5HIAA

Human hypoxanthine-guanine phosphoribosyltransferase in complex with [3r,4r]-4-guanin-9-yl-3-((s)-2-hydroxy-2-phosphonoethyl)oxy-1-n-(phosphonopropionyl)pyrrolidine
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
202
Chain Sequence
TRSPGVVISDDEPGYDLDLFAIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLIKVIDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVAVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Design of Plasmodium vivax Hypoxanthine-Guanine Phosphoribosyltransferase Inhibitors as Potential Antimalarial Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 71
structure length 202
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hiaA00
4LYYA 1QB7A 4F8EA 1U9ZA 4RHUA 4MB6A 1XTUA 4LZAA 1G9SA 1UFRA 3QW4B 1P17A 1AO0A 1DQPA 1VSTA 1GRVA 1WD5A 1XTTA 4QYIA 3GGJA 1L1RA 1V9SA 1ECGA 1ECJA 1A98A 3ACCA 1UPFA 4WMLA 1A3CA 1XTVA 1O57A 2GEBA 1NONA 1PZMA 1QK3A 1Y0BA 4JLSA 1QB8A 1O5OA 5HKLA 1D6NA 1STOA 4Z1OA 4FYMA 1P19A 1A95A 2H06A 1BD3A 1TC2A 4LYGA 1XZ8A 1JLSA 4WN3A 1OROA 1I0LA 1OREA 2HCRA 2PS1A 2XBUA 4RHXA 4RHTA 5ESWA 1QK4A 3OHPA 5BQOA 5ESXA 4RHYA 4IJQA 4TWBA 1GPH1 4RV4A 1ECFA 3OZFA 2YZKA 4OHCA 3DMPA 3M3HA 2H08A 2H07A 1J7JA 4RQBA 3GEPA 1A97A 1DQNA 4S2UA 2P1ZA 4JITA 1QCDA 3NAGA 5JSQA 1IBSA 4ZFNA 1P4AA 5KAPA 3G6WA 4RAQA 4P84A 4P80A 2E55A 1BZYA 4PFQA 5BQPA 1VCHA 1DKRA 1UPUA 2PRYA 2JKYA 3LRTA 4P83A 4RANA 3HVUA 3N2LA 3EFHA 1CJBA 1LH0A 1W30A 5K51A 2JKZA 3H83A 1VDMA 1QCCA 2VFAA 1R3UA 3DAHA 1HGXA 5IAOA 1ECBA 1JLRA 5JV5A 4M0PA 1A4XA 1QK5A 2IGBA 3MJDA 4QYIB 4RACA 5EUCA 1G9TA 3ACDA 1ZN8A 1FSGA 3S5JA 5BRNA 5HIAA 1P18A 4LZOA 1TC1A 1U9YA 1G2QA 4P3KA 1G2PA 1I0IA 1ZN9A 1I14A 4PAWA 1ZN7A 4X44A 2AEEA 4RABA 1BD4A 1YFZA 3DEZA 5E38A 2EHJA 4X45A 1Z7GA 2FXVA 1HMPA 4P86A 2JI4A 4RADA 2C4KA 1L1QA 1I5EA 4M0KA 1XZNA 4RAOA 3O7MA 4RQAA 4LZNA 2JBHA 1A96A 5BSKA 1NULA 3GGCA 4KN6A 1MZVA 1ECCA 3ACBA 3LPNA 3OZGA 4M0UA 3KB8A 1I13A 4P82A 1DKUA 2PRZA 4QRIA 3MBIA 1DBRA 1OPRA 2WNSA 4P81A 5KAMA 5IPFA 2DY0A
chains in the Genus database with same CATH superfamily
4QIHA 4MHSA 4IW3B 2GCNA 4MO2A 1WA5A 4CMEA 3U7FB 3H0CA 3F5QA 5K3FB 2O5EA 3VYSB 4Z86A 5HK8A 1QQBA 5HPYB 4ECEA 3TLGA 1HRDA 1XZKA 2R6ZA 4AY6A 1TM4E 2DF8A 1NI5A 4HGPA 3NC0C 3OTIA 3TQRA 3MRSA 3ACCA 3EUWA 2GD0A 1R6VA 1SQSA 2BR5A 3HP4A 4QJIA 5HVNA 2DH5A 2QOEA 3DFMA 1U04A 1XTSA 1Z4KA 3AUFA 3KTOA 4NPHA 3T4UA 1Y48E 1G41A 3OHSX 1SUDA 3GXBA 2AFHA 1I10A 1WDMA 3PF8A 4HRYA 3LSYA 3GD7A 3O94A 1UEIA 4M1EA 1GQFA 1U3FA 4N3NA 4D98A 1A7JA 1L4YA 2FG7C 4UPVA 4JASB 1Z36A 4AO8A 1LRKA 4GRDA 1QQ7A 4UEKA 2H7YA 3EJWA 2QVYX 1C1DA 1FSFA 1RJEA 5E1DA 3CW2A 3E9QA 2QNIA 1OBVA 1NVAA 5B12A 3S2YA 3VAYA 5CJ2A 5EJEA 1DIGA 1IK6A 3E3OA 4JEIA 1EFVB 5DTJA 4AZ3A 3P0RA 4OJKA 5IJ9A 1REQB 3R0XA 2Y0DA 2P9YA 3L7MA 1RW4A 5FJIA 1RWOA 3MWYW 1VSUA 2HW8A 2JRLA 3TSWA 1INLA 4PHFA 3EFEA 3I3OA 5FAKA 1RMQA 1UODA 1E9VA 1PL0A 4UZFA 4Y9UA 2IEDA 3L43A 4IHKA 3F4LA 5EJ6A 2HIMA 1MLDA 4EYSA 3C7AA 5ADWA 2PJUA 5I9BA 4ZHQF 1DFIA 4LYDA 1OVGA 2J87A 3B2NA 3INGA 2BEVB 3L2OB 4WW0A 3HQ4O 5KQGA 3BH0A 5IDVA 2A9VA 3SNKA 2ZK7A 3BE8A 4MRNA 5T67A 2IYLD 3LX4A 3BL6A 4JWKA 1T3ZA 1A9XB 1QPGA 1M67A 3CR7A 2VBGA 3ETCA 2XR1A 3D7SA 4HNGA 4MW7A 2FAXA 4OB6A 3KDAA 5FBLB 2JJYA 3RFCA 3RJ5A 2OFPA 1HYQA 3HC7A 2QAGA 4UMDA 1Y6ZA 3T38A 1UZMA 4KNYA 4EW2A 3IEPA 5JO9A 2GPWA 3JZFA 3NDRA 4G97A 3TW8A 5A6SA 3QX8A 1H8HA 5DF1A 3N0XA 1ZSNA 5IJ0A 1G2QA 4MO9A 4F6LA 1XZAA 2J41A 3ILHA 2PUBA 1SU8A 3QYPA 1BA3A 4GKKB 3PUZA 3ANSA 3UFXA 1YF3A 1NW3A 3FTCA 4JEMA 2XRFA 2XQJA 2G4VA 3P20A 4FNOA 3W4IA 5CFOA 2JJQA 2ZTVA 4S12A 4XR9A 3BYZA 3ZJ5A 4N03A 3KWFA 4B75A 4BNKA 3RKSA 4RPCA 2ID9A 4FR5A 5TMDA 1U1EA 4D9NA 2BBWA 3V2UA 4D2IA 1I5EA 2BW0A 2HU5A 4RAOA 1MV5A 2I4LA 4FFLA 4IDAA 4GYWA 3G23A 1LRLA 5EHZA 3T0IA 4JI2B 3MWKA 4F1JA 2WD8A 1MKYA 4O2LA 4TUYF 1WWKA 3B6IA 2BHNA 1U4NA 3PCXA 3S2IA 1KYXA 2EGGA 3QMVA 1JSLA 2ETVA 5EJFA 4CLRB 1N6HA 4L6CA 3K9HA 4LSMA 2OGZA 2YR0A 4G0OA 1JVSA 4PCAA 3DL0A 1PAUA 3SJ7A 2ODTX 2CNDA 4LYYA 4DAEA 3TRKA 4EB6A 1D07A 2AHOA 4RHUA 2JANA 4HXGA 2AUMA 5CB4F 4LZAA 4BFLA 3M1LA 4EI8A 1JFTA 2FUKA 2W11A 3ASYA 1WD5A 4QARA 3WRXA 4LMPA 4WPGA 5F64A 1NC3A 5ALDA 1Y63A 4OQDA 2CEAA 4BRSA 1B1AA 4DJTA 2YJNA 4HNTA 1AKYA 5HJ5A 2C83A 3QOXA 3A2NA 5JR3A 5JROA 3MMXA 4JUBA 5KPDA 1N92A 3VMFA 1A1SA 3LY5A 4R71A 2BFNA 1UMDB 4GBMA 4MI1A 3CU5A 4GU5A 4QAQA 2V1XA 1WDLA 5ARCA 3CUEF 1QKKA 2FEPA 1KAMA 1B6TA 2P41A 5CITA 3V2IA 2ZOSA 2HU8A 5J9FA 2YWHA 5IXYA 1FZTA 1CFJA 4WL0A 1JPJA 4O4IA 2UDPA 3FN4A 1TLLA 2A9FA 2F1JA 3LUPA 2FPWA 3BRWA 5D3QA 3T3GA 4C05A 3N2YA 2W70A 2OWEA 5HKOA 4JJAA 1XKXA 4B0PA 2RIPA 4X84A 4NXMB 3C97A 4GC5A 2QNRA 4QTUB 2Z6VA 5I8WA 5JMWA 3DGFC 5D1HA 2R4UA 1H9BA 5A04A 2O8BB 4HEJA 5FQNA 1X92A 1Q5PA 2NAFA 1CEYA 1XD9A 1XAIA 3VZQA 1VJGA 1Z2CA 3R6DA 3PKIA 2ZSEA 3AETA 5EERA 2FOIA 5A03A 1EJ2A 4U7HA 1BJKA 2R6DA 4KSBA 2DPMA 1A1VA 5FTMA 1D0IA 2X5OA 3H8WA 1XBTA 4BWYA 2OGSA 1U6KA 5EQTA 2KM1A 3G0CA 1U98A 4HDKA 4EHBA 1C0KA 4BMZA 1FRVA 2GKSA 4ZVPA 2Z6QA 3AHJA 1RABA 5COAA 1JQDA 2YWRA 2BH2A 1XUOA 3URMA 1W47A 2XYGA 4N48A 5AKLA 4G37A 3LP5A 3FFAA 1EX9A 3NBQA 1QIHA 