5HI4C

Binding site elucidation and structure guided design of macrocyclic il-17a antagonists
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLIHGVTRNWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-17A
publication title Binding site elucidation and structure guided design of macrocyclic IL-17A antagonists.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/inhibitor
total genus 48
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hi4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hi4C01
4LCYB 3DVFA 4L5FL 4W6XB 4NGHH 1HHHA 2C3GA 2VJXA 3TFKD 1QRNE 5L88H 1PEZA 4GS7B 1H3PL 4NOFA 3LH2H 3T0EB 1RZIA 1S7UA 5IFJB 3I3DA 5CAYB 1U6AH 2HJFA 4X80L 3IF1A 3LRSA 4LDEB 3SO3B 3FT4A 4K55A 5KS9A 3OBAA 4C56A 4K94H 5C07B 4JZJA 4GBXC 1W72L 3KNBB 1T4KA 1NCTA 3N1FC 3QIUC 1LNUA 3CIQA 3MRQB 4WV1C 1OW0A 4PJCA 1SJHB 2DQTL 1X5FA 3LAFA 4XMPH 4IRZH 3HR6A 1L9NA 4NZDA 2XT1B 4TYUA 4TNVF 1EXUA 5DQ9A 3RBSA 5I8OL 1T0MA 2VAJA 3ULVE 3P77B 5HJ3A 1FNLA 4GKZB 3IFPB 4M62H 4HUVB 4FQIH 4MJ6B 2Q76A 2OL3L 1FYTE 3KPOB 3LN5A 4X6CF 4EOWH 2D7TH 3V0VB 3G5YA 1LO3H 1YUHA 3WS3B 3MRPB 2W9DH 5D7IA 1B2WH 2O93L 1CD1A 4LOUD 5DJ8B 5DS8B 3DX7B 3GO1L 1JZ8A 1WTGT 1FP5A 4K7PY 1MVFA 3UBXB 4AJ0A 1AE6H 3TZVC 1VERA 5IQ9A 5TQ0H 1QLRA 3DX9A 4GJTB 4J3WA 4FFWD 1UWGH 3QDJE 4WUUB 1R3IL 2NZIA 3PWPE 5D6DC 4JFYB 4P49A 5DJXB 3LD8B 4NKOB 1OD7A 2E5EA 1ROWA 3LSOB 2QSQA 1A4KA 5F7MC 1R5VB 3QP3A 1KC5H 4NCC1 3IDGA 4OGYL 5KSAD 5TE4L 3G9AB 2B39A 3P9WB 2A6DB 3DOSA 3CLFH 3GMLA 2IG2H 3S4SA 5GS2H 1NCWL 2EDKA 4KK5D 5TDPA 2B4CL 5ADOH 1D5MA 1W72B 1E4WL 3HI1A 4NO2B 3GGWB 1BWWA 5F7NC 3L7FB 3M45A 3QNXB 3RUGA 4XX1G 2R23B 3LKRA 1JPTH 4OLYH 2R1XB 4EUPG 3SE8L 4N0UB 5T33H 3EDFA 3MLWH 1A7RH 4UT7L 2F54D 4F7CA 1TLKA 1O0VA 2VWEE 3C60A 5BS0D 4R8WH 4PRHD 4M03A 2OL3B 4Y5XC 3VXQB 2IPTH 4NQEB 4ZFGL 5IK3B 5FK9A 4TOYL 1EUUA 4WFHE 1SYVB 4FN0A 4M7JH 2VERN 1KLUB 3HE6B 2P8MB 1QG3A 4X8XA 3Q6FB 4W6WB 2OCFD 4P9HC 4U3XA 3GSOA 1AP2B 4PJXE 5SX4I 1ZS8A 4L3CB 4OFKA 1CD8A 3OB8A 1UM6H 3RVXD 4PJEE 2XQYG 4XB7A 3MLVL 2J4WL 3SKNB 3QWOB 3L7EB 5C07A 1PZUB 3KXFE 4DOHE 4FQPA 2AVGA 2CKNA 5DFTA 3JBG7 2OTPA 3ARBB 4XNMA 3MRQA 3NMEA 2H32A 2AEQL 4X5WA 1OAUH 2G5BA 3KLAB 1JVKA 4OIBA 4OLUH 3MYJB 3C5JA 1X44A 3QUXA 5HYEA 3E3QE 4N9OB 1HK6A 5E7FA 1DUYA 4GKZA 4POZC 2CRIA 4FQCL 3P4NB 4BELD 4ENED 4L8CB 3ALPA 5DMIH 3MACH 4N0CC 3H9SD 2C3VA 3KYAA 1I8KB 3MRMA 1QACA 5ESVB 2A6IB 4HJ0C 2HT3C 5D5MB 4D3CL 4JFOA 4MX7A 1FG2B 1YEIL 1F4XL 3DX7A 3HCVB 3QRFM 2PXYB 1BZ9B 1JHKH 1CQKA 2AQ1A 4PFEA 4Q9RH 3D25B 3VI3E 2EC9T 1R5IB 1J86A 3ZYZA 4G6KH 5TDOB 1IGIH 1N0XH 4WUUA 3D0LB 4XC1L 4AT6B 2DOCA 3BUTA 3KLSA 2FL5A 4X9GA 3BYTA 3EYQC 3LSOA 2JJSA 2Y07H 4LPUA 2WQRA 1ZT7A 1G1CA 2WMPA 1RSFA 2P49B 5T1LB 4GUPB 4HWZA 3K46A 4OI8A 4U6HA 4OLZL 5L2KD 2OQJB 4E0RB 1XR9B 3EJJX 3VXUB 3C2SA 3QPXL 2QADC 3TVMD 2VLKB 3IJSB 1IAIL 3FQWB 1FJ1B 1OP3H 1XGRB 4R96B 4XVSH 5A16B 1F42A 1HDMB 2WLYA 5D7JB 1T1ZA 2R9HD 3L7FA 5HDBF 1OGAA 5IQ7L 3H0TB 5JA8B 3RZCD 4JKKA 2EIEA 5DQDL 4U1NA 2R1XA 4FQJL 4PB9L 4LLMB 1P7KB 4N0UA 4P3CL 3I9GH 4MDIB 4BA8A 1PKOA 2XKNB 5A2IH 3TT1H 4YDKH 3SQBA 3CDYA 4YHML 4GRWH 2CKBA 4A2MA 4FXLA 5IFHL 1M7IB 4OQTH 3Q6FA 3QIBC 1RZGB 3QEGH 5D96C 3W9EB 3WJLA 4UIMB 4MA7H 4LLWB 1AP2A 3NFNB 4QHNB 2HFTA 4YK4C 4OLEA 3MO1A 1J8KA 1I9RL 5EZLA 3QXDB 1FLRH 1N0LA 4FFYH 3GJFB 2XZQH 4U6VL 1K5NB 1NKRA 3QJFB 4Y19B 3SKNA 3QWOA 3BDYL 3A67L 3PQYE 3NCBB 4OZIE 5H37H 1X4ZA 4GBXD 1G7QA 4ODSL 3RWJA 3WN5A 3QIUD 1NMAL 3RGVB 1UCBH 2EE6A 4X98A 2GAZB 5I18L 1V5JA 1CLYH 3ZHKA 2FECI 2DF3A 1DBML 1CDBA 1T6VN 1X6NA 4E41B 4YWGL 2EH8H 3WMSA 4M43H 3LPWA 3P4NA 5HHMD 1CLOL 2YD4A 3F7RA 4I9WE 1EFXA 4GKSB 3UYOD 4IMKC 5CILL 5JOPD 3NBNA 3FN3A 1I8KA 5MENB 1FDLL 1WCBB 4R0LB 1GYAA 1FG2A 2AK1L 3MLRH 4LQ1A 3IFOA 2P48B 3HCVA 1FGNH 1FRGL 1ZLVH 1BZ9A 1RZ8B 1QKZH 1ADQA 1MCFA 2QQLL 2VDLH 4OTXH 1RUKL 3TZVD 1HOCA 3D25A 1RZJC 1QFWL 1BD2D 1I7UB 1R5IA 4PP2B 3D0LA 4Q9CA 4W4OA 2H8PB 5E8PA 1V7ML 3CMOL 2V5TA 5FGBA 4Z8FH 3O3AA 4RMWA 1VFAB 3TLRA 3FFDB 2XFXB 3GMNA 4M8VA 5FCSH 3U2SB 4HUXA 2OQJA 1F13A 1BJ1J 5L0QB 1IC5H 2A77L 5JW3L 3DMMA 3HG1B 4KZEH 3AS0A 1A6UL 5GRXG 3CSYB 3VA2C 2VLKA 5HYQB 1QSFD 4C54A 4DW2H 3FT2A 3LN4A 3QCUH 2VDQH 1EIBA 3UPCA 1KN4L 1CVRA 3HTLX 1ZV5A 1HDMA 5D7JA 4GAJL 4HIIA 4JFDE 2BERA 5D1XB 3QEHB 1MJ7H 1QRNB 2BP3A 1M6OB 4QNPF 2P1YA 3SKUD 3V5KB 5GS0C 3F6LA 4WGVB 1P7KA 1F11A 2GITB 2DLIA 3GHBL 4D0BB 2BY3A 3GRWA 5BVJB 2QKIB 1LD9A 3W81A 3NZ8A 1HILB 4NFCA 1FFOA 3SDYL 3QFJA 5CJ8A 1GZQA 1BBDL 2W0FB 3HMWH 3EYVA 1EHXA 4NZUL 1EEUA 1H9VA 4H0GA 5E2TL 3IS1X 5JO5B 4KKBC 4HBCL 4CVZB 3W9EA 4LCUA 2OP4L 1A3RL 4QHNA 1D5XA 3DV4B 2V2XB 3REWA 5ACZB 2XG5A 3GJFA 3SE9H 1DCLA 2WP3T 2F5BL 2D9CA 3RU8H 5C0EA 4U1KB 2CRYA 3GMRB 1FYTB 2PW2A 1FFPA 4J3SA 5T3ZL 1BEYL 2YUXA 2P5WE 5TDNB 2DQEH 2ZOLB 1JWUB 1UCTA 3RGVA 4XHQA 3BDXA 3I3EA 2GAZA 5EOQL 5IVNA 5CZXC 3C8KA 3WIHH 1S9KC 1J5OL 4P4KC 1OTSC 1O7VA 3EO9H 4I0KA 4PPTA 4OCSH 1FV1A 3OKLB 1AFVL 5F96L 1AQDB 4OCWL 4Q74A 2APTA 4JB9L 3ZTJG 4POZD 1UVQB 2F53E 3U6RA 5GGRA 2J1KA 5EIQA 4R7DB 4N0CD 3MJ9A 2X41A 4MB5A 4HJ0D 4EZMA 2HT3D 3BRDA 1QBBA 