5HI4C

Binding site elucidation and structure guided design of macrocyclic il-17a antagonists
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLIHGVTRNWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/inhibitor
molecule keywords Interleukin-17A
publication title Binding site elucidation and structure guided design of macrocyclic IL-17A antagonists.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hi4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hi4C01
1RUQH 2J4WL 4RWYH 2X5PA 1CU4H 5C0CB 4Q9QL 1G7PA 3L3DB 2NY7H 3D69A 4M6NL 5EOQL 4PGEA 1H15B 1EMTH 3ZSTA 1B6DA 1RULH 3KYNA 1MFNA 4HULB 1QEWA 1R3IH 2G60L 4LKXA 5DUPL 3HCVB 1VA9A 1EA9C 1B2WH 3HZYB 5IWLC 3FQXA 2UYLB 1AHWC 5K9OB 4Y16C 4PJFF 4GAJH 4H0IA 4P0DA 4PRBA 1TVHA 5GS1B 4HWUA 2DF3A 4NO5B 2I07B 3KVQA 1P7QB 5F71A 4AEIL 3ZKNC 1NKOA 1XGPA 1WV7T 2A73A 4O2CA 1A1NA 2DKUA 3G04A 1WCBA 4L4VE 4LKCA 4DGYL 3IAPA 4X7DC 3C60B 4OFIA 1T6WA 3H9HA 4JHWL 4AY0A 1IFHL 5K9KB 3QJHA 5IK3A 4NCC2 4TSAH 4FQQB 4XNQB 4K23H 4WV1B 1QZ1A 3NFNA 3STZA 4D0BA 1BM3H 3GSWB 5EIVA 3K1KC 3EZJB 4NO3B 3T0BA 3S37H 2A9MH 2BY2A 2ZOKA 4L8SB 3SE4C 4GS7C 3DVFA 4E41B 2V2XA 3OJVC 4KZEH 3FO9A 5E6IC 3HS0B 4ZS6C 3LD8C 1U91B 4MX7B 5ISZE 1S7VA 1S9XB 3TZVA 2H45A 4MWFB 3VFSB 5D93B 1WWCA 2M2DA 3GMOA 1CTOA 3F7PC 4JJHA 4KMTL 2CDEB 4NQVA 3QIUD 2G75B 1HYSC 4FQIL 1DBAL 4XMPL 4MCZB 1CVRA 4NC2B 4L8DB 3NAAH 1Y6MR 3GBLA 2E6JA 3FB5A 3WLWC 3QI9C 4Y5VA 3MOAL 5JUEH 2HKHH 1U2CA 5CCKL 2E6QA 3OZ9H 1GOGA 1YY9C 35C8H 4EBQH 3VXTA 3AAZB 5ID1A 4HFUH 3I6KB 4JFFE 5EZJB 1UXSB 4ZXBA 4G7YH 4NFCA 4YE4H 3ROLB 1ES0B 1U93B 3QCVL 3TNMA 3GO1H 3NFPB 2VLRB 1ETZA 4GOSA 4C56B 1W0WA 3MV8D 3QUYB 4ERSH 3NABH 1AXSA 3TYFB 1GZQA 3INUL 1KIUA 4Y4HD 1KCUL 2OR8A 4X6EA 5JOFA 3U4BL 1UA6L 4XXDA 3CFIC 4HUUB 1ZANL 4OGAD 2VDNL 4XPHL 2NY6D 5E6ZA 4PJIF 4AH2B 4KC3B 4PGCA 3VG0H 2BMKB 3SCMA 4PTUB 1EK3A 3BXNA 1HYRC 3OJDB 3JV5A 1YEHL 3UJIH 1EUUA 3P0VL 5SWZE 3RP1A 4RSVA 3NGBB 2HJLB 4L4JA 4HWNA 4U1IA 5EIIA 2DQFB 5DRXB 4UB0L 4ODUA 2W1NA 3HZVB 1TFHA 4XP5L 2Y1VA 1FC1A 1AY1L 4HLZH 4JY5H 5J12B 5JW3H 5GS1C 2LABA 4Q74A 1FL3A 5FF6A 1KJVB 1J1OL 5ESVA 2PXYB 1TXKA 2BVOA 1GGCH 1JWSB 2ATKB 5D2NE 1F3RB 4X99A 5AUMA 1RZFL 4NUGH 3G9VA 1NCWL 3WDJA 3C60C 4ODSL 5GHWH 5SX4H 3QH3B 4LIQH 3TLRA 1MCSA 4KZDH 1WTGT 4WV1C 1GIGL 3TNNB 3JWOC 4YBQC 1MCJA 1UJ3A 2EICA 4GRWF 1YC8A 4NIKB 2A74B 3ZYZA 1HSAB 5ISZD 4RWHA 5L8LB 5DMKB 4NO0A 4L4TE 4G80A 4L8SC 4YK4B 3DRTB 1BBDL 2P5EB 2CH8A 1KYOK 1IGYA 4CU7A 3QDGB 3FAXA 3WFDL 3WKNA 2R1XA 4HIHB 1MUJB 2D0FA 4Q2ZB 5D93C 2VQUA 2OLDA 2UY6A 4WI3A 3VFPB 3WIFA 1DSFL 3BP7B 1BGXL 4P57A 3MLXL 3QO1B 4R7NA 1N5YH 4E0RB 4IOFD 1RIVH 2D03L 4HXAH 4XCEB 1CXFA 4L3EA 5IROA 5IHZB 1GPOH 3U0WL 2GAZA 3FQNA 3LRHA 1QSEA 5BS0E 1R5VB 3W5MA 1T2QL 2I26N 5EC2B 4LHQB 2AJUH 4WTZA 1UG9A 4PJHE 2CK2A 1XF2B 3VFVB 4NOFA 4ALAH 4JFED 3LCYA 2MJWA 5E2UL 4H1LH 4FZ8L 4O58H 4LPTA 1I1RA 1VPOH 4YDVA 5C0AB 3N85H 1E4KA 3BPCB 4PR5A 5IV2B 2KKQA 1CT8A 4ODXA 2CKBB 3QUYC 3MX0A 5ACMA 2Y5TA 2CO7B 3KPQA 1AI1L 2HLFC 5BRZA 2O5XH 1QHPA 5IVZB 1CLOH 2HKFL 1XZ0A 4RAVB 2R2EB 4CADB 4ZFOA 4NO2A 1FIGH 3DROB 1I9IH 3X3FL 4X7EC 3GMMB 3V4UH 4TSCL 3BT2L 5GGRY 4P23A 1NEZG 5HSFA 4LSSH 5GRUL 1CLZH 3NH7H 2HT2C 5AYQA 1YNKL 1JF5A 4TULH 1DBKH 4KGLA 4IRJD 1LO4H 2HRPH 2VXVL 2IPUG 3RKPA 2PR4H 3CC5A 3NGBC 4HIXL 4RMVA 5HDQH 4X0KB 3D85A 3TO4C 2J8UF 1UACL 2H2SD 4JQIH 1SJHA 3ARGD 1XCTB 3P4NB 1AD0A 4PLJD 4RRPG 2BVUA 5J12C 1A6TB 3MXWH 4P2OA 2F8XC 1DVFD 1X4YA 3HPJB 4HT1L 4JN1H 2PO6A 2PXYC 5HTSA 3ZKQD 5CJXA 2A6KA 4NM8L 5D71H 2VLJB 3QPXL 2Y06L 3VFOA 5D6CB 3O4OB 4Y89A 1TQBB 3O6FD 3KPLB 4L4TD 3FRUA 3C8DA 3DLQR 1KENH 4HIJB 2XI9A 2OL3B 3VXRD 2VIRA 5FYLL 3EJJX 3FJTA 5DJXA 4U6HB 1ZTXL 4LHUD 1J1PL 3DUSB 2VDLH 4DN3L 3RGHA 3NIGE 4YK4C 4JO4L 4NC1C 3UC0H 4XCCL 1PEWA 1VESA 2WIIA 4JG1L 3BOVA 3PL6B 3OWEA 5E8OB 5INDA 3ZLQC 1C16B 3RIFF 2DQCL 3QFJD 1UB5B 3WXWH 1RIHH 3GSQB 4KDTC 3WFBL 5TFSH 2CDFA 2VUOA 2EDLA 4QY8B 3NIFE 4F57L 1FYHB 5J9PA 43CAB 4WHYG 4NQTA 3MRCB 1U0QA 1UCBH 3O6ML 4RAHA 3P4OA 4LVEA 1HHJB 2NY5L 4KKLC 1DEEA 4PJ5A 5D6DA 5IBTL 4XVSH 1AQDA 4ZUWA 1WWWX 3OXSB 4Q7DA 3L95A 4U1SA 1IGMH 4QHLB 2JELL 4XCNB 1CDIA 1ZA6A 3BE1L 1DDHA 3BN9D 1FBIL 3WUWB 4JFOB 5F88A 4PLOB 4HH8A 2DM4A 1PZUB 4JDTL 4AM0A 1TCMA 1T3FA 5IB4B 2YR3A 3IU4L 4DGIH 5EO1B 3FFDB 4TPRL 4HEME 2W59A 4N0UE 5I71B 2RBLA 4N0RA 1S9VA 4JG0L 5TE7L 4YJZL 4PJ9A 1KPVA 4TNWK 4RFEB 4M43H 2RGSA 3T8XA 5KSBF 2NLJA 4QXUH 4ZDHA 1Q1JH 1X6LA 2WUCH 4RGOH 2XZCH 3C6LD 3QZWB 3OTTA 1KG0B 1YN6B 4KU1A 5HHMD 3O3EA 4YHKL 4XWGH 5IB2A 5C9JB 3IXAB 4OAWA 5HGBB 5AG8A 6FABL 4XH2B 5AEAA 1GC1C 3DI3B 2EYSA 5DJDA 3QG7L 3KR3H 4JM2D 2CJUH 5CP3A 4EOWH 1KBGH 3TP4A 4DN4L 3I6LE 4K3JH 1S9WB 2Z9TA 2IBZY 3MYJB 2APWA 4NUJA 3AXLA 2N7BA 4IIQB 2VLLA 4K7PH 5F6HI 3D39A 4HJJH 3K8MA 1BLNA 3RWCA 5D1XD 5ACZB 3F8UB 3O4OC 2E7HA 1AQKH 4HK0A 1TQBC 4MMXC 3ZE2E 3ZE0F 1FVDA 5HY9B 4PJAB 5MENB 4K3EH 4Y19B 3BSZH 4RBPK 4PTTA 4HZLB 4J3TA 4QRPE 4X6DF 1EVUA 4UI2A 2F19L 5H35A 1LWRA 3T0XA 4UTAH 3RL2A 4XP9H 2E27L 4TOYL 1HQRA 1KTLA 3MOBH 2WUBH 3RUGA 1H8NA 5KSVB 3OKMA 5CKGA 1J1XL 2C3VA 