5HIAA

Human hypoxanthine-guanine phosphoribosyltransferase in complex with [3r,4r]-4-guanin-9-yl-3-((s)-2-hydroxy-2-phosphonoethyl)oxy-1-n-(phosphonopropionyl)pyrrolidine
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
202
Chain Sequence
TRSPGVVISDDEPGYDLDLFAIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLIKVIDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVAVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Plasmodium vivax Hypoxanthine-Guanine Phosphoribosyltransferase Inhibitors as Potential Antimalarial Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
total genus 71
structure length 202
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hiaA00
4JITA 2XBUA 4MB6A 5BQPA 5EUCA 1FSGA 1XZNA 2PS1A 4RQBA 1L1QA 4RHUA 2AEEA 4ZFNA 4KN6A 2C4KA 1I5EA 1A3CA 2E55A 1STOA 4QRIA 2GEBA 3MBIA 4LYYA 1D6NA 3OZGA 2JI4A 3EFHA 1PZMA 1ZN7A 4RADA 2HCRA 3QW4B 1ECCA 1UPFA 1V9SA 4P86A 2H07A 5ESWA 1XTTA 2JBHA 1QCDA 2EHJA 5HIAA 4JLSA 1IBSA 4RHXA 5HKLA 4PAWA 1XZ8A 1VSTA 1P4AA 4OHCA 1A4XA 4RACA 3S5JA 4Z1OA 4P80A 4F8EA 2P1ZA 4P83A 4RHTA 1DQNA 2VFAA 1R3UA 4LYGA 1DQPA 4RQAA 1BD4A 3GGCA 4P82A 1ECGA 4PFQA 1OROA 1ZN8A 1Y0BA 4RANA 4M0UA 2WNSA 4P84A 5ESXA 1AO0A 4LZOA 3HVUA 4WN3A 5BSKA 5E38A 1I14A 1HGXA 1YFZA 3MJDA 5BRNA 5JSQA 1P18A 1U9ZA 2IGBA 1GPH1 3KB8A 3DEZA 2JKYA 2YZKA 5KAMA 1U9YA 1W30A 2H08A 1DBRA 1QB7A 1MZVA 3LRTA 1G2QA 5JV5A 3N2LA 1ECFA 1QCCA 3OHPA 1G2PA 1NONA 1P17A 3GEPA 3OZFA 4WMLA 1I0IA 3LPNA 2H06A 1XTVA 5KAPA 3NAGA 5IPFA 5K51A 1VDMA 4P3KA 4IJQA 1TC1A 1JLSA 1HMPA 4LZAA 1ECBA 1I13A 3H83A 4FYMA 1BZYA 1QK5A 1Z7GA 1QB8A 1BD3A 3ACCA 1DKRA 4QYIB 4QYIA 1A97A 4M0PA 3ACDA 4RAQA 3DMPA 1O57A 1P19A 4RABA 4X44A 1ZN9A 1J7JA 3ACBA 4M0KA 