2JCCE 3UZQA 4FOMA 1MFDH 4NNXB 3PWJB 1BM3L 4FMKA 4B7LA 1N5YH 1OCWL 1TNNA 5DJ0A 1LO2H 3IDIA 5I8CB 2DQUL 3QUZB 1A7OH 1I7UA 3ZSSA 3O9WB 5IMKB 5ESAB 1MRDH 3GNMH 1KCSH 1LK3L 5IJVA 2DDQH 5E9DA 4G6FB 5MERB 2J88L 4D2NA 3EYQD 1RK1B 4MCYA 3FFDA 2XFXA 4M00A 5C0FB 2R15A 4NGHL 3WO4C 3U2SA 5L88L 1A9BA 4JFFD 2H41A 3MGOB 3QNZB 2CDGB 5C0AE 3IKKA 4WUKH 5F3BA 1YMMA 1AI1H 4JRXD 3P9LB 2QADD 3CSYA 2X4TB 4PJ5D 4I13B 2BY1A 5DRZB 3S5LB 1JF5A 2NXZB 2X4NA 4IOFC 3PGDB 4K94L 1PKQA 4F15B 1XF4B 4KQ4H 5EO9B 1M6OA 2YPLB 3QR2A 3DSFH 3W39B 5HDOA 5IHZB 1B90A 4FTVD 4XMPL 4IRZL 5FGRA 3NGBC 3RX7A 4V1DA 4P2QE 1CE1H 4KDTC 3N0PB 1HSAA 1ZK9A 2CUHA 5E2JA 2WWKO 3EOTH 4HJGB 1J87A 1BLNA 3JWOH 1MFEH 2D2OA 3KWWB 1P1ZB 4NUGH 5EN2B 3E8UH 4EVNA 2MOVA 4FQIL 1U42A 5HSFA 5KSBA 5IMLB 4X0KB 5KS9E 4LKXA 4PRDB 1ZA6B 3W5MA 3QIBD 1LO3L 3W5NA 4KI5F 4JLRA 3BJLA 1J1XL 3HPJA 5DEGA 3DV4A 1K8DB 4PJCE 1JHLH 2V2XA 3HZVA 2IWGA 2IH3B 5I0DA 3K4ZA 2ATPA 2VC2L 2FLRT 3BKML 3QUMA 3SBWA 1OQOA 5TQ0L 2VIRB 2YA0A 1I7TB 4YC2C 5TDNA 2V7NB 1XH3A 5C3LD 2P46B 4UDTB 4U6YA 3TF7C 4CNIB 5I30L 5C1MB 2EDOA 4JCMA 3ULVC 3B9DA 3I50H 4HS6A 4LCIL 4XP6L 3IVKA 2MMXA 3X12B 3RWFB 3ORJA 2EDNA 4Q0XH 5INDA 5IIEB 4YE4L 1UVQA 2N7AA 3SDCB 5IMMA 1FVDB 2AEWA 3GI8H 3CLFL 4MJIE 4B50A 4PJ7F 4R7DA 3ZT7A 1ZANH 5D2LE 5J1TC 2IGFH 2F74B 3ARPA 4ZO8A 4OD3L 2DI8A 4NM4L 3C08H 3GMOA 1XGQB 2FLBT 3TIDB 2YC1A 2JE8A 3ARFA 2VUOA 5FYLH 1JPTL 4HQQH 4ETQA 2V5RA 2IAMB 3O9WA 1TZGH 5IMKA 4APQC 3DTXA 2X42A 2G2RA 2H1PH 3T65A 3MLWL 5C6PB 1A7RL 2APVA 4ZAKA 4GAFB 4X99A 2H26B 1FAIH 4XPFH 3L5IA 2GCYB 3LS4L 5BV7H 1GXEA 3VH8A 5EU4B 1VKXB 4XPGH 3KLDA 3QB7C 4OGZA 5E1HB 1MIEH 1DANU 4LLQB 4CN6A 2C3WA 3HR5B 4IS6B 4KZDL 3LKPA 3QQNA 1LDPH 3RUGE 1I1FA 3OPZL 4C58B 5D72H 3B9KA 3JV0A 4Q58C 1U58B 5J6GA 1UM6L 3V5DB 3IJYB 4PREA 1BPVA 3S5LA 4NZTH 3EW3B 3JV4B 2GTZA 2VLME 5FKAA 1AD0B 2YPLA 2WBJC 5GS0D 4ZUVB 2DM3A 2DTML 1G7JB 3GZKA 4H5SB 3CNKA 3EHBC 2Q1EA 3U9PH 5BRZD 4LSDA 1NMCB 2NY5H 2BY0A 3BEWB 3N1QC 2EDYA 1E4JA 3FO9B 4JN2B 5C08D 1Q1JH 3OKOA 1CFSB 4LNVA 2ADJB 4X0KA 4WHTB 5I1KH 4W81A 4PRDA 1ZA6A 4KKBD 4DCQA 4U1SA 1UZ8B 4S2SA 3X3FH 1X6LA 2XQYK 1J0YA 1OSPH 1D9KC 3MROA 3B3IB 1A6AB 2PCPA 1JHKL 1W0WA 5C92A 1T03H 2FATH 1R24B 4G6KL 1IGIL 1IFHH 1N0XL 5I1IH 1RD6A 2QSVA 4IRJC 5CZXD 1V05A 1YA5A 4LCWD 2PETA 4ONOA 4P4KD 1OTSD 2VDML 3D18A 3TCLB 2IBZX 3EJYC 3RWFA 5TF1L 4ZTOH 2YWYA 2XWBA 1FVDA 4OJFH 1C7TA 4K7PH 2Z92B 3NPSC 5LVEA 2ADFL 1SJEB 2MTPA 4X5XA 2JELL 1UYWL 2NZ9C 3IS0X 5KAQF 2ERJB 3F7QA 2EE9A 3QI9C 1V7NH 3MUY1 5BW7C 3KPRA 2KKQA 3MV9E 2FH8A 4XVSL 4O9HL 1HXYB 1IEBB 1NEZB 5I1DA 1UWEL 2HKHH 1WWCA 3TIDA 1S8DB 4FXGB 1OB1B 2JB5H 5IBTH 2OTWA 3ULUE 3BXNA 4GOSA 1KJ3H 4JM4H 1HI6A 1I7RA 3VFVA 5C0GB 4YDVB 4RGNE 2EYRB 2H26A 3Q1SH 4HAFA 4XCYA 3NCEB 2GCYA 4JFDB 1S9WB 4AM0B 3ROOA 4PGEA 4CBPA 1C5DB 4BSWB 5EU4A 4I0CC 3O6LH 4QRPD 2W9EL 5IG7A 2CIKB 4OQTL 1T89A 3O0RH 3VXTA 4U1IB 5BQ7B 1N6QH 1X5ZA 1MJUL 4MA7L 3RHWF 2ICWI 1A1OA 3CFJB 4F37F 1FLRL 3NIFE 4UINL 3VCLB 4OZFH 2XZQL 5DJZB 1WIPA 4G7VH 1S7TA 1MCOL 5T1MA 4IOFD 4MAYA 4JVWA 5CMAA 2V2WA 3BGFB 2YD8A 1AD0A 4H25A 4P2CG 2VYRE 3BGMB 4GMSH 1UCBL 4ZUVA 1TFHA 3VFSA 1G7JA 3FFCD 1LO0H 2YPKB 2IBBA 5AEAA 3QXWA 5F6IB 3GMMA 4ZOBA 1GGTA 5DI8A 4U0RC 3OGCB 4ZUSA 1CTNA 3C2AH 4IM8A 3FO9A 4JN2A 3I3BA 2NW3B 1JV5B 3H7BA 1K6QH 1OAQL 5C0BB 2ADJA 4QRSB 1GGBL 3RNQB 3INUH 2RIKA 5FOBB 5HYIA 4H26A 2V17L 4BH7B 4LCCC 1IZJA 4ODUA 2XTJC 1A1MB 2FIKB 4MNQE 5GZOC 4J4PA 3DI3B 3IXAB 3BI9X 2F53B 1KF9B 1U91B 3CH8A 1QKZL 4OTXL 1EH9A 1YNKH 2AJ3B 2P4AB 4QTHB 4MLIA 4BFGA 5F7EL 1G6VK 1NAKH 3WDHA 2OMBA 2AI0L 3ZDXF 3U0TB 4GRWB 3ULVD 1NFDE 1P7QA 4XVJL 4QT5A 4IOSD 1JTOA 3HNTH 3B9VA 5JIIA 4XNZB 2HWZL 3LIZL 1IAOA 4M6AA 4YHKH 4JJ5B 3RY5A 2R56H 4YGVB 1IC5L 1XGPB 2Z31B 4ERSH 3D2UB 1RPQA 4GW1B 1T3FA 3EOYG 4DW2L 1L0YA 2VDQL 3NFPB 3TWCL 2AKRA 1G9NL 1Q94B 3VRJA 1MJ7L 3F7YB 2VKWA 3ZHDA 1S8DA 5ANMB 3JWDC 4QOKB 1OB1A 4LLYB 2B1HH 4HSQA 2GI7A 3RY6C 4X9FA 4APQD 5I8KH 2VMFA 4YDVA 3OF6A 1QA9A 3LB6C 3QUYC 1S9WA 5HGDB 3MRCA 1FGVL 5CJ5A 4PRID 2ZJSL 2ZNWA 2H6PB 5BQ7A 1I8LA 1F3DH 3D9AL 4WENB 1QR4A 1CFVL 3HRPA 1XF3A 3G5XB 3BSZH 5IROC 4JHZA 4HUMB 3WJJC 3U83A 3VCLA 3MRNA 5DJZA 3NABH 3RU8L 2GT9B 5FO8A 1SM3H 4UBDC 3C09C 2ZOKB 4JO1H 4OZ4B 4AL8L 1FNSL 1ZLUH 1QR1A 2MKWA 3OXRA 2VXTL 2Z93A 3BGMA 1RY7B 5KANG 3MV7B 4JG1L 4CAGA 2WBJD 2YXFA 3ESVF 2HJKA 3VGAC 1MCLA 2YPKA 1CG9A 3EHBD 4I2XA 4U1LB 3TNMB 3BPOB 4H1LH 1MUJB 4OCSL 3X14B 4YPGA 3ISWA 4WFHD 1BF2A 2YD5A 3BP7A 4Z77B 4Z7WF 3W2DH 1JV5A 3V6FA 4PJAB 3T8XA 5LBSL 1D5IH 3GBLA 4WI8A 2GSIB 3NCYP 1YEGH 2FHFA 1CICB 3CFEA 3QUKB 2OTUB 1D9KD 1FG9C 4XNQA 3VFPB 3QBTB 2NY2B 1MFDL 2VAAB 3LCYA 1N5YL 3VXMD 1LO2L 3QXVA 4MJIB 2MHAA 3O2DH 2BY2A 2AJ3A 1A7OL 5CINL 1G9MC 4P2RA 4QTHA 1MFNA 2M8XA 4JKLA 3C8HA 4PJBB 4XBGA 1MRDL 4MMXC 2D03H 1KPVB 3GNML 1KCSL 4IRJD 4NC2B 2DDQL 5M7QA 3U0TA 1XZ0A 3S37L 4LPTA 2HLAB 4MNHB 1UXWB 4N5UA 5HYSA 1SVCP 1NMBH 1F3RB 2J6EA 1XMWA 2RJMA 3EJYD 3ZDZF 1II4E 1M7DB 2R0ZL 2YHGA 4QRTA 4YNYB 5CFHA 5DHYA 3SQOH 1MCCA 3W82A 3VI4E 3UX9B 1XGPA 3MLUL 1AI1L 3D2UA 2NZ9D 5E8OB 2RGSA 2DJSA 3FCTA 