4KAQH 4KKBC 4NZRL 1Q9LA 4JKPL 3PL6C 4MQSB 1C5BH 1NCAH 2MPAL 5TE4L 1JRHI 1RUMH 5FFLA 2J6EH 3CPLB 4N9OB 4JFDA 2HMIC 3DTXB 3JXAA 5CJ8A 4HW6A 3SDYH 1A7QH 3J8F7 4OZGB 5HVFB 2MCG1 1IC4L 1JPGA 4DK6A 3C2SA 1OD7A 1XF5B 1T89C 3VH8A 2ADJB 1FGNL 3IJHA 4XHJD 1U3YA 2EZ0D 3HC3L 4K9EC 5I1JL 2GJZA 5B22A 3V8CA 3G08A 1M1SA 1OCWL 1JPFB 1LEIB 2H6PA 3ARBB 1FNGB 1FZOB 1UWEH 2WM0A 1FNHA 3U4EA 4HHAA 4Q97A 5MEOB 1V3LA 3BP6B 4XCYB 1QSFE 5FHBL 1BVLA 3PIQB 1G6RB 3GKWL 4QT5B 3EHBC 2R2CA 1AXTL 5GGVY 5DQ9A 5I71C 3O8XD 3BZEA 3EUUA 2HTLD 3UO1L 3HKFA 4HS3B 1JI1A 3KDMA 1EEZB 3ZYIA 5I1HH 5IVXB 2A6JB 3C08H 4QRUB 2DWEA 5GRJH 4OTXH 1N0XH 4YQXL 2DM2A 3QEGH 3PWPA 4CVXA 4JGUA 3I6LD 4HMDA 2W9EL 4LF3B 1ZT1A 5IMOA 4IOSD 3I75B 1ZLWH 2FR4B 2DM3A 1MI5E 3TIEA 1L6XA 2F9BT 4LCWE 2ARWA 1C08A 4ZFGH 3S5LB 4S0TD 4F80A 4MS8C 2OZ4A 4IBLT 5D96B 1F2XK 4NDMA 4Y88A 5M94B 2H3NB 1YDPB 2NZIA 2ESVB 3GHBL 3OR7B 4FTVE 2W0LA 2QJDA 5T5NF 1Z9LA 4M8QA 1JWUB 3EO1B 5BXFA 5B3JE 1CFQA 2O5YH 4ZUTA 3VRLF 5I1LB 1IAOB 4YNYA 2Q7NA 4QRPD 1FVEA 3O2VL 3VXSB 1FO0H 3K4DA 4WY7L 2AXJA 5F7UA 1UVQA 1NC2A 3GJFH 5DK2B 2ZUVA 5EU6B 3K2MC 4NQEE 3IDGB 1OQOA 2P4AB 1HN1A 4Q6IB 2BZDA 2R23B 1XGUA 4O51B 2QQKH 4RMWA 1BIHA 3MLVH 1K3ZA 3QIUA 1DN0B 1IKNA 4FQXB 3NCEB 5D7IF 3UTQA 4UQ2A 4XNUH 3K2UH 3K81A 3LSOB 1IC7L 5AZ2L 4NRXB 3ARWA 3VGEA 2CUHA 4Y4FD 1DR9A 3DV4A 2NY2D 3OAZK 3LKOA 3PG2A 3U82B 4PJBA 4FQ1L 4HJ0C 1JGVH 4FABH 1BQLH 4GT7A 2YSSA 3DMMD 3TV3H 2Y7QA 4XMKH 4U2ZA 1KUMA 2HTKC 5KVDL 5H37G 3FB8B 4KK5D 2IFFH 3MV8A 3HMXH 4NJ9L 1PJ9A 1TCRA 4AIZB 4OF5A 4MNGE 1BBJB 4YFLF 4Y4HA 5CEZD 3K46A 4Z76A 1AO7E 5I1EH 3ARBC 2ATPB 3LPGA 5CJOH 3HG1E 2ZCHH 4OF7A 3CNKA 3TO2A 1WZLA 4UT7H 2FSEB 5BMFH 1T5WB 5HGAB 1CL7L 1EDQA 4LLVA 3S7GA 1NANH 1T7YA 2VISA 3IDXL 4KTDH 5B8CA 5HDBF 1RFDH 3MGAA 1CFVL 2IPTL 3E3QC 1Q0YL 1Z3GH 1QLEH 4R0LB 1T66D 4GW4A 2CKBH 1S7QB 3CJJA 2BSTA 3IRZA 4TTDC 3CFJA 2X7LB 2Z4QB 2LTQB 2NR6D 4L4VA 5T1KD 1WFOA 4PJDB 3R4DA 2UWEE 1B0GB 1LNUB 1I8IB 4HWEH 1A3RH 4LSQL 3SKJL 4FTVD 3UPRA 3BH9A 2BNQE 4IJ3B 4LLUA 1QG3A 4FQJL 1KB9J 3N1MC 5D96C 2KH2B 1IGTA 1GJIA 1YMHA 3QQ9C 1HEZB 3VE0B 2EDQA 2H32A 1CIUA 1QA9A 5ISZA 3LV3B 3UBXI 5I1KL 1JNNH 1GC1H 4N8CL 2C7UB 4GRMA 2OM5A 3DIFB 3L7EB 3MCKA 3AB0B 4CNIB 5I8OH 1CGTA 4MAYB 1ORSB 5C0BE 1Q38A 3TVMD 1WFNA 4YIQA 1UXWA 4YHLL 3T0WA 1Z9MA 4DCQB 4UIMA 4XNYL 1Z5LA 3CCHB 1I85A 4WU7B 1Q72H 1I9RH 1BOGB 4ZFZA 4ZTOL 1F2QA 3DSFL 2DMKA 4Q6IC 4OB5L 3FL7A 3VGBA 1WFTA 1FFNA 5BOZG 4JEGB 4DAGL 3GNML 1SYSA 4FQXC 3I50L 1D5ZA 4W6YB 1JZ6A 1V3KA 4JFFA 1ZWIA 3CU7A 2OL3H 3G6JE 1BVKA 4YXHH 4F7CB 2NPLX 4TVPL 1RHHB 4JN2A 2AJ3B 4LCUB 4JFEA 3SOBL 4Q9RH 1LK2B 3T4YB 3MRRB 4OFKA 4GW1A 3PGDA 1LEKB 1QVOA 5IUSA 3MV9E 4EQ3A 3SKMA 3EKCA 5D7SH 3ZYJA 1AO7D 2HT3D 1IEBB 1TNNA 3VFUA 4LGPB 4F7EB 3HG1D 1ZVHA 3V6BR 4KHXH 3MJ8B 1CYGA 3QUMH 3AREC 4NC0B 1TMCB 1ZMYA 3I02A 4OFYD 2R0KH 2GY5A 4IMKC 4R4BA 3BN3B 5L9DH 5SWZA 1QFHA 3MUHL 1JGUL 2JCCB 3MLUH 5CJQL 3F7YA 1QQDA 5DURD 4FZEL 4Y2DA 1CZ8H 4OZIB 2APTA 4ESKA 4O9HH 1AGBA 4U3HA 1X5FA 1U8QA 1J5OH 4UDUB 3RPIB 1CD8A 1MCQA 1AKJB 1G9MC 15C8L 2C9AA 1DQML 4IRJA 2C1OB 1JBJA 4IHOA 1HHHB 1YA5A 1Q0XL 4GUPA 2FIRT 5TDOA 4QRTA 4NRZA 3ARGA 3BQUB 3AY4A 2R2BA 1A14H 3B2VH 3P9MB 4PJIE 2BNQD 4KHTL 1FJ1A 2DQUL 4LDOB 1CE6A 3CVHL 4QHKJ 4H20L 1DVFA 3O3BA 5ERWA 1T0NA 3SO3B 1OARL 5F7KC 1NMCB 2UZIH 4XPTL 1RZJC 3BKJH 3MNWA 3OKEA 3QDJB 1ADQL 3EOBB 1X5LA 4OIBA 1IGIH 3O6FA 4IJ3C 5CINL 1RUQL 4JR9H 1H0DB 4L4TA 1WBZA 5JLZA 1KPUB 1CU4L 1G1CA 5GJSH 5C0BD 2DM7A 2CMRH 2R1YA 2NY7L 2EXYC 4X5WA 2ZNWA 1FZMA 5T1LB 1TTUA 4LHUA 1EMTL 1T83A 4ZO6A 5GPRA 3HUJF 2DYPA 4HKBA 1E4WL 5EU7C 5JW5A 1R24A 3L5WB 1N0LA 3AB0C 3LKQB 4G9DA 4MQXD 3BGMB 1B2WL 4JDZB 1CGSH 1A5FH 5TDPB 4JZJB 5C70A 5L7XH 3EYQD 4LIQE 3THMH 2AJXL 4DQOH 1INQB 1A6AB 1NMBL 3QFJA 4YH6A 5HYEA 5DRNB 3S4SA 1YC7A 1RZ8A 4DOHE 3GSXB 2WLYA 3IFOB 3HI1B 4YXKH 4HGWA 5E9DB 4HC1L 4NQXB 4OCYL 4BH8A 5ALCH 4PJAF 3U0PB 4PJ8D 4WRLA 3VMOA 1VGKA 2UVEA 5IFJA 1KC5H 3V0WH 3U36A 2JTDA 3SGKA 3ZZ1A 3QUZB 4CKVX 2X1OA 3BRGC 4Z7VF 3QDME 2YN5A 4TSAL 3MV9D 3IU3A 1S5IL 1V3MA 4RMQA 2AVGA 1ZKAA 3W82A 5BV7L 5LAXB 1XIWB 3HR5B 1NGZB 3RWGA 2GSGA 4U1HB 1P69B 4RA0C 2F15A 2XA8L 4CVZB 3NN8B 3S37L 1F90H 2XOTA 5TPWH 3BI9X 2APXA 3PHOA 3SQBA 3HC0A 3B5TA 2F5AL 1FL6B 1IAKA 3V0AC 2GTZA 4WU5B 4OQTH 1VEPA 2VITA 2W9LA 5DVNA 3VJ6B 3HE6D 4UOW1 4ZYKB 1I8MA 3M45A 5JPNA 3EJYD 5JW4R 3FN0L 1F6AA 1VFAA 1WC7B 5IKCB 4CUCA 1NCBL 4X7TA 5C3TA 4YHMH 3EO9H 1MWAA 5C0ND 4LKXB 2HKHL 4F8TA 4LPCA 4XWOC 3C6LA 1MJ7L 5ANME 3KLDA 3MUGB 3EZ8A 4PLKC 3GI8L 3QNZB 1XF3A 5TQ2L 1WZKA 2KQNA 4F7TB 1A6VH 4U6XA 5SWSB 4QHKI 1KLUB 3IFNL 3FZUD 3UJJH 5ENWA 3ARDB 4S2SA 2XNAB 1J0ZA 5I8EA 2M8XA 1G6RH 3I84A 4HAFA 5I2IA 3BQUC 4IRZL 3EYVB 5JW4M 2AEQL 1LO2H 5T3ZL 3H9ZA 3NIDF 4LKCB 5EU4B 1HZHH 5GZOD 3IGAA 3SO3C 5IVXF 5DF0A 4HS8L 5IK3B 5MHSE 5BZDA 1NMCC 4K94C 3CXDL 3G5VB 3EYSH 2J1KA 5D1XA 4WWKC 2ICCA 1ZLUK 5DD5L 3D48R 4K8RH 4HSQA 2KDGA 3PWJB 2NXZD 2J8UE 1CFBA 2F54E 4Z9KB 5T33H 4OM0H 5FCUH 1G7IB 4K3GA 4X7SL 4KKAD 4UV7H 3OKKB 2BVTA 2FB4H 1NCCH 5FGCB 4ZD3H 2DD8H 3F62A 3V5DB 4WUUB 4BFIA 