1P72A 2V7BA 4FSDA 4OIMA 2O1WA 1PJLA 2WM3A 4WI1A 2H16A 2SBTA 1W8IA 3IS3A 4GOND 3A1UA 1JLRA 1YDEA 2J31A 1UBCA 2W2LD 3GFSA 1MOPA 1R18A 1TZJA 5K3OA 5ELXA 1T25A 1Z2AA 3N9IA 4OHYA 1M7BA 1XL1A 2AJLI 1H8EA 4JQSA 3GAMA 4HSGA 3SJAA 2WIKA 4FNAA 5FR1A 5GOTA 3T4PA 3AT1A 2FRVA 3CRZA 4EKGA 1Y9DA 1PQUA 1K7EB 3HJBA 3L92A 3CT4A 1IZ9A 2Q5HA 2Y1WA 1TNDA 4NS4A 4RIGA 3U3MA 1DC7A 5EZ5A 2NADA 1MG5A 1N5KA 1Q0RA 1G8KA 4Q03A 4B46A 4TXNA 3NVKI 1T0BA 2YJZA 2BBTA 1RTTA 2OCBA 3TG2A 1GPJA 4H1HA 1XPRA 3A6HA 2Y0CA 3OC6A 1S5PA 2QW8A 1AN0A 2PKEA 3FYTA 1IOZA 1Z5VA 2VNAA 1SBZA 3RAPR 4LZNA 2C2YA 1IIBA 1EUCB 3AFOA 4WBXC 1YS7A 2Q3EA 4I1IA 3QVXA 4JGGA 3WWYA 2FX5A 4ZU3A 4WECA 8LDHA 1AQLA 1E3WA 1QH1A 3TZBA 5LA6F 1V26A 4PGFA 4QBKA 1Y9AA 1DDIA 4D45A 3UAOA 1KOFA 5IPFA 2XRZA 1ADYA 2YINC 5JNWA 1FDSA 4JQOA 4F6RA 4MV6A 4P32A 3T5MA 3AEUA 4EW6A 4XZ3A 1J21A 4BB5A 3PJGA 1DMSA 1ZDMA 4ZI5A 5DM4A 3RJTA 3F96A 1XZHA 3OZEA 5AICA 4R7TA 4X63A 3WL8A 1E79D 2F3QA 4FGJA 1HQYE 1TK9A 2JAHA 4WLNA 3UQYS 3ERCA 4D7AA 1IFXA 4X54A 1LS1A 3WWCA 5HOQA 2I4MA 4CQMB 4KNWA 5JECA 4FBMA 4KB5A 4GR4A 1NI4B 4PS0A 2WU8A 2XKJE 5KOJB 3AO0B 4JVSB 2FFQA 5D1NA 2D1SA 3GFGA 4XW2A 1RKXA 3V97A 3I4FA 2XGOA 4JDUA 3D8HA 3WB2A 3ZBQA 1F9EA 3GHHA 1GT91 2HA6A 3O8DA 3UWKA 2H9IA 1U5BB 4EG8A 1QK4A 3CVJA 4B3RB 4WJKB 1PJ8A 4ZOQI 1IEVA 3CRRA 3DE3X 1SHLA 3QWFA 4ONEA 4Y1RB 3WGJA 1K7SN 1Z6ZA 3WGNA 5BNTA 3KM0A 2MMCA 3UA3A 4C7MA 1P5FA 2UYOA 1J7JA 1DBQA 1UC5B 1W52X 3PC3A 2J0UA 3B6MA 2M6KA 2WSMA 4O29A 4IWXA 3ZK8A 1Z33A 2HMUA 3ZE8A 3ZZUA 4G8DA 3NALA 3GGDA 2ATEA 2W2NA 4J7UA 5CR9A 3SVZA 3AEKB 1A4IA 1U2EA 3GIDA 2BGGA 4EIWA 3VZCA 1J2EA 4F91B 1P3Y1 3OLCX 1QBGA 3AIKA 3P9ZA 4J4BA 3BZWA 1H3NA 1VCHA 3LC1O 4CU2A 4OX9Y 3GQBB 1LDGA 3FI9A 3KL2A 3HB9A 2MSKA 2PUTA 1YNOA 4LY0A 4OFZA 4CCWA 5FNZA 2QNBA 1NNSA 3N28A 1XDSA 3FKSA 5BR8B 3V34A 1L9XA 3C6KA 4EDFA 4PLHA 1CE8A 3T34A 1IB0A 1A4RA 2HMWA 3LZ6A 4FR0A 5CHEA 5UKDA 3R75A 1D3AA 5ENVA 3M4NA 4LJLA 4UOEA 2C8LA 3HYSA 1GTJ1 1U0EA 3QG5A 2C42A 5KJEA 3RTBA 4F60A 1DIBA 1JT2A 1Z26A 4LRSB 4EK9A 1CUUA 4QYXA 1J0DA 2GAOA 3LX8A 3T9AA 2CKMA 2KJQA 1PK9A 5AKGA 1XG5A 4H6WA 3R7SA 5EKXA 2EZ8A 4RGYA 2N1MA 2Y2VA 1FUEA 3KLOA 3L06A 4MAFA 5C0OE 5LP6F 5C81A 2EJWA 3RVNA 1EJ6A 1JR4A 2W58A 2SICE 3H65A 3KT3A 4D46A 1X1QA 2W6ID 2ZP1A 3IUBA 3O9ZA 3R6GA 4B3HA 3DV2A 2KE5A 4OY3A 4ESOA 1PUJA 2F9LA 1TB4A 4FS3A 3OFKA 1A76A 4RDIA 3P45A 2VBFA 5TRTA 4UUQA 4LWZA 3DTVD 1RZRA 1MA3A 4M49A 1RM5A 2OQRA 1QIJA 3Q3VA 4HZGA 2XOKD 1BHQ1 4X24A 5E6SA 2VBCA 3B6KA 4AO7A 4B84A 4Q3DA 1S7CA 4OHBA 5L6MB 2WJ3A 4QD3A 5EAIA 5JS8A 4Z0TA 1WXGA 3KLMX 2A1UB 1DAHA 1VCNA 3S55A 4DV3B 2QRPA 2W2QA 3PV0A 4UU7A 3L93A 3Q8XB 2OBBA 5IMBA 3A9VA 3WQHA 3GK3A 2WHXA 3EXFA 2DULA 4ZO7A 3M9LA 3I83A 2JFVA 1PG2A 2QMZA 5GOZA 1ECPA 3DUFA 1ZUNA 2WYUA 1ZA1A 1UM9B 1OHHD 3A1CA 3PC8A 4LTMA 4CETA 5JTTA 1YB1A 3JX9A 5BT8A 1OV6A 4H7HA 3DULA 1ADJA 3PLAE 4Q4LA 2NYUA 3OLQA 2C98A 2IHNA 1IM5A 2CJWB 1S96A 4XCXA 3STXA 1ECJA 1ENPA 3QBTA 1R50A 4ZMRA 2PWAA 4AF6A 4NOKA 2ZM5A 1GPUA 3PC6A 3LLVA 3VXKA 1K8RA 1WQ3A 1RJDA 1W59A 2XLBA 2Z4RA 3GCWA 3OPYI 4N7MA 4B7UA 1Z2DA 3H2KA 1JAYA 1YJ5A 1XKTA 5L4LA 3OLWA 3UN1A 3ZDFA 1MPTA 5LQKA 1OR8A 4MW0A 3CBQA 3VYTB 821PA 4J0DA 1TUBB 2XVAA 4LYGA 1NQ5A 1W1WA 4AP5A 5KDOA 3RVBA 3ZWCA 6ADHA 4QEZA 2DQYA 1XZIA 2AGVA 2GYUA 4URVR 5A4MS 1I1HA 3ER6A 1W88B 2Q3CA 3LPDA 1FF9A 4DDVA 4B45A 1LLDA 5LZ2A 3FSGD 2IXTA 3UMFA 2SKCA 3DYBA 1FFDA 3CX6A 1HQDA 2P1ZA 1KQOA 3IE0A 5K0EA 4R9SA 2PJRA 3H3JA 1Q44A 2ZR9A 4DNFA 4YI3A 4ZCTA 1U7XA 5CEEA 4UBLA 5CAEB 4Z2YA 4S3MA 3PUKA 1HFWA 1XMIA 4FHDA 2JBAB 1LPOA 2NNWB 4K8RB 5JVDB 1DE0A 3MTJA 4HDSB 3G2OA 1DV2A 3T94A 1OC2A 1D1TA 2VVTA 1GGMA 2DR3A 3FIUA 1XD8A 4WBNA 2DBQA 4FFBB 3RYIB 2K5UA 4QASA 2O2JA 3PTLA 5ILGA 4OBEA 1JHYA 2OV4A 2WG2A 1X7WB 4HUJA 4P2BA 1GADO 4QLBA 2BGTA 3OF3A 3MINB 1Q3KA 4GRIA 3FMOB 5JQGF 1T5HX 1RXCA 4E5SA 1KMIY 4RDCA 2FW8A 4DIBA 4MWOA 2GXSA 3NRCA 1AX9A 1M5TA 3LH5A 2IS4A 4MUGA 4MPPA 4B73A 5BSVA 5SY6A 3AR8A 2HA5A 4WXMA 3E4CA 3B78A 4ENTA 4K9NA 3NUQA 4F3CA 3T5TA 3MUFA 4BDSA 3FG9A 3EWNA 1Z0ZA 4EI2A 3MS4A 1OYYA 3DBHB 1Y5IA 3OICA 4N5NA 4P31A 1LJLA 2JGIA 3SIWA 3W9UA 4URYR 1YQXA 1Z9BA 2AN5A 1ZMXA 2Q5IA 4LE2A 3Q98A 4YJ3F 3OQ6A 2QRJA 1ESMA 2UYGA 3EC2A 4HWOA 1PW7A 4LZJA 1DO0A 4PNHA 1H69A 2WTMA 2AS0A 2J9FB 3F3KA 4OP1A 4TLBA 2ECOA 4JI1B 1KQFA 3W78A 1HYGA 3LT2A 2BGWA 3OX2A 1E5QA 1LBQA 4ZCMA 5J2TB 2PZLA 2AD1A 1MPXA 1UFVA 3GJZA 4NYMR 4UHHA 3S3TA 3S27A 3WXBA 1B15A 3WK6A 5A02A 1TIKA 5AD1A 2ZJ8A 2A94A 1W96A 3PD0A 3F8SA 1ECCA 1IUNA 2WLTA 4ZAXA 4JC0A 5HFAA 3B2QA 3PENA 5H8WA 3IKJA 3AHGA 5BNZA 4X3OA 3CNHA 3FNQA 3L4JA 4B82A 2CNWA 2EFCB 5LD2C 3LC0A 4AKSA 2R8EA 3KOMA 4XE5A 3WLMA 1OAOA 4OMDA 1U4SA 3LY8A 4DCPA 4ZMSA 4ID3A 2J0SA 1U3TA 3O0DA 2LDBA 1AE1A 1GG2A 2AK2A 4L78A 4C3VA 4DANA 2D7DA 4IDGA 3GGJA 1S1MA 4CF6A 2WZDA 3L0BA 3ZHOA 3UOAB 2I62A 2QB5A 4PBTA 5LMNB 2OFXA 3P1JA 5IC4A 1TPYA 2A0WA 2JLRA 3ET5A 5A0FA 3LX6A 4ZJPA 1EWQA 3HPQA 4R5MA 3GA7A 2G6BA 1HWYA 2ZSAA 1HA3A 4L9SA 2AOXA 2W0MA 3B1VA 1PNVA 4NCHA 3TI7A 1JQAA 1Q1GA 4D1YA 3F9CA 3U4HA 1XD2A 4Q7QA 3VDXA 1PHRA 2WKSA 2XI4A 2HBQA 3DVQX 3OT1B 5AR1A 3TD6A 1C3VA 4RMIA 