2PRZA 4S2UA 5BQOA 1QK3A 1ECJA 1DKUA 4RV4A 1QK4A 4X45A 1A98A 1LH0A 1UFRA 3O7MA 1CJBA 1G9TA 1O5OA 2PRYA 3G6WA 1OREA 2DY0A 5IAOA 1A95A 4LZNA 1WD5A 1A96A 1VCHA 1G9SA 4RAOA 1JLRA 1GRVA 1L1RA 1XTUA 2FXVA 4P81A 4RHYA 1UPUA 1OPRA 1TC2A 1I0LA 3DAHA 1NULA 3M3HA 3GGJA 4TWBA 2JKZA
chains in the Genus database with same CATH superfamily
2X8BA 2II6A 3PVZA 1ZG3A 1L1QA 1PKXA 3F3YA 2AEEA 4YC7A 1TK3A 4TS3A 4QEDA 4AG5A 2Q3JA 4LY9A 5BSEA 1R74A 4C08A 4CLDA 3GB9A 2JI6A 2ZWIA 1X7XA 3L6EA 1J25A 1CT9A 1FTGA 4WDRA 5TSDA 4TXLA 1VMAA 1G5HA 2I0FA 1ENOA 1GAXA 3SHVA 1C41A 3AL2A 2WUVA 2P9HA 1GQQA 2X14A 2ZEJA 4EUHA 4H77A 4IDFA 4L9WA 5J47A 3AI3A 3NTLA 3JD1A 4OL0A 2BPOA 2CZQA 4MVJP 2GNAA 1FX1A 3KZKA 4A26A 4DE5A 2OGWA 2DUJA 2QTVB 3EDCA 5TJ9A 2AN3A 3H7IA 2P6UA 2NT3A 1S2MA 5FWYB 2ACVA 1RT9A 1Z15A 3DOHA 3DVRX 1N4DA 3W3AA 2VNJA 3LUGA 5JHGB 3G85A 5J4HA 1A5ZA 3QX9A 2HTFA 2CLMB 4RHTA 5AJXA 5COQA 3EGIA 2IWHA 2IFTA 1T1GA 3H1FA 1ECGA 1L4MA 1GCGA 2UUOA 3MT9A 2FW9A 4RKRA 1PG2A 4MEAA 4ZVOA 2HGSA 1ZN8A 1PRYA 3QGMA 4RSHA 4KFRA 3K1JA 3A9TA 4X65B 1XTZA 3LS2A 2ENUA 2CVOA 3LJKA 1YB7A 3PE3A 3FNQA 2IEZA 4MTCA 2EW8A 2X5XA 3T7TA 1QSGA 4DDKA 2IUTA 2G7ZA 3GGGA 2AA3A 3VAZA 4KV7A 4EJ0A 5JNVA 1SKMA 2GD6A 4PS0A 2ERXA 4X63A 1XXHE 2PL3A 3A1WA 2C96A 4P54A 4C0KA 9ATCA 2BP7B 1SIBE 3KQYA 1A9PA 3OLYA 1ZAKA 2NW6A 2HQOA 1L0BA 3ZCPA 3C5EA 1QYDA 1AZSC 1T0IA 3RS5A 3NVKI 4DS3A 3MA0A 1EP9A 2YV4A 2IZ0A 2A5GA 4JJFA 1I5RA 1Z4PX 2VTBA 3TLYA 3GFRA 1MW9X 2HQSA 4WXMA 4NAUA 5E2IA 3FMFA 5CNJA 3RF7A 2CLEB 1QF6A 2MR6A 1LQTA 2OWDA 4LX8A 3FZEA 1E1MA 1NJ8A 5G4KA 1L5HA 3ZDQA 1JI0A 1P0FA 2YWEA 4TS9A 1I4OA 4EG8A 2QP4A 2NU9B 2H2DA 5C81A 3IAM6 5F2OA 4TT3A 1TC1A 2QUAA 5LUAA 2C1ZA 3AP1A 3SIPA 3IYLW 1V47A 4YUWA 4BO1A 4ARSA 