5HIAA

Human hypoxanthine-guanine phosphoribosyltransferase in complex with [3r,4r]-4-guanin-9-yl-3-((s)-2-hydroxy-2-phosphonoethyl)oxy-1-n-(phosphonopropionyl)pyrrolidine
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
202
Chain Sequence
b'TRSPGVVISDDEPGYDLDLFAIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLIKVIDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVAVISETGKAKYKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Design of Plasmodium vivax Hypoxanthine-Guanine Phosphoribosyltransferase Inhibitors as Potential Antimalarial Therapeutics.
pubmed doi rcsb
total genus 71
structure length 202
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hiaA00
1O57A 4LZOA 1CJBA 1DKRA 1J7JA 4QRIA 4QYIB 3GGJA 1HGXA 4RHXA 4P80A 4RQBA 4S2UA 1BZYA 4WMLA 4JITA 4RQAA 1STOA 2H07A 1DBRA 2PRZA 4TWBA 1QK5A 1ZN9A 2PRYA 2P1ZA 1PZMA 1A3CA 2DY0A 1VCHA 1P17A 1A96A 4WN3A 4X45A 5BQOA 1UPUA 4RANA 3KB8A 4MB6A 3ACDA 1WD5A 5E38A 5BSKA 4P81A 5KAMA 3DEZA 4M0UA 1G9TA 2GEBA 4Z1OA 4FYMA 4M0PA 1OREA 1I0LA 4RABA 1Y0BA 3HVUA 1OPRA 1I0IA 4P82A 1L1QA 3ACBA 3H83A 1XZNA 3G6WA 4M0KA 4PAWA 4LZNA 2JBHA 5ESXA 1A97A 1BD4A 4QYIA 1QK4A 3NAGA 1UFRA 1ECCA 1VDMA 5IPFA 1A98A 5JSQA 2H06A 5BQPA 5IAOA 1DKUA 1A4XA 1GPH1 1I13A 3DMPA 3GEPA 1LH0A 4JLSA 1V9SA 4RHTA 2AEEA 1AO0A 1OROA 1ZN8A 4IJQA 1ECJA 2PS1A 1JLRA 1MZVA 1XTVA 2JKZA 3N2LA 1DQPA 1IBSA 1BD3A 4RADA 2IGBA 3QW4B 1P19A 2VFAA 1R3UA 4RV4A 3LPNA 4RHUA 1G2PA 4X44A 1O5OA 4P84A 1A95A 2XBUA 3LRTA 1QCCA 4RAQA 1I14A 5K51A 4F8EA 4P3KA 1P4AA 5HKLA 1Z7GA 5HIAA 1U9ZA 2EHJA 1JLSA 1FSGA 2C4KA 3O7MA 5ESWA 1VSTA 1G2QA 3S5JA 1XZ8A 2WNSA 3OHPA 4P86A 1DQNA 3EFHA 3OZFA 4KN6A 3M3HA 1QB7A 4LYGA 1XTUA 4PFQA 1XTTA 2HCRA 5BRNA 2JI4A 3MJDA 1NONA 1TC1A 4LZAA 5JV5A 3GGCA 5EUCA 1UPFA 3ACCA 3MBIA 4P83A 2YZKA 1ECBA 4RAOA 2JKYA 1ECFA 2H08A 3DAHA 1HMPA 4ZFNA 1ZN7A 3OZGA 1QK3A 1L1RA 4RACA 1YFZA 1QB8A 4RHYA 5KAPA 1GRVA 4OHCA 1U9YA 1G9SA 1P18A 1QCDA 1D6NA 1I5EA 1W30A 2FXVA 1TC2A 4LYYA 1ECGA 2E55A 1NULA
chains in the Genus database with same CATH superfamily
2BUBA 3DONA 1H2AS 2Q9BA 3AHGA 3D8TA 2OD7A 4HRXA 5BW5A 5CB4F 4HFRA 4LJAA 1I32A 4ATNA 4FBLA 1HYHA 5EXEA 3SHFA 1Q3TA 1T25A 2VBGA 4GPIB 4C7XA 4BMXA 1QFSA 4DCVA 4CL3A 2JC3A 2ONKA 2BFDB 2WJGA 1THZA 3BMOA 3SSMA 1FDSA 3WO1A 4NEHB 2C2OA 3U7QB 4DA7A 1OKKD 4ARSA 4BWGA 3URMA 2Q5IA 3BSYA 3LO5A 3WYAA 3P94A 1M0TA 5DLYA 4CJXA 5DNEA 5SZKB 1WE2A 2HPZA 5EA2A 4EF6A 1E0DA 4IXNA 5DX8A 1QHXA 2PIAA 3SI7A 1WW3A 3AM4A 3NFYA 3GT4A 1QHHB 5HZGA 2FVYA 3QU7A 4V2UA 3T9CA 2GA9A 1XQWA 3CLRD 3CRZA 3BUSA 4QJ4A 4CQMB 3KJGA 1U8XX 2ZVQX 3KKEA 4IF6A 3L7BA 1PL0A 1YRAA 2OZVA 2NV2B 5AW5A 1HBJA 3T9BA 1X1RA 1E2DA 3JYHA 4M0KA 1Y5NA 3WQHA 3EARA 4WZBB 3Q0IA 2QSJA 5ESXA 3VKWA 3BCUA 3ZIAA 2OBBA 1G21B 3C7DB 3GZJA 3TNYA 1IZYA 3U60B 1H4QA 4QJBA 4PVCA 3PHIA 2AOUA 4MGHA 4O0MA 2V7EA 2O9JA 4ON9A 1S2GA 3DXYA 4F6CA 2F48A 2D5IA 4HS4A 3CBGA 4ANFA 2ZWVA 4H1TA 2GD0A 4YDRA 4B4VA 2ASEA 2X5NA 2PD3A 1C1XB 1WZCA 1ZDMA 2JAHA 1SCUA 1EXDA 3A6LA 1CUXA 4D6XA 3OTGA 1YR3A 3DTVA 1FX0A 3PFHA 3NYWA 4NFYA 4AJ4A 3UBTA 1SHJA 4ZV4A 2YS6A 4F97A 1JW9B 5KNDA 1PSDA 4EHJA 3QXGA 1U7OA 4I9FA 1A1SA 1KOJA 3HA5A 2ZJ0A 1YAJA 3DBLA 1TTHA 2DXIA 3TTWA 1A88A 5CK5A 2WU0A 3VHXB 2B78A 2BHNA 2KX7A 3CF4G 4LYGA 5AW1A 2AFIE 4TN1A 3PPWA 1VP9A 1EDEA 2E4VA 2PLNA 3S28A 5LQSA 3ZHBA 5FOXA 2NVOA 2XVMA 5L4SA 1UXKA 3EG5A 4HB3A 2WTXA 4RY2A 5IPFA 2JGNA 1FP4B 1KMHB 3KKNA 5AJHA 4PGGA 4Q3EA 3WDLA 3ZWDA 3FVVA 3WTCA 4JD5A 2AK2A 3TN7A 2IYFA 1FNSA 1L9KA 1BXGA 3BRCA 1GZSA 3C6BA 4GXTA 4ITRC 4L3OA 4RMGA 5F1KA 3GPCA 3BL8A 4GQIA 1C14A 3USCS 2LIVA 3VSDA 4EMTA 5KTPA 1QZTA 2REQA 5SICE 2EOAA 2V3WA 4NOKA 2OHHA 3V8EA 4F91B 1EVZA 5AVJA 2ZW9A 4LXYA 3MRXA 4YGXB 1N5OX 1HLPA 4J8PA 5KVAA 1VXRA 2AGVA 3FZNA 4AJ9A 4CKEB 4MTLA 1UBUS 3E2IA 4N7RA 1KZYC 5DBFA 4BEBA 4CM7A 3F6RA 1KI6A 1DO8A 3EODA 3KALA 3K09C 4LDQA 5DGHA 3JQFA 5ALNA 4BUZA 2I7XA 1U9IA 4DZZA 1HGXA 4QC2A 4MV7A 1EVQA 3MLBA 5DW0A 5H80A 3RVQA 2C5LA 2Y99A 3AXTA 3BAZA 3CNHA 4FQ7A 1W7AA 1U2DA 2I67A 4EB8A 3A7DA 3QI7A 1YOVA 4Z54A 3SQLA 4PZCA 5DTJA 3S70A 5A03A 4G36A 2CLDX 3P9XA 3QLVC 4YMGA 2A0WA 1GGVA 2QS9A 4CCSA 2PQ0A 3AV3A 4RKWA 1SBHA 1K8ZB 2DJIA 2XQJA 3KB8A 3CZPA 4E7PA 4OGWA 3SIWA 1UMDB 2IPNA 1SXJB 2Q9AA 3FYCA 1XE3A 1PR2A 2FQ1A 3IGFA 3OMWA 4HGZA 5BV7A 5CBPA 2ODTX 1DRKA 1L5RA 4CM3A 4F4JA 1Y3HA 3QTBA 5DASA 4F3YA 3KQLA 3KQNA 1XEWX 3O4RA 4Q4JA 4QBGB 3Q0EA 4QODA 5GMOA 3MGBA 4JUIA 4WNAB 3A9UA 3RWMB 4D6PA 4DAOA 4YRGA 5LP6B 5P8WA 2OBXA 3G6KA 5E6UA 3UN1A 1JNYA 3QIVA 5LB2A 4AAYA 3IV7A 1RZUA 5FADA 2X8JA 5EJGA 4BO9A 3UFBA 4EJMA 5B4TA 4CEHB 3HU5A 1PK9A 1YQTA 1FYDA 1EYZA 3VTZA 3NASA 2XX3A 2FK7A 3O92A 3H5LA 3DFUA 3M70A 4LOAA 4OHZA 1C9JA 5CITA 3OOEA 1Z2DA 3LT0A 4KKVA 4X6YA 5K3AA 2VAMA 4P7JA 3INTA 4YRDA 4AVYA 4DWOA 3R6DA 3G49A 4MO2A 4ZOLB 4CNBA 1Q7TA 2AOXA 2B4QA 4YLEA 1GUDA 3BJEA 2IV2X 4A6PA 3NKVA 2DJ5A 2G08A 1XP8A 4LMPA 3PEFA 3B2NA 2YJTD 1X1QA 5KNDH 3KKQA 3KZ1E 3ZGYA 4XIJA 2XADA 3EH1A 4GMKA 4L02A 3E81A 3HBNA 3N0XA 4L3VA 5AUQA 3DBRB 3ECSA 4QHTA 1LRKA 4MV3A 4WMLA 3GDGA 2HA7A 1HE4A 5F1YA 2WY2D 4N5LA 4QXOA 4H15A 