4D8YA 3CF4A 3HRKA 5K03A 4KXQA 3COJA 3GP5A 2KSQA 1I33A 3BQMB 4MIKA 4DQKA 2XA2A 2VXCA 4EAQA 3QV2A 4ZI7A 2LKDA 3WQBA 2AI2A 5H80A 1RZVA 1Q17A 2JI7A 3MJCA 4EW3A 5I7RA 1SXPA 1UWCA 1CY8A 4QA9A 4WVLA 5FIUA 4TL8A 4NCAA 3SZUA 3DW1X 1KS2A 1KI3A 3Q9LA 1HT1E 3EVFA 3CRVA 1Z6AA 4UMEA 5GV8A 1UXHA 1A69A 3IVRA 4P58A 4KV7A 3AONB 2I2XB 1GV1A 1RJ9A 1ZIYA 3MD9A 3VSEA 3EPKA 3KHUA 4TN1A 4KODA 2ZRDA 4QELA 1EVLA 3FD8A 1N2EA 3JWIA 2ZW9A 2IPMA 4B40A 1RD4A 2IPNA 1WOYA 3I1FA 3KQVA 4XCVA 5A7GA 4BQIA 1QGOA 5TPWA 2GYYA 1DQSA 2VT7A 4HH3C 4JK3A 3ZPXA 1VXRA 1FE8A 3O3CA 5G02A 1VBKA 2QRLA 3B70A 1XZQA 5FCDA 1ZGGA 4PGGA 3VNAA 3QU9A 3LW8A 5M3BA 3N8HA 2PX2A 4IYRA 1I0ZA 2RGEA 1IRXA 3AINA 4QFDA 3IIMA 1L5HA 3TRDA 3ZXYA 2VA9A 1QS0B 3LV8A 4IKOA 4A16A 3GRRA 2EJBA 1E7WA 3N86A 4KE7A 1IBRA 4QM7A 4JYZA 4M1WA 1QYIA 2J48A 1GUDA 3DFKA 4YJHB 3TZHA 5M29A 1GPLA 2YY6A 4GI2A 4OHRA 4G0NA 1NBWB 2E6KA 4FZ5A 2CXPA 2IH5A 3HDJA 1GFSA 2JFPA 4DA9A 3TAHA 5CCEA 2YYSA 3A9TA 3OEWA 4EB0A 4I6GA 5AI0A 3E5RA 4OXYA 4DSUA 4Z7NB 4JENA 4E5VA 1HDIA 4WKBA 2XF2A 1FS5A 1KP2A 3L3BA 3RARA 4EHHA 4QPCA 5IM4A 2ASEA 1XXHA 1LSSA 3GU3A 3VA7A 1GNVA 1FPMA 2Z58A 2N9UA 1F8GA 3PGJA 3FW1A 3GI1A 1M74A 2RHTA 3BAZA 1U90A 1E0JA 2OZLA 2Q5CA 2VH2A 2QX4A 1KYTA 4NENA 3IIIA 2VK8A 1SJ9A 3GHYA 4P7BA 5JISA 3QVVA 3I9V1 3RS5A 2QTVA 1EINA 3OVMA 5JNTA 1O58A 4AVYA 3VNRA 3MCAA 3PLRA 5M5BA 2IYFA 1SOVA 1TGVA 3QKIA 1DG3A 1Q83A 3A0RB 2HLDA 3DEIA 2J6BA 3KHKA 1XC7A 3M2PA 4FU0A 3LVQE 1DKUA 1DHRA 2EAUA 1NUAA 3R5HA 3RUPA 3UBMA 2HR1A 1Y8CA 2WWIA 3LCJA 3MTDA 1I4TD 1KI8A 1NMXA 2C4HA 2QRHA 1LPSA 4HGQA 4P3OA 1EWYA 3CVXA 2R5WA 4FUTA 4NH0A 1Z35A 3L1UA 1VIAA 3UMSA 1MEJA 2HCBA 2IOHA 3FAZA 3QY9A 4KO1S 3SGLA 2EEPA 3LY9A 2CYBA 1BYIA 3KQOA 4PXYA 3CEJA 5AK4A 3R8FA 2HHJA 4ZREA 2J3EA 4Y1EA 1XWWA 1YCGA 1KZ7B 1KKUA 2RH8A 3RHSA 5CB8A 1WLSA 4G67A 2I22A 3TZEA 2TMYA 1Q6ZA 1EU1A 1Y0BA 3GRCA 3O2JA 4G5GA 4HN4B 3NHWA 3BICA 4H2DA 2A92A 4I6JA 4NONA 4KE8A 1NMQA 3V4VB 4Q4HA 5GADl 4MP8A 4KO2S 1M2KA 1YZHA 2W2PA 2EDAA 2UVDA 1TT5B 3SLGA 1N2OA 3QE0A 1YIAA 2A9OA 3WLQA 1EQ2A 3G85A 1VHDA 2XNJA 3MSCA 4YJ2A 4IEIA 4PX3A 3RS7A 1HDZA 5L7WA 3OEED 4MVJI 3H1BA 3KQSA 3X1DA 1G8GA 2J67A 2RMKA 1ZGJA 2YFYA 1DBPA 3DE2X 3LC2O 4MVWA 4ASUD 4CBVA 2ALJA 3GUCA 2BDTA 1MH9A 1QOQB 3BIWA 3JQQA 3OAAA 4GICA 4JX9A 3TSOA 4YV0A 3EXHA 3K5PA 3B3FA 2DPLA 3PIIA 2G17A 3ZWDA 1SVKA 3B1ZA 1SC1A 4B2PA 2XB4A 1HOTA 2B4KA 3Q10A 1FTNA 4CYMA 5BUSA 3ICOA 4O02B 3PQDA 2J85A 1PQWA 2O1EA 4IV0A 4AJ2A 5GZ6A 5CFMA 2Y1OA 3VI4B 5AQ1A 1QGAA 2IHBA 3TQCA 5A9TA 3CS3A 3M4JA 4UM9B 2HK9A 2ZAMA 3IB6A 1MC8A 3HGQA 1LBEA 1Z0KA 5ALZA 1CUBA 3SDZA 3TYXA 1HEUA 1EFDN 3M0EA 4ADSG 1GPYA 1GQ2A 2XHEA 3TIXB 4DIOA 3BF7A 3U6KA 1T9ZA 3UAZA 2ZJ0A 1UZAA 2BH9A 3UJ8A 1MQ8B 1GPDG 3HKDA 2YDYA 1DI0A 2R1ZA 2FYTA 2AFVA 3WRYC 4QUAA 5JV5A 2X2OA 2V58A 4I50B 2XMRA 4U3JB 3WGQA 2HFKA 4COOA 1Z45A 3D0OA 2HO4A 5DP2A 3S5UA 1R6XA 1D04A 1WDKA 1ZH6A 3RIHA 3LBNA 1QDLB 1P29A 4TYMA 3IA7A 4JOSA 5IAAA 2QVCA 2ZYWX 4CIVA 2HH9A 4X6YA 4NK5A 1P7PA 3NB0A 2F3TA 4MYUA 4QYSA 3REQA 1SBCA 1IWPB 1ISIA 2AZDA 3F7TA 4WUTA 4F5EA 3FGOA 3U4QA 3OO0A 4UU8A 2GLUA 4X6UA 1TKCA 4DIUA 3O8LA 5HFNA 1I5RA 2OXRA 1A8IA 1A2OA 2C97A 4YFVA 2H4HA 2GR9A 1H3EA 2P4EA 1L1QA 1U0SY 2FFBA 1VRWA 3EH1A 3HWRA 1D2EA 4EATA 4EFLA 1MT0A 2G9UA 2J9YB 3HU3A 4A91A 3WDSA 1YWGO 1VSBA 5EL0A 5CEJA 1XEWX 4G1MB 2XYPA 3A7EA 2GCPA 4Z1MA 4BO0A 2HTEA 1FX0A 1FXWF 1VB3A 3U9LA 4JP8A 3SE0A 3B13B 4PNZA 4PYOA 4KAFA 5K8TA 3V4OA 5C8YB 3TIGA 5B2ZA 3KJQA 2FPIB 5ALSA 2YBEA 2FPRA 2V96A 4TLCA 2ZRFA 4CKEB 4BO7A 4YRZA 3VR2D 4H4DA 3VI3B 5BRAA 2W42A 3TZLA 1S3IA 2NWQA 2V3WA 3HH8A 1GUBA 4TT3D 1GRVA 1DCKA 1DPGA 4UARA 3GJQA 5TNXA 4HX9A 4FWIB 3LOQA 2IQ5A 1KQNA 4ACAA 4B44A 2VAPA 2CMKA 2JGJA 1WPQA 4MI3A 5T8KA 5FTLA 2NU6A 1A9RA 4WNCA 2WIAA 5L7TA 1XCMA 4X60A 3AF0A 1PJAA 3LO8A 3N0RA 4DR1B 2P30A 1H23A 3AFGA 4UEJA 1YDMA 1G20B 3KEOA 3FRJA 4JT2A 5LFAA 1I01A 3I3SR 4HNQA 2GI4A 2UVQA 2BGLA 2H1SA 3A4IA 1BX1A 2JCYA 1A8QA 4J1NA 2XPCA 3FLAA 3DAPA 3UXHA 1RQGA 2WFLA 4NCJA 2NU9B 4BV9A 3KAPA 3H2SA 2F3SA 5I4BA 1ND6A 1N25A 4BVLA 1C0LA 4DKXA 1HE3A 1G6Q1 1YCFA 4I9GA 1K6IA 2VOJA 1PNRA 2XCRB 1A97A 3ABQB 4JHLA 4O33A 4OSPA 1M0TA 1PHPA 2FSVA 2JFHA 3F5SA 4LZPA 4TL6A 4KWCA 1K4YA 2O05A 2Q2VA 3UUFA 1U28C 1WTCA 5FR2A 2PX5A 4LDJA 5AOCA 3S1SA 4AX4A 2QUAA 4NG5A 1L5YA 4Y98A 3UCEA 1UM8A 4FDMA 4K9PA 1O6BA 3PDJA 4QOEA 1LV8A 3LFUA 3HVUA 5JI2E 4IZIA 3WK5A 5JD6A 1AKUA 3A06A 3NIBA 3G0IA 1W35A 1AO3A 1YIDA 3TN7A 3W6ZA 2LE0A 5JPDA 1U8UA 2XYHA 3L9XA 1A7AA 2D1TA 4N7BA 1NZJA 1VDMA 1L8LA 4JT4A 1XF9A 4BQSA 2ZRNA 1VLHA 1FNBA 1QCYA 3KLPX 1UWVA 3U31A 1O03A 3HXTA 1LTHR 2YVLA 4WACA 5DYTA 4HYEA 4CKBB 1GA1A 4MHTA 1GL9B 2QTGA 2WSLA 4IFBA 1ZWKA 4EA6A 4U6NA 1OLSB 3R5SA 4JL5A 1PWEA 5E4FA 5F35A 1ODJA 3IEUA 3PC8C 1ZOSA 4N5MA 1GFZA 1VGVA 5CW2A 2W6NA 3M9XA 5EKTA 1BGWA 2Z3ZA 5HQJA 4RJIA 4YR9A 1CTQA 3PNPA 1KI9A 4CKWB 1H8HD 1YZKA 1ZCBA 2K2WA 1ZVJA 2QI9C 4D0NA 5F2OA 1V48A 1VPEA 1Y3BE 3E9NA 2JJ8A 2CMFA 1S2OA 1NNEA 2GN6A 3C16C 2FQYA 2W6CX 1XNGA 3HKCB 2H1CA 1U8AA 5KJ1A 5GJBA 1V1MB 2VQSA 4HWSA 4JUAA 5GONA 5IZCC 4CT4B 4MR7B 1R9NA 2IBTA 1AUVA 3FNFA 1DWQA 1NX9A 