5JHDD 2A6DA 2R56H 4NBXB 1QUNA 3T0DA 3GMOB 1LP9B 3MCG1 5F96L 4JZJC 4HKJB 1NGXA 3QEUB 1JNLL 2IC2A 3LDBB 2MHAA 5KS9B 3OHXA 5FUZH 3I9GH 4RDQF 4XTRD 4C54A 4XAKE 4WO4D 1FIEA 3UTZB 3TJHC 4LRNL 4MXQD 3LKRB 2Y6SD 3SDCD 3D3VE 2BOCA 4LVOB 4C83A 3RIAK 4NUGL 2R9HC 2VERN 4M4PA 3P4MA 3QUZC 5GHWL 5KSUB 2D7OA 5K59F 1NGPH 4YDJA 5D2LB 1XIWC 1OTTC 5DQDL 4A6YA 3FQUA 1FV1B 4P5TD 5I18H 3BMVA 2AI0L 1D5XB 2X4UB 4N0UA 1AXSB 2IQ9H 1T1YB 4QHMA 2K9UA 4GXVL 1FFRA 3MR9A 3VXME 3HAEH 3ULVH 1XGYH 3JTSA 4YDIH 3D5OF 1FVCA 4GKOA 3V52L 3MV7B 4XVTH 2VXQL 4H5SA 3DVIA 2FDBP 1RIVL 2AKRA 4WTZG 2YD8A 5HYJE 4KJPD 5E00A 5IBLD 2C5DC 4KI5F 5DJZB 4G6KL 2VLKE 2ZJSH 2A6IA 2V5SA 3JVGC 4G5ZL 5HHOB 4PREB 5B4MC 4MDIA 1A7OH 4APQD 3MO1A 2NY4D 3UAJD 3C5ZD 1CK0H 2ARJA 5D70L 1HDMB 3TEUA 3JSSA 3ZDYE 3ARDC 3WD5H 4MA3B 5FF6B 3MJ6A 5MHSD 3OL2A 5FDWA 3N85L 2X4SA 1FN4A 2ZUQB 1G9MH 3ULSA 2DQJL 2X4NB 3DHJA 5KVGH 4WVRA 3MODH 1KIQA 2Q76B 3MJ7A 4U1LB 1DTUA 4R26L 2F54D 3W0WD 4PJDF 1BEYH 4QRPA 2HFGH 4FQLL 4LSVL 5C0CE 4N68A 2Q3ZA 2QHLA 3S36X 4JY6A 4J7RA 1BF8A 3CUPB 2ADGA 3B43A 1K4CA 4Y16D 3OKDA 3NH7L 5I30H 3LN9A 3SE9L 2RAMA 4TULL 4XC3H 3AS0A 1LO4L 2QQLL 3ZKND 4LQFL 3VGHA 5KVEH 3KPTA 1QHOA 4R8WH 4XAKD 1C7SA 2OSLB 4LGSB 5MEQB 1MOEA 2JIXD 4Y4FA 4QNPE 5LCVH 2KL6A 3D3VD 3LDBC 1LQSR 5KANI 2GAZB 5EDXA 3LRSA 3MXWL 4OI7A 4BSWA 3C2AH 3DMMA 4MHHI 3V7AE 1FFPB 1I75A 3GMNB 5DFVD 3RDTA 4MVBC 3L1OL 4J8RA 3X3GH 2YZ8A 4LVOC 3OKLB 5J6HA 4J6RH 2ERJC 1FORH 1RU9L 4OJFL 5IIEA 5E6ID 2VKWA 5IESH 4ZS6D 2V5MA 4EDXA 5C09B 4M7JH 1KENL 5F72S 2B4CL 3IS1X 4P3WA 5DEGB 2EH8L 3PV7A 3VXMD 2R1WB 4JPKL 2K3TA 5JO5B 4NQSB 3QNXA 4Q9BA 4E41E 4GJTB 4GMSH 1HYSD 1SJEB 3ARXA 5C0RH 3I6GB 2AEIT 1LE5B 2DTMH 5HD8C 1JGLL 5KN5B 3IF1B 3QB7C 1JCKA 3WLWD 1J18A 4Z7NF 3QI9D 4G43B 1RIHL 4LLQA 4XXCC 5TQ0L 3DVGA 1CXLA 4P23B 3O6LH 1F6FB 1YY9D 3QXUA 4X4ME 3KYOA 2IH3B 1XR8A 4JFXA 3T0AA 1VACA 1BJ1H 5HDOA 4NYLA 1MI5A 4RX4D 5T1KA 3S35L 5F89B 4LCWA 3VFNA 4LSUL 5T5FL 2KZ1B 5GGQL 3DRQA 4JLRB 4R3SB 4K3DH 3BKCL 1DLFH 4OZIF 2ZCKL 3TF7C 2JJUA 3EO0A 3MRQA 4FTVA 4KPHL 2BSRA 4XAWL 4GFTB 2ITDA 3QFDB 2VLRE 4C56E 2HA1A 3RWHA 2ZUQC 2WINB 3P77A 2PO6B 5LBSL 4KRLB 1G9EA 3RZCB 3UZQA 2BXYA 1CDCA 4I3SH 5C0CD 3HI5H 4JE4B 3FRUB 4MJIB 4M8VA 1DQQA 3TVMA 1CR9H 1MRDH 3KPOB 4L29A 4U7MA 2HVJA 1A0QH 1UJ3C 2MCPH 5SX4I 4CDGC 3ZKMD 1KJ2L 4QXUL 1YEEL 3PP3H 1MJJA 2DWDB 4EUPA 1QD0A 2X70A 4DTGH 4K94H 2ARJQ 5C07B 2IANB 3NZ8A 1U8JB 1LGVA 1P7QD 1ROWA 2DL9A 4GKNA 5FKAA 4FFVC 4YFDB 3VXUB 3VRLE 4L1HA 5IW6B 1EEUA 3F7VB 1FYTB 5D5MB 2QQNL 4M1DH 2CJUL 3C60D 4I13B 4K3JL 4PB9H 1R5WA 3OAUL 5IROC 1WSST 5EUKA 4WDIB 3RNKA 1UKSA 4YBQD 4IS6A 5KZCB 3QG6B 12E8L 1YUHA 1AQDB 4MNGA 1UC6A 4PJ7F 3PXHA 3ROOB 4I4WA 3L95B 1AO7A 3T2NH 1AQKL 4E41D 1ZA6B 4QXTB 3DUUB 5HYSA 3HG1A 1CFSA 1MQKL 4OFYA 2X9XA 2VDMH 1CS6A 1GOFA 3RWIB 1DCLA 4MJ2A 2NNAB 4JRXB 1LO5A 3TN0B 5D1QB 4NC1E 4UTAL 1JRHL 1OD9A 5JZ7C 5EUOB 2P5EE 2QEJA 2WUBL 4NKDB 5DEZA 2ZUWA 1EHAA 1DQJB 3L6FB 3QDGE 4NQUA 4KAQL 3QULB 4NKQB 3GMPA 4QXGL 5JW4Q 5EC1B 4HDIB 3GGWB 5CWSA 1C5BL 1NMAH 2VZ1A 4BK4A 2CIIB 4GKZB 1A1MB 1UEMA 1G7LB 4Y5XA 4ODBD 4YGAB 1RSFA 2UWEA 4P23C 3VH8G 1A6UH 3BD4A 2OP4H 5IB1A 3TBTB 5E6YA 4TUOA 5CILH 3EBAA 2QKIA 3A67L 4KVNH 5EZIH 3F58H 2E7CA 5I6XB 4JPIB 3CIQA 1FZJA 1TETH 3MRHA 2BNQA 5ADPH 2AXGB 2VLRD 5LVEA 1BZQK 5F7MC 4C56D 4AIOA 4OZFH 3QUYD 4IMLB 5DJ8A 3ZMRA 3MBXL 2HLFD 3VFMB 2J8HA 1EAPA 3L3IB 5EBLB 5GGRB 5C0AE 1JGEB 1KEMH 2HFFA 5T3XL 1L9NA 1RJLB 3QQ3A 5C0DB 1ZXQA 5HDBE 3ECBA 1ZLVH 1E28B 3AXLB 4ZAKB 1NAMA 2VLLB 2PO6C 1K5NB 5C0BA 3RZCC 5FECB 4X6BA 1BLNB 4NKMA 3FOMA 5JPMB 3RWCB 1KXTB 2CDGA 2HT2D 3T3PF 4M9PA 4X6FB 3T4AB 1PQZA 5CEYB 3EYUH 2O5ZH 3UTSB 4HQQL 1MIEL 1JPST 2F58H 2CRYA 1U8HB 3LKSA 5A40E 1YPZB 3NZHL 5FM4A 4Z7QE 2GCYB 1JMXA 1A7RH 3KNBB 25C8L 1FNEB 1JHTA 3D87B 2V2WB 2IQAA 1N5AA 3G6JA 4Z5RB 1U8PB 4OV5B 5DJ0A 2V7NB 4PJ8A 2PXYD 4KTEH 4QEGA 1KULA 4PY7B 4F7MA 4EKXA 4YHOH 3EFFA 1IM3A 1HWGB 4S1SH 5JIKA 3L3OB 3T1WA 5K9JL 1XCQA 4JDVB 1C1EL 3ZTJG 3MV9A 1DBJH 5INCA 4CW1B 1L9MA 4KI1A 1U3HA 4NHUB 4OCRL 2VR5A 1XH3A 4M03A 3NOIA 3GRWH 2NTFB 5F9OL 4U49A 1IZKA 1YEFL 4RGNC 3MROB 3G08B 4YC2B 3NTCH 5C6PB 3NCCB 2P5ED 4TVSa 1KF9B 4MNQB 3FB7A 2ADIA 3QDGD 1JTPA 1MHEA 4QLRA 3HE6A 4PLNC 1S7SB 5I16B 3TN0C 5D1QC 3MRJA 2DL2A 1TJIL 1CGWA 5LGJB 2AXFB 2C3GA 3K2UL 1TZHA 3MFFB 4CVWA 1QKZL 1XGRB 3LEVH 4V2CB 4KKLD 4JHAH 1IGJB 4GAFB 1JGVL 1VADA 4FABL 4PJIA 1I4FA 5FYKH 1QYGL 4ODVH 2GT9B 3PWPB 2Q8BH 5GS0L 1IAIH 3I2CH 5C0AD 5I6XC 1CQKA 2CLRB 5F6IB 1NFDB 1N4XL 3P0GB 4DGVL 1NUNB 1OPGH 3PQYB 3X17A 5F9DC 4N1CA 3DX7A 4QYOA 2HYMA 2ZCHL 5DJAA 5BXFB 4ZAKC 3BP5B 5JORA 3LMJL 2ZCLL 4JGMA 4MA7H 5C86A 5BMFL 1DEDA 1L7TH 1NDMB 3GSUA 5F9JA 2OJEA 2GK0A 1RUAH 3IJYA 1FG2A 4NRYA 2AJZA 1Z3GL 1QLEL 5CJBA 2J7LA 2X89D 2EDHA 1UM5L 4AMKH 5DFWH 4FQCH 1Z0MA 2VE6B 3NACH 1NLBH 4LAJH 1PG7L 1BX2A 1DUYB 4WO4A 3QDMA 1I1CA 4OLYL 1A3RL 1C5CH 4OLEA 3MFGB 5E99H 3SDCA 5B38G 2VLJD 3KYKH 4P2RB 5DHYA 1JZ5A 3BIKB 1VDGA 1N7ML 1NBZA 1MCNA 4HUWB 3MLWH 1T1XB 3T2QA 1QBLH 1GOHA 3ZT7A 2W92A 4P5TA 4P48A 2AEPH 2LV4A 3RWFA 2DBLL 3GB7B 3V4VL 