4YBLC 1A6ZB 2FJFA 4GW1A 5EBMB 2VR4A 3QI9D 4D9LH 5KZCD 5DA4A 2WINA 5E9DE 3U4AA 5KVEH 1Q94A 1J0ZA 3F7YA 1A5FL 5J4MA 3IT8D 1JUFB 5I1CL 1AGEB 4PD4J 2QV2A 4QOKA 3H3BC 4JPVH 3DSFL 3TH3T 4NQSA 4JQIL 5I1JH 2EXWC 5C0CE 1KPRA 4Y16B 4XWOC 1CE1L 4Z0BL 5T1KA 5F8RC 5C9JB 5I19L 4PJIB 4I0PA 4ZPTA 1F6FB 2IANB 2WSKA 4J3XA 3LEXA 3HC3L 1MH5B 5LXGH 4Q6YA 1KTKE 1ZLWK 5CEYB 3RI5K 1PKQE 4D8PB 2X70A 1SEBB 1LVEA 3EO0B 5D7KD 3G5XA 4HUWA 3NCJH 1EGJH 5KN5A 1RJLB 1LEKB 1MSPA 3ARGB 4V1DE 3UJIL 2AJUL 5H35B 5C0NC 3TIEB 3F7PC 4X6BB 1YJDH 4XBPB 2V9RA 4OZ4A 2BVPB 1J1PH 3D3VD 3D39E 5FM4A 4R90H 4XMLH 4QRUA 5KSBE 1NCDH 2GK2A 1KELH 1NLDL 2AK4A 2G9HA 3CCHB 3BISA 1UZ6F 3K7UA 4QRQA 2BSED 5IV2B 3BIAX 4Q0XL 3QDMB 1INDH 4GAYA 2A6KA 3CLEH 4OZHE 4LHUG 4NT6B 1ZANL 4M7LT 4TVPD 4DGYH 3BWAA 3JWNC 3QHZH 3EOBA 3BAEH 2IGFL 1IAIM 4K8RC 2OTUA 5FDYA 4JKPH 4OCRL 3SGDI 2XTJD 1JNLH 1AGCA 2NY1C 3QRGH 2EDLA 4XXDB 5GZOD 5KW9L 4L9LB 5F7DB 1XGUB 3P9MA 3L3KB 3D85B 3C08L 1AH1A 3SGKA 1KEMH 1OARH 1VFOA 2CLVA 3FO2B 4ZXBB 2F8XC 4NKQB 3HB3C 4KRNA 1TZGL 5GGTA 4Z78A 4F9PA 2H1PL 1DE4A 1YNLH 3L5HA 3MV9B 1BJMA 3IGAB 1FAIL 2CUIA 4CU8A 3JTSA 2OS7A 5BV7L 3UTZB 5I73B 1OF2B 4RMRA 4ZPVA 1T7ZA 1MIEL 1JGVL 4L3EE 3OAZK 5DT1H 4BKLB 1HH9B 3DXAD 2XKUA 5EUOB 5D1ZA 1GHFH 5F88A 4Y4HA 2DICA 1PDKA 2H45A 5CGMA 4BYHA 5EU3A 2OJEB 1ED3B 1VHPA 4NZTL 4D0DA 4S11A 2XNAA 3MRRA 3V6ZB 4PJDB 1JUFA 4DZBB 5IWLC 3WIHA 4PGZA 1SY6A 4FRWA 2HRPH 2GJ6A 5EPMA 4Y2DB 2EKSA 2J3SA 3ARDB 5FYJE 3HMXH 2I60L 1GOGA 3V6BR 5LAXA 4WIQA 5IW6B 4IDLA 3U9PL 1FN4B 3HUJE 3PG2A 4XCEB 3LB6D 4ZYKA 3QUYD 1HXMA 4QXUL 5C9JA 1WBZB 5CJBA 3OKDA 1R3JB 4O02L 1ZGLA 2IANA 3DIFA 4JY4B 2BVUA 3N85H 1MH5A 3HHRB 1IC4H 2NMSA 1WBXB 1S7XA 5I1KL 4WW1B 4G9FD 2R1YB 2X7LB 4D8PA 4Z76A 4ZD3H 5C6WH 3C6SB 5FYKD 1AHWB 1E4XL 1DEEB 5FHAH 1OSPL 1I9IL 4IIQA 4L8SB 2DAVA 3QG6A 1YN6A 3WE6A 3C60C 1LO5B 1N64H 1PQZB 1QFWM 4UDUB 4X6BA 4U1JB 1W2KT 2W92A 1NH6A 4UBDD 3FT3B 2LFGA 4XBPA 1ZE3C 1IFHL 1PG7X 1R3HB 3LEYH 5BV7B 4QHMA 1TVHA 4KUCF 4GS7C 4QXGH 2NY4B 4Q6IB 4YXLL 5ICZB 3T0EC 2ESVD 2R2HA 1ES0B 2NX5D 3MJ8A 3TGXA 4P5MA 3P11H 5H2BA 3KPSB 5JHDB 2R4RH 3MRDB 5IV2A 3SO3C 1DEDA 4ZTOL 4P99A 3MLYH 2FBJH 3NTCH 5HYJA 3BOVA 2DB8A 2PYFA 4JRYB 1QUNA 4XNUH 3P0YH 5B3NA 3FQUB 1BAFH 4NT6A 1ERNA 3G08A 3TJHC 1NFDB 1HSBB 2JIXA 3CSBA 1D3CA 5HI5C 4EDWH 4GXVL 1AKJD 1V7NL 3TNNB 3CC5B 4OFYD 3D85A 4KJYB 3QUXC 1KTLB 1MCDA 2D31B 4ELKB 1MCKA 4X6DB 2VABB 4NO0B 2DKSA 1Y0LB 1JNHB 2JB5L 2W9LA 3UTPE 4LIQH 1KJ3L 3G6JF 3VFMB 5EU6A 2YRPA 1C16B 3KYKH 3QIWA 4ZDHB 5AG9A 3Q1SL 3PNWA 4M1GH 3I2CL 2VDRL 3VWKB 4N1CA 3VMNA 4M6NL 5EBLA 4S1RH 1QBAA 2WP3O 2J8UE 1B4JH 2NQCA 5IW1B 4LBEA 4HWNA 1P53A 1G7LB 1P69B 3GSWA 3KPRE 4M7LL 1U8QA 3PIQA 4OCNC 4DK3A 4HH8A 4PLJC 4HS8H 2CDEA 1N6QL 2IQAB 1ZT4A 5EIIA 1CL7H 1T5WB 1U8LA 1AXSB 1KJVA 3VH8G 1HIMH 1ZVSA 4LASH 1IZKA 3LD8C 5EA0H 5B8CA 2GIYA 2JJSC 1I1AB 3HZYB 5FM8A 1V3JA 2J2ZA 4G8GB 2UUDH 1H3GA 1P7HL 5GRUH 1GC1H 4DZBA 4HIEA 5JNYB 2BVEA 5DEFA 1F6AB 2ILLA 2QHLA 4AEEA 4Y2DA 4RGNC 2EXWD 1EJOL 4XWOD 3MPCA 3B43A 4U6XB 1TJGL 2X44D 1OGTA 4F33B 3C2AL 1F90H 4WU7B 3KYOB 4G8FB 2X4QA 5C09D 3INUL 2R1YA 3RNKA 2UYLB 2PR4H 2VLRD 1HHJA 3H3KA 1DEEA 3ARQA 5A40E 1UT9A 5HHPA 3AXLB 3VG9B 3C6LB 4OSUH 1CT8A 3EUUA 1LO5A 4MZ3A 5C0ND 3RA7H 1KIQB 3PABB 5EOCH 3ULVF 2AV1A 3NIDE 5HYFA 4WFED 3FT3A 4BSVA 5ACLA 3LOWA 3I6KB 4YX2H 2B8OT 3LQZB 3HE6C 1R3HA 5IBLC 1NAKL 1YN7B 3WJLC 1KTDB 5CD3B 4HUNB 4DUVA 2ARWA 2X1XR 2DM7A 1BQSA 5JHDA 3KPSA 3HNTL 4PJ8B 5I8EA 3L9RB 3WFZA 3T3ME 5EC1A 1ZTXH 5KSUB 4YHKL 4C56D 3GEWB 3L6FB 1T21A 1NSNL 4JRYA 2FX9H 2R56L 2VH5H 1N6UA 1UENA 5SWZB 4TNWK 1GOHA 4OZFB 5DRWB 3FQUA 1NGPH 4FP8H 3VWJB 4PG2A 5D2NB 4ERSL 4K8RD 8FABB 3SGDH 5TJWK 3AGVA 4HKZB 1AIFB 2NY1D 4X9BA 4YHPB 4OFVA 4JPIB 2D7NA 2EIBA 5ICXB 4WW2A 3VGFA 12E8H 4XBEL 4ZFFB 4NQXA 2B1HL 3HB3D 3KG5A 4GRLA 2B4CC 4OZGA 1MELA 3UTQA 4GXUN 3NAAL 2V5SA 1C16A 4JM2A 2HT2C 1MRCH 2DQGH 4M3JA 4MHHG 1S7WB 2Z91B 4N9GA 4ZDHA 3S36H 3MQIA 3LKOA 3PDGA 2E7BA 3VWKA 3D0VA 3MOAH 1TCMA 5E2UH 5C8JB 4BFBD 5FV1L 5EFIB 4RQQB 4LK4A 1NFIA 3IDNB 5D9SB 2PXYC 2KL6A 1F97A 3UZEA 1JYWA 1IQWH 4UAOC 2MSPA 3PHQB 2L7UA 5C0CB 1CWVA 1INQB 2NY3C 4PP1C 1BVLA 4XWGH 1T5WA 4PRPD 3TYFB 1AXSA 4EXPX 4RNRA 3T77B 4W4OC 1Q9KB 5T1DH 1ETZB 4FXKA 1YY9C 4RMUA 5ITBH 5FGBC 3FQXB 5JPMB 3NABL 3THMH 3PJSB 1JIBA 1SM3L 1U93B 4JO1L 5K33A 5I17B 2EEDA 3QEQE 4H8WC 4L8DA 3KPQA 3O4OC 1YQVH 5E4EB 3DMMC 3IFLH 4U6XA 1YECL 1CBVH 4PJXF 5BS0A 4PRHA 2JJWA 1S7VB 4PV8A 4BQ8A 3ZHLA 4F33A 4PJEF 5KVFH 4RX4A 2NTFB 4CADB 1O7SA 3HS0A 5D7JC 3WLBA 3D39B 3LN9A 1IGJA 1MFAL 1G9EA 3T4AB 2M2DA 3HLAB 3WNLA 1LDSA 1BECA 1D5IL 3VDAA 4J8RB 4MJ5A 1JGDB 2HKFL 3B2VH 5E8DH 5DMJB 1YEGL 4PJFA 1MCBA 2CD0A 5EG6C 5GRJH 3RL1A 5JUEL 3EOAA 4LGRB 1WWBX 3C60D 4I2XE 1KIQA 3HNSH 2J8OA 3O2DL 2WUCL 4NO5B 2YD1A 1A8JH 2V7HB 3I6KA 1TETL 3G5ZB 4X7EC 4G80B 5HHXH 5CSZA 1B0RA 2D03L 4FA8A 5CHNB 3Q5OA 1MCQA 1NUFA 1TDQA 1NDGA 2Y5TB 3BP6A 1YN7A 2K7PA 2YRLA 2X4PA 5CD3A 4HGMA 3T0ED 4K3HA 2K3TA 1NAMH 3QA3B 1FE8H 1J0KA 1TZHA 3NH7H 1FNGA 3VXRE 1W8NA 4U2ZA 1QLFB 4Z0XB 5C07D 3L6FA 3KDMB 3VI3F 4P2RE 