4C3ZA 1RYMA 5JJ5A 2WP0A 2V6FA 2WTAA 4UPDA 1TYDE 2VL7A 2GXQA 2Q62A 1JQBA 3PCRB 1NE7A 2X4IA 2I2CA 3DDHA 1EIWA 3QSGA 3ZLJA 2AOTB 2RK4A 5LU9A 3K9CA 5K0ZA 4FC6A 2MINB 4L8YA 3ZYCA 4BJHB 5KYUA 4QM6A 1X7GA 5TARA 3NKFA 1UMBB 4C5BA 4E13A 1G21E 2C2XA 2VSYA 2I3ZA 4OI4A 4QVKA 1ZW1A 4BFUA 2IP2A 3AIIA 3U7JA 4E4RA 1OX4A 3DL7A 4FD3A 1OTYA 2XZOA 2Q6VA 5EKSA 1Z62A 1FJXA 3EDCA 1L4GA 4OQMA 3O8BA 2K4MA 1TT7A 4PLWA 3UAGA 1OI4A 1UOPA 3UK6A 1F2UB 3UBTA 1IH8A 3TLEA 2PUGA 5JO0A 3QLTA 5DH9A 2TMGA 1SBNE 1J8YF 2X0JA 5AW1A 3MRTA 1JFSA 1XRSB 4BB6A 5F2NA 4M83A 1V3VA 1HE5A 4QU5A 2DBYA 5FV7A 8MHTA 4JKYA 2AMYA 2IKQA 3VBCA 2QRVA 4JIGA 3A3OA 2XKBA 3VKVA 4PN3A 1G5RA 2VQDA 4Q34A 2AD5A 2ZT7A 4LPSA 5DN6A 1PZFA 5HMLA 4Q3OA 3BRWD 4HNAB 5BUCA 5EEGA 1BHO1 2PG3A 4BNLA 3OZXA 3HSSA 3S99A 5CDUA 2CLEB 1FFAA 1XZBA 4RJLA 3ZWOA 2QM0A 3H16A 4KXMA 1RNLA 2HHCA 3X1KA 4GR9A 1ZR4A 2FJUA 2CNLA 1MRZA 3L0YA 4KWTA 1QVVA 3U09A 5J2UF 4RANA 5DHSA 3WGVA 5F1PA 2AWOA 3AP1A 4PINA 4C0KA 3C3XA 3KELA 3O8OB 2QYOA 2AXEA 1F60A 2BUCA 3LUBA 5FLYA 1R10A 4L5JA 5LQAA 1U0HC 2KBEA 2FLWA 1H1DA 1CY7A 4N3CA 3UT0A 2BGKA 2EKZA 4WKNA 5I7VA 2C2OA 4C6TA 2D2EA 2FH5B 3DYVA 4FDAA 2CDRA 4JI6B 4RA9A 3E05A 2QYHA 1T5OA 4CG2A 4L1KA 4YRTA 4RTQA 2TRSB 5P21A 1VIMA 3N0VA 3C6BA 1J2TA 4J07A 3ANXA 3EUEA 1IXRC 1NBME 2R6GA 3VOBA 4BP9A 2ZYVX 4DIEA 2RAPA 3V1NA 4C5CA 1SHZA 1KJJA 5CTJA 3H75A 2ZI5A 4KPUB 1OAOC 3F74A 4B6EA 1ULSA 2JIRA 4DV0B 5LSAA 4HNRA 4TMXA 4B32A 1KQGA 5FXMA 4P1ZA 1M2VB 1H8ED 3WBJA 4PAWA 4II2A 4R3NA 4IVRA 5HFJA 4P33A 1ODTC 4NJOA 4PG5A 5CX1B 4RUKA 1S2IA 1BXGB 3FCXA 2FWNA 3W2TA 3BXFA 3I6IA 1J42A 3OE1A 3QVUA 4J0KA 3ZU4A 1KFKB 3FRHA 4Z5XA 2R85A 2I76A 3JQGA 4Z54A 4PQFA 1O97C 4QODA 3JWJA 3FUXA 1FUIA 2V45A 2WJJA 5THQA 1N3YA 4JVMA 1JIIA 2YL2A 2OEPA 3STTA 1GZ3A 4ZVNA 4CUZA 2VP3A 3DWEX 4JR0A 2EC5A 1W36D 1G8AA 1QRSA 2Q8NA 4NU5A 1EBUA 4ISBA 2X8JA 3L8YA 3IB3A 2JL1A 4QRIA 5EXEA 5I8ZA 3L79A 1NM5A 3H4MA 3TX6A 1NG1A 1YHNA 1KAQA 3BMXA 3I9KA 3T7IA 5CFPA 4IKPA 1NLFA 1JG3A 1OT5A 3ETJA 2J33A 3FVRA 3WADA 4FINA 2I65A 3QLEA 3DA8A 4FI3F 3K0AA 3B60A 1EVIA 2G28A 3SC4A 4G8BA 1JEDA 2B8EA 4IIEA 4NWIA 3V4ZA 2OWDA 4D6XA 1NXPA 3AOEA 5ALLA 4GPD1 4WMLA 2YVUA 4I1SA 1GCIA 4E6PA 2J0QA 4EVSA 3QF4B 3MBKA 5GJCA 3IQEA 4Y6OA 2ENUA 2P0AA 3G6KA 1HNXB 5T64A 5CRIA 3S29A 3DE5X 1V5GA 4K6KA 5TQ2B 4R51A 1N36B 1UDWA 3PEFA 4QDXA 3L6OO 1SC4A 5LBTA 1YD7A 5FOVA 3VUFA 5LMZA 1KJZA 2ISCA 4DABA 4KQXA 3L8FA 3ESCA 1T1GA 4XXHA 1GPH1 3WLIA 2OG2A 2ZKIA 3MN1A 4JD5A 3W04A 1GQYA 4DB2A 1EHCA 1ZM7A 2QJFA 1UKCA 2CHFA 1JLMA 2RGDA 3CUSA 1JXMA 2B9EA 4R6WA 1GA6A 3NDBB 4NAUA 1ZMTA 2ATXA 2H0RA 1Q0LA 5FWXA 1HQKA 2OAEA 4FMDF 1L7VC 1X7YB 2PANA 1NNUA 2PTHA 1ZJ6A 2QQGA 3DMNA 1L7QA 1XCBA 3LGXA 3MFQA 3N70A 3P0FA 4GI1A 3W1WA 4HS4A 2GM3A 3OKAA 1HZZC 1OD6A 1P62B 5ALIA 5TJ9A 4Q4CA 4L2IA 5EIOA 1B8VA 3Q6IA 2FG6C 3WWEA 4CLOA 2W6OA 3NOXA 3VX4A 4XKJA 1XPUA 3IC5A 4I4IA 4CIYA 2WIJA 2J9GA 3A7DA 4Q0MA 3WWOA 5GIOE 3GEHA 3RUIA 3FRIA 3ZWYA 4RVCA 1POXA 2BGJA 3C5CA 3NRBA 2JATA 4FT4A 2HK8A 4I3HA 5ISMA 2X86A 2PUWA 3D3EA 4GYJA 1DRVA 4RZ3A 2R7MA 2I3DA 1C9NA 1YB5A 3AVXA 1EPUA 2C7QA 4FW9A 4RORA 3G3EA 4RTRA 1NR7A 4CW7A 1GVHA 2PT7A 3W6UA 2W93A 4MLCA 2WWXA 4R31A 1AZTA 4BP8A 1M8JA 1ZAYA 1T0UA 4DMMA 4J3NA 3TEJA 1WMEA 1T91A 2I2AA 1N3LA 3IP6A 2XE6A 2BV3A 5EFZA 1S3GA 2ADOA 2D0DA 1TQHA 2Z98A 3UT6A 2I3BA 4UBMA 1O9GA 1H4SA 1NMSA 1V8OA 4I5DA 3W5CA 4Q4AA 4L9WA 3ZV7A 3PX7A 1VMKA 5TB5A 3PFGA 3GF4A 2W7TA 4PYKA 4WE3A 5JTUA 3DBOB 1TA0A 4Z4QA 3FY4A 3BWBA 3G89A 3COWA 1M6YA 3PPXA 5F73A 4M1MA 5E9JA 5A4FS 2R0QC 2K7FA 1FVOA 1P77A 13PKA 1YBFA 3VPXA 1BQEA 2X4LA 1QHGA 1BEEA 1UT5A 4IJUA 4WCFB 3UHPA 2Q5JA 3AF2A 3SEFA 2PZBA 2XHZA 2ZI6A 2V9CA 3DOEA 4GPTA 4UBKA 1RPJA 2OAP1 4XB2A 5ICMA 2HUNA 3TOVA 4QOSA 2PRZA 4H1VA 1K6EA 2D59A 3SCZA 3FUCA 2C7GA 2H54A 3KT0A 4N0QA 4GP9A 3EXHC 4TWJA 4HMOA 4KBGA 3UJPA 3ASUA 5IVKA 3CZ9A 1EFPB 3I4CA 3A1WA 3WWDA 2QUIA 4TT8A 3TIVA 1YDFA 5C52B 3I9LA 3RH0A 4DAOA 3KX2A 4F21A 2J3HA 3M70A 5C9ZA 5DCYA 2DPGA 5ELLA 4K9DA 3EIEA 3T1QA 1O57A 1V1RA 3IE2A 4GE0A 1P81A 4DDWA 3WYBA 1E69A 3IUPA 1P2GA 2D2VA 1ABEA 3IYLW 4BNJA 4EO7A 5AVWA 4GDFA 3RIXA 1E6CA 1GFIA 4CRWB 4D81A 3JD4A 2YHBA 4KXVA 2IF2A 3IAEA 5FPYA 4AMZA 4X66B 2RHRA 4DJJA 4KU4A 3DXZA 3TDKA 3H8SA 1Z7WA 2ZUUA 3O38A 4ARAA 3BGSA 4FEYA 3CN7A 4WZ6A 5BWCA 4G9BA 1ZXLA 3PL5A 1N2SA 1JSZA 1PLLA 2WWVD 1F0PA 2C3UA 3G02A 3MLBA 4D3DA 4AZWA 3U3XA 3GOQA 5FLKA 2QN6A 4OQLA 4WXHA 2HXGA 1RBZA 4Q9AA 4BBZA 5JAOA 1ZJWA 2D5IA 4FR2A 3ZK7A 1PTJA 3W2FA 3AKCA 1E5XA 2IHUA 5L3SA 4YV7A 4J49A 4PANA 1D6MA 5TC4A 1WUHS 2LD4A 2VUUA 3EXEA 4YYZA 1JQKA 1KFBB 1V4VA 3I8SA 1UK7A 3K1YA 2A14A 3EVGA 4PQGA 1R4NB 3UHJA 3T3OA 4ZQBA 4K0KB 1FQWA 1MD9A 3P0IA 4W8GA 4F3NA 3DHVA 4RY2A 4IHJF 3ZY5A 2GFHA 1W4BA 3CVYA 4MV1A 2DWOA 2CLFB 2Z8YM 5BV7A 5LYYA 4P3XA 3DOJA 3IQWA 1C9KA 2ZRCA 7MHTA 3C24A 3VZRA 3VDQA 2CLCX 2H29A 1N6LA 4UZSA 5H02A 5L53A 4ZJUA 5F9FA 1JJVA 1JB9A 2I1LA 2PO5A 3A1NA 5BMVA 1T0IA 2O5RA 3ZHSA 3AVWA 2DAPA 3PE4A 2FMUA 4A82A 1VPDA 5BY2A 1ECBA 1JR3A 1NT2A 2AG0A 2NZ2A 1FDTA 1MDBA 1N2XA 2WA1A 3P9YA 3E53A 5AVYA 2YIJA 2YOGA 1DLJA 3MYRA 5HJEA 5DTEA 4CKXA 3TRHA 1SKUA 