5FHAL 4OZ4B 2N4IA 4PJAE 5MENE 4OM1L 2FBJL 4YC2C 4Y19E 1G7MA 2ZUYA 1TIUA 1QNZH 5HJ3A 3D25B 3PL6D 4EN3B 3IKKA 3S34H 3BISA 1S7XB 5GZNC 3L3HA 2HMID 1EFXB 5ANMA 1QBBA 1N59A 3FO0L 5DWUL 1XR9B 5L88H 5E5RB 3T3MF 5EIQA 1ZLSL 4F2MB 3FQWA 3PWNA 4U1MB 1PKQB 1JZ7A 4KUCF 1P2CA 3T65A 1U8LA 3PWUA 3NFSH 4WFGE 3C5SB 5JNYA 4J3SA 5C0JB 3CFJB 2E7MA 5M95B 4A6YL 4Q9RL 3CFDA 3GHEH 4L4VB 1F5WA 4OZGE 5HDLA 1JTOA 4APQA 3C5ZA 2ADFH 4BSVA 3FT3A 2PTTA 4NQDE 5TE6L 3BPLC 5DZOA 4FP8L 2HH0H 5D7SL 2V7HA 4WJ5B 3DURB 3CFBA 5F6IC 1QLRA 3UPRB 4KHXL 4U05A 4AT6A 1RJYA 2J8UA 2F54A 2R0KL 2V2TB 1CDGA 4NCC1 4H88H 3IVKA 1KEGH 4N0CD 5HVGB 1B3JA 2DLEA 4RISH 4UTBH 2B7DT 5KAQG 3GSVA 5MP6L 1CZ8L 1JUFA 4LEOB 1CIDA 5B39G 5IWLA 2PCPB 3QQNA 1AHWA 2FH8A 3PWVA 1J5OL 4Y16A 1VHPA 3RX7A 3EOAB 3H42H 1J11A 5CD3B 2A1WH 4YIQB 3E3QE 3WFCL 3O9WB 3EYOA 5KTEL 3NIDE 4Z0BH 2O93L 1F3DJ 3WKMH 1J05B 4K7FA 1P5UA 4FFYH 5DHXB 1XGQB 1R3LB 5IVXE 2LAGB 3TBSA 1I1FA 1LO3L 4PYHA 2RHEA 4N0FB 5DMYA 2JIXA 2K7PA 2DI7A 1KFAL 1A14L 1BQUA 3D3VA 4MS8D 5E94A 4D2NA 3RU8H 2CO6B 2Q20A 3P30H 3LOWA 3QWRD 3G6DH 4C59B 3VFGL 4JFFB 5I8CA 5AWNH 2XWTA 3VDBA 2R4SH 4PY8J 32C2B 3D0VB 3Q6FB 1WBXA 2ITCB 2QSTA 3SJVB 4M5ZL 4YHZH 3V8OA 1P6FA 1CF8L 1BZ9A 3MA9H 1IGIL 4LHUG 5E6IA 2ESVE 4FG6C 1MLCA 1CG9A 5DD3L 5MEND 1MFCH 4WW2A 3VXMA 4Y19D 4ZFFA 1A8JH 4BZ1H 1W8OA 2QV2A 4PS4H 4WHTA 5DTFB 3VXSE 5D5MF 3GK8H 1SMAA 3KJ6L 3LEXB 3K8KA 4NWUH 3L3KA 2OR7A 1TITA 1T7XA 3S4SG 5I1IH 1W72H 2XWJB 5ECJE 1LO0L 4MQ7A 2E6PA 5F97E 1A5FL 3L3JB 3S8WA 4HPYH 5KJRH 3QI9A 4MD0A 5SWZB 3THML 4DQOL 5HYJA 3T1FB 3MRKA 1QQDB 2NY6C 2V6HA 4HWZA 4Y2DB 4GMTL 4NM4H 3BZ4B 1DBMH 2I25N 5CHNA 3E0GA 3MUZ1 4PUBH 5K59E 2VLKA 1ZS8A 2DLFH 4YXKL 4YFLI 1CDYA 4WFGD 5IT2H 5ALCL 1ERNA 2B2XH 3ME0A 3BVNB 2HTKD 3V0WL 2ED9A 2NXYB 1MHHB 1NLDL 3NCJH 1F97A 5EUOF 3ULVE 4R7DA 2GY7B 3KAAA 2OXHA 3VCLA 2FWOA 4JJ5B 3RA7H 4LARL 4HKXA 4MXVE 4JFPB 4S1QH 5CEZL 5D2NB 2QTEA 4RIRA 3UTOA 1V7NH 3O11B 1B9ZA 3BWAA 3ARBD 5J57B 5KBNC 1TJHH 5TPWL 1AP2B 5F1NB 5E2TL 1ZLWK 5C0CA 1IL1B 2HFEB 3L3DA 2XRAL 3TBVB 2NY1B 4C55A 4OQTL 5BVPL 1H15A 1TPXB 1NCTA 3MC0A 2JK5B 1S9YA 4Y4KB 3EOYG 5BCAA 3RRQA 3LN4B 4MLIA 4AK1A 5D72H 1MIML 2VSDA 1Q9OB 3HZYA 4TTDD 2UYLA 3MLSL 3N1PC 2DYPB 5K9OA 1U6AH 3DGGB 3Q1SL 4YHPB 4J3VA 5EBMB 2B1AH 3UJTL 4J3XA 4F3FB 4NO5A 4FN0A 2I07A 3O9WC 1P7QA 3GJFK 1A6VL 1M05B 5BS0B 5ELIA 4ZPTB 4MB4A 5L6YL 1MF2L 4PJDE 5FO9A 3GI9H 5F7EH 1YEJH 3C60A 3IFPB 1LO2L 4PJHB 4IOFC 5K9KA 2LAAA 1WK0A 4FQQA 2IH1B 4XNQA 4WV1A 2OQJB 3CSGA 1M7IB 5CZVL 1HNFA 1EXUB 2ESVD 1KCRH 3GSWA 2I9TB 3UBXG 4R4FL 5DC4B 3OV6A 4JFYB 2J6EA 2Q6WB 4NO3A 1S7WB 5EWIL 1I7UB 3RWGB 3VXSD 3B9DA 3HZKA 1NCNA 4E41A 1AJ7H 3QBTB 3T2OA 3HS0A 4BQ6A 3U0TB 1U91A 4OKDA 4MX7A 5EU6D 1F8TH 1S9XA 3D0LA 5J7CC 4G8IB 5IFHH 4ZD3L 4MWFA 3VFSA 2J4WH 1GGTA 2EXWC 3O2WL 4Q9QH 1IAKB 3QEHB 2G75A 4P9MH 2R56L 3WIHA 4FQXD 4M6NH 1B0RB 5EOQH 4MCZA 1KB5L 5GSRB 4X4MA 4L8DA 3BRDA 5JPNB 2G60H 5F7DB 1RY7B 2FATL 5DUPH 5FUZL 4Y2DC 1PY9A 4H8WL 4XT1C 5F7NC 5IMMB 2DJ4A 3ULVD 1MWAB 3AAZA 5KG9B 3I6KA 5EZJA 1UXSA 1PZ5B 1U41A 3K3QA 2BY3A 1INDL 3ROLA 1YMMB 4AEIH 1U93A 2NXYC 3NFPA 2R39A 2VLRA 4C56A 5ENWB 3QUYA 4I9WE 4ORGB 1M7DB 4DGYH 4UT9L 2CXGA 3TYFA 4OGYL 4JHWH 1DZBA 3KPRB 4TNWF 5D2NC 1IFHH 5IOPB 3PWLB 1U8IB 3FB6B 5HHVL 4LLYB 4HUUA 2IQ9L 2VR4A 2MFNA 3DYOA 1UENA 4HKZB 4EQ2A 4AH2A 4M9OA 3WE6B 4GKSB 4PTUA 1XGYL 3RZWA 3OJDA 3HR6A 4XNMB 2NY1C 2CLZB 4X8XA 1TPXC 2JCCE 2IG2L 2HJLA 4G8FB 4Y4KC 4OZIE 1EBPA 2Z31B 1NFDF 2DQFA 2Y07L 5DR5L 5DRXA 1MCWM 4TUKH 3HZVA 4BFIB 4KMTH 5EO0B 1MAMH 1HK6A 1FO0A 4FQIH 4XMPH 4HXBH 4L3AA 4JM4L 1U9KA 1KJVA 1H3GA 2V17H 2PXYA 1A7OL 3VWJB 2CRMA 5CCKH 1JWSA 4WHYH 1WZ1H 2ATKA 2VLMD 1ORQB 3WD5L 3QEQE 5F8QC 3QH3A 2GJ6B 1ZE3C 4I5BB 5TDNB 5KVGL 1F13A 2X4TA 4CDHA 2BOCB 4C83B 1EFQA 3TNNA 4OT1L 3QCVH 2EXYD 4PV9A 3DX6B 2A74A 3QDJE 1HSAA 4O5LH 5DMKA 5E8PA 4JZNB 1X5GA 2HFGL 4MAYD 1EX0A 3DRTA 3INUH 2P5EA 1F4XH 1KCUH 4L9DA 4EI6B 3MBEB 3U4BH 1UA6H 3QDGA 4LVHB 4N0UB 3QCTH 2Q3AA 1ZANH 4HIHA 4XPHH 1GSMA 1MUJA 4BQ8A 4Q2ZA 3HMXA 1EIBA 3VFPA 3BP7A 1EEYB 4ZNEE 2BC4B 3QO1A 1NGWB 3E8UL 1YEHH 1IT9L 3MTRA 4E0RA 4XCEA 3PE9A 5IHZA 3G6AB 4JQVC 3P0VH 3BP4B 5DMJB 1C12B 5LCVL 1R5VA 4XNXH 2ENYA 5EC2A 4UB0H 5HGDB 1XF2A 3IKCB 5TGBB 3VFVA 4XP5H 3SKOB 3NBNA 4I9WD 5JMRA 2ICEB 5FOJA 3VXOB 2CR6A 3X3GL 2A6IB 5CGMA 3MSPA 5SV3A 5C0AA 2Z8VC 3BPCA 1J1OH 5IV2A 4OIAA 3CFKB 1QFPA 2CKBA 1XMWA 1FN4B 1NCWH 1QP1A 3ZHKA 3BKML 4ODSH 5A43C 1MRCL 3G5YB 1CBVL 4CADA 4RAVA 2R2EA 4JKMA 3DROA 1OP3H 1GIGH 2VXSH 4GMSL 3GMMA 2H26B 1ZK9A 2DTML 4M6OL 1JZ2A 4I1NB 2WLZA 4G6ML 4XWOD 1UT9A 1AKJD 1BBDH 4GAGL 4OCMC 3QSKB 1INEL 4J1UB 5FB8B 1YY8B 2X89A 4X0KA 3CFCL 3FAWA 1DSFH 1BGXH 2XIDA 1XCTA 3BQUD 3MLXH 4PRIB 5F1OB 2D03H 3U0WH 5SWSE 1SY6L 2IALB 3CDYA 4X80L 1OT1A 3BFOA 1MCDA 1XAUA 4D9QE 4M61B 3HPJA 1Z0NA 1T2QH 1BVZA 3TH4T 2WAHA 3LRSB 2VDKL 5D6CA 5HVWA 3ELAT 4U0QB 3QDJD 1U8KB 4NN5B 1LK3L 2X9WA 5DHVB 3KPLA 4JANA 4PGDB 5E2UH 4JKWA 4FZ8H 3RDTB 4OGXL 2EDKA 4HIJA 4I3SL 4Z77B 3WV0A 2OL3A 4XPFL 3G5XB 5C08E 5T1LD 4U6HA 2P8MB 1H3XA 4X9IA 5ICXB 1A4KB 4WI7A 