2BWJA 4IIYA 5LZ2A 1NE2A 2OV6A 3S81A 2CD7A 1QTRA 1VRVA 4Y2RA 2EWVA 4RAQA 1E4YA 3TSAA 3CZ5A 1ZI9A 3U61B 5FWYA 1QGOA 1V8ZA 5EVCA 1Y4SA 1NJ6A 3AR9A 4MRNA 5DU2A 3SICE 4B2YA 4A15A 1MC4A 1ZVKA 3IAEA 1QV9A 2RMKA 3JTMA 4PAQA 2VWQA 3ZG6A 5H5JA 4CG3A 2PTHA 3DDHA 3TBKA 3QE0A 4H6XA 2O5RA 4IZIA 3D2AA 4BV3A 2XWBF 3V7YA 3UMFA 2AVNA 1K5PA 1D2NA 3G1WA 1CXZA 3GG2A 1C30A 1JEAA 1VCHA 2ZYGA 1J9GA 2E85A 2PWYA 4IHJA 3DEJA 3RFTA 3RFVA 4AO7A 5B4UA 1EFDN 4R81A 5ALNA 3KKLA 1X7DA 3HYSA 2HGZA 5BN4B 3EIUA 2FQWA 5L3SB 1S2NA 4Q3CA 4K0KB 5FWNA 1VG9B 2ZIXA 5EGSA 1Z38A 3P9IA 5HIJA 1MAHA 3ZI0A 5BORA 3UXHA 5BP7A 5IZCA 5JXIA 4FCTA 3VHXB 1N5RA 4G9EA 4URZR 3FRIA 1QIIA 1Y7PA 4BRSA 3F0TA 3BKXA 5GIOE 1DJNA 4B3HA 1PGPA 1DB3A 1QFZA 1X8LA 2W93A 2MYPA 3T38A 4A0QA 2HHJA 1UF9A 2B4KA 2GZ3A 3KJGA 2PQ2A 3ORSA 4HZUB 2PBRA 3LDFA 5CDTA 1REQA 1NVMB 3N2GA 4GI3A 1SVNA 2PV7A 2GCPA 3WIVA 2FP4B 1OF1A 2BH9A 4RTSA 1K6EA 2QPOA 4W1QA 4YA6A 2A78A 4PCUA 5F2KA 4RZ3A 3W5HA 1XWWA 1EFPB 2GBCA 1YL7A 1ZJZA 2OXCA 3DDUA 3DV2A 2YWHA 5H81A 3T3NA 1V11A 3QEAZ 5ALZA 3O1HB 1CY7A 3C6BA 3IV9A 3P0EA 2VFAA 1CUBA 3HYTA 4M98A 5DX8A 1IMOA 3OTQA 5ER9A 5SYNA 4P82A 1VHJA 1WSWA 5E6UA 4Y6LA 2JI8A 3NTVA 1PZHA 3RUDA 1SURA 1I7SB 2DY1A 2FWRA 2GEVA 4CKCA 2PUDA 2CDCA 3T4PA 3KVYA 3FBTA 5EKXA 3VU8A 1QYRA 4YUAA 2GUGA 5DCLA 5KX5F 2RBEA 2C5EA 3D3JA 5FTKA 3ZWVA 1PDOA 8GPBA 4OXQA 1SQ0A 2OA0A 4BPBA 2UZ1A 4N7RA 1TDJA 2X3YA 2HCTA 2R62A 3PKJA 1ZJJA 2ODNA 1ONNA 2QAGA 3L92A 1N0WA 1LTKA 4HAIA 1L4UA 4GE3A 5HMLA 1R2QA 4J3NA 1L7XA 1JPUA 2VAPA 1FVFA 4HDNA 2AOXA 1XCJA 4TKZA 4JB0A 3ROTA 4BB0A 2WSMA 1YTLA 3OY7A 4MPJA 4BMOB 5K3SA 1AHHA 4QDJA 4URXR 4BE4A 2BJHA 1OC2A 5DNVA 3SEAA 4B17A 2WK1A 3TQOA 1ZVMA 1GUDA 2DTXA 2IXFA 1YIOA 2PBLA 4ALIA 5CURA 