2DULA 1WDTA 1ZLXA 2JFYA 3LUBA 1F17A 3BRSA 4WZBA 1HTBA 4IWXA 5TF0A 4C30A 3RUDA 1RFLA 4B44A 4NBWA 5HIAA 3F4BA 1QH1B 1O5IA 1E92A 1GKUB 3OHMA 4RIHA 2QXUA 2ZDGA 2WABA 4TMTA 5J5AA 3ORRA 1I2ZA 1I5RA 3A3YA 1JR2A 2OORA 2DQKA 2OZPA 1P91A 3TLGB 3OJLA 3SHOA 3PR3A 4R5HA 3T52A 4JQYA 1AHIA 3HFJA 5AK6A 1WAMA 1XVLA 1UOQA 1VLQA 5EHQA 5BRAA 3UCEA 5L3QA 2C20A 3PI7A 1TC1A 3TSWA 5LQJA 5ADUS 2HGSA 4Y9TA 3EVFA 4GI1A 4RVOA 3OX3A 1N78A 3CNEA 4LXQA 1NQVA 1V1RB 4O4HA 5EZYF 1C7JA 2I2CA 2IEZA 4LOJA 1SVIA 4DA0A 4C4TA 3W8RA 1E1CB 2DFTA 4C2UA 1F0YA 5AVQA 1E2HA 4L4UA 1NHWA 5KTRA 4OI1A 4BX3A 5J47A 1VYTA 4EB6B 1FSFA 1F5SA 3MLAA 5FL7D 4D8WA 4WH0A 3RUIA 3G68A 5JCJA 3RR2A 4BGEA 5F52A 4BMOB 3IR6A 2I6QA 3I28A 4TKZA 1JRLA 1E1QD 2X3UA 5AM0A 4ZZ2A 1ZCBA 1VGVA 2PTGA 3LI2A 3PQ2A 4JGBA 3ABOB 5CVEA 3G8CA 2RAPA 2AD1A 2QX7A 4E1VA 4C7OA 2FFAA 1MCZA 3IPAA 1T2DA 3STHA 1WVGA 1JAIA 4G41A 2QRVA 1QO0A 4YX9A 1GTL1 3ND6A 4CKWB 4K87A 3BJMA 4MCAA 4ZT4A 4ALIA 1O97C 1KK0A 4KACA 2OO3A 3ZNQA 2WW8A 3EDQA 3U5TA 4IDPA 4KB5A 2Q6OA 1YFJA 3UJCA 4Q24A 3JYPA 3MS4A 1Q7EA 1XAHA 4BNLA 5BXYA 5C1BA 4D9MA 2HWYA 3AVWA 2BD0A 4G5YA 2GBLA 3C8DA 4LHSA 121PA 3S6JA 1NMQA 1V48A 1KNXA 3R7AA 1M2VA 3H0CA 5EQDA 2EL9A 1BA2A 1TFRA 4ILEA 2LZ0A 1K5PA 3Q2OA 3BSWA 3F7OA 4IM7A 3VJMA 4AF7A 4BQQA 5BR8B 3EGIA 4BV9A 3UK7A 4YMWA 3ETLA 4W5QA 4AO7A 1TU3A 4Y0NA 1I0IA 5CA0A 4RM3A 1MN6A 1RP7A 1TF2A 2RH4A 1Z6TA 4JL6A 5JALA 4L2IB 5EFZA 4PC1A 1OB2A 3ZDEA 1UOPA 4NBTA 4R84A 1B0AA 1A9SA 5BP7A 2QZZA 1VLHA 9ATCA 1IK4A 2WF8A 1RC8A 2UXCB 3VVMA 4KODA 4F3CA 5K0EA 5LMZA 1VRVA 2ZR7A 3A31A 5A4MS 3FWKA 4KPGA 1EFPB 4LWQA 4EPVA 3W7BA 5I4IA 1GUAA 4L72A 1H5UA 4RNDB 3N5KA 4EPWA 1T1IA 3C48A 1KBQA 3MHTA 1BS9A 5DNVA 2DHRA 3GJYA 4KQ9A 2ZSAA 3CZQA 4FFBA 5CYPA 1AQNA 5JE8A 2JASA 1KYQA 1OZAA 2O4CA 2E7ZA 4NZMA 2YV2A 2CLSA 3QELB 4PYIA 3B2QA 3R74A 3BD9A 3MWKA 4WXMA 1GGJA 4P84A 5BSEA 3N86A 1A95A 3PWKA 4Q03A 3PGA1 3O8BA 4EFLA 3EHEA 4CKBA 1O96A 3C4QA 2DBVO 3IUMA 2VQSA 3GJRA 3NNNA 1QE0A 3KAJA 5E6UB 4A03A 4D79A 4F4CA 3H04A 2QVGA 1IIBA 1DFIA 1V3TA 1J8VA 1YRWA 2ZAYA 3PHBE 2XRFA 1KRHA 1KTIA 2GZ3A 1ZCZA 3DLIA 1ZSYA 2W6MA 1IXZA 2EP7A 3QE4A 3M33A 3OZFA 2LTAA 3CZMA 3FI9A 4R8SA 2PH3A 2MWMA 2V55B 3F47A 2IUUA 4EJSA 4RZHA 2A0UA 3WBKA 3ZD9A 2R11A 4PSVA 1XTTA 3UH0A 4Q3NA 2IU6A 3BIXA 2BGIA 2F62A 1W34A 3Q15C 1MO5A 1TK9A 4OHXA 4TMYA 2JLVA 3I4CA 3W06A 1G20A 2B9VA 2FN7A 3JR3A 4FE4A 4GX2A 3N2KB 3ZU2A 4A82A 1Z8HA 3ZCUA 1UK7A 1C3OB 2QT0A 1P2DA 3IBYA 4HH0A 1RRCA 1TM7E 4W5HA 3CPSA 2B25A 5CXXA 1PNOA 1XMOB 5TXGA 4DXDA 1MUUA 1QGAA 2QLBA 1QC5B 4BLOA 2F3SA 1SG9A 3N7AA 3HRIA 1QH1A 2H57A 1T0UA 1L1RA 2QSYA 4FDUA 3K0FA 4QUDA 1U5AA 1YZ3A 1ONBA 1ZLYA 2RGXA 3BB3A 2RAUA 2ZIFA 2X19A 3IX7A 3ILXA 3T5MA 4DE5A 2EBUA 2C03A 5EIEA 1MEEA 5K0CA 1W30A 3T4EA 4UEQA 1AE1A 1CUBA 4MV8A 3SJZA 2HSWA 4XM2A 3CG0A 3EZLA 3OE1A 4I4CA 3NRBA 4YCBA 2JLYA 1FJXA 1AKTA 3AO0B 4ZHQF 2CSXA 2ZI9A 4JEIA 1VE3A 1PFQA 2ETVA 1TQDA 1O6CA 2DTEA 4Y2VA 5FFNA 2CMDA 3AOGA 2XGSA 1S3FA 1NXQA 4BO2A 4ZRMA 1LK7A 4KWHA 1MOSA 2K7ZA 1SD2A 4M60A 3ZQ6A 1B74A 5EJ9A 4KO2S 1PS9A 1Z8FA 2VHEA 1SIBE 3HXMA 2WF6A 2NACA 3I92A 2X9QA 4YGYA 4ZXPA 2Y1KA 4HSEA 2QENA 3ZNNA 1E18A 3NKLA 4BGUA 2OL4A 1VJTA 3VNVA 1UBJS 3PUHA 4IP0A 4X20A 1N2CB 3RS8A 4C07A 3UUWA 1SK9A 1Z75A 5LYYA 3N74A 4DB2A 4L74A 4URUR 4J1SA 4C6TB 3F5QA 1N2GA 1BDIA 2GJ8A 2BT4A 3HPQA 3DA8A 2C7BA 2EX0A 4NLLA 5IM4A 1S2IA 2GAIA 4GF5A 3VPXA 1P2BA 2RCYA 4XFJA 3ZHZA 3HHPA 2IBTA 1DAHA 4RZXA 3FI0A 3MGKA 2ASVA 3ZD8A 1V71A 4JEHA 2JJMA 2NZ8A 3IB6A 5C51B 1ECCA 3VTKA 1KYZA 1HDZA 5DP2A 1H9AA 5E6RB 1GU1A 3IELA 4QECA 3BMXA 2HMYB 3KUKA 5JNTA 2AN4A 2G9VA 2G1UA 1X2EA 2ZXFA 3EXFB 4D97A 2HUPA 4M53A 4CV2A 3C3KA 3K30A 1RYDA 2R5NA 5AQ1A 1WB9A 3DLCA 1TKCA 1OXXK 2PWYA 5IVIA 1NW6A 2D7JA 4TQAA 2SICE 1T35A 4IS3A 4G07A 1P2UA 1WQ1R 4HAUA 2B83A 1V11A 1Z6PA 2FN9A 3PCTA 1WUHS 1E8DA 5EMMA 3SVZA 4E2YA 1IXYA 4OXXA 1RNLA 2E5LB 3LDUA 3EPRA 1KK3A 4ZCQA 3TZHA 1ZN2A 4BFXA 3M6UA 3REGA 3W5BA 2QAIA 3E7FA 2JH9A 2ZKLA 2EKPA 5L40A 2O5EA 3P8ZA 3F5MA 1CS0B 2C1XA 1Q5PA 3GCXA 1R0SA 3VNRA 4BNFA 1SA0B 1RBQA 1Y48E 4Q3CA 1Y9DA 6NULA 1JG6A 1YCDA 3AFGA 2VUTA 1INLA 1X8LA 4JJZA 4RJ2A 4JXXA 1OFUA 4LZZA 4ZCIA 1Y33E 4KN6A 5HZMA 3M3HA 4MYRA 2J6CA 5ULLA 2R4TA 5HXAA 4TKLA 5SZHB 3THXA 5DEIA 5MF6A 1EVJA 1QGED 1P1JA 1T24A 4UU8A 3SKXA 1RWMA 1YQWA 3JRNA 4GKBA 3A36A 3T4PA 3U7EB 5KTTA 5F9FA 1K8QA 3T7IA 5IANA 2QN8A 3V4VB 3SEZA 2XZLA 3AF1A 4B43A 3C5CA 2IQ5A 3BH7A 1F60A 3R5HA 4UMEA 1MAAA 3WLKX 3OHSX 4CM8B 5EHZA 4DNOA 3ECAA 3ISTA 2VYND 3ONEA 2VOJA 2IP4A 3LQ1A 4MIOA 1OXMA 2BN4A 3AY7A 1P8JA 2F3UA 4RE5A 5GIPE 1OXTA 3FLBA 4LE2A 3W1VA 2XUOA 4ECAA 4RVNA 4B6RA 1USVA 2JJ2D 2XNHA 4DA8A 1FFBA 4DLYA 5JAUA 1K66A 3VC3A 3AUKA 1XI2A 3LUGA 2Q8NA 4E5PA 2YWDA 4MW4A 3W5UA 3WGYA 4MRRA 5JAOA 1RQGA 1WBBA 1W96A 2CFIA 3I72A 5A7FA 4P80A 3TDNA 3WL5A 1N6OA 1Y1PA 5LP6A 1C0PA 1XD2B 3NJ4A 3FD8A 4HAZA 4OOEA 5JFGA 2BBSA 1YQGA 3L0DA 2ZYVX 2ET6A 2XJ9A 3Q10A 4P0QB 2QLTA 1ZNZA 2XSZA 4FYJA 4J49A 3PJGA 2FRDA 3IUJA 1ICIA 4ZI2A 3PF8A 1X1TA 1NX9A 3E6AA 4G0YA 4TTPA 3FTPA 4XR4A 4N8EA 1ZESA 3K71B 2H8GA 3G3EA 1M0EA 3UK0A 5TGZA 3K5WA 3MWEB 1QIMA 2D13A 