2JB6B 2YA1A 3KWWB 2WSKA 4EUPG 1IILE 1AI1H 4KKCC 3V6OC 1CR9L 1QSFB 2YA0A 2IF7A 2PN5A 3M17A 2MCPL 2HKFH 5C71A 5E8OA 4UINL 3S97C 1C16A 2MQ0A 2DQHH 3MBEC 3X3FH 4WUUE 3OKOB 1UB5A 4TSCH 5I66B 3BT2H 3GSQA 4ZPVB 3QUMA 5E9DD 5GRUH 3V5HB 4ISVB 1LP9E 4QY8A 1PYWB 1YNKH 3TJHD 5DVMA 43CAA 1EO7A 3MRCA 1VGEH 2ENSA 5KS9E 4HIXH 4Y8DC 5IHUH 1T89A 1HHJA 5CAYB 3QUZD 3KYOB 1KCSL 1JK8A 1XR8B 1PDKA 1WISA 4M6ML 4D9LL 4F7PB 1J8HB 1UACH 2DB8A 3MNVA 3OXSA 1XIWD 1MI5B 4QHLA 1OTTD 1R5IB 3MOQA 4XCNA 4LCWB 4KJYB 4EI5B 5HYSG 2CGRL 1OAXL 1XT5A 3V2AR 4FRWA 3WUWA 4JFOA 1A2YB 3ARRA 5L8KB 3CMOL 4UUJB 1WIOA 3UX9B 1SEQL 4HT1H 3EO0B 2RQ8A 5TH2B 5D2LE 4NM8H 5IB4A 3QPXH 2ITDB 5EO1A 5KAQF 4N1EA 4CAGA 3ARYA 1BJ1J 4FA8A 2X1PA 4OZHB 5CJ5A 1T0PB 3P2TA 1D5MB 2H2PD 1QBMH 4PRNB 4NQEB 2YWYA 3VFTB 2WQ8A 5FCSH 2C3WA 1FQ9C 1YNLH 4P3CL 3PGCB 5FYKU 3TT3L 5FV2A 4PG9B 4P2QB 3MXVL 1DQQB 4DN3H 4L29B 3MV7E 2FZ3B 4O2FB 4XP4L 3QZWA 5E7BA 4XCCH 4JG1H 1KG0A 1YN6A 1F6LL 3OKNB 2OP4L 5SWSD 3IXAA 2DQCH 5HGBA 2BJML 5I1DB 1S9KC 4XH2A 2W60B 3ARDD 5IM7B 3CAFA 3AS3A 4TQEL 4OSUL 5EZIL 3WDIA 1GGUA 1TETL 2YD3A 4YEFA 5HHOE 3K74B 1MJ8L 1S9WA 2LU7A 3QWRA 3MYJA 4MGXA 1G0XA 2AQ2A 3A6BL 4IIQA 1P4LA 2NY5H 1AR2A 2FEEI 2V5RA 5IBTH 3OQ3B 5JQ6L 3U83A 1UM4L 5HYIA 1RZGB 3B5HA 4D0DB 5H37H 5ACZA 2JELH 2C3HA 2UZXB 2QBWA 3BE1H 3TPUB 4EEEA 5HY9A 4PJAA 5MENA 3RDTC 1AC0A 4Y19A 4HZLA 4J3WA 2YD1A 4JDTH 4GAYB 2Y5EA 5MI0B 2O5ZL 4PJHF 4WUUD 3IU4H 3RGVB 2L4OA 1T5XB 3WN5A 2LVEA 4TPRH 5KSVA 3U1SL 1IQWH 3U7YH 2KUTA 4LP5A 2MOVA 4JG0H 5TE7H 1OLZA 3MLYL 5KANG 3VFRB 5EH1A 2X2YA 3VXNB 3S36H 5IFAH 3CPLA 4U1NA 3WFHB 3QXDB 4P9HC 4MHHG 4X6CE 4OZGA 1HXYB 4S1SL 2DS4A 4FXLA 4YHKH 3G5ZB 4NQDA 5EULV 1XF5A 5F8RC 2ADJA 3U30B 4NCDA 3ZSSA 3QG7H 1QACA 3O4LB 1FZJB 3V6FB 4DN4H 3RTQA 2FGZA 4HS6A 4EI5C 3SY0B 1JPFA 2BERA 2LFGA 5CMAB 2WP3T 1LEIA 4MZ2A 5IMKB 1FZOA 4RZCB 2FJGB 2N56A 4LAQL 4FQPA 5C09E 2EIEA 5CEXB 2NY3B 3NTCL 5HD8D 5MEOA 3BP6A 4XCYA 2YPLE 3T3ME 2VL5B 3ORJA 1SVZA 3PIQA 1G6RA 3SGDI 5C0IB 4QT5A 3TT1L 4NP4H 4KMLB 3BUYB 4YHIB 1X6NA 2V9TA 3MV7D 3TCXA 1S8DB 3EIFA 2CDGB 4HS3A 1P84J 1EGJH 3W9EB 1EEZA 3CH1B 1DJSA 3T0VA 4OD1L 2F19H 3H9SB 5BV7B 5IVXA 3PGFL 1PSKL 2A6JA 4X4ZA 2E27H 4TOYH 4QRUA 3TVMC 1U42A 4WGVB 2DQEL 4GO6B 4NZRH 5HHOD 1X9QA 2MPAH 3SKNB 4LF3A 2YMXH 1JHTB 5FYKL 5AZEH 2FR4A 3I75A 3X14B 4ODVL 1OGAB 3S5LA 3DO7B 1QPXA 1IAIL 4XI5C 5F1SA 5IQ9B 3NIGF 2HN7B 1IGFL 3SBWA 2QHRL 3IDJB 2H3NA 1YDPA 2ZOLB 2ESVA 1IC4H 3ESVF 3OR7A 1JWUA 3EO1A 1FGNH 3GJEB 4OCSL 5I1LA 1BWWA 3HC3H 5GQBA 1IAOA 3VXSA 5I1JH 3U2SB 2VOTA 1U3HB 3NIFF 3U9PL 3GSNH 4ZQKB 1MAKA 1OCWH 5DK2A 3SEPA 1X7QB 1RZKL 5C0FB 5C0GB 4AIXA 1I1YB 3WHXA 3O6KH 3IDGA 3O2DL 1RUAL 4MJIE 4Q6IA 1U58B 4O51A 2R23A 2X42A 1EHLL 5MI0C 5D7JB 5GRYA 1WEJH 1MH5B 5FHBH 1DN0A 3GKWH 1TZGL 5IHBA 3FB7B 4FQXA 3RGVC 1AXTH 4FFVD 3LSOA 3LS4H 1DANT 3ILPA 2FGWL 3T0EE 4NRXA 1BREA 1F02I 2PW1B 4B7LA 5C07E 2IANE 2CUIA 1EHNA 4OKVB 1JV5B 1NLBL 3JWOL 4QTHB 1P7KB 3VXUE 3RVVC 3AVEA 2P43B 5E99L 5D5ME 2DQIL 1A64A 4JRYB 1FC2D 5GGTH 4DW2L 2W9EH 3H8NA 1X5HA 3FB8A 3BESR 3U30C 2VQ1B 3WHE1 3MLWL 4AIZA 2CR3A 3GFUA 4ZUSB 5C09D 5EU3B 1MFAL 4CN1A 1T0MB 3CU1A 4GRLB 2X1XR 1BBJA 2F8VA 2AEPL 5I17B 3KLHC 3KGRA 3JV4B 5JZ7D 4BFBD 3GHBH 1T1ZB 1I3VA 2ATPA 1UWXK 3HTLX 2NQCA 3AU1B 3DI2B 5C9KA 3SE3C 2NY3C 2FSEA 3F12A 4P46B 1JGDB 1T5WA 5A2IH 4JRXE 3O2VH 1JTTA 5HGAA 1E4XL 3TESA 3LQMA 4G8EB 4KXZI 4WY7H 5EUOE 4ETQB 4NKOB 1G84A 4P23D 3W5NA 3OF6D 4N8VB 3E1F1 4R0LA 2GK0B 4ENEC 3IJYB 1S7QA 4OI9A 2FO1A 3MLTA 2X7LA 2Z4QA 5BV7C 2I27N 2XQYK 3EDDA 4N5ED 3X12B 1JNHB 4LSRL 4PJDA 3BYTA 2VZTA 4JGJA 2DQTL 3ZE2F 4MQXC 1B0GA 1LNUA 1JPSL 1IC7H 1FRGL 1I8IA 5AZ2H 3GHEL 3PP3K 2ADFL 4G8GB 1YEIL 5HPOA 4FQ1H 3OJMB 2DTSA 1BX2B 4XX1E 4WEBL 1HSBB 3OGOE 4U7SA 5EPMB 5GS3A 2PO6D 3Q5TA 2W0FB 4G3YL 3RZCD 3VE0A 1HEZA 1V7ML 5KVDH 3IDUA 3BAEL 3ARFB 3LV3A 5F1IB 2C7UA 5LGHL 4H88L 4NJ9H 1HHIB 3B8YA 1H5BB 3L7EA 4CNIA 4G7VL 4MJID 4MAYA 1ORSA 1U3HC 1N3NB 4DCQA 2WK2A 3W9DB 3CCHA 1LDSA 3UTSE 4P49A 2HWZL 4WU7A 1BOGA 4DZ8B 1ZGLM 4H1LB 2H8PB 4POZC 1YPZE 2IAND 5C07D 3WYRA 1UYWL 4W70A 4OLXL 5D7JC 4ZNCD 2YUZA 3RIAF 3QUKA 3DVNB 2X4PB 1CL7H 2MNUA 4UBDC 1BIIB 1OY3B 4MAUL 3IDXH 5DD1L 3VXUD 2ZP0T 3TBWB 1VENA 2N1KA 5CKAA 2XV6B 5ANMB 4BFGA 1CFVH 5BW7C 2IPTH 1FYTD 1Q0YH 3RU8L 4GLRH 4F7CA 1RHHA 2AJ3A 5GRVL 4LCUA 3G6DL 1NGYA 1LK2A 3T4YA 3MRMB 3JWDL 5C0NC 2R4SL 3MRRA 4MA1B 4UDTB 1AD9B 3T65B 5KZCD 3WEXB 3HHRB 1LEKA 5M7QA 5DGQA 1II4E 4JO3L 3CFDB 4KY1L 3MA9L 2Y23A 1MCLA 4LSQH 5ICYB 3FT3B 3SKJH 1IEBA 2WWMC 3K4ZA 4F7EA 2E9BA 1I9JL 3PNWB 3MJ8A 5IMLB 2VL4A 4GRLC 1ZHNB 1A9BB 1NFIB 4FQJH 3U9UB 4JRXD 3TN0D 4OLUL 2WANA 4NWUL 5D1QD 5F3HB 1P84K 2R29H 2JCCA 2ZG3A 3S88L 3GIVB 2QR0B 1VERA 1FGVH 4OZIA 5I1KH 3PUCA 4MNQE 4N8CH 3NPSC 3QXTA 2VMFA 4NNYB 4UDUA 1H3PL 4P46C 3RPIA 4XBPB 2CSPA 1YYML 1AKJA 4NM4L 1M71B 4X9FA 4YHLH 2C1OA 1ZLVK 5HHQB 1HHHA 2HG5B 2ZSWB 4XNYH 3FT4B 4N9GA 5B3JF 2ZSVB 4ZTOH 3DSFH 5J89A 4OB5H 2PETA 1DLHB 3BQUA 4PRPB 3L5XL 4DAGH 3GNMH 5ADOL 1NPUA 4OZHF 5GGSY 3I50H 3P9MA 4MLSA 3TBSB 1I1FB 2DIJA 5E0QA 4KRNA 1OB1B 4HEPG 