3WIVA 3BKXA 4PGMA 1DOHA 4R5HA 3GGOA 1KVTA 2YYAA 1JHAA 1I0IA 3AU8A 3PHHA 3I5UA 2O48X 2HDHA 2HMSA 2ORED 2ZWOA 1Z4LA 3ZG6A 1JDBC 5AJTA 4MGHA 1OIXA 2Z6UA 2HRDA 4WH0A 1SELA 2BZSA 5CM9C 2WUEA 5H3CA 1SOMA 2DR0A 2DP4E 1Z0IA 4QUEA 2ZTSA 5B1IA 1IN1A 1GAJA 2O2ZA 1QF7A 5DSTA 1E5LA 4XASA 4V0RA 3FFBA 3IEIA 3CRW1 1VL2A 1U8EA 2V7EA 3E7PA 3LCVB 3D43A 3KPYA 5JDCC 5C5DA 5I3ZA 1Q84A 5DTIA 3GUHA 4B7XA 1I7SB 4QTYA 4J1SA 5IJ9B 2BDEA 3UB3A 3H4VA 3JU3A 3E03A 1FBNA 3TM4A 5LD2B 3MM4A 4ABYA 3G9QA 1JDNA 5CW1A 16PKA 3SQDA 4OI1A 1L0BA 2N75A 1OI3A 4YXFA 1EUDA 1S1CA 4AYXA 4I81A 1NVTA 4J1TA 2E9SA 1D5WA 2EP8A 2YIMA 5E1OA 2NZXA 2WLSA 2B2NA 3A2KA 3PUYA 1QG0A 1W5TA 2GH1A 5CA0B 1M1NA 4ITRC 2J09A 2KI5A 2I54A 1F7VA 2XTMA 3C3JA 3KHTA 1Z7BA 2AI3A 5HX7A 4FYJA 1HLGA 2CNWD 2FDRA 2CVHA 2P9TA 4HAOA 4KIWA 3FUTA 4F8YA 3C4QA 5DTMA 1DTWB 1XJWA 5IJAA 3EW7A 2IK8A 1G8MA 4AURA 3W5DA 1Z6TA 5FNVB 4PLGA 1IVNA 3U3JA 1NONA 2M1XA 2MR6A 2R6R1 3CVOA 1UBGA 1EHYA 4HBZA 5ETJA 4RDXA 5EZQA 1PT8A 3CEAA 2Q3JA 1JAIA 5CA0F 2EBUA 5DGIA 4AULA 2HCJB 3OZBA 2PVCA 1W46A 4FONA 3VQTA 2NSDA 1U2DC 4KRFA 3QXJA 5A6SB 3AR5A 1G8PA 1QC5A 5IH3A 1OWMA 4FX5A 1O94C 3OUZA 4B47A 3CLTC 3OMWA 4IJQA 2C77A 4RA6A 5A3RA 4HNVA 1KK1A 3BK7A 1M8FA 1W48A 5JHHB 3TUJC 1BH6A 4KTTE 4P7FA 2IVZA 3AI1A 3GPCA 4IEEA 2EFEB 3IT2A 4UM8B 2QJTA 5CVJA 1RQ7A 3U4GA 5HQTA 3KQNA 2M32A 4YALA 1CP3A 3F2VA 5FPTA 4EHDA 3FBWA 1JG7A 3OZRA 1U2TA 4FKZA 4EF4A 2ZYHA 3ZC3A 4HXFB 4DY6A 5AJZA 1JA9A 1P73A 3STVA 2JLYA 1SB9A 1K7XB 2Q5QA 1E77A 3K96A 3NORA 4CIXA 1AMUA 3ABRB 5BOSA 4DN6A 3DGEC 3M6MD 2ZJ4A 2CVQA 1H4TA 1JS1X 2D5LA 3OQNA 1CUXA 4Y1GA 2PX0A 4PTLA 1II8B 1SQFA 4DQXA 1B6SA 1S01A 1CDZA 2FMHA 2G7ZA 4JMPA 1F3LA 1SWWA 2OCPA 2PKXA 1QIMA 1XXLA 2C94A 4X85A 2ONJA 4JODA 3AR3A 3AZQA 4EB6B 2V97A 3EWSA 1E2FA 3PE3A 5FUBA 5G40A 4P4LA 4LY9A 4P92A 1ZEMA 3ZWPA 5JAIA 2XB2A 3MNFA 1XEWY 1QHEA 2ZAOA 2YJTD 3JXEA 4PIMA 5AJHA 3WP1B 4MTCA 4BQFA 2O7RA 1KYQA 5HGJA 1XCPA 2O2SA 3NHBA 4ALIA 5IT0A 4OMFG 3GEGA 3PXGA 2JLWA 1TYCA 1YUBA 1E2DA 2SKDA 3BMQB 2FEWB 1MO2A 1C3LA 2WJWA 2CDBA 1GQSA 1SUEA 1QVAA 2CHUA 4XLZA 4B3MB 2OOSA 2HI0A 3L0ZA 3RS9A 1QFXA 5A6VA 1WY7A 4C6SA 1JJFA 3AP2A 3P2IA 3VVLA 1BWQA 1E1KA 4L8LA 2QLBA 4CR7A 1VBNA 3HA2A 5BW6B 3H8JA 4IDHA 3P32A 3K0CC 1P75A 2FN3A 4CHTA 1I13A 2P6UA 3L8ZA 3ENWA 3SXJA 3EGDB 4OHXA 3RFFA 1W94A 2CL5A 4HUQB 3QBVA 3TBKA 1XQWA 3A14A 4KCGA 4EHNA 3ESDA 2HLDD 4F8EA 5ALFA 3AETB 1EBBA 3D6JA 4FMCB 4J0EA 1XTUA 2B5OA 3EN0A 3S2SA 1KH1A 3V7UA 4DV1B 4ZJYA 1G6HA 4FZJA 3COSA 2QMOA 4XJXA 1M83A 3BK1A 4YBZA 2C5GA 4TWZA 1Q50A 3O4IA 1EFUA 3RV3A 3VPAA 3ZDEA 4JI4B 4Y3UA 1XEXB 4CT0A 2I34A 4HDKB 1RYNA 3LQ4A 2BFOA 1L3IA 1MB4A 5DIFA 4GE3A 3NVDA 4IJMA 3LLCA 1NAHA 2CHVA 3DOFA 3KXDA 1J0AA 1Y1KE 4G5OA 4P93A 2IS1A 2HA4A 1BX3A 4UHFA 2IX3A 4QDZA 1BVHA 4YN3A 3ZJVA 3Q9UA 3TSYA 1W6RA 4ND4A 3GP3A 3BSYA 1Y1RA 5E1MA 1I9CA 4ZEXA 1OFUX 1Z4PX 2QD3A 5LXTF 5JCOC 3BSFA 3GCGA 1NVVQ 3KZOA 4IO1A 2QTHA 3PX2A 4QGSA 3IMCA 2Y3IA 5HSGA 4QQ8A 4RGVA 1E7YA 5AKHA 1CFZA 3KKLA 5F21A 1ZD8A 5IASA 2XVZA 1SXJA 2B7BA 1Q7CA 2F8MA 1V5EA 3HY4A 3O95A 3QVOA 4U6QA 3TDMA 4ZYLA 3BA1A 1SXIA 3ETNA 1XDDA 5CH5A 3IODA 2Q4TA 3HLYA 1GJRA 4FCWA 2D4AA 2G0AA 1IUKA 4P3NA 2QMUA 3VPDA 1YJQA 2AT1A 3PNLA 1M6WA 4PTYA 1JP7A 4HB4A 3PZRA 3UGTA 4TM8A 3CPSA 4RELA 3C8MA 4DXAA 4WKOA 4CM8B 1T1JA 2Q2WA 4PC6A 1V8FA 5DEIA 2N47A 4ANFA 5IYZB 1A2BA 1DRKA 3ZU5A 3OEYA 3DBIA 3L6DA 4AZTA 1SU6A 2Z43A 1E2QA 5AOBA 1YFJA 3K0FB 1BJTA 4OM8A 1UBSB 1TYAE 3GLKA 4Y2JA 5FX2A 3GT0A 1EUQA 1SU4A 2F3UA 4W1SA 1EP3B 1IOLA 3QLVA 1G38A 4K6GA 4E70A 1ECLA 1USUA 2Q4BA 4NE2A 5ERXA 1UP7A 1G6OA 5D6NA 3E3MA 4GI3A 3MJFA 4JZYA 2ZVJA 1ZC3A 3VH2A 3AIMA 2HQ1A 3QTBA 4PAQA 4DQVA 1H2YA 1R2QA 3MOIA 3ZUGA 1NM5C 2RCYA 3CTMA 1T4GA 3GBVA 5DRYA 2B25A 2BTQB 1IBKB 4I66A 4PQRA 1O0CA 1Z17A 2XUIA 2PAFA 3CONA 5E7JA 5JS7A 3DONA 3WLRA 2O5VA 4F04A 5H3LA 1MFPA 4ZK2A 1M6NA 1SCDA 1WXQA 2V8OA 5GQSA 4UEOA 4BQOA 4O2RA 2CXNA 4N4AA 4BEWA 3QVGB 2ZSJA 3HYLA 3RG8A 3MJVA 1IHUA 5HUJA 1I3MA 4Q1FA 1XX6A 5KB3A 2GEJA 3GAAA 4NMMA 3AW9A 3GXOA 4IGEA 4KMMA 4CXMA 2XQKA 1W5EA 1ZIPA 1PVDA 3RTDA 2UV8A 1VPTA 3O7WA 1T9GR 3LK7A 2O2YA 3PRJA 1PWYE 4PZ0A 1VJRA 3FPJA 3NBAA 5HKBA 4TQGA 5KTSA 2C4NA 2FWMX 5EI5A 3GBPA 1Z7YA 3PQ6A 1T34A 3MMZA 4ZCPA 1ULBA 2P68A 2JDID 3AESA 4DTIA 3UEOA 1UC8A 4I8XA 3SYKA 5HJ2A 4LF6B 4FGZA 1DUIA 3E9MA 2ASVA 1H2ZA 4Z1MD 4Y8VA 5AK6A 3WK9A 3P27A 4TRNA 3U19A 1EFLA 5AVJA 5LYJF 3RS4A 1HX7A 4LNUB 5FT9A 3TUZC 3IMKA 3PDUA 1GPWB 1GD1O 4HSEA 1Y7LA 2GN2A 5B1SA 3CKMA 5CTAA 4NK4A 2XNDA 1FMJA 1HZJA 4MKXA 5BWMA 3VNSA 5KINB 3S2ZA 3QEOA 4UVDA 3WO0A 2OMKA 1OU0A 3KUKA 1R4AA 2H1OA 2XUQA 2ZFUA 3AKEA 2PMWB 2NZWA 1CUSA 3GZTB 1YVPA 5BYAA 4PVDA 3JQFA 3JYQA 1GN8A 4DQLA 5DULA 3GL9A 3MOSA 1YFLA 2E89A 2GAIA 4RLFA 1XNHA 3D2LA 3K32A 3VJMA 1ONNA 1A9TA 2H52A 3HKEA 3KQHA 2AOUA 2A9PA 4O59O 5LBUA 3RS0A 4D56A 5LZ7A 5JW6A 1N77A 2I6FA 3PNOA 2PN1A 4HQNA 3FNHA 4Z8YA 1NU6A 5ALRA 1HMYA 2GAFA 2WB2A 3AHIA 1PWHA 2QAJA 3EAFA 3FWZA 4OL0A 4B0OA 1B6RA 3L6RA 5A2QA 2FPSA 4V0QA 2XUZA 3A9CA 4FHFA 4AFNA 1JF8A 3DXXA 2Y6UA 3LPMA 2A5FA 2ZUCA 3TB4A 4BB0A 1F6DA 3VC7A 1CJTC 4U0JA 1UUFA 1HDYA 