1EWKA 5GM2A 3TKLA 3PHGA 3JAWB 3NLLA 1H69A 4MRPA 4M7PA 4PCLA 5HZKA 3FVTA 3A05A 4ZAZA 2P9JA 2OZPA 2EDCA 2WMNB 5I9LA 5FLYA 4BB5A 4AKGA 2B99A 2DBVO 3AUFA 1B15A 4C14A 2F9MA 5JHHB 1YJQA 4NXNB 5DT9A 2GK4A 2XGSA 3QMMA 4QQNA 1IBCA 5IU6A 4IJWA 3K3PA 2EJBA 4GM4A 1QM5A 2PYZA 4H1TA 1X80B 1D2MA 5EPUA 1W0CA 3DYVA 3HP4A 3GP8A 4ZYXA 2VK2A 2PAAA 4P34A 1B8OA 4YDRA 2PPLA 2XWSA 2GBLC 1T1JA 3ORQA 4Z6KA 2FZGA 5KPDA 2AC2A 3NGXA 1HYGA 1DOZA 4G8DA 3JVUA 5E3IA 4EHKA 1P2FA 2DULA 3B1KA 1O6GA 3E7FA 4U2KA 4I8XA 1SO8A 1SXJD 3R3UA 3DOFA 2OV4A 3UATA 4DEXA 1XDUA 3H4TA 4NQZA 3U2QA 3W9YA 3P1JA 4OMUA 4QU8A 3DE1X 4PN3A 2UYCA 1ZGBA 3SJCA 2DPMA 2PS9A 4L15A 3GUHA 1X7WB 3UT5A 5BWMA 4HQ6A 2ZRBA 2VHEA 1B14A 3E3AA 2HMUA 2YZNA 3HCOA 4LK3A 4D5EA 2QG9A 5AVXA 4NS1A 4ZFNA 3RKSA 1ZUWA 3AGPA 2W2KA 2YJ3A 4WQMA 1FCJA 2CJFA 4PC2A 3M6XA 3VV3A 1CW2B 1E96A 1PZEA 3ILXA 2A3RA 2AL7A 3HDVA 1WCXA 3H1PA 5EPOA 4EPRA 2PD3A 4HUTA 4C7MA 4GRDA 1Q19A 2CDBA 4EQZA 4BAGA 1O97C 1TQHA 1UFQA 5JNTA 4LGCA 3EIEA 4YJ2A 3VNVA 1E92A 1BKYA 4L4YA 5HKLA 1YAHA 2OHOA 4GEGA 4IDQA 4RFVA 4RACA 1SELA 5IVDA 3H42B 2HW8A 5LP6F 3B38A 1U0SY 3GRCA 2VF8A 2IUUA 3V00A 1RKXA 4E09A 2R6GA 4F45A 5ALRA 3EARA 2Y9MB 4BKRA 4DHWA 2F90A 2P9ZA 1DDOA 3CGGA 1AD2A 3ZLTA 2VKTA 3D8BA 3V7WA 1T29A 2AEJA 3LSTA 1TU4A 2Z6QA 3GJ8A 4CM1A 5GY7A 1SZCA 2EYQA 4UHCA 1DAPA 1EG2A 2XVAA 4EI7A 5HG0A 5FPPA 1SRQA 5IFKA 1GGKA 3H2BA 1SC4A 4HX2A 3VKFA 5F9MA 5ABPA 5F5NA 4C22A 2R8BA 3FSRA 4PU0A 2CV1A 1UZNA 2XW6A 3NEAA 1JHDA 4RSRA 3GPBA 2IZ6A 2NACA 3F4KA 4NCNA 4LRQA 5CA0F 3QVOA 1Y5NA 2VCYA 3AW9A 2W6CX 3UOGA 2O9JA 1BWQA 2RIPA 3PXCX 4X24A 1PGJA 5SV2A 5J4LA 5EY5B 1YR9A 4BGEA 1FNSA 2COEA 4KRGA 2HWWA 4HDSB 4PG6A 4ZO4A 5JDCC 3RGWS 3VYTB 4DA7A 5L6LB 1UKYA 3JQ7A 1TOAA 