3WDHA 1RHFA 2W0KA 3N9GH 1BAFL 1PLGL 1WVZA 3ULUH 4TVPH 2FL5B 2AABH 1V7NL 2BY1A 4EVNB 2EO1A 3QDJA 2PUQT 4LPVA 3EOBA 3SOBH 2VXUL 3EOTH 4M6AA 3PXJA 4KJWC 1HH6B 1NFDE 4ZAKD 1IMHC 1H0DA 1NEUA 1KPUA 3GUTB 4HCRL 1L0QA 1NBVL 2YPKB 3ARFC 3EYFB 2UVFA 5T1LA 2AV7B 4YHNB 1UWGH 1H5BC 3L5WA 1OSPL 1F4AA 3LKQA 4ZFFB 3VG9B 4ZNEA 3BGMA 2C4FT 4JDZA 4W68A 4EZMA 1WITA 1G9NL 5TDPA 4JZJA 4X5XB 3S3JA 1INQA 1A6AA 2R2HB 5C92A 1JGUH 5CJQH 2NW3B 5DRNA 4IDJL 4FZEH 2B1AL 1F4YL 1RD6A 3C9NB 3O0RH 1NDGB 3GSXA 4OD3L 3V7AG 3IFOA 3HI1A 4MD0B 5HYJB 4NQXA 2Y9RT 4OFDA 2J88H 3U0PA 5H94B 1NFKA 4LL9A 15C8H 4F33B 4NN7B 2VLKB 3WJLC 1RJZB 4ONGL 3QUZA 1Q0XH 1U36A 2FX8H 5LAXA 1XIWA 3TA3B 3HR5A 1NGZA 2EYRB 4ZTPL 1G6VK 4U1HA 1ZA3A 3FFCB 1H8OA 4MA1C 4P2RE 2UUDH 3H7LA 2UY7A 4KHTH 2DQUH 4CVZA 3CVHH 3NN8A 4H20H 1KJ2B 5FEBA 4HZAA 2V9QA 4OUUB 1OARH 4ODHH 4XPTH 1TNMA 1C5DB 1FL6A 4PP2B 1VB9A 4FXGB 4PG2C 4WU5A 4EIZC 4MNQD 5IFHL 3VJ6A 1WWAX 5CINH 5GZND 1J87A 4ZYKA 4HJGB 2OJZL 1LEGB 1RJCA 1WICA 4P9ML 1CICB 1WC7A 1ZGLA 3FKUS 5IKCA 5B38B 1S9YB 1EPFA 1E4WH 3FN3A 1P9MC 1J86A 4K9EL 1S7UB 3MUGA 3QNZA 3BYYA 1NAKH 3JVGA 4EXKA 1QR4A 2DKMA 2BFVL 2QQQA 3CFEB 3R1GH 5T1MB 3GMQB 5SWSA 2AJXH 4B50A 4F7TA 1HKLL 1KLUA 1NMBH 4LASL 1QR1B 4JHZA 1PKQE 4V1DB 3ARDA 2XNAA 3PWPD 4HMCA 3EYVA 2B4CC 4UIKL 4HC1H 4OCYH 5F93C 3JV6B 5IGXL 5EU4A 5ILTL 5FO9B 2HJKB 2PW2B 5FA4B 4OIIL 2D3VA 3PQYD 1S5IH 5EO9B 3G5VA 5C08A 5BV7H 5HVHC 3D2UB 3SGEH 3AS2A 4H0GA 2RR3A 3MNZB 2OS7A 3PWJA 5DFVC 1BJ8A 2XA8H 1G7IA 3G6JF 3OKKA 3HZKB 1JFQH 2RB8A 5T5NG 3V5DA 4WUUA 1RUKL 1NC2D 2F5AH 1FE8H 4YAQB 3MJ9L 3D0LB 4WW2C 5E2VH 3GRWA 1VFBB 3VG9C 4TUKL 1LP9A 2CRZA 4NZUL 4KV5F 1MAML 4HKJA 3QEUA 5IEKA 5LGKA 2H9GB 3FN0H 2WIMA 4AEEA 5KS9A 4HXBL 1MREL 4UILL 1NCBH 4L9LB 5DI8A 4O4YL 4RMTA 4Z95L 1QTYT 1NUFA 4POYA 2D9QB 4I48B 2V17L 3UTZA 5I75B 1MJ7H 4M48H 1S7TB 3LKRA 1CLCA 1WZ1L 3GI8H 5CBAA 5TQ2H 4P2RD 1H9VA 3R0MA 1JL8A 3IFNH 3LZFL 4FG6D 3FRPA 5KSUA 5B39B 3TCLB 4UNUA 3CSYB 5D2LA 2NMSA 3TA3C 2IFGA 4QKXB 1RZ7L 4IRZH 2AEQH 3SJVE 3JZ7A 5T3ZH 1FV1A 3OKYA 3UPAA 2NX5B 4O5LL 1Y18B 1D5XA 2X4UA 3EFDL 4CU6A 5FYJU 2NY0B 5FM5O 1T1YA 4HS8H 1GCFA 1F4XL 4EDWL 4QWWC 3CXDH 5ITFB 4ELKB 3QCTL 4EN3D 5DD5H 4XXCA 2MSPA 4XVJL 2DI9A 3MV7A 5A3ID 1EFXD 4YGVB 1KACB 4X7SH 3RBSA 1WIUA 3SDAB 2YD2A 3RQ3A 4X98B 3WL9B 2X6MA 4XNXL 5DJZA 2AK4B 5K9QI 4JO2L 1FNSH 4JCMA 1D5IL 4XPBH 3ZKMC 1SEBB 2GITB 5HHOA 2N7AA 4KMQA 4PREA 5F96H 1JNLH 4L4VD 1FO0B 3VWKB 5L2JB 1KN2L 5FA3B 1D5BB 1HDMA 4WI9A 3GJFB 5FYLE 4MA3A 1IBGL 3P11H 5A2JH 5KVFH 2IWGA 1IGCL 3NA9L 4MB3A 4KK9C 2X4NA 4LRNH 5DD6B 5CIPH 5BQ7B 4MA8H 2Q76A 5E8DH 4K07A 1SBBA 4U1LA 4DVBB 2X4TB 1TZIB 1A7PH 1MFDL 5I8KL 2VXSL 3U7WL 4PV9B 5DQDH 1IKFL 5ALBL 1A47A 1OAKL 4MB5A 3H0TB 3CUPA 2AI0H 3O3DB 5E8PB 1TTFA 1HHGB 2GTWB 3ZTNL 3CVIH 2DQGL 4GXVH 2P1YA 3O9WD 1SM3L 1QPPA 3SDDB 2X4QB 2QSCL 1R3JB 3L5IA 2E7LC 3LY6A 2OSLA 5MEQA 1GHFL 2OI9B 3V52H 1F4WH 4X6CA 3UZVB 2VXQH 5EZOH 5HGGS 4L9LC 3VDAA 4JFFD 4Z7WB 1F3JB 1FFPA 4G6KH 5I75C 4P59L 3GMNA 3DSNA 2GYSA 4G5ZH 1M4KA 3OKLA 3SJVD 1FAIL 4EJ1C 5HYQB 1ZT4B 5D70H 5IG7B 2FX7L 2XFXB 1CD1B 5C09A 5CP7B 5DEGA 1EV2E 1Q9WB 1Y0LB 3ILQC 1XF4B 2R1WA 5H8DA 5JO5A 2DQJH 1NGQL 2EXWD 4NQSA 3M1BB 4S1DC 5FV1L 5DRZB 2D9CA 4HWBL 2VZSA 1SJEA 2B39A 3I6GA 2W91A 2NY0C 1LE5A 3RWDB 4R26H 4AJ0A 5KN5A 1P6AB 3IF1A 2DQHL 3U46B 5SWZD 4U33A 4FQLH 4G43A 4LSVH 3ALPA 4XB7A 3U4AA 1UGNA 1TLKA 4NNPH 4Y2DD 3DUHA 5FYJL 2AXHA 3P4LA 3OF6A 5J6GB 3OG6B 2QADB 4Z8FL 1MLBB 2IH3A 1Z9SA 5A2LH 3G9AB 2WP3O 3SE9H 3SDAC 3VGFA 5CBEB 4NBZB 1VGEL 3O3AB 1HIMH 4NZDA 2QQLH 5IHUL 3OR6B 4LQFH 5F89A 1TTGA 2NXYD 2FHBA 4OUOA 4HUMB 5FYLD 1T6VN 4JLRA 3WUWG 4R3SA 4JHBA 1E27B 2XICA 4KQ4H 5E08L 2DIAA 2OZ4H 3K1DA 1B88A 3MRNB 3VWKC 3NCBB 1YMME 3QCUL 1AE6L 3BZFB 5D8JL 3VFWB 3QFDA 1WWBX 4ZODA 4X7FC 3ZTJH 2WINA 3MA7B 4ELME 3RZCA 3VRJB 3P40A 1MHCB 3KPRE 3L1OH 1EBAA 1XEDA 3UMTA 2NY1D 1RU9H 4OJFH 4JANB 4RBPH 3UDWC 4JFQB 3IB4A 3R06B 4Y4KD 5C8JB 4MJIA 1MFBL 2VZUA 2B4CH 1U2HA 3KPOA 2EH8H 1QBML 2AK1H 3QZWG 4JPKH 1GL4B 4YWGH 5F7WC 1YNLL 4P3DB 2DYPD 2DWDA 5EOTB 1AGDB 3VXQB 3T0EA 3M17B 3MLZH 5EORL 3VGGA 1F00I 1M6OB 2IANA 3FO1B 5C07A 1JGLH 2J12B 1U8JA 4AG4L 1IQDB 5GS0C 1RZJL 4RNRB 5BS0D 3QRGL 2QSVA 3VXUA 5TQ0H 5IW6A 2OI9C 1M7XA 3F7VA 1FYTA 2YHGA 3QUMB 4QGYA 1IEAB 2CIKB 5D5MA 1W72A 4CU8A 4WW2F 1H3TA 4PP1C 3KPNB 3QQ4B 1F58L 2X10A 4JPVL 4WDIA 4WEMB 3S35H 3QG6A 4LSUH 5T5FH 1JK8B 4N8PA 5GGQH 2JB5L 3BKCH 4QGTA 3MNVB 3ROOA 2GJ6E 2ZCKH 2IPUK 5BVJB 3W39B 3DOSA 4K7PX 2R69L 4QXTA 5DA4A 3B9KB 5HGHB 3DUUA 3H3BC 4KPHH 4QCIB 4XAWH 1FNAA 1BHGA 2BVPB 4N5UA 3RWIA 4A2MA 5L2KB 2NNAA 4JRXA 3TN0A 5LBSH 3V6OE 1NUDA 5D1QA 5FAAA 2JJSC 5EUOA 4F9LA 4NKDA 3DGCR 2R0LH 1DQJA 3L6FA 1QFOA 1FH5H 4BELD 1IQWL 3U7YL 3ZDYF 3QULA 2C1PB 5EC1A 4HDIA 3GGWA 4PJGE 2CIIA 4GKZA 1A1MA 1G7LA 3S36L 5IFAL 1BWMA 3FT2B 1KJ2H 1T4KB 1YEEH 4BFEA 3TBTA 2QADC 2XG5A 1NL0H 1YMMD 2VAAB 4JPIA 4R9HA 4ZOBA 2EKSB 1ZHLB 4DUVA 1LDPL 4ZUVB 2AXGA 4RAUB 4JKLA 4OF3A 4IMLA 4B5EA 3W81A 5DUML 1CFNB 2QQNH 1OAQL 3VFMA 2HJFA 3L3IA 3KPRD 5EBLA 3CZFB 5GGRA 1YEDB 1JGEA 