3IDSA 4B40A 4U2FA 4E94A 3CVYA 2G88A 3IAHA 1BDHA 3II6X 1MQ8B 2B4KA 4C7VA 2IBSA 2GZRA 2GMWA 2WUWE 3ZDDA 3FYTA 2VDVE 3OIYA 3WNBA 4LJ7A 3QA3E 4HDMB 5BT8A 1SUPA 4R31A 4YRPA 5HZHA 4LDZA 1UAYA 3QVGB 4AG5A 1NV9A 4UPEA 5K0TA 4DB4A 4C76A 4E88A 3T3HA 1C9MA 3OEHA 2HIAA 3IMKA 1XNRB 5TT0A 3A9SA 4DABA 4I5IA 4JVOA 4IJQA 5CT9A 1KVSA 3KOOA 1XTRA 1V35A 3UJ8A 3ZBUA 4X65B 2F55A 3GBVA 1X7ZB 4KI0A 4EUNA 4KMMA 2RHJA 3DLPX 3LQFA 2VFAA 3S5UA 3VBCA 2R5WA 16PKA 2OV4A 4QYMA 2IEAA 2OBNA 4RU1A 4E4TA 2HJGA 5A3VA 1ZMBA 1P9RA 3H17A 4JQZA 4R8KA 4TT3D 3HWRA 4ER0A 3EEOA 4YJHB 1Z4NA 2BJVA 2KI5A 4P98A 4YAUA 3GRAA 3RC2A 4U2BA 1V6CA 5B58T 5TQJA 3I64A 3MYRA 4WBNA 1W48A 4HNQA 3TZLA 3E8MA 5E8JA 1ZWLA 4UTNA 4J75A 3GVPA 3AK4A 5C4GB 2IYXA 1NDQA 3ESZA 1A5TA 1V3VA 4UOEA 1H2RS 3GLHE 3H2HA 4M7PA 3X1WA 3CINA 3W5DA 3NU1A 5A4JA 3T7KA 4J7CA 2D1FA 1NA5A 1JDBB 4I55B 3U48A 3VI3B 2ST1A 3L7DA 1QNFA 3WKBA 1DBSA 3CEHA 4FDVA 4HEHA 4RCVA 3WK7A 1Z0JA 4F12A 5C18A 4AQYB 1W85B 5IT9A 3VU9A 3GP5A 4BN5A 1R8XA 1GG5A 4MUIA 1KYIA 3LKBA 5EHXA 1IBKB 1DEOA 2CV0A 2YZKA 2XUFA 3L3BA 4Q1FA 1IRIA 5T6BA 2H08A 1I7PA 1FRZA 3ANSA 2H59A 3OIVA 4D9FA 1ODSA 5EE1A 5DBEX 5C8DA 2W6QA 1VKZA 4LUCA 1M2WA 3QBVA 1NVVQ 4K9LA 1XCOA 3M6LA 4N8SA 1TZCA 3ROFA 3U4DA 1UZLA 4ZAZA 1QF9A 5L3SA 4I6GA 3A7EA 3OEYA 1IXSB 1TPZA 4D0NA 2FPMA 2E18A 3L1VA 5ICGA 1UT6A 1AZSC 1O57A 2CDCA 2R8EA 2X3FA 3P0EA 2Z6UA 1QIFA 2CHGA 3QVKA 1HL7A 5SYAA 1A50B 3W2IA 1Y9AA 4ETMA 3V2UA 4CM6A 1BDJA 2I99A 3O91A 4JBGA 5GQSA 3BCSA 1D1SA 3KPYA 1UZAA 4RK6A 1EE9A 2HQOA 5G41A 1DMSA 1ELOA 3HYSA 3JQ9A 3Q3IA 4GPEA 4PZUA 4LTNA 1MW8X 3NBFA 2GXQA 1NW3A 2IL1A 3HZOA 2XB4A 1H0RA 1PDVA 4P2BA 1ZQ9A 3WBJA 4EEKA 1S8AA 2QK4A 4LJRA 4EJ0A 2J3DA 3FSRA 1J5XA 1NUHA 4AJ2A 2XMCA 4E6PA 4TYNA 2ZRPA 3VNQA 5AIAA 5KI6A 4RY0A 1VZ2A 3L7MA 3D6MA 3DLBA 3RRMA 5KOHA 1OFHA 2C2HA 3IBSA 5T5QA 1E3LA 4DV7B 2Z6AA 4A36A 1C3LA 1MVNA 3S2ZA 3DDZX 3ZIAD 1XRLA 2BFDA 3GU3A 1GQYA 4PZDA 3EAQA 2NU7B 1OFIA 1A5ZA 4GGPA 5BMVA 1NLZA 2ONYA 3O03A 3OIUA 3O2NA 3JVDA 2NZVG 1NUAA 1P1CA 4GYJA 1JNXX 2VTBB 4BVEA 2FEXA 2IUYA 3BRWD 4LNHA 4R0VA 2I33A 4UD6A 3VR5H 3ZDAA 1YRHA 3V4SA 3MFQA 3C3AA 1C81A 3U37A 1BCSA 2Q5EA 3VDMA 4KRFA 3UGKA 1VMIA 5F33A 1NVTA 4KP7A 2BCGY 3A14A 3OZRA 2WWGA 4QYXA 3SBOA 4P9NA 4US2R 2IX9A 2R8ZA 2P9QA 5JTTA 1E4YA 3MWYW 2IEGA 2XQVA 3KQVA 4XARA 3UWKA 5K51A 1NYTA 3EEBA 4Z2AA 1OAAA 2OGUA 1SOVA 2UKDA 3C3YA 1FFAA 4GGOA 4HMPA 5KSZA 2NZUG 2OO7A 1YK0A 3GF4A 3DFFA 2BI7A 1KARA 2BMFA 2XE8A 3G0GA 4GL4A 3RD5A 4Y9DA 1RM3A 5FA6A 1QQAA 4S2EA 5K6TA 4ZO9A 2PUTA 1B8NA 5DN6D 3LX5A 2CNWD 2DG2A 5K0BA 2MYNA 3U7FB 2CVPA 3AT1A 3QPVA 3D81A 3DW1X 4PLVA 4U4AA 3R7WA 4BYMA 4CV1A 1EUCA 3GUUA 5DXFA 2FW9A 4JR1A 1BRMA 4PO3X 1L1FA 3KD3A 2BZGA 4UTVA 1X8JA 1R1DA 4V0KA 1C7ZA 1YZNA 4AZ3B 1E2QA 2WDZA 4XWOA 1UEXC 1WJGA 3PZBA 2BFAA 1Y6GA 2C88A 3GFGA 2I9KA 2GHRA 1UDBA 2QKYA 1BGXT 4CLOA 4ALLA 4E2FA 4X8OA 1XALA 4YC7A 3TQIA 4QM7A 1HDOA 2EZ4A 5TIIA 4G8JA 1UDAA 1UJ2A 4QDXA 2P2SA 1MV8A 3W4IA 4MRVA 3GBSA 3W5JA 5FRDA 3IPCA 1HV8A 3ICVA 4XVQA 4URVR 3DDWA 1Q3HA 1RWXA 3BK1A 5A3QA 1HR0B 2Q3FA 4DUZB 2JI8A 5EJ6A 3ISVA 1FTYA 4C21A 4G0PA 1BX3A 3WRYA 1DO0A 3I2YX 3R7DA 1RACA 3BFJA 4HVTA 3LHKA 3AR3A 4DV3B 2Q1YA 4FR0A 2NYVA 4IKOA 2X2FA 3W9UA 3ZWMA 1QP0A 3A6FA 3LCJA 4GI2A 1XCGB 3LKVA 4H0NA 1R4AA 4U8HA 1OWMA 3EEYA 4N7BA 1J39A 3WL3A 2HIGA 2PMBA 1JBEA 3O4JA 4EJ6A 9ABPA 3OT5A 2MYPA 5BWOA 5JDIC 2HUNA 3E48A 3KVNA 3QG1A 3R0VA 5FULA 2XE6A 5A9RA 1YKGA 1QIGA 1RAGA 2ADMA 3I83A 1Z18A 3MTGA 1RYEA 3WLJA 1ZH0A 4E5MA 1QP4A 3TLBA 1U2SA 3RFXA 1D1QA 1XTSA 3CLKA 3FDFA 2YJ3A 3FW1A 4RXMA 4JLKA 4TL6A 1G21A 3FTQA 4UHDA 1UFKA 5TQ0A 3T6KA 5HZKA 5DXJA 2GM5A 3LFHA 4RD1A 4DRZA 3DBIA 3IQEA 1NBOA 1NGSA 1L5SA 2VPQA 3OF5A 3P9NA 1F12A 3CT6A 5IBPA 3DTVD 2O2XA 1PD0A 4R2IA 4TKUA 5AJUA 2FI1A 3JQEA 1VRCA 3NTLA 5AKLA 2HIMA 3OJ0A 1RWPA 4ZVRA 2V74B 2B2CA 4YO8A 2IEYA 3ZS9A 4ZGGA 4W1PA 1GTVA 5ER6A 2ISQA 4COKA 1NG1A 1M7BA 5TQ2A 2VL7A 2CJFA 2QOEA 2DWUA 1SKYB 4W82A 4EX6A 1GYRA 2Y27A 4R9NA 4JNCA 3MTJA 3BJRA 5FBVB 4PLFA 3N2LA 2JD2A 1R0KA 3UJPA 1YVEI 1RWQA 4HI0E 4AURA 2W2KB 3L0OA 1UP7A 1SXGA 1Q0LA 1Y9EA 4CDRA 4D6YA 3PNQA 2ZJ5A 4FIZA 5EP4A 2OXCA 4WVLA 1PVVA 2IYZA 3KQHA 4M2LA 2XD9A 3DJFA 1XKTA 1FP2A 3HL4A 4GZ6A 2RHGB 1Z45A 4NBSA 1RBZA 2PO7A 2NPFA 1JVBA 1LTQA 2QBYB 4RLFA 2PT5A 2YFQA 2OGWA 3CW2A 4MVJD 3VVLA 5A4AA 5C7OO 1H4TA 5EZ5A 3T7EA 3V8QA 3W4JA 1ANKA 1DHTA 3KYBA 1E8MA 2V5AA 4QBTA 4TXNA 2CCKA 5CNIA 1XPOA 2OHOA 1KMQA 2RMKA 3GRZA 4HQNA 4I66A 3GEEA 4QQRA 4Z5XA 1RIIA 4WZAA 1Z29A 2OWEA 1FP7A 2GF9A 2QX9A 1MTOA 3VUEA 1AZLA 2PSHA 3CZAA 3B1FA 3LVFO 4UCFA 2C4UA 1UC8A 2DQSA 2WSSD 3RE1A 3NBMA 3AJAA 3E2MA 4QTTB 5FH9A 1GG9A 4CMIB 4KRXA 5IF3A 3CLVA 1SOUA 1NOJA 4L7QA 1R6AA 1PKEA 1U7XA 2OAGA 3PDCA 4HUQA 2H5EA 4Y30A 3RNOA 4EYOA 5B3KA 3PEYA 4TV8B 1GFZA 5BV2P 5C5DA 5KMGB 1GL7A 4K46A 4HNVA 2HQSA 4BVBA 5FJJA 3L8HA 1CUIA 1G17A 3CJQA 4YP7A 1K2WA 3V7WA 2AJBA 3IUYA 1N7IA 4ARZA 1CUGA 2YWJA 3E35A 4OFBA 3BAFA 3HDQA 4ZODA 4Z51A 1VPTA 2QE7A 4YK7A 5L53A 4KE9A 2BIFA 3H11A 3K5PA 3SS9X 3OD5A 3RFVA 3C8HA 2HH9A 2XLBA 2NWQA 2A1TR 3N3BC 3SOPA 2DTDA 4FDAA 3RM3A 4LNAA 1OH5A 1QZ3A 