1JDJA 1ZGAA 3H2GA 3OI7A 1CUCA 4MB0A 2X77A 5G1PA 6REQA 4EJ2A 3JWEA 1G6OA 1XBTA 3PC6A 5DWDA 4BKPA 4J1SA 1E94E 2BI4A 2Z4TA 3L6UA 5HCUA 2NZ8A 5EJ8A 3EQ2A 3JATA 4MLDA 2F8LA 2QBYB 1XVTA 1B1AA 2ZBGA 3NM4A 2IY7A 1BH2A 4HCJA 5DHAA 3QE3A 4IH9A 4N3BA 3LY5A 1UZAA 1Z0JA 1F4LA 1DAFA 4INZA 4M1YA 3G89A 3C5HA 3REGA 1F8GA 2BGJA 4G0MA 3EOZA 2VTVA 3AKDA 1ZUIA 4TYPA 4PZ0A 4QQRA 4CL8A 4JDPA 2VQFB 4MOWA 2JDID 4LJAA 3HKDB 1S4QA 4FHFA 3ZD7A 3ZKWB 4OF4A 2RHLA 5IXJA 3F2IA 1JU3A 2GBIA 2ZBFA 3MIZA 3QELA 5DGHA 2JIBA 5A1TA 3KEOA 4FC7A 2I67A 2LE0A 5F1YA 1ZBQA 4FQ5A 3VYWA 1Y80A 1QP0A 1GZHB 2BLLA 3ZE8A 1TLFA 3HY6A 1KJ9A 1UFOA 1ZHFA 3KHTA 2IU3A 4HPWA 4RVHA 1S02A 3B78A 2KWIA 5KKCA 5LPNA 3AQ4A 2GNPA 1P5FA 1TW2A 3SR0A 1YDMA 1AV7A 3OPMA 1CULC 2E4WA 1H66A 1VCNA 2LKDA 4L6AA 4II2A 2FP3A 1GGVA 1KZ9A 2ECQA 4IGIA 3RRZA 4BX8A 5CFRA 3L06A 4FFOA 1NYRA 3GPIA 1G66A 2X7JA 2OBFA 3V6LA 4RENA 3CW9A 4KQEA 4ZGBA 5DN9A 3S4YA 1HL7A 4DWOA 3PQ3A 2QYTA 1CY1A 5BWOA 3UPUA 4HUJA 4OH1A 4UMVA 1UXIA 4WA7A 1AKUA 5JJ5A 3RH0A 3AVYA 3K05A 4BUZA 4DIOA 2JGDA 3II6X 5EJIA 4GD3Q 3TI7A 3UWDA 4U7TB 5KSYA 3CVXA 4WLNA 2RK3A 3OZBA 5CLIA 2GAIA 3TX2A 2GQ0A 1XZ8A 2V54A 3WGHA 2LVBA 4XH9B 1V39A 2BMAA 3A9WA 4NBKA 1AGPA 4L9AA 4Y7DA 2WWGA 3NM6B 3OFVA 3OOSA 2W2LD 3O1LA 2R97A 4MJ7A 1ITZA 5FJIA 5IX8A 2Q5JA 2V9CA 1OU0A 2E4ZA 3HXKA 1LVGA 1PNOA 1RPTA 1SVWA 1XJQA 3KJQA 3OHSX 1TO2E 2AZMA 2W5UA 2ZIZA 3MRVA 3B9PA 1ULAA 3H9GA 1KQNA 1U0HC 1G42A 3CKLA 2FMKA 3WRWA 3ZCXA 2WLTA 1B23P 2J5RA 2ARKA 3QMPA 1J5PA 1U0GA 1LBEA 3BD6A 3IP5A 3KZVA 4HO1X 4CEHB 3JQBA 3NOOA 2XZOA 4GPTA 4O4LA 4XFKA 2HLHA 1MQSA 1XU9A 2W6IA 4R5HA 1U11A 5FPTA 5H70A 5LOVF 2D2VA 4GSYA 1RJWA 1IPFA 1Y42X 1JJ7A 4CKBA 4E7PA 3LL4A 1Z0AA 2F67A 3BSFA 3HDGA 2YN0A 1IWOA 4BEVA 