4O00A 3OAUH 1RJLA 2H32H 5C0DA 1Y6NR 1E28A 4JZOB 4ZAKA 1P4LB 1NBYB 2GI7A 12E8H 3N0PB 4OF0A 1K5NA 2RCSL 5FECA 1J0IA 5JPMA 4QNPF 4KQ3L 4NP4L 4RA3A 3SDXB 5IR1B 4X6FA 3T4AA 3WNMA 5CEYA 5JXEC 1RUPL 3S3PA 3UTSA 2P7TB 5AD0B 1U8HA 3FMGL 2H1PL 2P8PB 1MQKH 1YPZA 5E95B 4HIEB 2Z31D 5HI4C 2GCYA 1EGJL 4X4YB 3KNBA 3UCRA 4X4XB 2K1MA 2OX5A 3X13B 1JRHH 2NW2B 1AIFB 1FNEA 5HHPB 3WN5B 3QWOB 5C6TL 2V2WA 3SQOH 3C5JB 4Z5RA 3OAZH 1U8PA 1PG7W 4QXGH 4OV5A 2V7NA 4ODTL 4KK8D 3I85A 2YMXL 3DETC 4UAOB 5AZEL 1UADC 3VWJD 3PV6B 4PY7A 4U1NB 2ZKHL 1X4XA 4PRIE 4MD5B 4CMHB 3L3OA 3ARVA 2IPKB 4JDVA 4U1KB 3P3YA 3CDGA 4NFDA 4OF6A 2GJ6D 4CW1A 1R3HB 1NEZA 2IAMA 4I0PB 3A67H 43C9B 4RDQG 4NHUA 3RNQB 4NQDB 4KKNA 2NTFA 2I9LB 3KYMB 3TYGL 3WFEL 2EC8A 4RMSA 1R6VA 3BW9B 2D7TL 3E6FB 5I19L 3PP4H 4RCAA 4KKCD 3MBXH 3MROA 1DUZB 5CZKA 3GSNL 3GMLB 3RTQB 4XHQA 4HS6B 4MSWA 3B9KC 5T3XH 4MNQA 5ITBL 3MBED 3O6KL 4RRPA 4WCYH 1S7SA 5I16A 1HINH 1U8MB 1JWMB 4I77L 5IW1B 2A83B 1WEJL 4PBWD 3MLRL 2OTWB 3FHQA 5LGJA 4N0YL 2AXFA 4JREB 2E9WA 5F9WB 5J8OA 3LS4L 3MFFA 3GM0A 3V9FA 4HQQH 1MIEH 2FLRT 1L4IA 4N0CC 1R3KB 1XGRA 8FABB 4P2YA 1OP3K 3NZHH 3KPPA 5E8EB 5LWYH 1IGJA 2YRZA 2OBGA 25C8H 1ZEAH 1EO5A 1FLTX 3RY6C 5C3LD 5J1AB 1PD6A 3BRFA 1QRNB 2GT9A 4KRPB 5DYOB 3AFLA 3D6GA 1X5IA 1YEKL 3ZO0A 5GGTL 1J8HE 4AENB 1B4JL 2CLRA 2OYPA 4YZFE 1NFDA 1KELH 3FN9A 5K9JH 2NCMA 2HLAB 1C1EH 5AYUH 4XCFL 3PQYA 1KB5B 3P9LB 4O2EB 4OCRH 3ARQA 3W2DL 3BP5A 4IIQC 1A6ZB 5F9OH 4GQ9L 5IW3A 5DO2C 1NDMA 4ZO7A 3SPVB 1YEFH 2VDQL 3ALXA 4DJMA 1FCGA 1P1ZB 4QOKB 4PFEA 2XTLA 4DKAA 4OZHE 4Q9CA 5ESAB 1I9EA 2BVYA 2ZPKL 1QFWL 3OPZL 4TVPE 3BKYL 3WHXB 5DT1L 5FXCH 2B1HH 4P2QE 5C1MB 1MCHA 3ZKXB 4QHUB 4PJCB 1TJIH 4OBRA 1G1YA 2VE6A 1KXVC 1DANU 1N64H 4PRID 1A9EB 5CUSL 3WN5C 3NCYP 5GJTL 3FHAA 1DUYA 1UEYA 1QKZH 3ILPB 4OI8A 3JTTB 1FNLA 2CLVB 4P4RB 1GYAA 3O3UN 3WBDA 4F9PC 4F37F 4UAOC 1PW3A 2P48B 2FO4A 3B83A 3QNYB 3HAEB 4P2RA 4CMHC 3CMGA 3BIKA 4UNVA 4U1JB 1JP5A 4P2CG 4B41A 1A1OB 1N6UA 1QYGH 4HUWA 4L3EE 2FHFA 3L3GB 5IQ7H 3RDTD 3GZKA 4I0PC 5GS0H 4ZOEA 3QDAA 1T1XA 2L7UA 2G5BA 2D31B 3LKNB 5F3BB 1MCIA 2WMPA 4QTIL 1R0AL 1N4XH 4DGVH 3D18A 5SWQB 3GB7A 5GISL 4OZ4A 1QSFD 4WHCA 2MWCA 5E5UB 5F7LB 4J4PA 3STLB 3RTQC 3Q48A 3D25A 4EN3A 1OAUL 1QSZA 1X5ZA 1QO3B 1OW0C 1S7XA 1CLYL 2NYYC 5F1KC 3LMJH 2ZCLH 3F12B 1HH9B 1EFXA 2AP2A 2VDOL 4LEXH 1I7ZB 4JREC 1ND0B 1XR9A 5F9WC 3V5KB 1MCPL 4F2MA 1NC4B 4U1MA 1PKQA 4WFFE 4BZYA 4FNLH 4PJEE 3PDOA 3C5SA 1UM5H 3CK0L 3HE7B 3MLTB 1J8HD 5C0JA 3WO3B 2Z35B 4MNHB 1UKQA 2X09A 1MI5D 3GBNH 4LCWD 4UQ3B 4EI5D 1D9KB 3Q6GL 4K8RC 1KT2B 1PG7H 4KRPC 4ONHB 4OLYH 4Z7QF 5HYFA 4I18B 4IOIB 4WJ5A 3DURA 5JA9A 3O4LE 2PYFB 1FFQA 1F3DH 1N7MH 2V2TA 4LCYB 3SBWC 4D0CB 5JTWA 1B6UA 2R29L 1FGVL 1MVUB 4LEOA 1QLFB 4NQED 4TVPD 2PCPA 2D7PA 4DVRH 2DBLH 4P2QD 3EOAA 3KXFB 3V4VH 5FHAH 5CD3A 3RWJA 4LCIH 2O61B 4OM1H 2FBJH 4LCCB 5D4QA 3O9WA 3VI3E 2W0PA 1AGCB 1J05A 5BJTB 5D7LB 2EDFA 2YD6A 4YUEL 3H9SE 4LSTL 5DVOA 1DE4B 1XGQA 1R3LA 1BECA 4MJ4A 5CSZB 4N0FA 3VW3H 3ZKXC 4XI5D 2ZUTA 4WI6A 4AYFA 2P42B 3FO0H 3QUKB 5DWUH 3ZDXE 3B2UC 4MXWL 5BOPA 5KW9L 1ZLSH 3LS5L 1RVFL 3DNKA 3N9GL 1OGAE 4OLZL 3ULUL 2BSSB 32C2A 3D0VA 3LKPB 3Q6FA 3RAJL 6CGTA 2AABL 3AMKA 2ITCA 3SJVA 3HNVL 1UZ6F 3MRLA 4U6YB 1NGYB 3EOTL 3MRDB 4A6YH 3IDYB 2Q8AL 3ULVC 1HI6B 5J0BA 1YNTB 2ZUUA 1CVSC 5TE6H 2GFBB 2DI8A 1GGYA 2VN7A 4KV5E 4FP8H 4LLWB 1MCRA 5DTFA 3QO0B 5DDHA 3LEXA 1UWGL 1JE6A 2EEAA 3RGVD 4LVNB 2XWJA 5IB3A 3PDDA 4JKKA 4FHBD 4GSDH 1KJMA 3L3JA 1X5JA 3T1FA 4UMGA 5MP6H 1G7QB 3BZ4A 1BQHG 2YZ1A 3FQRB 3O0RL 4WFFD 3OG4B 5FM5M 4LRIC 1FLRL 5T3ZE 4OFPA 4PGJA 2L0DA 1X5AA 2VKXA 3RVVD 2J88L 4HGKC 2Y72A 1CXHA 3WFCH 3BVNA 3QT2A 5KTEH 1AGEB 4PV8A 1MHHA 2B0SH 2VQTA 3EDJA 5I1AB 4N9GB 5IHLB 2XY2A 4R0LC 3KS0H 1LO3H 2FX8L 4WTXA 4JJ5A 3HE7C 4JFPA 5D2NA 1KFAH 2LTQC 4W6XB 1Q94B 3O4LD 4JRYE 2ORBL 3QEQB 3KLHD 3O11A 2ZG2A 4RGMB 3VFGH 2ZZUT 4ZFOL 4ODHL 4I18C 1AP2A 5F1NA 2NY3D 4QF1B 1IL1A 2HFEA 1DL7L 3TBVA 4M5ZH 1T21B 1CF8H 4N90E 4J3OC 4XB8A 5J13B 2JK5A 4Y4KA 3MRBA 1DQDL 2NTSP 5DD3H 1AFVL 3LN4A 4ENED 8CGTA 1Q9OA 3KJ6H 3H9SD 3DGGA 2C4FU 3HPLB 1H3UA 1T22B 5DK0B 3STBA 4YHPA 2ZNXA 4MAYC 4X83A 5EBMA 1LO0H 4F3FA 1NAKL 4LCCC 1WBYB 3R1GL 2OR9L 1M05A 2E3VA 5BS0A 4MCYB 4ZPTA 1KJ3H 1I3GL 4GMTH 3DX9B 2BRRL 3KYAA 1OGAD 3TPKA 4LMQE 5DMIH 3IFPA 4PJHA 3R8BB 2IH1A 2FBOJ 2OQJA 1M7IA 1AXIB 1EXUA 3DV6A 4G8GE 1N2RB 2I9TA 1NLDH 1JHLH 4BH7B 3BIBX 3REWB 4P5MB 4JFYA 1CL7I 2Z91B 2Q6WA 2VSCA 2EE2A 3KPMB 1S7WA 1KTDB 3B6SB 3M8OL 4TNVK 4LARH 1I7UA 5JA8B 5CEZH 3IDYC 1U3HD 3GDBA 1ZA3B 5MEPB 4GLRI 3U0TA 5AAMA 3SGJA 2OTUB 4G8IA 1JFQL 3IAQA 5E2TH 4POZD 4LPXA 5D7JD 5DEFB 3QEHA 1FE8L 2XRAH 4OZGF 4RQQB 5FGRA 4LVNC 1B0RA 4JQVA 4UBDD 5E1AB 5E2VL 5BVPH 5GSRA 4NHCL 4OZFB 1VFUA 1OWWA 5F7DA 3MGTB 3UYOD 1ZGLB 1HOCB 2G9HB 1MIMH 1FFOB 3EDKA 1A02N 1EZVX 1X3DA 1DQTA 5IMMA 3MLSH 2YC1B 3Q1SH 5KG9A 5SX5H 4M48L 1PZ5A 2EE9A 2FEDC 3DYMA 3UJTH 1YMMA 3K7UA 1N8ZB 1D6EB 4JRYD 2X41A 4JQXC 5E2WH 5LJYH 3CLEL 1JF6A 2WWMD 5DXWA 4ORGA 5L6YH 1M7DA 1MF2H 1DQLL 4WI5A 1LD9A 1KB9K 1OM3L 1AC6A 4GRLD 4Z78B 3KPRA 5IOPA 1GAFL 