3V4UL 3TJHD 3RGVC 2A9NL 1ACZA 5F1IA 5D2NA 5CJOH 5HI5D 3K0WA 5DRXB 4D9LL 4EI5B 4NIKB 1JPSH 4YHPA 4PS4H 3GSVA 4DZ8B 2CK2A 5JIHA 4L3EB 2YR3A 3ZDYE 3QUXD 3LPFA 2AV7B 1WZ1H 3R06A 1SQ2N 4ZFFA 4HHAB 3LZFH 4HF5L 5H94B 5TH2B 4JPVL 4H1LB 4TUKH 4MJ4A 2AJVH 4JZNA 2IBGA 2G75B 3IDYC 5IGXH 2BX5A 2AXGA 2WANA 1S7WA 2Z91A 4KJWC 4R0LC 3SGJC 5JLZB 3IJHB 4O2FB 3O3UN 2VXVL 3ARZA 2HFEB 5E6IB 1FZOA 1YEHL 4RQQA 5EFIA 3WFHB 4I3SH 3RKPA 7CGTA 5LXGL 4X4XB 5D9SA 4WO4B 2BJML 3TC9A 2UY6A 1INQA 2HN7B 4RMSA 4PLJD 3ZKNC 4XGZB 2A1WH 1SYSB 4WUUD 3T77A 3HUJB 1Q9KA 1T22B 3NCJL 3JV6A 3TVMA 3QO1A 4EXKA 1EMTH 3GB7B 5FA4A 5MEPA 1KCVH 4OKVA 4PRAA 3MRGB 1EA9C 3ZT5A 1U0QA 1YJDL 4PTTA 1U93A 5ALBL 3RZCA 5I66B 5I17A 1J1PL 5GJSH 2FJHB 1XGYL 1QBLH 3VD9A 1IGYB 4JQVA 4WHCA 4RGND 4L1DA 1NCDL 4K7FA 4L29B 3G5VB 4K9EC 2ARJB 4RAVA 2QQNL 1WQVT 4NM8H 5CZVH 4HMCA 4KTYA 5F9JB 4JREB 5D1XC 3T4AA 3SJVA 1WEJL 4PGDA 2D7OA 4OZIF 5JW4N 1OGAD 3CLEL 2DWDA 4DGYL 1NCBL 1KT2A 3BAEL 2RCSL 5D6CB 5ID0B 1JNLL 3QRGL 5EB9A 2H9GA 2R1WA 4JN1H 2FJGB 4QHKJ 3ULSB 1LE9A 3VFTB 1NGWB 2AK4E 1KEML 3BPNB 3GJFK 1OARL 3GSNA 4NQED 4NHCH 3SN6N 4NO5A 4LLVB 2YPVH 4XP1L 2V7HA 3HE6D 4BUGA 5JPNA 2H2SC 1MWAL 3CVHA 5D7SH 5IBLD 1RJYA 1YNLL 3F8UB 2MPAL 4KGJA 3ECBA 4RFNC 3DJ9A 3EYOB 1S3KL 4JO2H 1XR8B 4RAHA 4NC1E 4KVNH 2ICWB 5DT1L 3SBWC 1HWHB 1VFBB 1S7QA 3OJDB 5B39A 1NC4B 1F4HA 1U8PA 5HYSG 1BGXH 1CI5A 1GHFL 2I9TB 3UTTA 4ODWA 1D7FA 2ATKA 3EYFA 3VFOB 3MLZL 5HGAA 3QDGB 4QRRB 1HH6A 3FQNA 2UZYB 2NR6C 3KR3H 2HRPL 3DGGA 2BNRE 5D6DA 1K2DB 3HMXL 3VE0A 2HT2D 4MDJA 2HFFB 3I6GB 5E99H 1J0IA 2AP2A 2CIIB 5JLZA 4O2FA 1YEDB 4OQ1A 5FIEA 2ZCHH 1L0QA 3MUJA 1OAYL 3N85L 3PE9A 3MA9H 3CFKB 2PXYD 3FOLA 2X4SB 5HVHC 2X40A 1J10A 2NY3D 1KOAA 4ZD3L 4MD5A 4PP1D 5I2IA 2YD6A 3U0PA 5EC2A 3O9WC 5IW3A 5FHAL 2GJ6E 1T22A 4F58L 4BH8A 1QSFA 1YY9D 3TBWB 2X4OB 2UWEB 4HLJA 2WW8A 2VXSH 3NA9H 5ILTL 4OT1H 2W60A 4NWTL 4KK9C 2MJWA 5CEZE 3WYRA 1P4LB 2FJHA 4ZO6A 2LU7A 2R8SH 1IGYA 3U9UA 3H9ZA 5I74B 4D9RD 3GMPB 1I1RA 5SX5H 3WHE1 1NC2B 2C1PA 4L29A 3DMMD 3VXUD 3MBEB 2ARJA 3P11L 5AAMA 3K8MA 2VLKD 2W91A 1OTUC 5ESQA 1CDUA 2NXZC 5MEOA 5D7JD 3UO1H 3MLYL 2FBJL 3NTCL 4TSAL 4D94A 4F15C 3BO8B 5D70H 4URTB 1FCGA 3DO7B 4S1SH 1U8MA 4N0FB 4P5KB 4WI4A 1BAFL 2OXHA 1MI5E 4R2GB 1I1YB 2N7BA 5IB5B 4MNGA 3I02B 5D6CA 5ID0A 2YKLH 3CDGB 5JORB 1LILA 2FB4H 1IGFH 3ME0A 2XY1A 3DURA 1M4KA 4M8QA 4LLVA 3QFJD 1TZIB 4JFHE 5JDJA 4LIQL 4ZUUB 3RTQA 2MCPH 4U6TA 4M4RA 4MAUL 1MFBH 3KYKL 3LS5L 3ILPB 1NBZB 1ULVA 4L4VB 5DUBA 3QJHB 3OL2A 3DVIA 1JHTB 1AGDA 2QR0B 4FQXB 3EYOA 5IB4A 3GIVB 4S1RL 2JCCF 1Z9SA 1B4JL 2EO9A 4U2YA 2XV6B 3B8YA 1KXTB 3TYGL 4Y19D 3B8SA 4K3GA 3WKML 1EGJA 5KTEH 1TJHH 1UM5H 4HS8L 5EZJA 2QSCL 3D69B 1ZMYA 1HIML 4NRZA 2Z35A 4LASL 4OM1L 2E7MA 3RGVD 5EA0L 3VFOA 3S88L 3L3HB 5EU6E 5L2JA 1H15A 4MMZC 1IM9B 1HCFX 3QDGA 4E41D 4XH2B 1GC1L 1OAKH 2NNAB 3GSXA 4P9MH 1BQUA 4NO3B 3RIFF 2BSSB 3MRLA 4OV5A 4IJ3C 1BX2A 1LP9A 1HQRA 4KJWD 4P2YA 2HJLA 4K94C 2W65A 4HX1A 5IFAH 5TQ2L 3CUPB 1A0QH 1IKFH 1YEDA 2VO5A 4KKLC 2HP4A 1MCWM 1F90L 5LGJA 3QEQB 2CDFA 4JZOB 3SKOB 1WCQA 3ZSTA 3E2HB 2VDPH 1UJ3B 3MV11 3VXSA 3ZKND 1D5BA 2PR4L 2IAMC 4R6UA 3U48A 4JRXA 2P24B 3LDBB 2Q8BH 2X4OA 5SV4A 5T3XE 1RU9H 2GUOA 2UWEA 3REVB 2IPUK 5EOCL 4RWYH 4Q9QH 1OQXA 4XRCB 2JJUA 4LPVA 1T89C 3QZWA 4N8VB 5KS9F 4YZFE 4YJZL 1Q0YH 4U49A 4I77H 3DROB 1LE5B 3MRFA 3HG1D 1YMMD 3EGSB 3MBEA 4PGCA 4P4RB 2SEBB 4PJCF 1KIRB 4HV8A 3WFCL 1IL1B 3EYSH 3HZMB 4X7SH 4ZFOA 5DVNA 5D1XD 3WFBL 43CAA 1X5HA 1YEFL 4N0FA 1WFTA 4FP8L 1H3XA 5J1SC 3BIKB 1FLTX 4K71B 3UYPA 5DJ2B 4AH2B 4YH6A 3E6FA 5GQBA 3VXRB 4PJ9A 4OLWH 4QF1A 1A7QH 4GT7A 4M6MH 12E8L 5AAWA 3O3BA 2FWOA 4HEME 4XP4H 3UTSB 2H2SD 1WZLA 4HZAA 3UZVB 2O26U 2DKMA 3FOMB 5KJRH 1MRCL 2DQGL 1NBZA 1I3UA 4L4VA 4KU1A 3QJHA 1JGLH 3S36L 5D2LF 1E4KA 2E8ZA 1ZVYA 2C5DC 3MOAL 1A3QA 4ZO9A 4J4PC 4ZSOB 1FVEB 1JF1A 4YXHL 1HHGB 5MP6L 5EOCJ 1IQWL 1MRFH 3F5WB 2R0LH 3NIGE 1RHHB 4OLVH 1IC1A 2XZCH 2A83A 2XRAH 3MOQA 4XAWH 5T1DL 1LEIB 4OZGE 1L0XA 4YR6A 1MHEA 3TBSA 4AEIH 1JWMB 5EO1A 4HPOH 4ZNCD 5ITBL 3OKYA 4YHNB 1UADC 5J13B 5F6HI 3THML 3U0WH 2J8HA 2P5EB 4I48B 2ZSWA 4LLDB 4X6CA 2NR6D 1P9MC 2A74A 2CQVA 3BUYB 5I6XB 2ZWLT 2VSCA 1GGIH 3A6CH 1JI1A 4X7CC 2XY2A 1YQVL 1FSKC 2Z4QB 1NANI 5BMFL 3PUCA 3IFLL 1WWAX 3GMQA 4M7ZB 3DVGA 3RUGF 2DYPB 2VB5A 4DTGH 5KG9B 2ERJC 3ROLB 1RZKH 2VDKL 3RWIB 3QG7H 3W0WA 1CF8L 3DBXA 3SKOA 1B4RA 1T0NA 4G43B 4QTIL 4NRXB 3VJ6B 5E8NB 1V3MA 1T2XA 5E8DL 3MREB 4UU9B 1L7TL 3O9WD 3NA4A 1UH3A 5FB8A 3BE1H 4C83A 3REVA 5EWIH 4QO1A 3PHSA 5BS0E 4PRHE 4LSRH 5EIVA 5K9QG 3MXWL 4KK9D 1AO7A 3QEUA 1IILE 3HZKA 5FYJD 3T2PA 3VD4A 2Z8SA 2N1KA 4TUJB 4HG4J 4GAGL 4I3RH 4JFXB 2EEAA 4YO0A 4I3GA 1NAML 4PJFE 1NCAH 1FE8L 2EC9U 3HPLB 5T3ZD 3KYMB 1OTUD 2NXZD 4NKDB 1IL1A 3T4YB 2KZ1B 5DD0H 4G6JH 1ACYH 1B9ZA 4P59L 1UEMA 3RVTC 2WIMA 2YPLD 1KCRL 4Y0GA 1S7SA 4A6YA 5DJ2A 2V2TA 4P3DB 4Y7MA 4TTDC 3F65A 1ZLSH 2O5YH 2X4RB 1WZ1L 2EEBA 1UACH 2PTVA 2PO6A 1WC7B 3LZFL 3O3DB 3FAXA 4LVOC 2APBA 2BXYA 1BFSA 1FFNA 1BOYA 2ZUVA 1CXIA 4PLKC 3WD5L 3L5JA 5SWSB 1DBKL 4X8JB 3H9SE 4KMLB 4G8IA 4GW5A 4HFWB 3IFNL 