4X3CA 4ZYXA 1GRCA 5K6RA 1NFRA 2C4VA 1B3RA 1D6JA 2GBLC 2OO5A 2P30A 1G8YA 4KLRA 4MS1A 3LSYA 2Q0QA 3UAZA 3LHIA 3VU3A 3X2FA 3O8RA 3JATB 3E2PA 1PQ4A 1DDGA 1XHFA 2A3RA 1JZTA 1H5QA 1PYOA 4I4TF 1E94E 4LVNA 2GGSA 1D6SA 1Y5LA 3EVAA 1RI4A 3JYLA 4MMXB 4OP3A 4E5KA 1K8RA 4AKGA 2VDMB 2G17A 1P33A 1X7ZA 4DA6A 3QXSA 2OY0A 1UJNA 3WMGA 4RVFA 3H5RA 1KERA 1MAUA 2BFWA 2PWAA 3HB5X 2DFKB 3Q11A 3EZ7A 4LXXA 4DJEC 5CIQA 3B70A 1TLTA 1RJ9A 1VSQA 2XMQA 5AKGA 3HVRA 3RVDA 3HFGA 3D64A 3SAJA 4OIMA 4MWSA 3JRWA 2IF0A 3NAGA 4TTVA 4OGGA 3K94A 4CQNA 1D2HA 2Z1DA 1JFSA 1RJFA 2XAUA 3TVDA 1Q6ZA 2NXJA 3NHYA 3PPYA 2VPIA 4L4RA 4LF6B 3DBRA 4JUDX 1WHSA 1JAYA 5TEVA 4NE2A 3A1UA 4H0CA 1WCYA 5CEEA 5KOIA 1RYZA 2N75A 4ZU1X 2WKWA 8LDHA 1FYXA 2J4FA 3A10A 3P5BA 3K53A 3K9BA 1KMIY 3NNDA 4EYEA 5MN4A 2EZTA 3ELBA 1K86A 2AMJA 5CNMA 2Q2VA 4BFLA 5HW0A 1OIWA 1U5BB 2F67A 1JA9A 4XM1A 2YHBA 3NI2A 4EMUA 2UV8A 4CIAA 3WSWA 3ZDZB 2JJ2A 2DUMA 4YUAA 1VIMA 5LBIA 1N4AA 1P2VA 2ON6A 2AI3A 4TUYA 4MLPA 1U7HA 4YALA 1JFLA 3HB0A 1M1NB 1BDBA 2D4AA 4RY8A 4L9RA 3VNBA 3B20A 1CBUA 1G3MA 2H7XA 3FB1A 4PC6A 1J09A 1R4NA 3QGMA 3A4TA 4DCMA 2P8JA 1D2AA 4IDHA 4D99A 2XVYA 1DKMA 1DX4A 2QRGA 5F7ZA 3LTEA 3TB6A 3TFWA 3V8VA 2HU7A 1GG2A 4JXKA 4R1OA 2I6FA 1JHYA 5THQA 4MHSA 1ENZA 3M5WA 1ZONA 4N7JA 4Q02A 2PMCA 3VQTA 2X8BA 1K0UA 2MINA 3TCXB 3JASA 4MR9B 4OH7A 4GDMA 1Z15A 3OE5A 3N53A 2VTVA 1C30B 1FYFA 1U3GA 3K7EA 4GMFA 4MW0A 5ALQA 4BEVA 4NULA 1ADJA 1YNSA 3RSLA 1LTHR 4PLCA 1WP9A 4JLAA 1W5AA 1YV9A 4YMUA 4EW6A 4GWKA 2BY4A 2WMYA 4M9RA 4UAGA 4FWTA 2GB4A 4FDTA 2X5OA 2CLFB 2XMSA 4TXLA 2QL9A 1EWYA 1DAPA 2HIHA 2EX1A 5LBTA 1YVPA 4B2PA 3JTMA 5INTA 1IY1A 3NHSA 3KM0A 1EG7A 3ODPA 4NYIR 2CVZA 1DTEA 4HDSB 1ORRA 2G4VA 4OQEA 3ROPA 2I55A 2C9MA 1IXRC 5B6IA 3CUSA 3M5DA 2ZANA 1UJBA 4UUQA 2JAQA 4YJ2B 2XT6A 1QQTA 2WT9A 1E7YA 1USUA 2DH5A 4WFIA 1NQTA 4X97A 1HETA 1NRJB 3QH4A 5CCDA 4Q1VA 1L7BA 2IW3A 3M6WA 3V3TA 3HDJA 1G0NA 3G9UA 4BGVA 3RYIB 2RIRA 5D5QA 4QKQA 1PKXA 2Q3CA 3U4HA 3I01A 5ECGC 1RQXA 5IC6A 3TI7A 1ZQ1A 1G4HA 2PT7A 3D5TA 3PXBA 4DF3A 1M9NA 4EG1A 1UC4B 3SZMA 1DDOA 3OLYA 3I5UA 3OU6A 2Q41A 1TPYA 2QJTA 1JHVA 3ICOA 1IHDA 1HM5A 1I51A 3TTYA 3AKDA 4DCPA 5EZ6B 2PCJA 4LBWA 5E4FA 1EPUA 2OHFA 2OYRA 2XNKA 1HYBA 2BGKA 3NVAA 3Q1KA 1ZOSA 2KM1A 1E2KA 2O20A 4Q7MB 1ZVKA 3EMVA 5CPBA 4B3JA 4OBEA 1A4UA 2WLTA 4QE3A 4H60A 1J25A 1WVMA 3EBPA 1N2SA 1PGOA 2HSDA 3A1FA 3A0RB 3HKCB 3D6HA 2WKSA 3UV3A 5JAZA 1VPVA 4FLMA 4YEDA 2EJCA 1GPWB 2LKDA 5G1NA 1T8UA 4KIFA 5D7NA 3ZQJA 1ZD9A 3WC4A 3DZCA 3SQOA 1D4FA 4PSDA 3WKAA 4PU0A 2HDHA 2A7QA 3VHRA 3ZCPA 4EFKA 4YV1A 5JSFA 1IQPA 4KGVA 5ALKA 1I3KA 1X7WA 1ULTA 4A6EA 4JH0A 2B1GA 1XDGA 3ZWBA 3TVYA 1G3UA 3ND8A 4DVGA 1RQNA 5LDDC 2QR3A 4UM7A 4ZOLF 1ISSA 4I7EA 4YREA 4E5DA 3ASYA 1ZN8A 2W4IA 1CFZA 2V9ZA 1SOWA 2FUG6 4GNRA 3BMNB 4PFKA 1MZVA 1XTQA 4RADA 4UHFA 1M2FA 3GH1A 1BD3A 3NXKA 4PHCA 3IEVA 3OU7A 3AR9A 1GPLA 2AV6A 1YVDA 3O82A 1CULC 2P90A 5ALLA 1HT2E 2XCLA 3A1CA 5IUNC 2G9ZA 4L0CA 2B3TA 3PLNA 4MGYR 4LHEA 2PGJA 2VT7A 2EJWA 2R86A 4D3YA 2F43A 3RVJA 1T5IA 1QONA 1B23P 4AKEA 1NMYA 1ZRSA 1NR1A 2O7SA 4RELA 1T4CB 1ZXLA 5IH7A 1J1UA 4G5GA 2GYWA 2A0XA 1FW8A 3ZV3A 1KP3A 2C8VA 2F00A 3PSAA 1VKHA 2JZCA 3Q4GA 3FYHA 5AW2A 1R0BA 2B35A 1W29A 5ALPA 1FP1D 2UVPB 3VVCA 1MX5A 4YROA 1U1CA 1UH5A 2A92A 2OGTA 2JIDA 2X1LA 3OQIB 4OQPA 4XYMA 3IQZA 3IAXA 4KKXB 5TQVA 4BKPA 4DLNA 2ZYWX 4AQDA 4C5AA 5D6OA 5DCYA 2B8TA 5DYIA 3K0HA 4CEIB 1A7KA 4XPIB 4EDFA 1JU3A 1KY2A 4IVNA 2E1PA 4F5DA 2H4HA 3IFSA 3EXEA 4NVRA 3GWGA 2DPMA 3ZHCA 4DQDA 1MX3A 4EYQA 5BSHA 2CCGA 3BWDD 5DDIP 5M5BA 4R7ZA 1PX0A 3MTQA 4ND3A 5EJ8A 1Z5GA 4CV3A 3T34A 3O4GA 4QYIB 4MR9A 4D9BA 1MPXA 1YDFA 1KH1A 1YBAA 4NV1A 2PD4A 5FWDA 4AWXA 2R00C 4WT7A 4LXUA 4TWBA 3H9GA 2GFQA 2Y92A 3CNOA 5EE9A 3TLGA 2FQQA 3E7XA 1E2EA 4Q01A 1U2RA 3KOWA 1ECLA 4YRIA 3KAKA 3DLHA 4NWIA 4WCFC 4QBHA 1PN3A 1UPCA 2DWOA 1CDDA 3GLGE 4N40A 3U3KA 1K7CA 1QIJA 2RHRA 4WLFA 1JKIA 4A8JB 1NT4A 2P4UA 3ND7A 2BKEA 4MK4A 2JEZA 5A5FA 1JKJB 2WLSA 4OSPA 3LLSA 4MICA 3DAFA 1VOTA 3C97A 1DG9A 3IAM6 1C8KA 4OXIA 4C7KA 2ZDHA 1GKIA 2V7QD 3P9QA 3CVXA 1ZD5A 3GUHA 2NTNA 3WIUA 5LN1A 4Q48A 2P2DA 2H31A 2Y0EA 4JXJA 4M3NA 4LKOA 4JUAA 2OE2A 5CVJA 2WSIA 3GFPA 3VR1A 4UAJA 1M1ZA 2EBWA 4BEJA 3W05A 2XR1A 4X90A 4Y67A 4PNEA 4CMAA 5AI9A 1IG0A 5JMPA 5LLTA 2XQIA 2IPOA 1GPH1 4XDHA 2VK1A 1IDOA 3F9IA 4F4IA 2CFOA 2IBMA 2JD0A 4PRYA 2JRLA 1FNMA 1VFPA 2A1UA 2I8LA 2ZPTX 3TTVA 1PJLA 4K1LA 5LSAA 1B0UA 1OI3A 1VRWA 3T5DA 2ZM5A 2XJ4A 3B9RA 4I1YA 5FBKA 1E3QA 3L0BA 3MJFA 4CCAA 4K8OA 3IXQA 4X44A 4QLOA 1Y3IA 2WG0A 4L8VA 1M2VB 2PLRA 2GRUA 3NRCA 1A9RA 2ZIVB 3NHMA 1YI8A 4G0VA 1JIXA 4UD2A 3L9WA 2YJ5A 3D4IA 2VRCD 1BGWA 3KTDA 4FKZA 1FSGA 1PV1A 1YZUA 1W87A 3AEKA 2G6TA 3B3QA 2A14A 4MRPA 5GZ6A 4BX0A 2G0TA 4PWYA 4FDMA 3TJMA 4DT1A 1PJ2A 4ER6A 3DUFB 2R1VA 1WU7A 1REQA 3CUKA 4MQFA 2AWNA 1SU7A 2PNFA 2QL7A 3ADKA 4P4NA 5ALDA 1MDBA 1VIDA 5HRAA 1NWCA 1W4CA 3CUTA 4RVGA 4DPLA 1K6EA 2CKDA 4KWIA 1KS2A 2CVHA 1US8B 3CUYA 3UTCA 4ZYUA 1T13A 5BN5A 5ALVA 1ZITA 3CE6A 2G8LA 3PFKA 4L76A 1E2JA 2R65A 1XMPA 1X7XA 4LRYA 4L9AA 1GTG1 3O95A 3PHCA 1VI6A 2VCHA 2P67A 3H2YA 3WYFA 5K05A 1QVAA 4BFWA 