVA 4M6OL 5DFTA 4YE4H 5IW3A 5CJ5A 2YPKA 3SDDB 2PETA 5E8EA 2X40A 1RPQA 3NPSB 3WFHA 1E28A 4MCYA 4JHAH 2CPCA 3ARDB 3DV4A 4HZAA 4D3CL 5L2JB 4H8WH 1JF6A 3V7MA 4Y5VC 1BF2A 3NTCL 4MX7A 5EWIH 5DRZA 4HLJA 1QKZL 2BMKB 4DGVL 5BVPH 4GQPH 1FYTD 3ARGC 3KYNB 1UACL 2N4IA 3S96A 5D2LB 2X9WA 3HZKA 3I9GL 2D7OA 4XNYL 5JW5A 4DGIL 4BA8A 1LP9B 2J2ZA 4JFED 4MAYD 1MI5B 3S88H 3AMKA 1YEJH 4OFKA 4EUPB 3DWTA 4O2CB 3CVIL 1JP5A 3SQOH 5EC1B 2GT9A 4TUOB 5EDXA 4DW2L 2MHAA 2NY0D 1J88A 4CVXB 2HH0L 2DL2A 3SPVB 4OKDA 4P46B 3VGEA 3H9SB 4ODVL 5I8CA 3Q2CA 2F5AL 1MCFA 4Y19E 3TYGL 3BVNA 2A9NL 2ARJQ 3KPMA 5JHLH 1BVLA 2C3VA 4JGJA 4NM4L 3PWPA 3RTQC 2XNAB 3MLWL 1DBAL 2HN7B 3ME0A 4LIQE 2XXMB 3K4ZA 1PYWB 3LCYA 3NCFB 3CAFA 3HE6A 1XF3B 2GW5A 2PUQT 3MRPA 4PJIE 1G6VK 2P4AB 3WN5C 2C3XA 4L5FH 1OP9A 2MPAL 1RUPL 3VFRB 1NBYB 3CC5B 1CTOA 5HI5C 5H94A 3EJZD 4HJGA 5ESAB 4U6YA 5D2NC 3BWUC 1LD9A 2F58L 3GNMH 1FRGH 2FO4B 4AH2A 5C9JB 4L9LC 1ITBB 5FO7B 4GBXD 1JF1B 1ODAA 5C8JA 3S6CA 5EA0H 3QDGD 1QOKA 3HE7D 3H9HA 1D6VL 1BFOB 1UG9A 5DTFB 1JWUB 1F8TH 4K2UL 4BFIA 3GFUA 2E9BA 2FRGP 3BZDA 3ARBC 4L4TB 3WHE0 4H1LH 2BNRD 1QLRA 1WUNT 1AGCA 1HEZB 1FC1A 1Q9WA 3MXVH 4P5KA 4M7KH 1GHFH 2WUBL 4OM0L 2A6JB 4OGXH 1KCLA 5HGHA 4PJBE 4RBPK 4OCRL 1FZKA 3EYOB 1JTTA 1WC7A 5FECB 4OF8A 3MLSH 1NGWA 4FQ1H 4P23D 1PY9A 5DRWB 3REWA 3IS0X 3VGGA 2CKBH 4GG8A 1U93B 4QT5B 3PABB 3H42L 3VFNB 5I71B 3DTXA 1OAKL 4M6NH 4ELMA 4PGCB 1ZEAH 1ETZA 5H37G 1OB1B 3GZKA 5F3BB 1J9CT 4TRPL 4DZBA 4N5ED 3SE3A 1PQZA 1FFOB 5DJ0A 1CG9B 3LV3A 5TF1L 2OR8A 2NY5L 3WO4C 2PXYD 3VXMD 5HYIA 5T1LA 1ZT4B 5F7LB 4I4WA 4OI7A 1KLFA 4MDJA 4U0RB 1LEGB 4S1SL 4KC3B 2I07B 3VDCA 3R8QA 4L3AA 3QUZC 3OR6A 3C5ZB 3BP5A 3O2DA 4W70A 3UJTH 1W2KT 4JFPB 1VCAA 3ZMRA 3QWRD 1A14H 2I5YL 4HF5H 4RQQB 4OLWL 3RL1A 4WFHD 5KSVA 1QNZL 4QGTA 2OYPA 5DVKA 4EKXA 3IDNA 4OF0A 3BP7B 3SDCA 5F7HA 1S8DA 3T3MF 