1QQDA 2JF1A 1FVEA 2B2XL 4PBWD 2YD7A 3H7LA 4LVNB 2Y7QA 3MNZB 2BNRB 2YBRA 3B6SB 4L4TA 2BFVH 3FHQA 3IXTA 5F1KC 2OBGA 3BW9A 3L3IB 5HHOA 3ULUF 3L1OL 5I76A 3MR9A 4NQDB 2YSSB 4NQCB 5J11B 4LSQH 1JWMA 4CKVX 3T2OA 3GSUB 3RJQB 1DQQB 2LU4A 4P9HH 5C2BH 3LV3A 1CGYA 1IC7L 1DQLH 3PWNB 5F97E 3ZE2E 4OF0A 4XNZC 4BZ2H 4I4WB 2LAGB 3P30L 4CW1A 1TQBB 1QBLL 1NAMB 3MV8A 3OKKB 2Z4QA 4Y2OA 1LEGB 1KXQE 5KG9A 4AEHL 1JGUL 3V4PH 6FABH 3S34H 3RWIA 5CZVL 3NIFF 4KKLD 4I18A 2G60H 4QRPA 2PYEB 4XPTH 1Z9MA 2CLZB 1MLCA 4ZQKB 2Z8WC 3VJ6A 1T1WB 3OX8B 5F7YC 1SVZA 3AAZB 3NZHH 3WUWB 2IAMD 5DDHA 4AENB 2VLJB 2ENYA 4NN7B 1I9JH 4HGWA 4X7TB 3TA3B 3DECA 4XVTH 5FDWB 3UYRH 4NHCL 3OKMA 2EDHA 1NJ9A 3K3QA 1J8HA 1L6ZA 1MI5B 4O58H 3JUYA 2P7TA 4JJHA 5D7SL 1HHKA 3FFCA 5CCKL 2EDXA 4TUJA 1KEGL 2FGWL 3BQUB 2GEEA 1KCUH 5E08L 1YEKH 3SDXE 1NPUA 1OL0A 4NPYB 4JFEA 3KYMA 1OAXH 1ZWIB 1F8TH 4X6FB 4HKBB 4H88H 1Z0NA 3DUHA 5EZIL 3RWHB 2FYYA 4Z7NE 4HIJA 4XCFH 1BGXL 2WLZA 3L95A 4MSWA 3OJVC 2I26N 3AMLA 3O3EA 1T2JA 1OP3K 4P57B 1DVFB 3TO4B 4ZUWB 2VDNH 3BPOC 1NFDF 4NDMB 2Y06H 2X4RA 4GG6A 3FB8B 5B38G 1P4IH 1BVZA 3KR3L 2GJZB 2E27H 3O3DA 5GS2D 1BQLL 4OGAC 2UVEA 4YDLB 1TXKA 5HHME 4J7RA 1S5HB 3AVEA 3O6FA 5E99L 3Q5TA 1CICC 5SWSA 3MTRA 2VE6B 5JOPE 1TJIL 2DMBA 3UTTE 3WLWC 4Q7DA 2DLEA 3ILQC 3H42L 4X80H 3QSKB 4J4PD 4X6EB 4P5TB 1F6LL 3RFZC 1JGEB 3MJ7B 2VZ3A 2ORBL 1T80A 5E94B 1ND0A 4UI2A 4ZFZA 4LEOB 2BRRH 2DIJA 4NQCA 4WU5B 5I1HL 5FXCH 1P7QD 2OXGA 3GSRB 3KJ4B 3NA9L 1KPUB 4OT1L 5EBGA 2BZDA 3D87B 3G6AB 4CVUA 1BQHB 4UUJA 5IB1B 3CX5K 4WHYH 4RFOH 2R8SL 3A6BL 3OKKA 4LVHB 1NANH 3M8OL 5D1ZC 4ODXB 2C9AA 1EBAA 1T83A 5T5NG 4Y4HC 4WJ5B 1U2CA 1RZ7H 3DYPA 5C7XH 4G5ZL 5BOPA 1QSFE 2PYEA 4GFTB 3UO1L 2CLZA 4Z7UE 4J2XA 3PHOA 1RJCA 2K1MA 2FGZA 3CJJA 3BZFA 4ZODA 1QFWI 4XNXL 1SBSL 3WUWA 4YFEA 3QFDA 2ADGB 2R39A 1R3IH 3QAZC 3QH3B 1N5AB 1PZ5B 2YKLL 2VZUA 1NDMB 2FB4L 1ZLVK 3OF6D 3FB7B 1YY8A 4X7TA 3KPNB 3TA3A 4QHUB 1MCSA 1WT5A 1AJ7H 2XQBH 3AU1A 1KLGB 5TE4H 4LPYA 3KPMA 2MCPL 5DD6B 2EDWA 1XF5A 1MFBL 4UT6L 3V95A 4FQHA 3T2QA 2QQKH 3V6OA 1CQYA 2ID5A 5C0IB 1T20A 4MNGE 1JJUA 4Y5VA 5HVGB 2KPNA 3ZE0E 3QCVL 5K9OA 5DJAA 3SCMA 4UIKL 5EBWA 4LSTL 4NNYB 5KTEL 1HKFA 3WFDL 4QXTA 5HI4C 3CK0L 1CDIA 3RVTD 5HHQA 3SE8H 1AD9B 3P3YA 4B5EA 4UT7H 4P57A 5B39G 4L1HA 3H9HB 4TTDD 4Y4FB 1CFTB 1KB5L 3U4BH 4XAKE 4WWKA 2VL5A 4GQ9L 1KN2H 1KIPB 1A9EB 1R5WB 2GJZA 5EZOL 4AIZB 4TOYH 4P9ML 4LSVL 5CJXC 1FHGA 2W1NA 2LE9A 3EZ8A 1GPOH 4HWBH 4MD4A 2GFBB 3PWUB 1ORSA 1ONQB 1OWWA 1FL3B 4OF3A 4PLKD 1S5HA 1VPOL 3CDCA 3CXHK 3T08A 4JPWL 2D0FA 3VI4F 1VEOA 4TVSa 3R1GH 5GS0H 1XF1A 1MNUH 3P73B 4L9LC 4RAUB 2KZWA 4X6EA 3MLVH 3D1MC 3N50A 5KSAB 5J9PB 2VDPL 1FVCB 5DQJA 4ZXBC 4P2RD 3MRHA 3WL9B 15C8L 4HC1A 4OKDA 3U46B 1FL6A 1W0VA 1KB9J 3QI9A 3QIWC 3RL2B 5I0ZA 3JWOC 5BW7A 1LP9E 1RU9L 1AQKL 3KPLA 2DS4A 5IM7B 4KWUA 1KPUA 2HFGH 4PJ7B 3ARVA 1Y18B 3G6AA 3O2VL 1MHPH 2IADA 5IB1A 2DQCH 3K2UL 4PJGA 2EDJA 3BKJL 5F93C 4NYLB 4JFFE 5ENWA 4PV9A 4QY8A 2F54B 1P84J 1RV6X 1WICA 4D3CH 3D2UD 5DTFB 5I1GL 2ZCKL 1F4XH 2GKIA 4JRXE 4PRBA 4PJ5E 5CWSA 3OAUH 4QOKD 3CZFA 4XC1H 4CVXB 1KB5B 4Y2DC 5ISZA 1FZJA 2DQDL 4HUUA 4FTVE 5KSBF 3DETC 4M6OL 4OLWL 1AGFB 4M6ML 3HI6L 4E5XA 3RIAF 5E6YA 1KGCD 3D3VA 1BFVH 4XP9L 4UQ2A 1GVIA 4Y1AB 4OLZH 3HAEA 1UGNA 1CDCA 1R3LA 1EAPB 4OZHF 1N59A 2FO4A 1BVKB 1AHWC 1JGLL 4RGOH 1RK0A 1IAIH 1ZHBB 5JW4Q 2BMKB 4MD0A 3ZYIA 3MCG1 2OZ4A 3O11B 4QHLA 1FL5B 3PF2A 4OLVL 4Z95H 3E0GA 1ORQB 2CH8A 4FQJH 3MV7D 4PB9H 5I9QB 5IHBA 4XAWL 4P3CH 3VRIA 4AEIL 3IU3A 1JK8A 4HPOL 4Q6IC 4JFPA 1XCTB 2AK4D 4F7EA 4P46B 3U0WL 3H9HA 4Y4FA 5C6TH 4ODVL 3CFDA 1BBJB 2BNUB 5GSRA 1A9EA 3GIZH 5IFHH 1GGIL 2NW2A 4P23B 4OGAD 4JO3L 2IH1B 3DUSB 3O8XA 4YHZH 1FL3A 4PG2C 5J0BA 1CICD 2XYCA 1Y6KR 3OKEB 1I9RH 1RZKL 3BVNA 3J7HA 3WLWD 1KULA 3ILQD 4RAUA 3BDYH 4AG4H 4WW2C 3DXAA 1WFNA 2YEZA 2CXGA 3BH8B 4ODSH 5L2KB 1BJ1H 5DYOA 2QLVB 3U46A 4EUPH 4GRLC 5AWNH 3SOBH 2NY5C 5D4QA 5AUMA 5I18H 4JM2C 1C1EH 2X4UB 2Q6WA 1DBMH 4M3KB 3VWKC 5KBNC 5IT2H 5EWIL 3HE7B 3HUJF 1F3JA 4YWGH 3X3GL 4NKIH 4HZLA 4Y5YB 3BD5A 2CRZA 3MLTA 3NCMA 1CLOH 3GKWL 3RY6A 4NZRL 4PY8J 2E7HA 5A2JH 4MB3A 4NYLA 4FNLL 5D1ZD 1FDLH 3MRJA 4N1HB 3KPTA 4QXWA 1QYGL 3JVGC 2EDTA 3C9NB 4Y4HD 2AK1H 5DTFA 3X11A 3QZWG 3ES6B 1PSKL 5AYQA 4HKXA 1F2XK 3QQ4B 5JXAH 4UQ3B 2EH7L 4W70A 3ULVH 4BK4A 5LJYH 1E27A 5DD0L 2QQLH 1RUKH 4U7MA 1FZKA 3S96B 2FSEB 1QFWH 5A43C 2GJ6D 1QPPA 3J8F7 4KHXH 3X17A 1AO7E 1M71A 1DP0A 2UZXB 3MRBA 5IROA 3CMOH 1V7MH 1YPZA 2Q20A 5CZKA 3SDXB 2AJSH 3ZYOA 5IUSA 1MAJA 5H8DA 2O5YL 3N1GC 2ITCA 5CBAB 5BRZE 3AB0C 2BNQA 5CEZD 1RUML 2IAND 4XP5L 1K4DA 5C08E 3R8BB 3QIUB 4Y1AA 3WNNA 1H8NA 4WV1B 3Q3GA 4LU5H 1EAPA 2GSGA 5DA0B 1CGSH 1WFUA 5JW3H 2A77H 4S0TD 3STLA 2ESVA 3E6HB 1JF6A 4A2LA 5GGVL 1YEJH 1A6PA 3CVIL 2E7LC 1ZHBA 5GGSB 4GAJH 3DV6B 4Z7VA 2EE2A 5CIPA 3I6LE 5HHMB 5HI4D 1VENA 1HEZB 5DRNA 1BHGA 4WNQB 5E5MB 4PG9B 3UXFA 3O4LB 1DANT 1OWRM 2ZSVA 3O41A 5E24E 1U3YA 3VDCA 4P9HL 5C2BL 1B3JA 4LCWE 3RQ3A 3TO2B 4PJ8C 5IOPB 1FO0L 1I7ZB 2J8UF 2BNUA 3SDYH 4BZ2L 3SE4A 3EIFA 1BBDH 1BD2B 4WTZA 3SE3A 5HYJD 4HH9B 3QDMD 5GRZA 1PYWA 