1YZGA 4XFKA 5LD2C 3CISA 1IOLA 1SHTX 3DBLB 3O1JC 4L9WA 4MUYA 4RGQA 4JB2A 1GSAA 1EWTA 2FU5C 1KDTA 2VXBA 4D4HA 5HK9A 1WQ3A 3IPRA 5AJZA 4HYQA 3ZGLA 1JU9A 1QB8A 3ESYA 2JAUA 1FP6A 3LSTA 3MAGA 3SKVA 3L07A 4DMGA 1R15A 2D2IA 2DX7A 3R1IA 4KE6A 3KTFA 1D9ZA 4MVJF 3S1SA 4IIEA 4NAUA 4BATA 3C3EA 5CVDA 3ZWAA 4CRWB 2NO0A 1QGUB 1YR9A 4TLDA 1H65A 3T1TA 1VYHA 2FP4B 1QUEA 2R7KA 2ZVDA 3PQFA 2WWYA 5C8YA 1AIPA 2WHPA 4DG5A 4F8YA 3EPPA 3M9WA 4DWWA 3RF7A 1MOZA 5AUNB 1E6MA 2B1RA 3CXUA 3GJTA 4EFDA 2F3QA 2ZTHA 1JHAA 3QUCA 4QEKA 4I1SA 2GBPA 1TQ4A 3QX7A 4LRQA 1H94A 2BFBB 3PX2A 5AESA 4NE9A 2J5RA 1F0PA 2WI8A 4MKFA 4E22A 3I62A 1H0KA 1XRMA 2A9VA 1YASA 4PG8A 2F8TA 1AF4A 3H1EA 1N8KA 3CO0S 3OURA 1LV7A 4G5SA 4LYEA 3AHDA 3JSXA 4R0NA 4LRTB 3FCAA 1YB7A 3L8MA 1QIIA 3PS9A 5JCPA 3ESQA 4M9ZA 3FH0A 3SLGA 1VG0B 4PG7A 4RSRA 1L5FA 4M0PA 2P9YA 2JAXA 2UUOA 4IQFA 2GCNA 5D86A 3X1MA 4E30A 1NJ6A 3SR4A 5COAA 3G0BA 2IW1A 4FYKA 4JYCA 4LX8A 4AJOA 1UK8A 3EK2A 1JSZA 1YWGO 2CJWA 4ROSA 3UHJA 1AKMA 3RSFA 2XA9A 1IQ0A 1CS0A 4IOMA 1ST3A 3T06B 4YAIA 1EBBA 1AV7A 4K9DA 2H1VA 3PC8C 4BMNA 1FXWA 2WJYA 1B4DA 1N5KA 1N2BA 1LPSA 4K26A 1U0OC 4LOIA 4KHZA 4II2A 3QKUA 1E1KA 1L5WA 3PWTA 3QUSA 5KTOA 5M7EA 4FI3C 1SB9A 3PJFA 3R4VA 4KBFA 4BBZA 4D44A 4DVJA 4ZJPA 4EH1A 5BNWA 1KI7A 1Y81A 5C1DA 2X15A 2ZSJA 5DWDA 3STWA 1UMBA 2JLSA 1KK1A 3WWCA 4PRLA 4D43A 4WZBE 2ID4A 1N2IA 1TKBA 4B34A 1QX3A 4HEQA 4LY9A 2XOKD 1OV4A 3CB2A 1FIUA 3LLCA 2C58A 5AUPB 1U28C 4Y2TA 2DPYA 2HRDA 3ZWWA 4US0R 1IM8A 5JDCA 2J7PD 5JEEA 3P27A 3RYTC 1IY0A 1X39A 1XU9A 4AKHA 5G0TA 1NJSA 4XJXA 5JY1A 2G0NA 1O9HA 1MB3A 4WK6A 1GADO 4RGBA 4J16A 4V24A 4CMGA 4DLBA 5HM6A 5JPCA 1GNRA 4MW9A 2AX3A 4PX9A 1L8AA 1P80A 2PSEA 5F73A 5LQAA 1CEXA 3E3MA 1G7SA 2JLBA 1KAOA 2YZGA 4R3WA 5KYYB 2P2LA 2ZB8A 2JF0A 3EOBI 4IUYA 3JZAA 2I1WA 4IY1A 1W76A 3ZZMA 2OFOA 1XF1A 2XV1A 3ANXA 3G7UA 2FRDC 5BUZA 4C1BA 4OJMX 3KAPA 4PZLA 4S1WA 1F8FA 2D1RA 4JVNA 1RIFA 1W9HA 2J6HA 1MA3A 3K1AA 4W1SA 4YFVA 5C7LO 3A2LA 4RPJA 3SHQA 2GEKA 3DDHA 1P62B 2G8NA 1F8GA 3GGPA 3L8DA 3PC3A 4FMBB 3AHIA 4IMRA 4KXVA 1PWYE 4I46A 5DEOA 4ZAVA 4J0JA 4CMJA 1QANA 1U2TA 1RYMA 1FTGA 4ARIA 1E62A 1YL7A 3PUJA 3FVTA 4OA8A 3RAJA 1FZQA 1VE5A 1Y5IA 4D3XA 5KC9A 1CQPA 2V3CC 2CXUA 4H4EA 4Z0TA 1N3BA 1YB2A 3KWFA 5SYNA 4IDQA 4TVSA 1W4AA 1G19A 4K9NA 5JNSA 3C41J 1WETA 4AKIA 1PZNA 2PRJA 3LL7A 3NHJA 3U9LA 3DL4A 1ZI6A 3SZLA 3PC6A 5EPEA 3PGLA 1W0KD 2Z98A 4KL8S 2HK8A 4WGGA 3CGGA 4OK3A 1FQKA 5IM5A 5ESDA 2QAGB 2QLNA 4LDPA 4UNQA 5FO1A 4E0BA 1ZVVA 2IUEA 5HF5A 3CE9A 2JIMA 5CLIA 1FC0A 1M3SA 4K9KA 4JY7A 4BNWA 2FEKA 1X7WB 2PWZA 4N0QA 4NFLA 4PF1A 4WX2B 5IUJC 1I2MA 4F86A 5D01A 4DRXA 2YMLA 1T43A 4BO4A 5AK4A 2MMGA 3K1ZA 3QKRA 2ZSHA 1EJ2A 1TU0A 1Y0BA 4LZLA 4PTLA 4B3CA 5KDLA 5HSGA 1NDUA 1XTZA 3GCDA 1AS3A 1WXEA 4BO7A 1UDRA 3A6EA 1SUEA 1ZGAA 3VPFA 2B2XA 3FSGA 4UQLA 5JADA 2YWFA 1EZZA 4FX2A 1ZXBA 1K88A 1SHKA 1XWWA 2Z2XA 1FUEA 1DIRA 2EWMA 2XMGA 2XQKA 5J5VA 4GZ5A 5JZSA 1R6UA 5ALIA 1GZ3A 3GLHA 3PB3A 4A8PA 2B3DA 5HQJA 4TWAA 1I13A 5KKAA 4C4AA 1E8NA 2WU1A 1ADGA 4PYNA 3PJDA 4QRHA 1E64A 3K6JA 1H3NA 1J8YF 3OTQA 5E7IA 5D1HA 2H1RA 3CPEA 2H52A 5B2ZA 4YRQA 1UODA 5J4LA 1WG8A 2J9YB 4A8JC 2CVQA 2DFDA 2AIRA 2FSSA 4KEAA 5TJ9A 1G8PA 2C77A 2AKEA 4RDCA 1ZUD1 2ZTLA 3GLQA 3RFTA 4FR2A 5LXTB 5FF9A 3NJ8A 3KUXA 4NPCA 3E9RA 3F67A 4OYHA 2GN2A 1P7PA 2Q5QA 3VNUA 4Z3DA 5JSZB 1NQWA 1PV4A 4Z1MD 1EUCB 2NN3C 2LKCA 1G6HA 3O3OB 1Z3IX 3NWEA 1PFYA 3PR2B 3R3XA 2VAXA 1JE1A 3GPBA 4CFSA 3EZFA 1SU4A 4YPOA 1L3BA 3FNGA 3IQFA 5A3RA 2NZWA 4D98A 3D6UA 4QWWA 1QE5A 1TU4A 1EWRA 2PA3A 3A27A 3AM3A 3QX8A 4HDMA 1BYUA 1QS0A 1BXZA 5B4VA 5JS6A 2JIRA 3KQKA 1Y42X 3WAKA 4BV2A 5I51A 2BDEA 3KKLA 4HNTA 3VR6A 1YQ9A 2IQIA 4X20B 4KJXA 5J4YA 4KBYA 3L4SO 3P9ZA 3CWQA 4WCFB 1RKQA 1DKOA 1YKFA 1G16A 1GTSA 2Y1CA 1EUDB 1KAMA 4XYEA 2IWHA 1CSEE 1Z5ZA 3THYA 4CLDA 3A06A 1A9XB 2H1CA 4E08A 4RHYA 4C5BA 3EB9A 5KOJB 4KR6A 2EKBA 1SZPA 2PX0A 5LYJB 2V96A 1X7GA 3GLIA 2YVKA 3PFBA 5H16A 1QG2A 2CLMB 4ACBA 4Z2YA 3W8EA 3C6KA 3IIMA 1ZUNB 3H83A 1HZZC 1GCUA 3B60A 3IP1A 4CTJA 5EXDA 3DHYA 1CUAA 3VHXA 2RDMA 5AJWA 1IHPA 1CQJB 1SCJA 2IRWA 4JQCA 4CXMA 3AIMA 4P34A 2NYUA 2R25B 3ZKWB 1DEKA 2F2TA 3PCXA 1GPAA 4CFYA 1JILA 2EAUA 1GHTA 1AXEA 4LY6A 4ARVA 2HWKA 3L1UA 1TT7A 4LY0A 2GN9A 2PFGA 3NBQA 1PD1A 4A0SA 2GD1O 5EIBC 1KYYA 4IJKA 1KI3A 2Z5FA 4OSOA 3C2QA 1R88A 3QBTA 4EYGA 2KJQA 1VPWA 2EJUA 2FX2A 3HDTA 2QD4A 3NIDB 4M55A 3AP1A 2ORYA 5E38A 1YL6A 4KG7A 4Z1OA 5HQTA 1GUBA 4C20A 1C9DB 1EFPA 2A30A 2XXJA 1CQWA 1ZIPA 2GPTA 3B1XA 1P1BA 2P4SA 2NIPA 2J5XA 1RKVA 4RLHA 4J3FA 2Q0HA 1TQ2A 5LLSA 4RTPA 5ITSA 1A5SB 1PJRA 1P2SA 1P74A 4MEBA 3GNTA 3KETA 1I3OA 1UBCA 1RVV1 3AQ4A 4IJWA 1BHO1 4H6PA 3HB4X 5DWVA 5C1IA 1OH8A 4I1OA 1XROA 4B80A 2YWCA 4IDNA 2REOA 1ZINA 3VZSA 1I7DA 3FUVA 1FVFA 5BQPA 3U3MA 1DKUA 4UMVA 5CIYA 5E2IA 3OCWA 2BFEB 3SNKA 4DLZA 1Q7BA 2BONA 5HOEA 3GP3A 3IOEA 1JQ3A 4HLCA 2FSIA 2XCUA 3D7RA 3DT9A 1ST2A 5KX5B 4C4XA 4XVHA 4WJKB 4XQEA 2I3ZA 4RV4A 1EJBA 5CYGA 3VA7A 3K9GA 4MVJM 3CNBA 5GADl 4ZXFA 1KMCA 2WV9A 3CY6A 4Y8VA 4O4HF 4AF6A 3DE1X 4F11A 1ZAKA 2JVIA 3RHTA 3IOCA 4NNJA 4KXWA 3W1WA 4AJEA 1LTKA 1NW8A 4BP3A 