3EYUL 5DYOA 1JZ6A 2Z4QB 3HMWH 1I9IL 3F5WA 2DQCH 3MPCA 3S34H 4PGEA 4EXPX 3RWEA 3GM0A 3MLZL 1L6ZA 3ULUD 4KJQD 4R0LC 4Y16A 2MCG1 2AK4D 3TGXA 4TSCH 3CPLA 3MRBB 4YHKH 1AY1H 2H32B 2EXWD 4PJ7A 5T1KD 4XXDA 4X8JB 3S35L 4KHTL 4G6JL 3WS3A 1U58A 2J3SA 5TDPB 4BUHA 4G9FB 3B2UD 5AAMA 3BDXA 2QSCH 1BBDH 1XGQB 5EU7C 2EE3A 3QUML 4U1SB 4PG2A 1C1EL 3MFGB 3VD7A 4LSUH 3QNYA 3WO3B 1ACYL 4HAFA 1GJIA 2X1QA 5J1SC 1YMMA 3SE4C 1T0MB 3WJJC 3G5YB 1G7JA 4PJ9D 4HFUH 3SCMA 1DZBA 4NSKA 4X6EB 1JNLH 2UZXB 3VI4F 1N8ZA 1S7TB 4NKIL 3D3VA 3P73A 1FYTE 5BZDA 4YHMH 3JUYA 1A6PA 3FT3B 4FZ8H 1T1WB 3RWJB 3O4OC 2QADD 4CVZA 1QHOA 2X89D 5EN2A 4JVWA 4FQ2H 4JFEE 4OZHB 4XBGA 1CU4H 3ARGB 3WJLC 2WNGA 4F15C 1R5VB 5CJXC 5EO0B 4OT1L 1KBGL 1CFNB 1EO8L 1L4IA 3IDJB 3KJ4C 3ARFC 4JFDD 5ID0A 3UZQA 3DMMA 4PJGB 1MHEB 4XB8A 3FQWB 1KGCD 5JDSA 2ZOKA 2FX8H 4N1HB 1D9KA 5TE6L 1R3IL 4ZNEE 4M7LT 1FN4B 2GCYB 1JGUL 5CIPB 3RWHA 4PGDA 3UP1A 2R0WH 1NEZB 1MHPL 1KPUA 2VDLL 5K9JL 2P7TB 3GI9H 3LS4L 1JWMA 3MV7A 1YNTB 3LEYH 1DP0A 4X4YA 4JDTH 1N0XH 5FYLH 1C5BL 1A3LL 2C1PA 4RX4A 4XTRC 3BH9A 5F7MC 3X14B 1OW0A 3RTQB 1VACA 4O2FB 2WIMA 2IADA 4CN1A 4X9FA 1GSMA 2A73A 3VU2A 1H5BA 5ICXA 4NKOA 3T3PE 3U0TB 4X4ZA 2SEBA 2IJ0C 3G6JE 1OD9A 5DQDL 3WN5B 4U1IB 1E6OH 5D93C 5FHBH 1INDL 5DMYA 2CXGA 1KEMH 4KDVA 1X5GA 2GIYA 4HAGA 4QWWC 1RMFH 2WWKO 3LQMA 1R0AH 3BHBA 1KIRA 1P7HL 5FYLD 2AJZA 2Z31C 1M71B 1CXHA 1X7QB 2VZ3A 4GKSB 5I8EA 1ZHKA 2VC2H 5ACZA 3RGVB 4PY7B 4YO0B 5B39A 4HPOL 1GYAA 4L9LB 1X4YA 3FN0L 3K8LA 4M1DH 2FEEI 2GFBB 3SN6N 5IG7A 1PDKA 2GJ6D 5EZIH 5DJCA 4DGYH 1MY7A 1T0NA 4MAUL 1YQVL 4R4FL 2NPLX 5I74B 3BRDA 3S4SA 3LSOA 1Q1JH 3FHQA 1IGCH 2W91A 2JB6A 4PUBH 3FHAA 4NQDA 3FB7B 1B90A 1T1YA 4QRPB 3I84A 4FQPA 3AREC 4P3CH 4AT6A 4KZDH 4HS6A 5DVNA 3DRQA 1FG2A 3MBEA 4WWKD 4M3JA 4KRPC 5BS0B 4DCQB 4S1DD 4KMLB 3TA3C 3U2SA 4UIKH 1OGAB 3BGMA 5J6HB 1MCNA 