1V35A 4KGDA 2HMYB 4FFNA 1R9MA 3R6LA 4RVSA 3E3LA 1DKRA 1YMUA 2DFNA 2DG2A 5G2OA 5DTQA 3OPNA 1R7RA 4BLSA 1MQ9A 4F4CA 5CVDA 2QRZA 2Z3WA 2ZCVA 1BXRB 1Y5NA 1MQSA 1S9HA 3UCXA 1VC2A 1EP9A 4I7EA 4KVGA 2HYIC 1UBNA 1YZNA 3MQ2A 3ZCXA 2X14A 5K0TA 2NMVA 2JHAA 2BFBA 2I0FA 4MWEA 5DSZA 2JKZA 4GC9A 4B71A 3DAFA 2Q41A 4FKMA 1DVRA 3RVQA 5DLQC 1X1EA 5DEOA 5FP0A 4F4HA 1VHWA 1GGVA 1QZUA 3DMFA 2HZBA 1KTIA 1XVTA 3DCYA 2JB9A 4K6CA 5EWMB 4Y2TA 3PB3A 2VP0A 4LOAA 4BVJA 3CR8A 1RI5A 1RHUA 1OA0A 1O8CA 2C7BA 4BO8A 3T5AA 4KAXA 2WUFA 1I80A 3ACDA 3IKLA 2H2IA 4K81B 1WB9A 3WX0A 4DZZA 3LCCA 4WK0B 3P94A 1QQAA 3GCDA 1T8UA 5LLSA 1GAQA 1UAYA 1HDOA 2WSYB 3L07A 2CEKA 4IIJB 1XRPA 4X8MA 3QOYA 1CWUA 2BMAA 1EX6A 3E58A 1FP6A 2JCBA 2C00A 4KLZA 4Q9IA 5A4IS 5DFAA 1ND5A 3NFYA 2A5LA 3PT5A 3A28A 3WBBA 2YIDA 2IXAA 1KKLA 3WDLA 3LZCA 1V71A 2JFOA 4EYKA 4XVUA 5C7OO 4J90A 2VF8A 1ID8A 1V2GA 4FN5A 1QHYA 1EGMB 3P9QA 1I3LA 1QORA 2C5HA 1P4GA 2X23A 1Z8HA 3U3KA 4YVFA 3GLVA 5H83A 4V1CA 3EZYA 2R6CA 3QNMA 5DKFA 2HXSA 9LDBA 1UQTA 1EAYA 3TFOA 1N2CB 1A9QA 1P9OA 1M66A 3FYUC 3AKZA 1JW9B 2X5KO 1SCUA 1SC9A 1VLVA 4MQMA 1LXCA 1HURA 3FLMA 2ZI4A 1XU4A 3VSCA 3SLKA 1TYBE 3B1FA 5IMSA 1GQRA 2DY0A 2ZSHA 4NC9A 4TL7A 4NCKA 2XD9A 1OUMA 2O06A 3O1IC 1ML4A 5DIZA 3DF9A 1KSJA 1OBOA 4YP6A 3GO4A 3ZY3A 2MSDB 2W6QA 3I6ZA 4QYIA 5EGNA 1KH3A 1ZQ1A 2FI1A 3BWYA 3DT6A 3H19A 3QSYA 1V9SA 3RV4A 1VYHA 4GVPA 3LK6A 1ZJZA 2VNIA 3B1YA 1UCFA 2VQFB 3WSVA 4CEIB 4ZPXA 1X7ZA 4RY0A 1MRSA 1FB5A 1ZZEA 2KWIA 3GDOA 4IM7A 3U13A 4BGIA 1BRTA 1ZJYA 3T9FA 1FFXB 4F8JA 5TR9A 1F4LA 2J0VA 2GUGA 4AMBA 2AA3A 1K63A 4FM9A 4HAUA 3EIWA 4UVHA 5MGBA 1YMQA 2CUKA 2PYZA 1O6FA 2OCIA 2JCSA 3THSA 1M76A 1I0LA 3RYHA 1SUIA 1N8KA 2XBUA 4BOYA 4YMUA 2A9KA 1DJPA 3COVA 3AUAA 2ZVPX 4QGBA 4ROSA 3VR0A 1U7WA 4EA7A 1XVIA 3HDTA 3QFRA 5AVSA 4NYIR 3NTOA 3DMPA 3C43A 1QP7A 1DRWA 3N0TA 3GLGE 2UXDB 4OX9B 1SVNA 4HB0A 2J5XA 4C21A 2H63A 4INJA 4JCOA 3RRYA 3KKPA 3ZCSA 3KZNA 2AVDA 3ZK9A 4PSVA 4Q7JB 3B3GA 1UJNA 1FP4A 4MWCA 4DLYA 1C4KA 2WVJA 4U9IS 3AYZB 4PLZA 4F3YA 1P2UA 2BI4A 5DN6D 4IZOA 1YZYA 4CCYA 1NN1A 3LP6A 2E2WA 4DCMA 1XN1A 4Z2AA 4Y2SA 3NNDA 4D5EA 1XAJA 1NW8A 3MT8A 4DUGA 5D2CA 1EUYA 3KFXA 3D4IA 4QKQA 1BQ4A 1Z6YA 1NXVA 1PTKA 3HUFA 4XH9B 1ELOA 3DBLB 4OXIA 1X6VA 2ZEJA 2EHDA 1BS2A 3T3NA 3SYLA 4Q3EA 4GSKA 2GJAA 1XDGA 5AVKA 4AYWA 2FX3A 1H2WA 2IYTA 1YB2A 2RBEA 4IIVA 2CVOA 5D8DA 3LCRA 4TV9A 2P4QA 3W5VA 1K3TA 3HVKA 1PR9A 4U2DA 5KX5F 1QJCA 1KDPA 3IHKA 3SDSA 5T41A 4DDTA 1TO6A 2J30A 3A4NA 1AUOA 3NHMA 4J1TC 4ND8B 4GX0A 1R5OA 5IANA 3IRUA 3PGA1 4XCQA 3ZXUB 1U8YA 2I2WA 4BYGA 5ADHA 3FLBA 2KPOA 2NQ8A 1CPYA 1E2HA 4LRQA 4MRMA 1NJGA 4DRYA 4YX9A 3HVJA 8ATCA 1CYEA 4FDTA 1VI5A 2O8DA 3TTXA 3W5HA 3B7GA 2NG1A 4GMXA 1DBIA 3U4AA 2BI7A 1XRJA 2X1VA 5DWQA 1RBMA 1U3VA 3LHDA 3SZRA 3W3ZB 1MAUA 3WNZA 1UINA 2DLNA 3NYIA 4ODIA 2CJXA 3AR2A 4BN4A 4RM2A 4MW5A 4Q66C 4RVUA 3TINA 4RHFA 3N8DA 1X38A 4FHCA 4LRXA 4Q1AA 1LRJA 4AMYA 3EQZA 4R8RA 3OJLA 1RRGA 1YZQA 5EIBC 2PR7A 4KPFC 4ZT4A 4C6RA 3FUVA 1GCGA 3E4DA 4HLUC 4M38A 4WRRA 3U1TA 1ICIA 1PQYA 3K7EA 4I4TB 3EIQA 2VHVA 3J81k 4PF1A 4PPYA 3JQ8A 1VLQA 4MQFB 4B35A 2R00C 5EMJA 2REOA 2I6SA 1YOVA 2VHXA 3E22B 3UIEA 4GM1A 3PUIA 4QXAA 4BVGA 1YQQA 4OB8A 4DJEC 1LVUA 1GPAA 4IFEA 3ONWA 2P6RA 5G53C 2WQ7A 3LL7A 3K8QA 4A2WA 2Q6LA 3QVJA 4JYBA 4RKYA 2IL1A 3Q7IA 1X7DA 2G72A 4BHTA 4YPVA 1YH3A 1NLZA 1KJNA 1XF1A 3LDAA 1IM2A 3MMPA 4JBLA 4Q05A 3WGTA 3ZGYA 3R9XA 5C8ZA 1XTPA 3MAJA 3QJ5A 4W9MC 3K1AB 3PVCA 2NO9A 3OCUA 4DC9A 2PCJA 3UWPA 1P0FA 4NZNA 1GUYA 4ZVLA 2ZBVA 4MGZR 4WOPA 4MW6A 3A70A 1E4YA 4FLFA 3VNUA 2ZUWA 4XD7A 1ILEA 4C2UA 3E2MA 5EGSA 2ZJ6A 3ZDYB 2IZ0A 3FPKA 4ZVSA 3F6RA 4YCAA 3AILA 2F1IA 3WKEA 3RK4A 2DR2A 4G5QA 1RXEA 4UU0A 1NI3A 3GZJA 2FP4B 3ITKA 5C5CA 1UFOA 5K9ZA 1XXHB 2ZWIA 4BZWA 2GPBA 1SUPA 5IDXA 4IXDA 4RAQA 3IBFA 4DZRA 1A9PA 2D06A 3EK2A 4PIPA 4P80A 2OZLB 4ZYZA 4P0PB 4ALKA 1TECE 3DC7A 2B7LA 2RGWA 3JPWA 5LP1A 2VJPA 4KVFA 4AX8A 3FNBA 4BRZA 1PFGA 4P7GA 4ZICA 2W6MA 1SUSA 2HNKA 3I2HA 3N2EA 1A8HA 1NYRA 1X1DA 2AKEA 1OBCA 1H5QA 3MTGA 2YASA 1TO1E 3H83A 3L7YA 4M99A 1R0LA 1TCVA 1BDHA 4U7JA 3W2HA 1MC4A 3CUYA 1GNQA 4EYGA 2J4CA 3AHHA 4XM2A 4JYPA 3U49A 3UAXA 2CC2A 2X9LA 4NFSA 1KMHA 1T4DA 3SI7A 3OIDA 2FUG1 2Z3VA 4KK3A 4CM6A 4FT2A 1KR5A 4L72A 4JOCA 1N7IA 2Y68A 2HXYA 1O9HA 2CXUA 2W8ZA 4PZUA 1EDDA 1EJBA 5JY6A 3NM4A 3WRVA 2HV9A 5EXTA 1OXXK 2VP6A 4JUIA 4O4LA 2OV3A 4C4ZA 1SC3A 1G4HA 1H0SA 1ST2A 3BXPA 5JZVA 1JHOA 3TW4A 4Q4HB 4RD4A 2N42A 3KLNA 3TSAA 4A8HA 2X41A 2RJOA 3JYLA 5D5HA 4IG4A 4EW1A 3QK7A 1K75A 3QUBA 4D8UA 4WNAB 4FJ1A 3ENQA 2ZIEA 4G8JA 5FOWA 2RGAA 2V4ZA 2ZE7A 4JLWA 4CN9A 5F7XA 1TM2A 3HBMA 4HK4A 4XDYA 3UK0A 4DWOA 4OQZA 5CPBA 4KR3A 3DFZA 1HE4A 2V9ZA 4LSGA 1QQ5A 4KRYA 1QZTA 4Y9RA 3SFTA 3V8EA 3FJOA 3RWMB 3EXHB 5DOZA 1Z2EA 1BE1A 4ZYXA 2O2GA 4LHWA 4H7JA 4P82A 2AG8A 1NF2A 2CJFA 3GOHA 1Y3FE 2B37A 2AOWA 1ZA2A 2PQMA 3H2ZA 4IOKA 4NPAA 4O4HA 1RKBA 2C61A 3IPCA 4FFWA 4MB6A 4B3SB 2BEKA 1G63A 5AW7A 3U3DA 3FLEA 1HKHA 3HXQA 4N5IX 4KI7A 3KQKA 5BYBA 1Z4QA 1XDBA 3DNFA 1C4WA 2C9CA 1XDZA 1F06A 1ZVQA 2F00A 3M7IA 3Q3EA 2G83A 4O5OA 5BUQA 4YHHB 1OH5A 1IE3A 1T8WA 2C88A 3D9QX 