2D6FA 3LQ2A 4MWTA 1XQ6A 1EE1A 1ZL2A 2GVZC 3BSFA 3G0DA 1D1TA 1PTKA 3GFTA 3OQ6A 1T9GS 2FGKA 3IULA 2GN0A 3OLCX 4QFCA 4YJ2A 1QC5A 1T2VA 2A78A 4MRAA 2IKSA 2Y9PB 2NUAB 1MJHA 1UJCA 2WJVA 3INNA 4LXHA 4NZPA 4ZALA 1EX7A 5HG0A 3U39A 1KI6B 2GM4A 3FTNA 1LDMA 1V9CA 5JSKA 1E6EA 2VT6A 2FVXA 2J30A 2I3AA 3IQGX 3THOA 9GPBA 2LBPA 1IMOA 2CCJA 2ZEJA 2FOLA 1ZJ5A 2FPKA 5IVDA 1KXZA 1P7YA 4C4PA 3UENA 4S0ZA 3C7AA 3G8YA 3I9V1 3M6VA 3V42A 1QG0A 3FVWA 3NM5A 3MJVA 2XGJA 3FTFA 5FDFA 1JI3A 1LNZA 1RWBA 3LQ4A 5HKAA 1OI4A 1Y5MA 4MA5A 4IIJA 2YV3A 3IE2A 3M3PA 2OUKA 2YJGA 1Z4JA 3KOMA 2VRNA 4C4OA 1G6OA 4U0JA 1VLLA 1KDRA 1DC6A 1MO2A 4G2NA 1DWOA 4N5IX 2KQUA 3NYIA 3I73A 3V48A 4D2IA 2FKAA 2LRHA 3H16A 5FNZA 4MQEB 5GJVC 1ORDA 4UNNA 2IHVA 2OCGA 2R87A 3MTIA 4CCWA 4ESHA 4ROTA 1XZCA 1UBGA 3DGFC 2FX5A 3KR1A 1G66A 1A3CA 2I2FA 5JDIA 3L0ZA 5HMLA 3ZTWA 1O03A 2AFVA 1M8PA 2PMWB 1E7WA 2ODEA 2VNHA 1ZICA 4WCDA 4DLLA 1U8FO 5K09A 1NV8A 3NT2A 4FYYA 1KDOA 3H9BA 2CYCA 5DK4A 1LPPA 3P2IA 1AZTA 3FUWA 4JLOA 5FLKA 4BFTA 2WV7A 4AJPA 2BP7A 3BTVA 2IDJA 4P0PB 1WTCA 3OI7A 5J2UF 4QELA 4RZUA 1DRJA 2DR0A 5B7PA 2BWJA 5TGDA 3BPSA 3IR5A 2G71A 4QULA 5KPDA 1NVXQ 2ZQZA 3G6WA 3AERB 4K28A 1KK2A 2ENUA 1QPBA 4G9GA 4CUJA 3K5HA 3O73A 3VYRB 4GR5A 4MP8A 1O9GA 5I7RA 1P6QA 1YRYE 2PH7A 1Q0HA 3MSXA 3AM1A 1RCUA 3WNDA 2ZYRA 3QXJA 3REQB 4B17A 4FEGA 3JD1A 2ECKA 2D1SA 3NX4A 2NO7A 4JJGA 1JFFA 1J0AA 1DHRA 1P4GA 4FS3A 3DS8A 2IIVA 4G4GA 1XRSB 2GF0A 3DEJA 2ESRA 4WKNA 4GOND 3TPCA 2LDBA 1M6WA 2W6ZA 2XQFA 3JD0A 1TADA 3O26A 5B53A 5NULA 5KYWB 4P3XA 3GT7A 4Q34A 1W581 1A2BA 4N4AA 4RXTA 2RK4A 5IDXA 4LWPA 3PLRA 4POAA 1JG1A 2E4ZA 4BVFA 1KVUA 5EXTA 2I2DA 1OGJA 2Y6VA 1PUJA 4UOQA 4XPIA 3M4XA 4WWHA 4EUKA 4CKCB 2E1RA 5KREA 2Y1EA 1JQLB 3COPA 2VHUA 4DQLA 1YUMA 4WVFA 2PUHA 3SJ7A 4M1EA 4ZT3A 3UGJA 1Y4SA 1BE6A 1I94B 3HKEA 2NV6A 3TKAA 3MS2A 3WE7A 3Q3JB 3QEAZ 3HR4A 5IP5A 3GEGA 1Z6YA 3ESDA 3WISA 3C1OA 4J3JA 1RZRD 1GVNB 4IFIA 5ICSA 1DIBA 1SC9A 3DXXA 2BE9A 3OT1B 4CU2A 5BR4A 4IYRA 1EFCA 3SIXA 2XGOA 1ESCA 4KNYA 5ALUA 3UOGA 3D3QA 4YRCA 3TXAA 1KZHA 4PTZA 4NK5A 2WD9A 3AUXA 3RU2A 3JWPA 4DC1A 2B8EA 2HCBA 2I80A 3N2GA 2HR1A 5KYKA 1ADYA 3JD2A 1RE0A 4G6ZA 3KC2A 2VNAA 2NXNA 2XF2A 1QM5A 1U02A 4Y2RA 3GUCA 1ID8A 4KLZA 3FPSA 4IOLA 1O96B 4DIMA 2FF5A 4CCYA 3IOYA 2CHFA 3NOVA 1A9TA 3BL5A 4F8JA 1W2WB 3LH5A 4JC8A 5DMXA 1TMYA 3TECE 3M4YA 5J3JA 3RS5A 2VPWA 3D6NB 1KIAA 3PXUA 2Z2ZA 2C9YA 2NUTB 3CT4A 3GFQA 1E2LA 1RM4A 2RHHA 3A4LA 4X63A 5FORA 4B45A 5H3LA 1GA4A 1RJ9B 2QBYA 3RHSA 1AKEA 5HIMA 4BX9A 4MV6A 1MABB 4TLAA 3OUTA 2OG1A 4A2CA 1ZISA 1XUOA 4HZGA 1QYIA 4QL3A 2V8BA 4POOA 1YNOA 4Q3LA 3VSEA 1AQJA 5EQJB 5FWAA 4NS4A 4MUGA 3W3AA 3SZ3A 3FY4A 2Q3DA 1HX7A 3C3XA 3EZ6A 4IDOA 5FBLB 1R4MA 5BQOA 3P2OA 5HFAA 5FOWA 1SUWA 1F4PA 2E5WA 1ABEA 2VPXA 2W2NA 2Y93A 3FAKA 3JQ9C 2Z5LA 1T5LA 2I8AA 3P9IA 3QF7A 4PYKA 4XDZA 2J5BA 5DHAA 2CBXA 1XZJA 5A4IS 3P9RA 3IKLA 1IN7A 3KFVA 4LF4B 1KFEB 1XQXA 2B37A 3C8UA 1R4ZA 3QELA 3JVUA 1LPMA 3BXXA 4J7AA 3ABRB 1NVFA 5JECA 4QXMA 1SHLA 3AEKB 4WOCA 2YN4A 2XWQA 3SXUA 1NBMA 2IYSA 3UEOA 1RKUA 1GQSA 1M1NA 1F3OA 2J32A 2PFSA 1FYVA 1N5MA 1MA0A 2WNIA 4GRAA 2H8KA 2CB0A 2IOFA 2V3VA 3KV3O 3TMKA 3VGJA 3WMXA 3F3MA 1YR6A 2JK0A 3KR9A 1HQKA 4EG4A 5KWSA 5IEJA 1OI2A 3D43A 1QAOA 1JXOA 1BWRA 1J8QA 1Z2AA 1Z34A 3CV3A 3FHLA 1US8A 4IW3B 2ALJA 5D85A 5CNKA 4I1IA 4LDRA 3RARA 4B6OA 5EJ7A 5DSTA 4H7DA 1A4XA 1M2GA 3KJXA 3TEMA 1M1XB 3HI6A 3PC8A 2GF2A 4NARA 3TW0A 1FSPA 2DCUA 1HLDA 1LLFA 4N6OA 2QORA 1D0VA 2CMKA 3V9PA 4Q1AA 4DEXA 3C3PA 1LGYA 3ML1A 2HX1A 2R1ZA 4JBLA 1EX9A 1KHTA 1G2PA 4ZTZB 2R6R1 5TSDA 3SC4A 4TPKA 3I9MA 4UBIA 5EIWA 4PN7A 2GBIA 5NLLA 3MAJA 2E0IA 5FLEX 1TCUA 2OFWA 1JBKA 3AUSA 4ECEA 5AKZA 2GPYA 4NENA 2R44A 4PINA 4DTCA 1JH9A 1IY9A 3H8WA 3QKIA 4O8CA 4JENA 3CF0A 4GMDA 4WEQA 1MT0A 3KQOA 5CR9A 5JD6A 4NI5A 3JAWA 5E1BA 1SU8A 2YUIA 3DM9B 1N1DA 2X0KA 3TG8A 3UBMA 3TJRA 3PRYA 4ZN6A 4HATA 1Y89A 2ZR0A 3GCWA 2C82A 2WF9A 5D5PA 4RF5A 2OM6A 2RJOA 2XA1A 1NJ1A 1V8ZA 3D6JA 4JYMA 3S4YA 3MB8A 4MWGA 2WVHA 1E6UA 4ARUA 2XMRA 3FRIA 4G4SO 4FFVA 2ECOA 4ZZIA 1QYDA 2F9FA 1IEWA 4W7HA 1EXNA 4WADA 1MO6A 5CT4A 5H4HA 3RC9A 2BDTA 4XKJA 1O89A 4K6OA 3TQTA 4EL5A 1IYZA 4ZGBA 1ESMA 4HV4A 4OX9Y 3LVBA 1MORA 2BM9A 1WVIA 4KN9S 3EXEB 1W36D 1C7QA 1DE0A 2DBRA 3D8SA 3L6OO 3PYXA 3OX4A 3AZOA 4ID9A 4NYMR 3ZLVA 3DVAA 4HTAA 4Q05A 1D5CA 2G83A 4F2HA 1RPZA 2D8MA 2IYPA 4FI3F 1NBHA 4UBLA 4NMLA 5ILGA 1KDPA 4NMWA 5AVZA 1J97A 2RHOA 4TS1A 3ZWXA 2W2XA 4LI3X 1B8VA 3LUKA 3ADDA 2ZZNA 2IT1A 3HJFA 3NCTA 5I7HA 4CKYA 1ZGBA 4R40A 1U2ZA 1GARA 2J3MA 1FXSA 4WXHA 3CB4A 3TL3A 3DC2A 4INJA 2UZAA 3NAMA 4H2DA 1TVCA 4KC0A 4U1RA 1MT3A 3ZZ0A 4DREA 4RDXA 3UJNA 2HFKA 3KPJA 1JEYB 1XTBA 2AI2A 4DQVA 1EK0A 5IJ0B 2LCIA 4J94A 1AQUA 2CLEB 4RVCA 4YVFA 1C4KA 4EKEA 2DERA 3F7MA 2GK4A 1JR3D 4YQYA 5JZBA 1SQSA 3DCNA 3I32A 3L84A 4LV6A 3B1WA 3LZCA 4HRVA 1J1IA 1EG2A 5KNCA 3ANYB 2VUIB 1RM0A 2HADA 3D3JA 4LF9B 5I7FA 3KEQA 2L18A 2OHXA 4UHEA 3TQFA 1NBWB 4Q6WA 5TPWB 1Q1ZA 7ABPA 1I3MA 1A5AB 3AOEA 4EI7A 2BI4A 2FA9A 1FDRA 2A88A 3L0SA 1MFZA 2YQ5A 1N2CE 4HFMA 3GJZA 4LHZA 4PAQA 1KI8A 1KTVA 1WPQA 2KYRA 2ZK7A 4I1VA 3CPJB 3JSAA 2E85A 