2EXYC 5J0BA 2L7JA 4TYUA 4LQFH 5E6ZA 1HH9B 1ZA6A 4ZDHB 2OJZH 3HR5A 2YD7A 4WI4A 1A6UL 5INDB 4HGWB 3HZMB 4OQTH 3VXME 3FQXA 2ZG1A 3S3SA 5DJ8A 3TFKD 1EHAA 1K6QL 1VFAB 1RULH 4JVUA 2ICES 2MMXA 1P6FA 2HLFC 3BUYB 3U82B 4NRXB 4O5LH 3WO4B 4KJYB 2IPTL 3PF2A 4HIXH 3SKMA 1G9EA 4HJ0C 4HMCA 4ZD3H 2QQQA 5CEZH 2VTFA 1AGEA 3IFLL 2V5SA 3JTSB 4JFYA 3LQAL 4LFHG 3EFFA 1LE9A 2FGWH 3STZB 4F7PB 4UU9A 4J6RL 5DFVC 1YN7A 4PREB 4P2YA 5FA3A 3OSKA 3QT2A 4KROD 3CSBA 4Z7VB 1RJZB 2X4NB 4I0PB 5IT2H 4X6CF 4DN4H 3GIZH 1F6AA 3MMEA 3CLEH 4FFWD 5EUOE 3P9WB 2AK4E 3C60C 3QG6A 5HHOD 1MPAL 3FO1A 5A2KH 1IGIL 3VFVA 4MA8L 3L3OA 4XMKH 2EH8H 4OJFL 3WNMA 1JYXA 1QQDA 4R0LB 4X6DE 3O3UN 4HIJB 4NBZB 2ICEB 2VB5A 3SE9L 1D5IL 4P4KD 5KSAA 3MLVL 4U3XA 1NUNB 1GAFH 3OGOE 3LN5A 3MCKB 4NYLB 4UB0L 1IZJA 3O4LB 1Y18A 4HWZA 3VFWA 4YXLH 3WNLA 4QRSB 1JGVL 1ZVYA 4K3JH 5D7LD 4DK3A 4UUJA 1MQKH 1FP5A 4EZMA 3BH8B 2VUYA 2FZ3A 4L3EB 1A6TA 5CEYB 3VXQB 1BBJB 2AKRA 3MUZ1 3VGDA 1AD0A 1QFPA 5DK2A 5J8OA 4OLEA 4JZJC 4OFIA 5KANI 3ZKQD 4K71B 3ULSB 4F8TA 2BRQA 1MCOL 1XZ0A 3M45A 3F12B 3MJ8B 5DI8A 4WUKH 1EPFA 3MRGA 2HYMA 4ZUTA 1LO3H 5DK3A 1UJ3C 2R2HA 3TO4C 4MA3A 4QGYA 4C57C 15C8L 3CDCA 5ICYA 1NC4A 3B9VA 3O4OB 4KK5D 4I18A 3I02B 5A1AA 1NGPH 1KGCE 1KN4H 3MCLH 3LQAC 1M05A 2I25N 2V2WB 1VPOL 3KJ4B 3ARFB 3LIZL 2DI8A 4WW2A 5DQJB 2V9TA 4H8WC 4LLVB 2YUZA 3FOLB 2ZUSA 3VXTA 5B3JE 4IEFB 1CD9B 4Z76A 1HHJA 4P9HL 5CS7A 3PNWB 1BIIA 1NEUA 3HZVA 1S7UB 4NKQB 1XGRA 32C2B 4JM2D 1N64H 1U8NB 2VERN 1IC5L 5A16B 5JO5A 4J3OC 4PBVC 5J12C 2JCCE 3LEVL 3P9MB 1MRCH 4XNUL 4NJAH 4LPXA 3CXDH 4FXKB 4RIRA 4Y19B 4KJPD 4PP2A 3IKCB 3KPSE 3CSYB 1UENA 4HWUA 4ODXB 5EU6A 4I77H 3HZYA 3H9ZA 4PBXA 1YPZE 3FFCA 4NM8H 3PJSA 2LABA 3L5HA 5FYLE 4NQVB 4IIQA 1DBMH 3KYMB 4HZLB 1NLDH 3VGBA 1C16B 5D93B 4HKZA 3LHPL 4M48L 1EX0A 1QBML 3MRFA 3HUJF 1FNGB 2VKXA 4MXVF 3WFBH 2QV2A 4KU1A 