2BOCA 4P23A 2P8LA 1U8JB 2IH1A 4IHOB 3VWJC 2HVJB 2JIXD 4HFUL 5D2NC 1A3RH 2XOTA 4JR9H 1KJ2H 2YMXH 3OKEA 5HHOE 3V4PL 5CBEB 4U1MA 2DWEB 4XPTL 1HCVA 3WIFB 3D85D 1T2QL 4XI5C 5FKPB 2GTWB 2KDGA 4S1QH 4M1DH 3N9GL 2GK0B 4ZXBD 3R8QA 3SDDA 3NZHL 3OKNB 2IALA 4YAQB 5MEQB 5EU6D 1OD9A 1SHMA 3QIWD 3MV8E 1J5OH 2DLGA 1I9JL 1EHAA 4XVTL 3UYRL 1OP5H 4JB9H 4QRPE 3LY6A 4DKFL 3QDAA 1WAAE 5F7KC 5GRYA 1KCUL 5K59E 1Q72L 1CFQB 3ES6A 1JPGA 3SGEH 4GRMB 4Y5XB 3P4OA 2RAMA 1MQ8A 1BM3H 1CR9H 1F8TL 5C0JB 4H88L 2NY7L 1DQDL 3NIDF 1MJ8H 5HGHB 1M7XA 2DQUH 5F89A 2FSEA 3QHTC 3C5ZA 4RA0C 3TBVB 3GUTB 3DVNB 2CJUL 4OM0L 1T04A 5AD0B 4Y2DD 1E6JH 4F80A 5E4EC 1FO0B 1LK3H 3DETD 2D0GA 3FFCE 3IDMA 4XCNA 3U36B 4EI6A 2VDNL 5DVLA 1IJ9A 2BSTA 5ITFB 4PTUB 3MRKB 2XN9A 4JFEE 4E42A 3T3MF 4JY6B 4EN3B 2BDNL 1ZT1B 1J05A 4HK3N 3MRIB 1Q0XL 4OF6A 1PJ9A 5IB2A 2Q7NA 3HI5L 3JTTA 1A2YA 2ADIB 4XTRC 3QNYA 4ODBD 1HNGA 1QSEA 1K3ZA 5FYLD 3PDDA 5E00B 3DV6A 2FBOJ 43C9B 3QXAB 4X4YB 3CMGA 1IGTB 4GG6E 3BZEB 1WBYB 4MQ7B 3S9DB 1I8IA 1YNTA 5I16B 4R97B 5A3IC 4WNQA 4PG9A 1I8MA 1T1XA 2BRRL 4IRSA 3ZL4H 4QCIB 4ZUTB 4TULH 1G0DA 4K7PX 4Z7WB 1JZ2A 5JOFA 4UOW1 3KPSD 5JHDD 5CP3H 4HIXH 3OMZA 4O51B 3VXPA 1I7ZA 3VGGA 1H3UA 4DAGL 1D6VL 1NGZA 4JG0L 4RFOL 4CRPA 2FX7H 4HH9A 4HXAH 1KENH 4JRYD 3BN9C 3NPZB 2XPGB 2DMKA 2RFXB 3IRPX 4ELME 2GW5A 1J1XH 3KJ6H 4ORGB 2EC8A 1BF8A 5CBEA 1RZ7L 2DL9A 2O5ZH 5C7XL 1A6TB 3OSKA 1MLBA 2VC2H 1VGKB 3VFWA 3BKMH 4YIQA 5FKPA 3L3OB 1WK0A 4NO0D 4RMTA 3U4EB 2GK0A 3LKSA 4PRPA 5BO1H 1MVUA 1OHQA 4YAQA 4GRLD 3W9DB 5FGSA 3EO1B 5MEQA 4JM2D 5I30H 1JZ7A 2VN4A 3QQ9C 2QADB 1G7HB 4PJ5B 3E1F1 3MBXL 3VWKD 4LCIH 4XP6H 1N8ZA 5KVDL 5E6IC 4ORZC 2XACC 5F1SA 3BRGC 1AJ7L 2XQBL 3JXAA 2WBWB 5M95B 5IWLA 2GY5A 2DJUA 4YE4H 4PRIE 3DYOA 2X9YA 4MJ2A 3SKJH 2OR9H 2QQKL 4ZO7A 3MUGB 4IDJH 5BOZG 1RZJL 3V9FA 2EDFA 1JFQL 1CFQA 3OR6B 4OD3H 3GBNH 4NM4H 5F6HJ 4G9DA 3RWDB 5C0JA 4PY7A 3BMWA 2VLLA 4FQ1H 4XZUB 1MAKA 4KTEL 3CSPA 3QIBB 3TBVA 5D96B 1ZSDB 4Z7OE 5HHNA 5IVXA 3NFSH 1QVOB 1U92B 3U36A 5D7LB 5D1QB 3LS4H 5DLMH 3U4BL 1A7PL 3VW3H 1F02I 2ZUUA 3PP3H 1KN2L 3CFBA 4OD2B 3T0WA 4MCZB 4RX4D 5DK2A 2NY0C 4EEEA 5ID1A 4LCYA 4QNPE 4JREC 1GPOL 4HWBL 1IE5A 1T7XA 2P8PB 4KZDH 3OPZH 3K1KC 3T0EA 2ADIA 5IFJA 3R1GL 5GS0L 1MNUL 2ZUTA 1IBGL 4GQPH 4NQTA 3V4VH 3ZLQC 3ZDYF 2XZZA 5I1LB 1JL8A 1DDHB 1V8HA 4HMEA 3VXME 3QXAA 1T5XB 3KNBA 1PVHA 2EDRA 1EV2E 3RTQC 3ZKSD 1R0AH 4N8CL 1SJHA 2DTMH 5LWYL 3FMGL 3M07A 4R4FH 3V2AR 3VG0L 2E6PA 3P77A 1ZLUK 4LRNH 5IMOB 4PJ8D 2HFGL 3LPGA 2FH6A 1I75A 1MHPL 1RIVH 3IFPA 4HUVA 2DQCL 3G04B 3FZUC 4MJ6A 3AREB 4BFIB 3NCFB 1DTUA 3KPOA 3V0VA 5SWZD 3WS3A 3MRPA 3VWJD 4OFPA 4Y8DC 2VN7A 4ORGA 1YJDC 3Q48A 3DI2B 5DJ8A 4R4BB 5DS8A 5LQBL 1MCJA 3IETB 4J12A 3UBXA 4XI5D 2X1WL 1UKSA 1PBYA 3L3OA 4IOIB 3OAUL 3S7GA 1H0DB 2CK0L 4JHAH 4JFYA 5DJXA 4NKOA 5AZ2H 4PJGE 1KCKA 1G7HA 2FZ3B 3FQRB 2VDMH 2WV3A 4GKNB 1R5VA 5DJDB 3WDJA 4ONHB 3RVUC 1JPST 5TF1H 3IDJB 1BFVL 4PRNB 3JV5A 2A6DA 1DLHB 2ADFH 5IBUG 4J23A 3MUGA 2JELH 1UYWH 3DRTB 2BVQB 3GFUA 2ZG2A 4RGOL 5D7KE 4X4MA 3W11C 4OFIA 3WDIA 3SKMB 5BRZB 3HC0B 1W72A 2P43B 4NO2A 1QHPA 2CXKA 4F7TB 4O9HH 3UMTA 3GGWA 1UWEH 5C08B 4WI6A 5FF6B 1TENA 2A9ML 4YHOL 2LV4A 4OAWB 3QNXA 4Z95L 2R23A 4BUHA 3D3VE 1R3KB 4UV4L 3WKNA 3BIBX 1ZSDA 2DQFB 5I74C 7FABH 5IHLB 1M05B 1I4FB 2IFGA 2ZG1A 3FO0H 4OBSA 5JW5B 1FBIH 4RBPH 5C6TL 3MBEC 2CGRH 5D7LA 5IR1B 2OL3A 3CAFA 5ABDE 3VXQA 4NQEA 5C70A 5IK3A 3EZJB 1SYVA 1BWMA 3GIZL 3P2TA 3HE6A 1KLUA 2W9EH 3SJVD 2P8MA 3V8CA 4YHZL 4G3YL 1DUZB 1MJUH 2RQ8A 3OAZH 4JE4B 4QWWC 4TVPE 4M61B 4L3CA 1JZ5A 4XTRD 2DLTA 4UINH 4HKJB 2XTJE 4LHJB 3CSGA 5F9OH 4PJ9C 4DWHA 4KK6C 1MCOH 1F2QA 3L7EA 4AG4L 1LWRA 1FPTL 5F7FA 1NGQL 3ARBA 3ET9F 5GSVB 5AWNL 4DFHA 3SOBL 5A3ID 5JDSB 3P0VH 1XT5A 4CN1A 1C1EL 5LCVH 5IF0B 2N4IA 1RMFH 3KLAA 5JXEC 1C08B 1E4KC 3MYJA 5IT2L 2BXZA 1YYLH 4NKIL 1NUGA 1EX0A 3T1FB 4F3FB 1QP1A 5I75B 3G04A 1OAQH 3AREA 4TSBH 4L8CA 2HMIC 3C87A 1GGBH 3BN9D 2YUVA 3DXAE 4M93B 5DUPL 3FHAA 1F4WL 5ESVA 2A6IA 3UTTD 2V17H 3KS0J 5D5MA 3S35H 2BOBB 4U31A 4YEFA 1X9QA 2DBLL 3DO3A 5JXAL 3ULVL 2PXYA 3G6JB 4JVPA 3UTOA 3TT3H 4K3EH 1G1YA 4M9PA 3S3SA 5TDOA 4KHXL 5KANI 1CU4L 4AT6A 5F7EH 4Y4KB 2AJSL 2AI0H 1X5GA 3QQ9D 2Y1VA 2FZ3A 3C5SB 4LSPL 3WEXB 4NP4H 4XVJH 1CCZA 5FGCE 5L6YL 3QWQB 1D6EB 4GKNA 1MF2L 1PX4A 3PV6B 5E6ID 5DJDA 2HWZH 3LIZH 1N2RB 5T1LA 4GUPA 2APWA 2XXMB 5K93A 1X3DA 3ZKQD 4BZ1L 4C59B 4LU5L 3ARSA 1CGSL 4E0RA 1XR9A 4G9FE 4TRPH 3M1BB 3VXUA 3WFEH 5FYKE 1YEJL 4JDTL 3BPCB 3HC0A 2IC2A 3IJSA 3LDBC 3FQWA 1FJ1A 1YPZE 3HAEG 1XGRA 4R96A 5A16A 3TWCH 4EUPB 1G9NH 4UV7H 4N0YL 4OAWA 5INCB 3QO0B 3H0TA 2BNQE 2Z9TA 1AGBB 4JDVB 4NN6C 2XWJB 5I71C 5TE7H 3BMVA 4LLMA 2DQFA 2VZTA 2HVKB 2HYMA 5DGQA 5JHLH 4MDIA 3G6DH 5DMKB 3DRQB 4DVBB 1P4BL 2XKNA 2ESVE 1T0PB 2NX5E 1HKLH 2AXJA 4WI9A 1FGVH 5DJ6B 2ZJSH 5L8JB 5DJCB 2NY0D 3V79C 1M7IA 1DN2A 5JW4M 4Z7VE 2I07B 1RZGA 3R4DA 3D9AH 1DUZA 1MY5A 1CFVH 4UIMA 5SX4H 1E4XI 4LLWA 3NFNA 4JR9L 1OAZH 1KJ2L 2YMXL 3QXDA 1FC1A 3BKCH 1MHCB 1K5NA 3QJFA 1CD0A 2F5AL 1RJZB 2OK0H 1RHFA 4Y19A 3BT2L 4S1QL 4M1DL 2PO6C 1F4AA 2Y4SA 4AL8H 1FNSH 2VXTH 