9LDTA 1W1UA 4AY4A 4XUEA 5BT9A 4EYKA 1V1JA 2JIQA 3K9NA 5MN6A 4FD3A 1BU8A 4PAWA 4BTLA 5LM3A 2QN7A 1Y1RA 1BD4A 1H6AA 5EE3A 5JLAA 3ED5A 3GYBA 3DZDA 3THRA 5DBGA 3AHFA 3EQZA 3DM5A 3O8LA 3ZWKA 2M6SA 3ENKA 5G0WA 1U99A 2J3IA 1ZM4A 3DLTA 4MQ6A 1XMSA 2JIZD 1QYRA 3AR6A 4KQCA 1YR8A 1Z6AA 3H5WA 1UBFA 2NNLD 1G5HA 2ZBDA 4LV8B 2BZ0A 4TWJA 3F73A 2OV8A 2IU3A 2X8WA 3GAFA 3LPDA 3PK0A 3ZCSA 3ANLA 3KZMA 3OEEA 4N5NA 3CWZA 5DBHX 4G09A 2EJVA 2H11A 4J90A 3GQVA 3LRPA 4B32A 2IZ1A 3RREA 4GM1A 6PFKA 3K0EA 4ERXA 4NZNA 2ZT6A 4TV8A 1VSBA 1JHPA 3C7KA 4Q5IA 5DF1A 4TV9A 1MVOA 1NW5A 2HBYA 4M1WA 4LJ9A 3D3EA 4TKUB 3TTUA 2YQZA 1GGMA 2Z9BA 3IHTA 1GGHA 2VP9A 5LDGA 5JRDS 1VSVA 3PT9A 3M9XA 1S9HA 4MV1A 4L6CA 3V32A 4E4YA 4BRUA 5BNZA 3HJHA 4UBOA 4CLOB 4DLPA 5CD1A 4M49A 1CUEA 2E6UX 2FW0A 3LS2A 4JK3A 1JLKA 2FUKA 4WY8A 1MB4A 2RBGA 4QXQA 4Q16A 1WHTB 2I62A 4B3SB 1G7TA 3PITA 2ZBUA 1J0BA 5ALSA 1VB3A 2HEGA 3I6IA 1M2EA 2QD5A 4UHHA 4R69A 1Q0SA 4BGIA 4OUKX 5ALMA 4A2QA 3H6HA 4E1BA 4ZIRA 3B51X 4RA6A 5A4FS 5AW3A 4RTRA 2FCAA 1EUYA 3FF4A 4K9SA 4N3BA 3PF9A 4Q4HA 3LCUA 4YQZA 1SQ0A 1BXRA 3KKPA 2Z3VA 4FCCA 4WEOA 2G28A 3TMYA 4C0QC 2P4EA 5A62A 2Q0XA 2WF7A 4RH1A 4DBVO 1LSOA 3QLJA 5AK0A 4LRSB 3ROMA 4FNOA 2A0KA 4BXOB 3KL4A 4DMUB 4NABA 1NP3A 3H4IA 1JQEA 2ODAA 5HCNA 3NGLA 1QO9A 1JR4A 1BEEA 2QTZA 4ZRNA 2OHJA 4MS3B 1XJWA 1NATA 1GZ4A 1DJQA 1HG0A 5GM2A 2O8DA 3O21A 1KSJA 5CT5A 3QU5A 5LQUA 1ONOA 3TKYA 3VJRA 2Q1UA 5AVOA 5A05A 3NYQA 1E3WA 2Z9CA 1J24A 4UDNA 3U3XA 1E9DA 4IOKA 4MMZB 4N5DA 2DU8A 5A5GA 4FONA 1ZOPA 4Q6BA 4R2LA 1V1MB 3FDXA 2RH9B 1Z5WA 3UAGA 4QXPA 1MU0A 2GAJA 2A9FA 2F1OA 1JQBA 2VJOA 3VH4A 2HO5A 4DAEA 1A7AA 2YW9A 2GZ2A 3DG9A 1NPYA 2JFFA 4C89A 1P7WA 4IZ6A 1EM8A 2J4DA 3ELDA 5AYVA 3ZW8A 2J6BA 1QKIA 1X19A 1O94C 2FW7A 3BTUA 3E84A 3U9TA 3UXHA 3IERA 2HMWA 3HCNA 4Z8YA 4G5QA 2Q1XA 3QFTA 1C1XA 3PNYA 3IIIA 3BGOS 1N2ZA 2QVYX 1L1QA 4RZ3A 4W9RA 3WP0A 5LP6F 1QQBA 1VBFA 2G6BA 5CM2Z 2Q1WA 3LAWA 4LPKA 2XB8A 4I0WB 3WLSA 2GNAA 3MB5A 3WQBA 4YRTA 3JASB 1B14A 1FLVA 1I30A 1M66A 4UXIA 2FZWA 4GI7A 4MEJA 5IWAB 4QPZA 1R5JA 2GN1A 2X8LA 4H6XA 1P9LA 2CWWA 3GK3A 3G59A 4JX8A 3DMTA 2RBKA 4W99A 4C01A 4BVJA 1HNNA 1M7GA 3L4EA 4HB2A 2IA5A 2ERXA 4IG4A 1PVDA 5I8ZA 2C61A 4JFAA 1RKXA 1Q6YA 2GZMA 2WFLA 2NAPA 3VDNB 4RSGA 3W78A 1E5LA 1HTWA 4U2DA 4A7PA 2WIAA 1OVGA 4YRLA 4RHUA 4OMCA 2A57A 2NO1A 2YYZA 3GEIA 1O8BA 4DDVA 5T3YA 2DHEA 2R96A 3JQ7B 2JARA 2VWQA 3GFFA 3OTWA 3MQ4A 5FPTA 2BTEA 1ABBA 4EIWA 3DQQA 3GLTA 5JRJA 5IAEA 4YMLA 1TM2A 1CJUC 3A6KA 3GGDA 1DQNA 3QXHA 1Z37A 4OAPA 3NYRA 4IAOA 4PIVA 3KVYA 4DKXA 1W8DA 1KIMA 2EERA 6AT1A 5KYXB 3RYIA 3RC8A 2JGEA 3TOXA 4X60A 1M75A 1TKRA 4FE7A 4E33A 4PN3A 5CCXA 3BTSA 1PWZA 3DFZA 2B8NA 5J40A 3V1TC 5KC8A 3ZJTA 1AX9A 3HBAA 1KETA 2ZJ3A 4B3HA 4FFRA 1ODCA 2HTEA 3ORYA 2ONJA 5AKJA 2GLTA 2P9TA 2O23A 3OPXA 2V7BA 4J0FA 1DZ3A 3PT5A 1ZSVA 1D2NA 2FF7A 5JMTA 1ACJA 1FB5A 1PJCA 1FQWA 1O95D 2XWBF 4TT8A 3BULA 5KCMA 3BXPA 3CLUD 2AN1A 2G09A 4PPNA 2NZJA 3DOHA 3AF2A 3SM9A 5BSTA 4XOIA 2C3OA 2KWIA 3BORA 3KNZA 3W6ZA 3ZE9A 2E55A 2FMFA 1TZKA 1UF9A 2J6IA 4LHXA 5T41A 4PYJA 3O38A 4RESA 2JVKA 3VU0A 3WRVA 4EQ6A 1JR3A 4WLVA 1QUFA 1IAQA 5EZSA 2PLFA 3LGAA 3W9SA 4EHKA 1ZZEA 5IM4F 3GJSA 3RJ5A 3A9VA 3EZYA 1K63A 2ZI3A 3BIOA 1ISJA 1JIKA 1F4VA 1FVXA 3HU1A 3MWDA 2BMAA 4M9UA 4AG3A 3F71A 1UPUA 3W6UA 1B8OA 2B1QA 3ENZA 3WBFA 1JE0A 2LVBA 3DAOA 4NU5A 3KLPX 3SEAA 5AXBA 1U4OA 4BAGA 3SR0A 4KGDA 4OJTA 1GILA 4ABTA 4M0CA 5KSWB 2J3KA 1M0WA 2VKTA 4MB2A 3SF0A 4E14A 4ED9A 5IHPA 4FOOA 4LSGA 2ZUWA 3OCXA 5CFZA 4U00A 3DKRA 5A3JA 1Y1TA 1RAEA 3I5AA 4FFOA 3MTBA 4MR8A 1AB6A 3VKUA 4YECA 3DMGA 4EHHA 3W7VA 1NN0A 1YONA 1GRNA 1NBEA 4UW9A 3T1NA 3NBXX 1XP5A 2EP8A 3BMQA 3EE6A 4YLYA 4E5YA 1CPYA 1TMKA 1Z4LA 4FFWA 1K1EA 5E6SB 5E4TA 2ZPUA 4Q7QA 5LQKA 4G0UA 3NWBA 1HYEA 1ATZA 4OB7A 1A98A 1AK1A 3NHLA 3ZZUA 2R2GA 4QSHA 1VCOA 1UPTA 4KDCA 4GDFA 2XTNA 5AKIA 2TMYA 5ITZB 5E9QA 1P81A 5KQLA 1LPAB 1YBMA 4ENQA 3EOZA 5ALTA 1NFFA 3ILYA 4IO0A 4A26A 2XUGA 1PBNA 1UP4A 3KD2A 3QTTA 4GWGA 3CZ4A 1LJUA 3ZUGA 1DBQA 1V5WA 1GJRA 3E22B 4MUNA 4WASA 4XQ9A 4H3KB 1UFQA 5AW4A 2FSUA 3IMEA 4NDZA 4C0JA 4BQEA 2OORC 2Q2NA 3DO6A 4RMHA 3Q8LA 1F6WA 4O4HB 1SD1A 1WF6A 3RIGA 3TAUA 1UIRA 1XAIA 3DT8A 3INYA 4OQZA 1C4XA 1ZNXA 2QU7A 4PANA 1M6YA 1SPBS 2HOQA 2MYUA 1K5GA 4TXJA 3PLAE 4NZOA 4DNXA 2D59A 3FZEA 4BZXA 2QJWA 4AICA 3RSQA 4KTTE 4EB6A 2X1MA 3MK31 2JIOA 3TR5A 3B3GA 5GV8A 4J6EA 4HT3B 5H9WA 1KDYA 1VPLA 4ZCMA 1SCDA 2I3DA 1MC4A 3B1JA 2XCSB 4G63A 1WKCA 4WKCA 4B87A 1OA0A 2HPAA 2QUZA 3IJRA 2PZEA 5K3BA 3BTOA 4JDPA 2XHZA 2R3SA 3QI2A 1PE0A 2VNSA 3HSSA 3L7YA 3GAZA 3M7IA 1E7RA 2ZJ2A 1YDWA 3ZIDA 1XMQB 1CR2A 1QGYA 4BLSA 3AESB 4U2GA 1KVQA 2FP3A 4ZT6A 5BOSA 1JG3A 1UT5A 4AG6A 2I2XB 3TQCA 2IYNA 1PG2A 3QFRA 1O54A 1XN4A 3VR3D 3NUZA 2ILVA 3NWPA 3OZGA 1PJ3A 3B6EA 4Q3OA 3Q5DA 3D6VA 4O2BA 1K6MA 1PW5A 1HO3A 2QRHA 3MCVA 3UWOA 2IK8A 3SDZA 4MAMA 4KMSA 1T1GA 3EQ7A 5FP0A 3DE3X 1DMRA 2B4AA 1XTIA 1B43A 2GEUA 2Q5CA 2ZITA 3QYJA 4PG5A 1J2UA 3ZC3A 4R1PA 5EZQA 1QU2A 5GWXA 1FTWA 2Y0BA 4ZDKA 4DYDA 1A8PA 5U4QA 1CJBA 1X15A 3W34A 5F4ZA 3WADA 1X1DA 3KSZO 1QYCA 5JXJA 3K20A 1WMAA 3D3WA 2EFHB 