3ZT6A 3PWLA 1ACYL 1RIUL 1U8IA 3FB6A 2VZOA 1BD2B 4LLYA 3AGVA 5CZVH 4JB9L 4N90D 5DFTA 1WIPA 4JAMA 1Z6JT 1K4DB 4R4FH 3BDXA 4HKZA 4MQTB 1IARB 1RURL 3FOLB 1PX4A 3WE6A 4GKSA 5C08B 5EWIH 4P46D 3C6SB 4XNMA 2CLZA 4OLWL 2XN9B 3L7FB 5J13C 4H25B 5LQBH 4G8FA 4EUPH 5FKPB 2PYEB 5TF1H 3I3DA 2Z31A 5GGSB 1SJVA 1KPRB 4OCNC 3MRGB 4HH9B 1UM6H 3CDFA 3O2WH 5E4IA 5EO0A 3B3IB 3HNTL 3ETBF 2IGFL 3LEYL 1FNSL 1KB5H 4XPBL 3IDMB 1BQSA 5IEKB 4UU9B 2VWEC 5C6WH 4X8JB 2FATH 3VWJA 1BFVH 4PRPE 1EUTA 2F5BL 4G8GD 4H8WH 5GGUA 1ORQA 1NJ9B 5DI8B 1T7VA 1KYOJ 3P11L 5KVFL 3QDMD 4KJWD 3GBML 2GJ6A 4LNRA 4I5BA 5TDNA 3HC4L 3V6ZB 3JV0A 5CBAB 1ZVYA 1INDH 1I7TB 4MA8L 5E8DL 3MV11 3DX6A 3ARFD 4PJCF 3MACH 3LQAH 3MRPB 4PJBE 1A7PL 4I3GA 4UT9H 1PVHA 3V6OA 4JZNA 4KWUA 1ZT7A 4OGYH 3QIBB 2BCKB 5HHVH 4EI6A 2R8SH 1KTRL 5KSBB 3MBEA 1JN6B 1XGTB 3ULVF 3CVIL 3WNNA 4PJGA 1CI5A 1EEYA 4MXVF 2BC4A 1NGWA 5FOBB 3RVUC 2IMNA 5HI3C 2D4FA 3G6AA 3BP4A 2DLTA 2IG2H 1F4WL 1YQ2A 1C12A 4Z0XB 2H2PC 2Y07H 5DR5H 3CX5J 5HGDA 1S78C 2D4DA 5EZOL 3IKCA 5TGBA 4QRQB 2EDEA 3SKOA 1W0VB 2ICEA 4JM4H 3VXOA 4PGBB 2PNDA 1N6QL 2OMNA 3BMWA 3CFKA 4YDKH 3QDHA 3DYPA 2Z92B 3FFCE 1S7RB 1KCVL 3IXTA 1FHGA 1ACZA 3BHBB 1NAMH 3HMWL 5IVOA 3G5YA 2NZ9C 4R4NC 4LNVA 2KBGA 5FUCC 2FH6A 4X6DB 5DJ6B 4OT1H 2H26A 2C3XA 1X5XA 4J12A 1YJDH 2D0GA 4GBXA 3QP3A 4PRAB 3RVTC 4BUGA 2DQDL 4NNPL 4U6TA 3CD4A 1A6WL 3REVB 4YR6B 2BRQA 4J1UA 3O45B 5FB8A 2VO5A 3TWCL 1YY8A 3SGEI 3BO8B 4BQ9A 4FQ2L 5CSGA 1HIML 2XQBL 4PRPD 4PRIA 3E8UH 1IT9H 4IRSB 4NT6A 3GSRB 5CGYC 4E5XB 2IALA 3HZMB 4KQ4L 3RKDC 2OZ4L 4X6CB 4V1DE 4M61A 2ICWJ 2Z93B 4WI8A 4BA8A 3HI6L 1U8KA 5DHVA 4PGDA 4HBQA 1MRFL 4WNQB 4Z77A 5AAWA 3G5XA 2P8MA 4XZUA 4LGRB 5ICXA 1QOKA 1A4KA 2JB6A 3KWWA 4JFEE 5TF0A 2D7MA 1QSFA 2YPLB 3P0YH 2AK1L 4E42A 3BKMH 3DARA 1MRCH 4U3XA 5DA0B 1CBVH 4YWGL 1MCOH 3QIBC 5E5MB 2UUDK 4M3JA 1IM9B 1ZVSB 4S0SD 1YECL 3OKOA 4XP6L 3SKUD 1Q9KB 3MLZL 5I66A 1C7TA 4M6OH 5DVKA 4ZPVA 1GZPB 3H3PL 3S96B 3V5HA 4ISVA 5HYJD 2YK1L 4G6MH 3VRIB 3A0OA 1FL5B 1PYWA 4WUKH 3WSQH 4GAGH 1K8IB 2I24N 1INEH 3OBAA 2VLKD 4M1CC 5T3XE 3CSPA 1KNOB 2GUOB 3CFCH 5GIRB 4F7PA 1J8HA 2GEEA 1T2XA 3LH2L 1CCZA 3T09A 4ZSOB 3U6RB 3CGTA 4B7IA 3TA3D 1UH2A 1R5IA 3TO4B 4KJYA 2FIKB 4EI5A 3FFCD 2AJSH 2JCCF 3ISWA 4NGHL 1SY6H 1MPAL 4NJAH 4X80H 1A2YA 2P5WB 4L1DA 5I73B 1RZKC 1CGUA 2APFA 2IADB 4UUJA 4P5KB 4K55A 5TH2A 3VA6A 4QWWD 2VDKH 2NX5E 1LK3H 4Q0XL 3KG5A 4GH7B 3FQTB 1D6VH 4OGXH 1S5HB 1G7HA 4OZHA 1K2DA 1LILA 5EZLB 4XPFH 1D5MA 4PRNA 4CMMB 4NQEA 2R0LL 1CICD 4I2XB 4TRPL 1FH5L 3VFTA 5D7IB 4Y5YB 2MKLC 3PGCA 4R90L 1J0JA 4PG9A 4P2QA 5K9QG 2Q87A 2VTFA 1T1WB 2FZ3A 4O2FA 5D1ZB 4RMUA 4GRWH 3IDIA 2J8OA 3QA3B 1HILB 3ZKSD 4UINH 4LK4A 3OKNA 4PRHB 4XX1G 3VXRE 4QRRB 5C2BL 5I1DA 3T0EB 2ICWI 4LMQI 4V1DD 2W60A 5IM7A 5A1AA 2AK4E 5GGVL 1NL0L 3WIIH 5I9QB 1MCCA 4KK9D 4IRSC 5CLWA 2KQMA 1ODAA 2BHYA 1ITBB 4NQCB 2HT4C 5DLMH 1W72B 3QFJE 1KCSH 3TIDB 1T03L 4S1RL 4M6MH 3SE8H 1AGFB 4D9LH 3DXAB 4BKLB 4BSJA 1RZGA 3MQIA 4D0DA 3H3KA 9CGTA 4W4OA 3TJEL 2GQHA 3D2UD 2CGRH 5IF0B 1TDQA 3TPUA 1OAXH 2FYYB 4LLMB 4BK5A 4XBGB 1WAAE 3OSKA 4KUZL 3CMOH 2XZZA 1URLA 1SEQH 3IJSB 3RI5F 4GAYA 3BPNB 3HLAB 3RGVA 3WLBB 1SYVB 1T5XA 3ES6B 1ZHBB 2P45B 3CVHA 1EJ6A 3FCTB 4NSKB 2VR9A 1WF5A 2RFXB 3CX5K 4JRWA 3VFRA 4C4KT 3ARTA 3VXNA 4B0MM 3MREB 4UNTA 3SQOL 2CPCA 2F74B 4OCXH 3WFHA 3QXDA 5EU5B 1L7IL 5T3XD 4TSBL 4P3CH 3TT3H 3QXAA 1ADQA 4PJEA 3MXVH 2VC2L 1KIPB 4XP4H 2HRLA 1HXYA 5GXBB 4NKIL 1J88A 1MNUL 4GG8B 3G5ZA 3IFLH 2I60L 1E4JA 2BJMH 3RHWF 4Z7WE 5JDSB 3VA2C 4TQEH 4OSUH 1OSZB 4N5EC 3ILQD 2VNCA 4QRSB 5DD0H 3O4LA 3V6FA 4LP4A 1U8OB 1U95B 4L5FH 3SY0A 1MJ8H 5CMAA 2NX5D 4S1DD 5IMKA 4RZCA 5C7XL 3PP4L 2FJGA 5HHME 5I73C 3A6BH 2NY0D 2HJFB 3SE3A 5CEXA 5JQ6H 5JXAL 1UM4H 2VL5A 2XWBB 4YHYB 3DBXB 1A4JB 4X5LA 2DBJA 5C0IA 1SBSL 4HC1A 1UB6A 4WCYL 3F6IA 3BUYA 4YHIA 1HINL 3VI4E 1CFTB 1S8DA 2FJHA 3W9EA 1I3RB 3SDAD 3CH1A 4M62L 3H9SA 3BDYL 5CSBA 1U92B 4G42B 4PRDB 4Y5YC 5F6HJ 2EIBA 3JWDC 2AK4D 5LWYL 1IE5A 3GIZL 5D1ZC 3U1SH 5KSAB 4WWID 1ZEAL 1N6VA 3MLYH 3SKNA 3B9AA 3Q5OA 3VWKD 3X14A 3T0EC 1IJ9A 1OGAA 1B4RA 1Z9OA 3DO7A 2CUMA 4HBCH 5LXGL 5IQ9A 2FX9L 4AEFA 5I9QC 2P46B 2HN7A 3IDJA 3ALWA 2ZOLA 4HV8B 1A3LL 1KELL 5DQJA 5AYUL 2E5EA 3CDGB 3GJEA 5ABDE 1HE7A 1NEZB 2IAMB 1L0YA 4YO0B 5GSVB 3U2SA 1OGTA 1YQVL 1LP9F 5I0ZA 1AR1C 4ZQKA 1X7QA 3LQZB 5C0FA 5C0GA 5KS9F 4N1HB 1I1YA 3JUYA 3OB8A 4LAQH 4JVWA 1U58A 4MSWB 5D7JA 1MH5A 3BPNC 5GS0D 3TT1H 1NCDL 3SDDD 1KSRA 2B1HL 4BQCA 5JR1L 1YN7B 3L9RB 3RWEA 2Y25A 1UZ6E 1ZSDB 5BW7A 2PW1A 4CN4A 1N64L 1FSKB 4OKVA 5D2LF 4F9LC 1JV5A 2YEZB 4PP1D 2P8LB 4OD1H 4QTHA 3ZE1E 1U8NB 1P7KA 3PGFH 1PSKH 3Q3GB 4J2XA 4JY4B 3KPPB 2DQEH 4WW1B 3UYRL 2AERT 3F7QA 4JRYA 5CGTA 3TH3T 5BO1L 3P73B 4NOBA 1ZAGA 2BNRB 1KN4L 2RJMA 2VQ1A 5IQ7L 4ZUSA 5EU3A 3B9EA 1T0MA 4GRLA 4M7KL 1V05A 5I17A 3UEZA 1IGFH 1SMOA 2QHRH 3JV4A 4KRMB 1G9NC 2AJVH 1T1ZA 4YXLL 2BOBB 3HUJB 2EIZB 3AU1A 3RL1B 4U4BA 4YX2L 3X11B 3WS6C 4ZUUB 4OCSH 5ESQB 4M1GL 4KK6C 4P46A 1JGDA 4YHYC 5L2KE 1D3CA 3F7RA 2VDPL 4G8EA 3U9PH 4Z7OF 4HUXB 4U0RB 2G2RB 5EOCL 2FHCA 5CIPA 1DFBL 1MWAL 4NKOA