3PDGA 2R1WB 2E9IA 4G8GB 2GJ6E 1DBJH 5EZJA 3PL6D 5EBGA 2WP3O 1BOYA 1FL6A 1PW3A 5D5ME 2R29L 4KV5E 1P7QA 3LKPB 2PYED 4N9GB 1KEGL 1IM3A 1JPST 3BQUB 5FUOL 5CAYB 2XZQH 4PV8B 4YXKH 1YEIL 3EO0B 1OSZB 1C7TA 3RI5F 4QHNB 4PLNC 4AK1A 1FGNH 4OLZH 3WUWG 5E9DA 3GGWA 2E7HA 3EOTH 5CP7A 1BGXH 4P23C 2IWGA 1SJEB 2OL3H 3N85L 4G8EA 4WJ5B 2QSVA 3M8OH 4GW5A 4TUJA 1Z9SA 3TA3B 2DQTL 3IDMB 4YQXL 4OLYH 3ARWA 3WLBB 2FJHB 4S1QH 1MF2H 2WW8A 1JZ7A 3DX8A 3OZ9H 4HS3B 4N5EC 4HV8B 3UPRB 5E08H 1KG0B 3CXHJ 4DN3H 3AUVA 3MGOB 1UWXH 5DLML 4ZO7A 5HGBA 4DVRH 4X4XA 4QYOB 4XPHL 1LDPL 3SDDA 1ZTXH 2P45B 5T33L 5E8OB 1B6UA 3N1QC 1TETH 4KAQL 4XP5H 3KNBA 3VW3H 2APWA 5IFHL 1BZ7B 3WIFB 1OT2A 1OAZL 5L2JA 4WEBH 1Q9KA 2BMKA 5HD8D 4ORGA 2HMIC 3ULVF 1H0DA 5HHOE 3UXFA 5EOQL 5CEZE 5A2FA 2BRRL 5D2LA 3QXAB 5JIPA 3DVGA 3ULUC 4M6ML 4MHHG 4KJQC 4YWGH 2EKSB 1LP9A 5AEAA 1MI5A 1KPRA 1Z3GH 3C60B 1RUQL 3GIVB 3LN9A 2EXWC 3UZEA 1WT5C 2O5YH 3QCVL 4WGVB 4PD4K 4YDKH 1S7RB 5CSGA 2BDNH 5EC1A 1AP2B 4TUOA 1CDBA 3DXAD 1S9VA 3QJHB 1HZHL 2YSSB 2DS4A 5SX5H 3WKML 3K8MA 4CVXA 3S98A 3SPVA 4P46A 3NMEA 2APTA 1H3UA 2FGZA 4G80B 5KVEH 4QRUB 1K9TA 2R69H 4JO4L 2FEEL 43C9B 4JG0H 3F6IA 4PJ9C 2W59A 2XNAA 2HN7A 3MLWH 2Q8BH 5JOPE 5IMMB 4PR5B 4L8SB 1NAKL 4L4VD 4LSSL 1XF3A 1II4E 3HA0A 1NCDL 5LWYH 5IEHB 3GMNB 4KUZL 1OGTA 1NFDF 1NBYA 4KVCL 1KJMB 4JZJB 3CC5A 3VFTB 3SBWC 2WWKT 2YPVL 1TZGL 1MEXL 3DURA 2XN9D 1OPGL 5FYKH 2F19L 1FYTB 4R4ND 1H3XA 3MRCB 2FO4A 4P2CG 3GMQB 3OAZK 3NIGF 1D7FA 2YWZA 3GDBA 3WIIL 1JF1A 3MV11 1FNEA 2EECA 1SY6L 4V1DD 4JRYD 4DZ8B 2VZSA 4BJLA 4YZFF 1AKJD 5E70A 4JFEB 2KBGA 3MXWL 4MAYB 1KPVB 5GJSH 2R1XB 1A02N 1EMTH 2GUOB 1A4JB 4I1NB 1BFOA 5E8NA 5E5UB 2FX9H 4NO5B 5DTFA 2X05A 3Q1SL 4M7LL 1JWUA 3BKYH 4OLVL 3IU3A 5F89B 5D7IE 4DQOH 2YOCA 5E4IA 4HCRL 3ZTNH 2XFXA 5FYKD 2GSGA 1HEZA 2NY0B 2BVTA 3SGDI 3RJQB 3MACL 2VNCA 1I4FA 3RZWA