3RTQD 3L3JB 4JG1H 4TNVK 4K3DH 4JFQB 3F7VB 3OR7B 1CDHA 3BKYH 5J1AB 4QLRA 1C08A 4XAKD 1X7QB 4E41A 4OUUB 4Z18A 4D9QD 5F9DC 1QFOA 2MQ0A 4DGVL 3QDJB 3V5HB 3PWPB 4LPXA 3FZUD 4FABL 1EERB 1KJMB 4GKSA 1NC4D 2JB6B 5LBSH 2XKSA 1VGEH 4APQB 1AXTH 1TMCB 3TBYB 1XF2B 5MENA 1WCBA 4R0LA 1GJIA 3SGJA 2JJTC 1CR9L 3ALWA 4PRIB 1EZVX 1NUNB 3QDGD 5ETUB 1RZ8A 1BREA 4QRRD 3STZB 1MJ8L 2YN5A 3NOIA 5CINH 4OD1H 1EUTA 3CH1B 4M4PA 4PP2A 1Q8MA 1RURL 2H8PA 4NUJB 1E6JL 2E3VA 2O5XL 4Y4KA 1XFPA 2VITB 4M7ZC 1MEXH 3S37H 3EYUH 2BHYA 1VFAA 1D6EA 2H32H 4I18C 3RVUD 3OZ9H 3AFLA 2R0ZH 3UAJC 4NKMB 1EZVY 2XWTB 5GRVK 1KJ2B 3VXSD 5C09E 3NN8B 3HG1A 3MLUH 3PWVB 2VLRE 3W11D 3BPCA 5HYQA 4LEXH 3TCXA 1UQSB 2G5RA 3BZDA 4PJHE 4EUPA 4FFVC 1K4CB 2XXCB 5D1XA 1DBBH 4HDIB 5DSCB 3QEHA 3NACL 1QRNA 1A5FH 5I1CH 1N7ML 4WFEE 3V5KA 4JQIH 4PJXB 5E7BA 2XWJA 3ZL4L 4PJEB 2GITA 1NC2D 2AJZB 3TN0B 4Z0BH 4TULL 4D0BA 2UUDK 3SDAB 5BVJA 3MGAA 2QKIA 3MBED 5I19H 4YHIB 3KXFB 4HIXL 4DOHB 1HILA 4NRYB 2DBJA 1RIUL 3HC3H 1QSEE 3OJ2C 2DL2A 4NJAH 2W0FA 2FX7L 4HXAL 1KENL 4DEPB 3NIGF 4C56E 3K81A 5JO5A 4XNYH 5EU7E 4PYGA 4CVZA 4GMTH 4QWWD 3ULUH 4OIAA 3KJ6L 1TCRB 4WTZG 1A47A 5ACZA 2O5ZL 4OZGF 5J12C 3WIIL 3UJIH 1H5BB 1FZMB 2QSTA 4PJ9D 2AJUH 4KK6D 4C57C 4U1KA 5FO7B 3GMRA 1FYTA 1QLEH 5F3HB 1HHIB 1BOGB 5BO1L 2W0PA 2R4SH 2ZOLA 1JWUA 4R3SB 1NLBH 4JFQA 3OR7A 3O6FC 4L4VD 2PF6A 1NLDH 2Q7YB 4ZTPH 5KZCB 4TVPL 5JXED 5D7IE 5BXFB 1HINL 1KTRL 3OKLA 5FHBL 1AQDA 1IQDB 4XPBH 2E7CA 4LVNC 4MXVE 5D93B 1SEQL 2OR9L 3SKJL 3MNVB 3K1DA 1LHZA 5CSGA 2HMID 3QHFL 1VACB 4IDJL 4PRPE 4O2EB 2CKBH 4OCRH 4TSCL 5J11C 3FONB 3GBNL 5KW9H 4NNXA 3PWJA 1EEQA 4YBHA 3BH9B 4BQ6A 4KC3B 1NBVL 1L9MA 1IM9D 1IMHC 4XCCL 1YDPB 3RWGB 4FQ1L 2WZPD 5I8CA 3QUZA 1IM3B 4ZOEA 1FC2D 5CKAA 5ESAA 5CP7B 5EOTB 2ZKHL 1WUNT 3NFSL 2VITA 3T04D 1QFUL 1T83C 5MERA 1RK1A 5DLML 1F5WA 2B0SL 3VW3L 2CPCA 5FA3B 3W0WD 3LKNB 1JGVH 5HGBB 5C0FA 3PL6B 3UPRB 4NKMA 2IPKB 1NUDA 4PBVC 2AEPL 1F58L 3MGOA 3QNZA 2CDGA 4XHJC 2BVOB 5E5UB 2VZ1A 1G6RL 1YC7A 4LSSL 3P9LA 5JTWA 2F58H 1JZ6A 2X4TA 4NN7C 5DRZA 1UQSA 5IVXE 3V4VL 4AIOA 3PGDA 4O5LH 3TA3C 3RWEB 2YA1A 1UB5B 1XF4A 4EIZC 1WT5C 1H3VA 1FIGL 4CMMB 5EO9A 1QPXA 5GZNC 5A2LH 3BGAA 1AO7D 2F15A 1R0AL 3W39A 5IHZA 1JRHI 1RUAH 1BFTA 4H20L 3V6OC 4PJEA 2I60H 4LCCB 2PW1B 2XTJB 3KAAA 5DHXB 4R4FL 1TVBB 4OZIB 4JHBA 5FYKL 3PQYB 4LRNL 4QXUH 4HJGA 2DLFH 3T0EE 3KXFA 4GW4B 4YHLH 1U95B 4O02H 4Y5VC 5F7HA 1RIVL 3KWWA 1P1ZA 5EN2A 3FAWA 3SCMC 5F44A 1NCCL 5IMLA 5C07E 2C4FU 4R7NB 5CEXB 5DK0B 1JPFB 1EVUA 1E4XH 1I9IH 1ZHLB 1K8DA 1S9YB 1MFCL 2IH3A 4LLUB 2YUZA 3I6LD 2R2EB 4WWKC 1LMKA 3MJ6A 2JKXA 3S36X 5L8LB 2VIRA 2E9IA 2PO6D 4X83A 3ZE2F 3ZO0A 1I7TA 5BVPL 4JHAL 2V7NA 3FRUB 5SV3A 3MODL 3O2WH 4R3SA 3TH2T 2BSRB 2ITDB 5FUCC 4YDLC 4UDTA 4CNIA 4LF3B 5AZ2L 4ISVB 4FQLH 4YXLH 3OV6A 3PGCB 5BXFA 3ARXA 1LO4H 3X12A 1IQDA 4MGXA 3EDEA 5IIEA 3MFGB 1G6RB 3OXSB 4KPHH 3SDCA 5JQ6L 3MNVA 4L4TD 1B0GB 5SWQB 1ZA3B 1FNEB 5DGRA 1G9ML 5T5NF 3RWCB 5HHOD 4O2EA 4GXVH 4WUUE 3EKCA 2F74A 1CE6B 3QUYB 3TEUA 2AS5M 4WDIB 1PLGL 3S4SG 2XICA 4PBXA 3KJ4C 1XGQA 2P5ED 5F8QC 3B5HA 1E28B 3BZ4B 4KKNA 1IM3A 3LMJL 2N56A 5IESH 2IAMA 4HCRL 4KKCC 3FRPA 2FEDC 4KGLA 1OM3H 3MV8D 1B0WA 3FO1B 1CFNB 5EOTA 4LVHC 7FABL 1EHLL 2O61B 4OCMC 3FO0L 4MA1C 1FBIL 4J1UB 2CGRL 4QHKI 3I2CH 2VDRH 4M6NH 4YFDB 4X4ME 5FA3A 1VKXA 3SDXF 3R0MA 3ZT6A 3MCKB 4M7LH 3PL6A 3UPRA 3UAJD 4LLQA 3HR5A 2OMNA 4IS6A 4FZEH 2IPKA 4Z7NF 3KYNB 1OGAE 5GHWL 3MLPA 3VGAB 1JN6B 2BVOA 1XGTB 1U58A 4RGMC 2NX5B 3V5DA 3IJYA 1JE6A 4HEPG 4N0UE 4CMHC 1U36A 2DMCA 5F9OL 1OLZA 4YQXL 4ONGH 5CJQH 2MQCA 4GG8B 4FFVD 3M17B 3JV4A 2BHUA 4NQEE 1J8HD 4AQ1B 1HN1A 4OCXL 4HJJH 2ICEB 5F7LB 5DMYA 2PTTB 1BFOB 3P0VL 2EDQA 2VZOA 5LCVL 4WFGD 1EJOH 4H5SA 1AKJB 4MHHI 3VMOA 1RMFL 1RQ5A 1TJGH 3VA6A 2R0WH 1JYXA 4L4JA 3VFRB 5C0DB 3BEWA 1YYLL 4GW4A 3OAYH 5ICYB 2EIZB 4JFED 4IEFB 2P5WB 5EU5B 1CFSA 4TSBL 4WHTA 5B21A 2I24N 4LQFL 3QULB 1JPFA 4FQQB 1UZ8A 3VXNB 1A4JB 3S35L 1WWWX 2VQ1B 5GJTH 2BVYA 3B3IA 4Y4FC 1A6AA 2OX5A 4WCYH 1RI8A 3BWUC 1BZ7B 3TT3L 1H3WM 1UB6B 3GJEB 4K3EL 4KI5C 3F12B 1R24A 3SHSA 5ACMA 2KBGA 5CKGA 4DVRL 2BSRA 2JCCB 3O8XC 3UBXG 2VRAA 3O6FD 4ISVA 5SWSD 1X4YA 2DQIH 4G8EB 4NP4L 1PY9A 3TCLA 5D5ME 5HHVH 1FNFA 2EYSB 32C2B 1I3RB 2FNBA 1P9MA 3AS2A 1DFBH 1T1YB 1IGCH 4Z7UF 4KROB 1NSNH 3EFFB 2Z92A 2F8VA 2X2YA 1SJEA 1G7IB 5KSVB 4LARL 4TRPL 1OTTC 1FNEA 3LQAH 3WFEL 2EKJA 5DK3A 4NQDD 4NQCD 4ETYA 1F4YL 3LHPL 5FUZL 4WDIA 1HXYA 1IEBA 1NEZA 1U8HB 4MXWL 4UV7L 4KFZC 2AXFB 2E9JA 4XBEH 4U1HB 4FXGA 1W8OA 4MA3B 5C09B 5C0AB 2XA3A 1ZHNB 5TE7L 5I1EL 2VLRB 3U7YH 4U1GB 1A02N 1CFNA 3NAAH 5JHLL 5C0GA 2MWCA 4D9RE 2UV3A 2EYRA 4O2CB 3G6DL 4AMKL 4J1UA 3AROA 2VSDA 4JFDA 3VXUE 1F00I 4AM0A 5L7XL 5IKCB 1HKLL 5TGBB 1C5DA 4BSWA 5IVZB 2VLKE 5I1AB 2PYED 4RZCB 3ZE0F 2NY6C 2CIKA 2K7QA 4JQXA 4DN3L 4U1IA 1HHHB 4P2QB 1OP9A 1KACB 3KYNA 1IRAY 3QWRD 1CXFA 2ZUQC 3RJDA 4XHJD 1OAZL 2D3VA 3CFJA 1RZIB 1S7UB 2RR3A 3BKCL 2HJFB 2OK0L 3TA3D 3IF1B 1TITA 3GSQB 3LRSB 3UJJL 5KS9B 3TPUB 5F1NB 4JZJB 5GZND 4KMQA 3QFJE 4LDOB 1LNUB 4K3DL 4PJCB 1J12A 1MCPH 4NN5B 3BKYL 4WEBL 4Y89A 