3L4BA 4BKRA 3UB2A 2V98A 2VYFA 2IU3A 3G2LA 4L22A 3R6TA 1E6KA 4MV5A 1S2MA 2BAGA 1STOA 4D3ZA 2Z09A 3ZWQA 1DBVO 3KPUA 3HKDB 5E0KB 3WQRA 5A3VA 2COEA 3TPFA 2ABWA 4OHVA 2AFIE 4Z4GA 1DB3A 1MO6A 2W37A 5AM4A 1KY5A 2RKOA 4C7JA 3HN7A 4NBVA 2C0QA 2J5RA 1WZUA 2YHUA 4PR0A 5KTMA 1M5UA 1R3DA 5CA1F 2JJ1A 3D4PA 2RAUA 1BMDA 1PYDA 2AB0A 4CLHA 4PZLA 4F4IA 1YKSA 3KR0A 2A1IA 5JCJA 4E2ZA 1L4UA 1DL5A 1NPTO 3U7RA 3GLIB 3CVVA 1DS6A 4EHAA 1K1EA 5LOVF 2EX4A 3UYLA 4YRFA 3G8CA 1WF3A 4L5YA 2H2WA 4W7IA 5JSZB 4F71A 2DJ5A 2UZIR 3T9EA 4NS1A 4YDHB 1NE2A 1KJIA 2DUMA 4L0MA 4FYKA 2IEIA 1BHJA 2VXOA 3Q7PA 4I1YA 1NV8A 4OMCA 4X5OA 1XE3A 3TL6A 1M1YE 2P78A 2PX6A 4MUMA 3VDNB 4ABTA 1QSGA 1DKQA 3I2KA 4I14A 4NBLA 1N5RA 1QV6A 4BNFA 1JI0A 4PZ9A 1YL5A 1QP4A 1OE0A 1SCKA 2H85A 1FX0B 2OGUA 2V6BA 4YJKA 3T9BA 2Q5LA 4I1UA 1ZOLA 2FW6A 3R0VA 4ITUA 3D7RA 4KQEA 4PO3X 3ROMA 1QYRA 4M1SA 5E6RA 4F4DA 2PSDA 5TXGA 3S44A 5MDHA 1C29B 3D0RA 4H27A 4DT1B 4XEUA 3PNSA 3NU1A 2P6MA 4Z7OB 3OOJA 4XYBA 1W75A 5G0UA 2O0MA 5KOHA 1JDBB 4L4YA 2EX0A 4JB0A 4J03A 1W1IA 3EIUA 2JLXA 5FBKA 1JHQA 1D4OA 2NZ8A 4OG2A 4QGGA 3FR7A 4MEAA 1I6MA 2F59A 2JGNA 2NU6B 5G0SA 3RK0A 1JR3D 5JD4A 4GOMD 1NYTA 2MOKA 4FHZA 4LE0A 2ZTLA 3V8VA 4QGAA 1MB0A 4JXZA 3E5NA 1LBIA 3MTQA 1A7KA 2MYNA 3OFSA 3R4VA 4X1IB 3RVKA 4KVZA 1LNZA 2G80A 1TYEB 3OJ0A 4URHA 4XX0A 3GARA 3KSMA 2GPYA 1QF9A 1CUGA 1U1GA 2WFLB 1KJWA 1CNFA 3E9CA 2C4KA 3W05A 2I29A 3IQGX 1YRAA 1B7GO 3RSSA 1H93A 2AE2A 3CZPA 3TUIC 4CKCA 2XEXA 1T8YA 2F3RA 1CY6A 1N5DA 2GA9A 2YNMC 4GOKA 4NRDA 5FKJA 4CM9A 2XQFA 4KR6A 4LHYA 5IN5A 3RDPA 3IAUA 1EFAA 2Q46A 3H2HA 4EHKA 3H5VA 2VCEA 1DAFA 2IY8A 4R9VA 3OP1A 5JCXA 2AW3A 3NWOA 3G1WA 1BWPA 1KE1A 4CL3A 4ZHSA 1X80A 3ICQB 4QHYA 2PZAA 4DR2B 4LWOA 4DCNA 2OE2A 5FHRA 4RPIA 1TOAA 2WAXA 2CUZA 4D9MA 2ZUFA 3OD1A 5BSTA 1X9HA 4JEHA 3D3WA 1B26A 1A72A 2F1OA 2HMAA 1EVZA 5F7JA 5A7HA 4AG6A 4EG6A 2ORYA 2GN4A 2I2DA 4OGWA 5C7LO 5HRUA 1YK0A 1EHIA 3D8RA 3W7AA 1YCDA 3W2IA 4N5LA 3ELYA 1E1YA 4NZPA 1V0JA 1KYVA 4Y9DA 3T7KA 5AIBA 4FD2A 1NW5A 4HZUA 2C2KA 4M8KA 3FFWA 3Q7QA 4RKRA 3I9JA 1D09A 1KZ4A 5HM6A 1XA0A 1P7YA 5HE8A 3ZCPA 3IH5A 1CP2A 3U4DA 3A9WA 4HDQB 1LFDB 4RIHA 4GZ6A 5FUVA 1UANA 3AM4A 5IBQA 5D3MA 5BN4B 2XDQA 5LQSA 2YOHA 4RZUA 1YA8A 4RSGA 2AE1A 4DLBA 2EDCA 3UWDA 3PXCX 1DQRA 2A2ZA 5IS2A 4DLUA 3UC9A 3KYCB 1QYXA 3ED1A 1ZJJA 1XAHA 4NJEB 4XIYA 5JFTA 1E99A 3CZCA 4YYEA 5F7OA 1QOPB 1E89A 5K8JB 3HFGA 2QRKA 2P2CA 3ZWWA 5C5IA 4D9IA 3NUGA 1Z18A 1MN6A 2MIIA 2VHQA 2VSOA 1KEVA 1GZ7A 3CMMA 3H11A 3WMEA 3WZLA 1T15A 1KEEA 1G3QA 1MAAA 3CRMA 1CNMA 2JARA 4HMQA 3R77A 1OW3B 4N0MA 2GA8A 4OYLA 3TVYA 4B6QA 1U94A 4JP1A 3CLRD 5DYNA 1PJ4A 4IR7A 1VZ3A 2JVKA 4BLPA 4DYHA 4OLAA 2BMVA 2Q0XA 1WUTA 2NXEA 4TV8B 4EGQA 2C3MA 2OYRA 3R7WB 3CF0A 5KYUB 3MYYA 1JQ3A 3DAHA 1CVLA 4CM3A 4R0MA 3I9MA 3LLUA 1G291 2J46A 1E96A 1FDWA 3DQQA 4MVJM 1BFDA 4CMAA 3RT1A 3M1YA 2FE4A 5BRNA 4AQYB 1IN7A 2EU8A 1OU4A 1UDAA 4G1BA 4KH0A 3RBXA 3RU3A 1U0BB 1NZFA 1NU8A 2GD2A 4Q47A 2XTAA 4NBSA 3OJXA 3JVUA 2BP7B 3CEPB 2ZR7A 4IQFA 3P9PA 5FUQA 2QZZA 4Y1FA 4DLNA 1K27A 3T95A 2AVNA 1VFPA 1GSIA 1WSBA 3EXIB 4K2HA 3SBEA 4B81A 2QTMA 1DRUA 4RK4A 4A36A 4XOUA 4N82A 3C3DA 1FQOA 4JSTA 5A62A 1RWPA 2BBOA 4HDCA 3TLMA 4L8GA 1QZZA 2BFDA 3A6FA 4IRXA 4IH1A 4YMWA 2C4UA 3DVSX 4HYTA 4BQEA 4I1PA 1JVBA 2YN4A 3DDCA 3CSSA 5ERGB 1LSOA 3ZKAA 3TFWA 3BB4A 4OQEA 1W1UA 1ZK2A 1E1CB 3GEEA 1RWBA 4I1VA 4PO9A 1SBIA 4JI3B 4EJMA 1OF1A 1FTGA 4MS4B 1RQRA 4UAUA 4RPKA 4A73A 1RQ2A 3S4YA 2RIRA 1M2OA 3F3MA 2OQ2A 3GC6A 2B1QA 3JW8A 3DC2A 4MNTA 2Q3BA 1KA9H 4P7JA 1ISRA 4XRRA 4ZA2A 3K53A 3AERA 1L8QA 4MKRA 2PD4A 5AQEA 5B1HA 3QMWA 2GZSA 4JAVC 5L3VA 2I4IA 3X1MA 4TTSA 4QQKA 2AJCA 2OA0A 2EX1A 1O6ZA 2VZ0A 5FFNA 4E07A 1XDWA 3X2FA 1GWNA 3O9VA 3Q1LA 4R9UC 5THKA 4E4TA 3OCXA 3E2IA 3QKTA 3BTVA 5HK9A 2QSUA 1QHHB 2DMRA 4AY5A 1BCRB 1DEHA 2GVNA 6NULA 1GUAA 3LUJA 3GLUA 4WXEA 2FQQA 5TGDA 3RF6A 4NX2A 2VP2A 5K3FA 2Q3HA 2GJKA 5ALVA 1U8FO 1Y34E 2JHFA 3GUUA 2LV8A 3JQ6A 1ZW6A 3CGWA 1SN7A 2PGLA 3LCMA 3O75A 4K03A 2OV1A 1RLMA 5F1YA 1ZICA 2GHTA 4LISA 2NZYA 4BVBA 1NXSA 1OFUA 1VKNA 4XARA 4P2GA 4JNCA 4ZOAA 1XALA 1U7UA 3PXDA 2R751 4GVXA 5CFZA 1N6OA 4Z0HO 2B92A 2QUBA 4L50A 1H9AA 2JCXA 4MUFA 1YGPA 4AKTA 2JFFA 3HCRA 2Z95A 4DBZA 3BXHA 1Z5PA 4LW8A 1Q1QA 4ZAFA 2G82A 3IALA 3VU9B 4TMZA 4BQQA 4A15A 5EXDA 1OLUB 4MTLA 1IVSA 1D4AA 1SXJD 3DQPA 2IYVA 1P1HA 4OHMA 3LUGA 4QU9A 4U9HS 1UPCA 4BKOA 3CG4A 2VYVA 5DWDA 5A5GA 1FSSA 1EFVA 1M2HA 3M4ZA 4YDRA 1REQA 4BECA 4HEA1 3T7JA 3N75A 4R83A 3ULKA 4CEJB 4X8HA 2ZRLA 3NONA 4EB3A 4WZAB 4YAEA 1IVYA 1W30A 3N59A 3P19A 1G6KA 1VYTA 2X8JB 3B8EA 3PDIB 4ETIA 1IN4A 4YXWD 5C5EA 2NQ2C 4PC2A 4YRCA 1SUCA 5ADVA 5JFGA 1VKOA 3A3PA 4RDHA 3LQYA 5FPPA 5FPQA 3AR4A 2FPLA 3L41A 2EFJA 3V1MA 3C6QA 3BPSA 4ZKEA 1IJEA 4OV6B 3WP0A 3ST7A 1QK5A 1G7RA 1TMGE 3KKZA 2BEVA 4J43A 4G0WA 1WXIA 4J8PA 1UADA 2ZSBA 2WT9A 2XITA 3Q0EA 1ZONA 2WVGA 2Z2IA 5CGZA 3T3EA 1RAEA 2ZYGA 1A9XA 3Q8LA 3EGEA 4B5LA 5LQDA 3VJRA 2QP4A 4G0MA 4F11A 2EBFX 3HJNA 3QWHA 1FUUA 3GFBA 5M7EA 3DEFA 1RRCA 3DBVO 3MG9A 3I1JA 1CY1A 4E1BA 2QZJA 3GRZA 5DK4A 3EPPA 1IAVA 1SEPA 5B4VA 1Q0QA 4IQ4A 3WLFA 3PHJA 4P54A 