5C52B 2IEIA 4LDNA 1NF2A 4NYMQ 3PKJA 1BXGB 4MP3A 3UUGA 1UQTA 2I22A 5BN5B 1Z5PA 1U2DC 2WM2A 3DV0A 4FGZA 2NU8B 2IE0A 4J4TA 3UMFA 3JWHA 3LDHA 3N2NA 4REQA 4C0KA 2M98A 4MUKA 4Q9AA 5I45A 2FRXA 3R8CA 4W5TA 3LCVB 5C5CA 1UBMS 1I6MA 1LC3A 3E3LA 3N8KA 3Q7PA 3QFHA 3W2FA 1S0UA 2Z2IA 1MG5A 4KQEA 4UE3S 2VQEB 4QM6A 4ZVQA 4Q3KA 5BNIA 3DUFA 1KJQA 4X3PA 5AJVB 4CIWA 1L8QA 3VUFA 2CDAA 4YBZA 3WQSB 4A16A 2A8YA 2B4YA 1QHFA 3A0UA 5H70A 4NE7A 1N1GA 1B8PA 4WDRA 2J85A 3A70A 1BQ4A 2D0PB 3P2KA 3Q7TA 4JWTA 4JOCA 4NBNA 1LJ8A 2AN9A 3VH2A 2PGXA 4ZI3A 1JFRA 1H85A 1OTXA 4KQJA 5JZVA 4OB8A 4GFDA 4KYUA 2XT9A 3TE6A 4ZVLA 4BNXA 4BLRA 3FOCA 4CMKA 1BEZA 1HFEL 2FY8A 4R2HA 1ZKMA 2V1XA 4N9WA 3C74A 2NUPA 4U7GA 1UXJA 5EUBA 3TEFA 5AIBA 2I4RA 1JDZA 2QN1A 1YBFA 5C1PA 4BIMA 4F4UA 4YP0A 3OLZA 1WXGA 2DBQA 2P7HA 3KLBA 4LA4A 3V1KA 1KQNA 2CMFA 1AGNA 3MT0A 3SXJA 5CLFA 1N6IA 4O4JF 3EWSA 1BXKA 5ALFA 5JCZA 4JI5B 4L85A 2FR8A 2QGZA 1DP4A 3R23A 4Q9DA 3FPKA 1A9ZA 2HSGA 1ZIDA 1GNPA 3FNIA 5LUBA 5SV2A 1V7PC 1QCCA 1B73A 1YJXA 1I14A 2FUNB 3L6UA 3TLEA 1JXQA 3F7NA 2H7VA 3BMQB 3U3OA 3VPAA 5JI3E 3KSBC 3PU6A 3U26A 4MULA 3P0RA 4B3GA 1ZFNA 2IY9A 1LRLA 3B7PA 5JJIA 3RYCB 1PX2A 2QYTA 3WKEA 4DLXA 5I6DA 1XZ8A 2Q4OA 2ZUVA 3SMQA 4BZWA 4P4LA 4EF4A 5ALGA 2XXBA 1LD3A 1BCSB 1EVEA 4KI7A 4OJYA 3RFUA 3SSAA 3TD2A 2ZSKA 4NECA 1T2EA 3FR8A 2HCRA 3NOXA 3OECA 1LDYA 3IUEA 4FT2A 5DGCA 3NHAA 3WB9A 4QU8A 4BLUA 4BO5A 5IXJA 2JI4A 4RK1A 3T3EA 1XZKA 3GD5A 5DBIA 4JELA 4ZAXA 4GIBA 4WW0A 1AK9A 2OILA 5J58A 2BCEA 1NUTA 2CVFA 3DBHA 3JQAB 1X1SA 1TMGE 5BR7A 4FGLA 2OHGA 1JBQA 1OLXA 3KWLA 5DHUA 4GR4A 2WSMA 4LDJA 4CTOA 2V7QA 4MVWA 1K5HA 3FUTA 4RACA 3NTVA 3MWFA 1IFXA 5H68A 4K9QA 3T7SA 3HWX1 3RSOA 1F2UA 1U94A 3BXHA 3GEMA 1OCEA 4M6WA 5DT2A 2A5LA 3JQCA 3WFJA 1N2HA 5F2OA 4DLWA 3UK1A 3U7HB 4Q7KA 2XODA 3F74A 4MI3A 2WYIA 2ZR9A 1NDHA 1QVVA 1YF3A 4RF3A 2P5UA 4RQBA 1KAHA 3T5BA 1HQCA 5JXWA 2PRZA 3KUCA 2DSTA 4U5QA 5LR6A 1PQPA 2XIJA 1OI7A 3DWEX 2C78A 2QD2A 3FPJA 2C3PA 5CA1B 4XX1A 1R8QA 1IMJA 1NMSA 3WGGA 1XL0A 1YJCA 2FP4A 1WHSB 2VHZA 4CT5A 3UMMA 1P0MA 3RAEC 4H4DA 5D3QA 1R0LA 1F14A 2FPWA 1MXFA 4KO3S 2TECE 4FFDA 4G86A 2ATVA 5HCUA 5GZ1A 2YTZA 4NZ9A 1LUAA 4B84A 1O95C 1CT9A 4BBAA 1WABA 3JARB 4JA0A 5CFQA 2XZOA 4O08A 1A4IA 2OV3A 5DWQA 2X23A 3TYXA 1MQSA 2P69A 4NCNA 1QNLA 2O7QA 3ZVLA 5ITVA 2QVCA 1SD5A 2IP2A 3C6ZA 5TS2A 3ZJ5A 4QGSA 5CXUA 2HLDA 3RIMA 4N41A 4UUPA 4YQEA 5LIPA 5AK5A 4ESVA 5E2AA 2E89A 5K3FB 3HK2A 4Z4QA 4GOMD 1CERA 1GUZA 1I0ZA 2BF4A 1NSFA 2QXTA 1T1SA 3DSRA 4KR0A 4AMYA 4I5DA 4RUKA 1FLDA 4UTOA 1I24A 2VDJA 4RHTA 1ZK4A 2UZIR 2OSBA 2A0FA 4EY8A 1GM5A 2PKRA 4FNAA 2ZUSA 4TMZA 5TQ0B 2XBMA 3EVBA 4JWKA 3ZH9B 1REQB 3FNRA 3U7GA 4JLDA 2JPDA 2FZ5A 4HWGA 1I7SB 2G9QA 1Z38A 2XBUA 2AVDA 3QUBA 3AY6A 3MC1A 5CH5A 2AT1A 1Y34E 1Q50A 1NU8A 1G3RA 2BGNA 1VJRA 5FUYA 1XVAA 2PX8A 5FR1A 3U3RA 1R6VA 4IHQA 4JMLA 1W8IA 3IEMA 1FDOA 3HKCA 3OKPA 4AJLA 7MDHA 3PA8A 2DLCX 2CXNA 5CX4A 5GM1A 3S5JA 1IAVA 1CDOA 3DP7A 1ZM9A 2PUBA 3SVLA 5PGMA 1S01A 3EVEA 3M1YA 4G8BA 4MTCA 3TVTA 3N2GB 3E9YA 4I3GA 1VHDA 2BDUA 3FPLA 3LWZA 4EJ2A 2ZYSA 4S1OA 1TA4A 3URKA 4QDUA 3PE6A 5I7UA 4NQRA 1WPGA 1S9DA 1WDKA 1BVRA 3A32A 3WJAA 1NKVA 1ILWA 1E60A 4N6NA 1O2DA 1H8HD 1T0IA 1W0JD 2GPBA 4OATA 3SK0A 2B4RO 4CCYB 2Y67A 1KYWA 3W04A 821PA 2O8FA 1IJKA 3HUFA 1OMOA 3BYZA 4RAOA 1EFLA 3A9WA 4R8LA 5HFNA 3UPDA 5IJWA 3JAWB 3OG9A 4HGQA 1XU7A 4AWAA 1EI9A 5ENDA 4KJZA 2P2GA 1QZXA 2BBOA 2CL5A 4R6WA 4MCIA 4TVBA 3DAYA 5IBQA 3CRRA 5HE8A 5KHOC 1JLLB 5HJ5A 2GO1A 2Y8EA 3P19A 3CKMA 1ZO8A 2AEJA 3BGIA 1RHRA 1ZH4A 2W71A 1S89A 2AW5A 1TJNA 1UXIA 2RARA 4EWLA 4YPFA 4IIFA 1R0WA 3TI9A 3TUIC 1FU8A 1JPUA 2VYQA 5D2CA 3VC7A 5JH7A 1E0AA 1UL1X 1FK8A 3QJYA 1Q83A 3UB3A 3V8MA 2CD7A 3KB6A 4X6LA 3RI3A 4DMHA 1SCBA 2GJ4A 3GLRA 2QJRA 3T1YB 1Z63A 3LBYA 4AD8A 4PCLA 4X62B 2GARA 3OF2A 3UPUA 4CYMA 1AF7A 3FB4A 2Y1XA 5M3BA 3VPDA 1RM5A 4YJKA 4BLTA 2WWVD 2Y77A 4N1AA 3K35A 1S3GA 1RWKA 1WR8A 3TSYA 3PKIA 2B98A 1J2RA 2M32A 5H3HA 4ZQCB 3T38A 2WJ4A 3SBEA 4RPKA 2HQRA 1SKMA 2AG0A 4HH4A 4YMTA 1LLUA 4EGSA 4KN5A 3IQXA 4OPMA 1RLMA 3A9RA 4RS4A 4ZK2A 1N0IA 2QAGA 3HPRA 4E15A 2IYYA 1UK6A 2NVWA 1Y8QA 3KDAA 4O1MA 4ZCSA 1L4LA 1WB6A 5HFJA 1G59A 5COQA 4FHEA 4ZMBA 1E66A 2E37A 2JAOA 3KSMA 3W5VA 3KVOA 3QW2A 2JLRA 1L5QA 1EDDA 1QK4A 1K4KA 4QYIA 5AICA 5AM4A 5CB4A 1WZEA 2I03A 2HSJA 3V9AA 3M6IA 1RRKA 3B9BA 2VYCA 1WX1A 1KXJA 1GZHB 3F4KA 2BKVA 1FBTA 4Y9SA 1AO0A 1MKYA 3M1IA 2BKXA 2OTCA 2C1ZA 1JFTA 4N0EA 4X5OA 3GT0A 1G64A 1UR5A 1IBSA 4MP6A 5HF9A 4CIYA 2ZB4A 3SD7A 5I01A 3RRZA 3ZVMA 1URPA 4U7WA 3RTCA 5I7AA 3RTDA 5IDYA 1ISHA 1L4GA 5HIIA 4RAQA 4WZAB 1BCRB 1Z0IA 2BAGA 1B76A 3EDMA 4URZR 3ANNA 3OA0A 4GH5A 4X61A 4QOSA 3V8NA 4Q9KA 4AYTA 2C4KA 5ALWA 4ZVOA 3RABA 1VSTA 3QBEA 2IDMA 1GCOA 2PVSA 3S55A 1NY5A 3CR3C 2AE1A 2WTMA 3LDAA 1I5OA 2DQYA 1EFUA 5I7EA 2CXTA 1JGTA 1XXHE 3DQZA 4L4XA 5CDHA 1U0GA 4Y9RA 4G0ZA 4E1AA 1Q0RA 3HDGA 3OEHD 4UE2A 1DJLA 1JECA 4Y9UA 3UPTA 3DE0X 5GONF 4ND1A 4CR6A 4H59A 4YRRA 1SXHA 2DHQA 2AFIB 2RGEA 4HO1X 2QL6A 1RLIA 1YOVB 4RA9A 4KQFA 3ZU6A 1XZLA 5MN5A 2PD6A 3AL2A 5JVDB 2VPTA 1I4WA 1VHQA 1SVSA 3IUPA 4RLSA 4D42A 5KYWA 3CHYA 2WMOB