1PEYA 2QX7A 4DUZB 2N75A 1UINA 1Y8AA 1D6JA 3DUFB 3KLMX 4PSCA 1U2DC 3OVMA 1B0UA 3U16A 1K68A 5DBOA 3QFSA 3AY6A 1W4CA 1XN4A 3OAAA 2C1EA 3QKTA 2GEFA 4ZKDA 4KHPB 1GYQA 1NFFA 3OOEA 5I7VA 2WZQA 3KYJB 5LQMA 3F49S 3QHPA 2QSYA 1A9OA 4B8YA 2UUAB 2AQ8A 2H7XA 2VTBB 4RNCA 4WFKA 3RV3A 2C2BA 1L5GB 2Q7DA 1GZSA 2ZDGA 1BGVA 1XD9A 5DISB 5C0OE 4WH0A 3WRYA 1PE0A 3EYAA 3ML1A 5AW0A 1L5KA 2ZUCA 3VTKA 2PY6A 1OZGA 3IEVA 4P3NA 4BMVA 5JWHA 4OLJA 4F06A 4DR6B 2P0AA 4CF6A 3HU1A 1FXWA 2HWXA 2V6JA 4EKIA 5CW1A 1H85A 3LW7A 3WGLA 1ZH4A 4CW7A 1FFXA 2CXTA 4GP9A 3N0TA 4YK7A 3W6PA 5JD6A 4GMKA 5M04A 3FWPA 5K8CA 3QWHA 4CFZA 1A9XA 2CCGA 3RUCA 2JA1A 1BS9A 3CFYA 4RTQA 1T1EA 2REQB 1ZJ5A 3GEGA 4XPZA 1NNSA 4M7OA 1Q17A 1VSQA 2C94A 3Q7IA 4JLJA 5EUBA 4AROA 3PEYA 2FF5A 1C7QA 3H4IA 2SCUB 4ZJZA 3D1VA 3EA4A 2OKCA 1JA9A 4PYNA 1M1YE 1VKRA 3CLTC 4UU8A 3VSDA 3QPDA 4LMBA 3C45A 4RD2A 5FL7A 3M3HA 3QUQA 4QLOA 1HDEA 1ZH8A 1RADA 1N0IA 3C8HA 4IFIA 1CR2A 5KNCA 1FIUA 3GLGA 4C0BA 1SKQA 4NDAA 4NLLA 5C8YB 3D43A 5B1IA 4K88A 1G64A 1ZD4A 4X7PA 5ICGA 3PP8A 4KMRA 1TA4A 1ZNQO 2JHAA 2WC1A 2PH1A 2CZGA 2ZG6A 3RUIA 4A82A 1SXJA 4BQFA 3BWBA 1PTJA 3BMCB 4DOMA 3DAGA 5L8VA 3A1TA 3G2HA 3T52A 4DY4A 1SCQA 1ZH2A 2FSIA 5CFNA 2HV9A 4Q9HA 3NHLA 3PQEA 4CM8A 3E5RA 3OOJA 3E5HA 2QRZA 5C8VA 1UOEA 2WJVA 1X86B 1XKXA 3RKRA 5KJCA 1AKTA 1GADO 4CI0B 4GVXA 4QHTA 2WVJA 5TF0A 2ZB8A 3UMCA 1A82A 1SQ5A 3IA7A 5LUBA 1WW8A 1JXQA 1Z2CA 2ZWAA 3BTOA 3EFOA 3LOPA 3NEJA 1N6RA 3OICA 4AP5A 5AVVA 1F14A 1UM9B 2QMEA 3GT0A 1EIZA 2GRUA 2JJ2A 2QY9A 1OE0A 4UOZA 3JWGA 3DD1A 4DXDA 4ZTZB 2IHTA 1SQFA 2F1OA 3QXGA 4LF7B 4OHKA 3KG2A 4D0LB 3UHOA 1Z5VA 1XGKA 2AUNA 1JECA 3CRMA 3T5BA 5TS3A 4BJ6A 1N8NA 5KMGB 2QZ9A 4MRMA 2AEFA 3M6LA 2C4TA 4RF4A 1E8NA 2F8MA 4R8KA 