5DQ9B 1EXUB 1YECH 3CFCL 5TPWH 1T0MB 2AGJL 5C0DA 2AERT 3OGCA 4YFLF 3MMEB 1EBPA 4LP4A 5HJ3B 2NW3A 5SX5K 1MFAH 3SCMD 5C0BA 4J3UA 4QRSA 4Y19E 2Q76B 3RNQA 1VGEL 5J56B 1AXTL 2HKFH 5FOBA 1GL4B 3G5YB 1YUHB 5D7IB 4BH7A 1A1MA 4LL9A 2FIKA 1UFUA 5FYJH 1CD1B 5JUEH 3ZKXB 1LP9F 4P46C 3IXAA 2F53A 1U91A 2VOTA 1DSFL 4WWKD 4OB5H 1TTGA 2WUCH 4E41E 4OD1L 3SE4C 5IQ9B 1TETH 3F12A 4ODTL 3SE3C 1QLRB 5D2LB 3DX9B 4W68A 1SBBA 4P23C 5HDQL 2JCCA 3T0BA 4F7MB 1MEXL 4WY7L 3EYUL 3MFFB 3DNKA 4OQTA 1A4KB 4HWEL 1DQTA 3OZ9L 3AMKA 3IDGB 4JJ5A 2V5YA 3EDDA 3SDDC 3GMLB 4YGVA 5LGKA 4EJ1C 3MOBH 1A7BA 3V4UH 2A9NH 2Z31A 3WNPA 5TDPB 2VXQL 4LEXL 4HAGA 5FEBA 1E6OH 1D5MB 3NFPA 3HI1B 3HE7C 1DBBL 5ANMA 1DLFL 4HF5H 3SPVB 1Y6NR 1MQKH 4LLYA 3RUGB 3LKRB 5MHSD 4M1CC 4KKCD 2FEDD 3U79A 2F19H 3S3JA 1B6DA 1MCEA 3VD5A 3ARWA 5MI0B 2X09A 2YWZA 4F7CB 1JI2A 1S7RB 3HG1E 3C60B 5HGDA 1YMME 2WUBH 2VXVH 5TGBA 1YEHH 1DQMH 3ZE1E 5FK9B 2C1OB 3WHE0 4NJAL 2BJMH 4PB0L 2H6PA 4XNYL 3C5ZC 4P2QA 5TE6L 4GMTL 3T1WA 3ULUL 2HLFC 2Q8AH 1KYOJ 3GSOB 1GGUA 1K9TA 5ISZD 1ZS8B 4YPJA 3GI9H 5E1AB 1SMOA 2R2CA 2GT9A 2ZUYA 5FFLA 3GSQA 1QLEL 3TJEH 2ZOKA 1Q9OB 3K8LA 3TPUA 5ALBH 5F1NA 1OPGL 2R4SL 2RB8A 3MV7A 1XEDA 1XGYH 4XNMB 1NLBL 1RZKC 5LKNA 2CLRB 2H32B 3NCYS 4X5WB 2G5BB 4ZTPL 4U1LA 5CUSH 5DVOA 1Z5LB 3TNMA 1MUJA 3LEVH 1WSST 3X14A 2QQNH 3C5JB 2BRQA 3QUXB 1A7NH 3MMEA 3MXVL 1P6FA 1WIUA 2YD3A 4XPBL 4Z77A 2Z0BA 4YBQC 1DUYB 3RDTB 1MCWW 5EU7C 2FR4B 1WEJH 3LRHA 4PJAA 5TF0A 4GH7B 2GSIA 1NCBH 1CICA 3N1PC 2C3VB 3MRMB 3QUKA 2RCSH 2CKBL 3QYCA 3RKDC 4IRSC 1IT9L 4JFOB 4MX7B 1EO8L 2YA2A 3VFPA 5C2UB 2VAAA 1P5UA 4Y4FD 3DYMA 1OLLA 4QGYA 4MJIA 5EO0B 4Y8AA 4FZ8L 4JO4H 4XP1H 4YXKH 4KI5D 1C8PA 1WISA 2ED8A 4PJBA 5D2LA 2FHBA 1MWAH 1KPVA 3O8XD 1CGVA 4X7FC 4YUEL 2MPAH 3H3PH 4F7MA 2CR6A 5HI3C 4RDQG 2FL5B 3P40A 3MFFA 1S3KH 4LGPB 5CS7A 2HLAA 4MNHA 1UXWA 4KRPB 3G9VA 1ZT7B 1M7DA 2VDOL 2ZZUT 3SO5A 4YNYA 4HWZB 4JPKH 4U6HB 1RVFH 4RGNB 2B5IB 1OTTD 4LNRB 5E8OA 5EBMA 2YK1L 1A6ZA 2F58L 3TV3L 3MLZH 4O5LL 5DWUL 1T1ZB 2QHRL 1YYMH 1OGAB 1AGEA 3SPVA 2CSPA 4U1NB 1RUAL 3ALXA 4Y16A 1ADQL 1QO3B 1U3HB 1N6VA 2DLFL 1S7RA 1OT2A 4PJIA 4YHLL 4ODHL 3KVQA 1OAYH 5T3ZE 2C1OA 2IQ9H 2NY6D 5CEYA 2CKBB 3RHWK 1SEBA 3EO0A 4F37K 3U1SH 2YPLE 2CMRL 4H8WL 4F58H 1TQCB 1RJLA 4XVUC 3MO1B 1LEKA 5IB3B 5EZLB 3ARGA 5E1AA 5H35A 3TIEA 5ILTH 2BNQD 4NWTH 4OGXL 1Q9OA 2BVPA 1G7QB 3RWJB 3WN5B 1AC0A 3O2WL 4EN3C 3O6KH 4Y1AD 4MNQB 2CLRA 4X98B 4FQLL 4HMDA 1Z5LA 3CCHA 4KV5E 4ACPA 4RWHA 3MLSH 1LO4L 1JWSB 1QD0A 5CJXA 4TSAH 3RDTA 3QDMA 2ZCLH 4JKWA 4KPHL 3BP5B 3RX8A 2FR4A 3GRWL 1EFXB 4R97C 2BC4B 3SY0B 4DKEL 1VB9A 4XXDA 4OIIH 3IFOB 4L9LA 5F7DA 1XGUA 5DZLA 1GIGH 3L3KA 4P46D 2J5LB 3FO2A 2I27N 5EO0A 3L5WB 5EULV 4ZXBA 4UAOB 2C3XA 1X5IA 1HOCB 2NY3B 5IESL 4FMFA 5E56A 4P23D 1OM3L 4MAUH 3LS5H 1WAAF 5DMGC 4BSJA 5E8PB 3MV9A 3IGAA 3UTZA 5K59F 4M7KL 3O3AB 1OF2A 3Q5YA 3AY4C 1FORH 5D8JL 1QOKA 3TYGH 4BKLA 1HH9A 3WKMH 3GMNB 3T0DA 4FZEL 2QSCH 3SDDD 5EUOA 4HUXB 4LAJH 1UKTA 3O4OB 4OM1H 4LNRA 1I1CA 3DMMB 3VGHA 3S88H 2DQHL 3IAGC 2OJEA 3FT2B 1ED3A 3LN4B 3MJ9L 2UZIL 4ONGL 3VD3A 5CJQL 4P0DA 3HE7D 4HIIB 5GGSY 3V6ZA 1JCKA 4PJDA 3T3PE 2IPUG 4HJJL 3S5LG 2VNCA 4M1CD 3ARDA 1I3GL 4I8DA 1F11B 2D4FA 1QO3A 5HTSA 2R0WL 5IW6A 1FN4A 2JLLA 4XCEA 4HXBL 5TQ2H 1U3HA 2EXYC 1MCRA 1WBZA 1LD9B 1R3JA 4X9HA 4JY4A 3NZ8B 2XG4A 1FFOB 3QFJB 1GZQB 1WBXA 3EYVB 4WW1A 2X7LA 4GG6F 3C5ZD 3UJTL 1AR1C 3C6SA 5E2WH 2J6EH 3B2UC 1AHWA 2HLFD 4LCUB 5JMRA 5GJTL 1D5XB 1ZKAA 4L8SA 3REWB 5KVGL 5IB3A 5D1QC 4WCYL 1PQZA 4PR5B 4UDUA 5C0EB 1KYOK 4U1JA 4K9EL 4OF5A 1WF5A 2PW2B 2XN9D 1FFPB 2EYTB 4MNQA 2V6HA 2B1AH 4Q6IA 2DQIL 1PW3A 3C8KB 5ICZA 1T6WA 2EZ0C 1ES0A 4ELMF 4KVCL 5HHVL 3BPLB 3MRDA 4U3CA 1FV1B 1QSED 4LHUB 1JWSA 3WFCH 1DFBL 4YBQD 1IGCL 3BP5A 3WFBH 3U6RB 5GGRB 1YEFH 5GGVY 4KUZH 3ARBC 3IDYB 2IEPA 1NFDA 3LQAL 1HSBA 3O4LD 2BC4A 3SY0A 1CN4A 3RKDD 4IRSD 3PXJA 3TNNA 3CC5A 5JA9A 4KJYA 1UA6L 1KTLA 1YZZA 2D31A 4NJ9H 4ELKA 4X6DA 2VABA 5AG8A 4NO0A 1Y0LA 3HNVL 1YEEL 5K9QI 5DJ0B 3L5WA 1JNHA 3IDIB 5FUOH 2MQ3A 3DHMA 1CYGA 4N8PA 3AREC 4Z9KB 5ALCL 1QFHA 3U7YL 3VFMA 3QUML 2CO6B 1RULL 5IJVB 2CUMA 4S1DC 5HI3D 5E9DB 2OM5A 4UOJA 3BEVB 3HC4H 4AZ8A 1KSRA 3B9AA 5IW1A 3FRPG 4MCYB 1EEZB 1G7LA 1VEMA 4YXHH 5MP6H 2EE3A 2IQAA 1A9BB 35C8H 1K8IB 2GHWB 2X1QA 3T0XA 3JVGA 5F3BB 4NWUH 1YMMB 4Z7OF 2PTUA 3DPBA 1CLZH 1I1AA 2X4NB 3HZYA 3K4AA 4NC0B 4G8GA 4R26L 1PKQB 1ODAA 5DUML 5JNYA 1F6AA 1JRHL 1G84A 1MCPL 5D71L 5BMFH 2QQQA 4V1DB 2X9XA 1I9EA 1H8SA 3K8KA 1HSAB 4M9OA 5TPWL 1CDGA 4MA8L 4K23L 3WCYA 25C8L 1NFKA 1S5IH 5GGTH 2VDKH 4OCYH 1BLNB 1CF8H 4WU7A 3KYOA 2EO1A 1O5DT 4G8FA 4GSDH 2UVFA 4MQXC 4EVNB 4QTIH 1C5BH 5KSBB 4B0MM 4LKXB 5JIPA 1CVSC 2UYLA 1L7TH 4CDGC 4JLRB 4RFNB 1UC6A 3HPJB 5FYJL 3AXLA 1JTPA 1V3LA 5DEGB 2E7LA 4XVUD 3HZVB 3C6LA 3EFDH 4UTAL 2ATPB 3PABA 1NCNA 4PR5A 4TQEL 4OB5L 3QUMB 4OZHB 3MXWH 3LQZA 4EN3D 1XH3B 2EYTA 5C0BE 4LKCB 4ONFH 1KTDA 4U6YB 4GAGH 1SY6H 1GZPB 4U0QB 2RHEA 4PJ8A 4M5ZL 4HS6B 3IVKB 4LHUA 4FFZH 3L9RA 4UMGA 4XXCC 3V7AE 5KSUA 4YDIH 5INDB 5DZOA 1K85A 5IMMB 5HVFB 5SWZA 4P59H 5DRWA 4OZFA 5CEZH 3MOBL 2Y72A