4EMTA 4HTAA 4KX3A 2PLAA 3IBYA 3IXQA 4A6EA 2X40A 2R6JA 3BDIA 4G5RA 3OKPA 3KEGA 2VUSA 3KKMA 1LI5A 2Q9AA 1CUFA 3MWJA 1O95A 5ES4B 4QDOA 4TUYA 1T5DX 2PZJA 4P38A 4N40A 3H2GA 1K92A 3C74A 4R81A 5ARBA 3FIJA 1P91A 3GDFA 2WTEA 1U81A 4DSOA 2G06A 4XA8A 5DHPA 4C07A 3UJDA 3KVYA 4RFSA 4ARIA 1OLOA 2DLDA 4HLDA 5HJ7A 1JUDA 2GDZA 2ZIFA 4RVHA 1VHQA 2ONYA 3NIWA 2V7VA 5LDDC 2VF2A 1KSHA 4HDRB 4HAIA 4N6NA 3DNMA 3EE6A 4RBNA 5SV2A 5AVUA 2R8ZA 3AIOA 4P8RA 2GVDC 5CXSA 2QVZX 2JNWA 1G4AE 4YJGB 4ID9A 2JAPA 4CLOB 4EQ6A 4HVLA 5A0VA 3IUEA 3UANA 1P74A 4MUJA 3AEQB 1EG2A 4OXRA 3TEMA 2CBGA 2PO7A 1JSCA 2L69A 2C58A 2XNDD 5HKLA 1JPNA 3ANYB 2Y0PA 3FJYA 1T0HB 4K88A 1ONBA 2VHZA 1QOZA 1Z12A 4NY1A 2CF6A 4L7QA 1G66A 3QM1A 4OFBA 5ECWA 1TAUA 1F8UA 3PFHA 3BGDA 4EJ6A 1OBHA 1LNQA 2Y2UA 5K0BA 3OQIA 4LI3X 2BPOA 3OLVA 3OESA 4C4RA 1TJNA 3DAGA 3SQLA 4EZBA 2WZBA 1TI7A 3ADKA 4H6XA 5HDBB 1DT5A 2TYSB 2YBDA 1R8SA 4UUPA 4Y9SA 5FL3A 3PUWA 1ODLA 4O0MA 1UMDA 2E6UX 5ALXA 3CPJB 1EB8A 3PK0A 3QY0A 3NEPX 4RF5A 4DIFA 2EL9A 1EAMA 3AR6A 4M1ZA 3N07A 4YROA 3BD7A 3R9KA 3ZDAA 2VJDA 3OCJA 2HY7A 2I7TA 1X3SA 5JALA 3ESQA 2C7PA 1MEEA 4KYVA 4O4JF 1B8NA 3GN2A 4PZAA 3LS2A 3MWFA 4ZT5A 4M0MA 4D3XA 3N7UA 3K0BA 1N0VC 3DFUA 3PGVA 4DTCA 2P9JA 3CSDA 4DPKA 3LBHA 1K8QA 4UDXX 1OH6A 4UTVA 4YCCA 2C1EA 3AYXB 4RF3A 3IT3A 3TL3A 4EL0A 3PP8A 4LF9B 1R88A 2O8BA 1GVNB 3CZ5A 4LC9A 1NTOA 3IOYA 4LJYA 2JI6A 5IBPA 1FYFA 2WPNA 1MG0A 1BH2A 3NBUA 3O90A 4HEA6 3AHCA 3DFFA 4BZZA 4CEHB 2BRUA 1RS0A 2ZSIA 2ZPUA 3BL8A 1WXHA 2X2PA 1OZ0A 2WVAA 2J5BA 3DV9A 2HL6A 4RPHA 4FUQA 5EINA 4IDBA 3HI4A 4PU0A 4GECA 4DV5B 4E3WA 1JFFB 2GBIA 4J0CA 3BE4A 4UTNA 3PQFA 1USVA 3PCTA 1IY8A 3NIGB 5HTOA 2OTCA 1H2HA 2QQ5A 2VXBA 3IBTA 1V1JA 2Q3LA 4NQZA 4RVGA 4ZXFA 4CM4B 1EFRA 1UR5A 4QT4A 4P08A 3CLVA 2OY0A 5U9CA 3VYUB 1E0AA 4GZ5A 3ZHCA 1FTYA 3L82B 2BCGY 5E38A 2GB4A 4ALJA 4WJLA 3HR7A 3IAHA 3L4BC 4LKRA 1VOTA 2I9PA 3A1VA 3M82A 2IW1A 2R79A 1AKMA 1U0TA 3FYUB 3ND9A 3KO8A 3ZWKA 1JJBA 2OZEA 4QUDA 2YHSA 2F8SA 2HMVA 1SRQA 2Y1KA 4F2PA 2OB2A 4I2VA 2VAMA 4TLAA 3FHJA 1GRCA 2FPGB 2QX8A 2X0IA 2D1FA 4CL2A 1PT9A 2Q0HA 3ET4A 5CDHA 2WMOB 2R62A 3LKBA 4FN4A 3MD0A 2IFTA 5JU6A 3NHJA 1YGYA 2PPVA 2V7XA 2WYVA 4NNOA 4RM3A 3ZQJA 4ECAA 4PNEA 1AS3A 2B6NA 4P4SA 2QL6A 3D4BA 2YY7A 4CDRA 3F49S 3FZNA 4RYDA 5D7BA 2E4WA 2WJIA 1BKYA 3G2IA 2DUJA 3GNSA 2M9MA 4Q24A 2R86A 3RG2A 4B5KA 2E48A 2VDQB 3GJSA 4EFNA 5BV1A 5IHPA 3I23A 4Y6LA 1ECGA 3CHYA 3ZEIA 3GFQA 2L0XA 1Z74A 1SBQA 5A05A 3K94A 1HO3A 3NT2A 3ORSA 3MA0A 4Y2YA 3V3KA 5F1OA 1TU3A 3KJHA 3VGPA 1C5KA 5AI4A 1TEZA 1XZCA 3LIIA 1AH2A 1R0RE 3AB3A 4L75A 3SSOA 2VTKA 4IIHA 3Q7SA 1NA5A 1WD7A 2CK3A 2UZ0A 1E1MA 5NULA 2PKQO 1E6MA 1XP8A 4FDUA 1KAOA 4AIRA 1N6IA 4Q39A 3UGJA 3R1IA 3I9NA 2OD9A 4K86A 3FCSB 4JSYA 4J29A 2AG1A 1Q3TA 4GBGA 4CQMA 3M6LA 1JIUA 2OGWA 4DCOA 1U7DA 1Y3DE 1NI4A 5DCWA 3LOPA 3PNQA 4F9GA 5KOJA 1JPUA 3IRVA 2RHGB 3GH1A 1GKLA 2PD3A 1KY2A 1EWVA 2NU7B 3IJ5A 4K05A 1UJBA 2IDJA 5DBIA 1U5BA 1XTJA 1ZL2A 3KYJB 3NBFA 1Y98A 1IUOA 1J56A 1L1FA 4Y1RA 3T3IA 2OV8A 4CF7A 1L7PA 3U3OA 1D2GA 3WTCA 4N7RA 4RIEA 4EA8A 2DSTA 3B1XA 4LHEA 1OSNA 2B35A 5J5VA 1C30B 1IRIA 1WBJB 2YV3A 3L18A 4JU9A 2C2GA 3RCBA 4IPTA 1JDPA 3AEKA 3JWHA 5DNUA 3SJUA 3TPCA 3CLHA 4O2AB 4DUGD 2C96A 3SF8B 2I9KA 2C9ZA 4IDOA 2G6TA 2M1ZA 5BNFA 5CFQA 1DCMA 5EMHA 1NWHA 1WB5A 1QM5A 1AHHA 3GQBA 4PLTA 4ARCA 1MEOA 5FH9A 1J23A 3K15A 4EY7A 4JLVA 3O4HA 3RUAA 4YRNA 4NU8X 1PK8A 4DY4A 3CUUA 4YAOA 5C32A 3OIUA 4Z4EA 1U3GA 3LDUA 4OVKA 2D62A 3ZV5A 3OTHA 2C04A 3U17A 3KB2A 1J7KA 3STYA 1ZI8A 4PWZA 2ACEA 1ZLYA 4TYWA 3WB1A 5G41A 4QO7A 1SVWA 2XUGA 1K6XA 3S2EA 3N7AA 1YRBA 1IPEA 1S8AA 4L08A 4WQMA 5FADA 2AEEA 4OXNA 4MMXB 4ENVA 4NBWA 1ZESA 1GGEA 3MWLA 2W2KB 4D99A 4CQNA 3MMSA 4OHZA 1A5ZA 1CEXA 1FRNA 5TDHA 4C29A 1SVSA 1MTZA 1PSZA 5GVSA 4UM7A 2AQKA 4G0ZA 3L5OA 4M0CA 4RA6B 4KL8S 2TSYB 1I1QB 4GQBA 4HADA 2ZZNA 1ULAA 4IGIA 1NULA 1JHXA 1ZM2A 1C1XB 1KP9A 1I7DA 3LQRA 5CLLA 3THYA 1L1EA 4R05A 3GCXA 1E3JA 1T3GA 1Q19A 2NXNA 3KQLA 5B3JC 4HWKA 4PQYA 3UGKA 4ZK6A 4YQEA 1PYOA 3C3BA 2WM9B 3I6QA 4IJKA 3BSWA 2REQA 4D6PA 1WV0A 2IF0A 2RGNA 3BIOA 4OXKA 3DWGA 4R2KA 1GTG1 1FFBA 1GZ5A 1PJ2A 2GTPA 3I42A 3WHLA 5BOSB 1LPBB 1RBYA 2ZIVB 3PQ8A 3PQEA 4A23A 4KAJA 3MK31 3FTQA 1T10A 3W8EA 4F0JA 4D25A 2VPIA 3AR9A 4MUYA 4V3CA 2VHTA 3C85A 4KFRA 3PXBA 3D6MA 2ZDQA 2BISA 3E1KA 5IT4A 2I2FA 3RIMA 3C1UA 5CXQA 4U7DA 1G5HA 3ETGA 3FYSA 4BVAA 2HDWA 2PFGA 2CJWA 2EGUA 4HGYA 4PTZA 4CMGA 3BVPA 1YI0A 2VKQA 3VTFA 2R9VA 5DNEA 3IKTA 3O1LA 1ORTA 4FOSA 2F48A 1GN9A 4DDHA 2DHRA 1DC5A 1ZXXA 1QYCA 2RG7A 5IAJA 4XD7D 3SD7A 2Y1GA 1P4SA 2VHCA 3WG9A 4BLQA 1B00A 2O2IA 1THTA 3EJ6A 5C1OA 3L1JA 4BO4A 1HT3A 1TUBA 4BCCA 3I53A 3Q5DA 1XTQA 1QU2A 2BFWA 2IP4A 3GBSA 3C5EA 4LC1A 1NQAO 1NASA 4DF3A 2R1UA 2IE8A 4EJFA 1W88A 1C4OA 2RE8A 2FRDA 4BAZA 5BXYA 3H6HA 1FW8A 4FNGA 3O4GA 1FMCA 3QFCA 3AL0C 4BNVA 3D6TB 4PSKA 3Q0TA 3GR6A 1GZ6A 5DB4A 3UW1A 1CY4A 1GG5A 2IHTA 3FMPB 3AUYA 3JQ9A 3O74A 2B83A 3H2YA 3BUSA 2UZ1B 3OQVA 4E1AA 3P2KA 2WC1A 5ALTA 5CAEA 3S1AB 3REGA 1LY1A 1I32A 4OQPA 3AK4A 4UHJA 5JVDA 4I5IA 2HF7A 1GLGA 4HDSA 2ZJ2A 5BYKA 1CCWA 3ETHA 1Q7RA 3E23A 4AW9A 1BS9A