1WJGA 1H22A 1Y82A 3FHCB 3N7AA 1VJDA 1XZDA 2FVYA 3L7NA 4CQLB 1CRQA 4CU2A 2ZS7A 1Z6ZA 1YO6A 4IIGA 3O03A 3P2MA 4E2XA 3EGWA 4ZI5A 3THXA 1V1MB 1N6HA 2F3QA 4GO1A 2ZTUA 1FNBA 2R1UA 4AS2A 1XWFA 3KZNA 4KAXA 4CCAA 4GXRA 4JGIA 1LFDB 1X1AA 2HMVA 2ZROA 3KR2A 3NM5A 4O4JB 2QRKA 4Z2AA 1A8IA 1F8XA 2WSYB 3TOCA 3DFUA 3FE2A 3THYA 5BPFA 3QBJA 3V1UA 3BZUA 3GRFA 2JFHA 1VKZA 1MX3A 1Y8ZA 4XD7D 4P7FA 2NYUA 4J0KA 4P08A 1VKJA 3GPLA 2O07A 1XHFA 1N5KA 1TJ3A 3THYB 2C7RA 1ONSA 2ZB3A 4E1BA 3M8KA 3CM0A 1CJSA 1OIVA 1R8QA 4Q93A 4Z49A 1LV7A 2DJIA 5HNKA 2XDWA 1X80A 3OF2A 3D6TB 3HFSA 3KOYA 2VO1A 3M89A 4HWTA 5AUNB 5BN3A 4F91B 5IUNC 1Y6GA 3HC7A 5MDHA 1ZCJA 1IY1A 5DW0A 3Q15C 2QU8A 2YV2A 4QYWA 4YXWD 4FYYA 2WWFA 3AJAA 2IIPA 3AG5A 1ZNZA 3AZPA 1IN6A 1NTRA 2VF2A 3WGZA 2EZ8A 4FYVA 1WDLA 1QFJA 2C98A 1KF0A 2Q3MA 4WL0A 3T7CA 3D4LA 3NHJA 4F72A 5ALVA 1UXOA 2YMMA 3BGIA 4IDCA 2PBZA 4N49A 5F52A 4UHKA 4BNLA 1G6Q1 4CCWA 5BSFA 5IF3A 4RNDB 4EB6A 4YFYA 4D5GA 1ARZA 4NULA 4Y2HA 1KJQA 5JMWA 4PAGA 1XF9A 3ZJUA 2H29A 1KHTA 2O8VA 3BXEA 2IY8A 1LJ8A 2H17A 3WNDA 2C0PA 4X6LA 5DGIA 1MORA 1B42A 2CFOA 2OHFA 4H7HA 4Q3AA 2FRDC 4QSHA 1J22A 1J7KA 3BSYA 3OJCA 3UCXA 3W9UA 4RHUA 4E31A 2G1AA 2R5FA 3C16C 3WLHA 3RSOA 3D2LA 1D7OA 4F5DA 2RJNA 3L8HA 1HLDA 5LBUA 4BFWA 2O6LA 5KI6A 2RGYA 2Z5FA 5CJ2A 1GLVA 1GPBA 2O2EA 4O4JA 5G4LA 1ZW1A 3K70C 4OU5A 1HQKA 1FTQA 2ZJ3A 4FP9A 4DCTA 3BFVA 4KXLA 2D5BA 4XA8A 3LY9A 1FYXA 1N8SA 4O2BB 4AX4A 1OY1A 1ZGCA 5EAIA 1YB1A 4YAEA 5HKKD 2VPXA 2SKDA 2C3UA 3T9FA 1YE8A 4WXEA 1IN1A 6NULA 4QVIA 4CZ2A 2AKYA 3QX7A 4NCXA 5DHPA 5I45A 1PGOA 2FF7A 2H2WA 1P1CA 4OK3A 4G1BA 2NSJA 3UT6A 4EL5A 1E2BA 1GO2A 3ER6A 3GCWA 1MT3A 3GA5A 1ML4A 5D87A 2O5EA 1WUTA 4AKEA 4KNWA 1MOSA 2YH2A 1KDZA 3PRJA 3AM5A 1UQTA 4GX2A 3UA3A 2OCAA 3JQFA 4Q4LA 4XLZA 3A1VA 1Q0TA 3W7AA 3EF0A 1P0QA 4IDAA 2W37A 5EIEA 1PT6A 2YV1A 1T10A 1NOIA 1SQSA 1C5KA 3F3MA 1YBAA 1A9YA 1NPTO 5CJPA 3T7RA 1PZXA 1PJZA 2IYVA 3M5CA 2C83A 4TLAA 4Q1EA 3H9UA 4ZEMA 1NMSA 3DOUA 3GLVA 3LUFA 1ADYA 2FEWB 3B6JA 3BGOS 5AESA 1TYCA 4HX5A 5JCJD 3TZEA 1EDEA 1RW4A 5IAGA 3UANA 4FOLA 4BQEA 4UAJA 3THOA 3H0KA 2FG6C 1XVVA 4G85A 4TXHA 1VHLA 5JDIA 3VOSA 1K92A 1Z4JA 2VP9A 3N2LA 3P2JA 1VE1A 1TAHA 1PFYA 3FCXA 4IDBA 4BP9A 4EZEA 2FPUA 2PSSA 1F0YA 3CPJB 3F97A 4Q05A 4OAPA 2HIHA 2VXYA 2ZJ7A 4B3CA 2ISCA 3CIFA 1JIKA 1A2QA 4NH4A 3ZWMA 3LNTA 3GEHA 2EERA 3W77A 2YYSA 3FRHA 4ZQGA 2ZM5A 4M4SA 2CMGA 1V95A 2J6IA 5HMMA 4R0VA 4ZHQB 4EY7A 4F38A 2BTQA 3A0UA 3L79A 3QOYA 4ZO8A 1N9KA 2LDBA 3DH0A 2HCJB 1Q1QA 2GRJA 2CJWB 1EG7A 1NW3A 4W1SA 3TQTA 2ZYRA 2ZZNA 4EA9A 1KAOA 5A02A 3FR8A 3M6FA 5BQPA 5BRJA 4O4IB 3AONB 2ZATA 1GJRA 3NP9A 1WDKA 1RXIA 5KYWB 1G8KA 4X44A 3AP3A 4IINA 4N5MA 4A10A 4IICA 1QH0A 1YONA 4DCCA 2E1RA 4YMSA 2IRWA 3PDCA 4RJKA 2FW6A 4BVFA 1E1RD 2NO7A 4CMEA 2I4OA 1ZLYA 2XLBA 3K0AB 3BZWA 1ZM9A 3K1TA 2C2ZA 1UPAA 5TDHA 2NO6A 1I2BA 1X92A 4ITUA 1THGA 4F56A 5AVTA 4HPXB 3KPUA 2AI2A 1EGHA 3ZYCA 2OHVA 5M3BA 3QNWA 1OGIA 3FUCA 4HQFA 5WRFA 3WZLA 1CQJA 3HDTA 4FLFA 4HVCA 1R4AA 1DEAA 2DGDA 1RRFA 2J5KA 2MSKA 3EHDA 5AK0A 5HEKA 2H0AA 3BCRA 4HWGA 1TIPA 3FBWA 1LVHA 1IVNA 2NUTB 3KKQA 1QBKC 1H93A 2Y27A 2C4KA 4TSRA 2NV6A 3A06A 3SYTA 1DAGA 4C7OA 4LE1A 1ZUNA 1T1SA 3UH1A 1UL1X 4RESA 2IQIA 3LBIA 4KSBA 1DDIA 2XUPA 5CT8A 1JJBA 3VX4A 4AN0A 3L8ZA 1ECCA 4Z0NA 4F7DA 2ONZA 4YNBA 4ENUA 1ID8A 4LJSA 3KDPA 1EA5A 4OXYA 3C6MA 4UHDA 1UJ2A 4F3RA 2I87A 6Q21A 1EXMA 2KMLA 4PIMA 1D2AA 1T15A 4WE3A 2DBYA 3LA8A 3HTXA 3PWTA 1XL1A 2D2IA 4RZ2A 2ZT7A 5JMPA 5JJCA 1H94A 2J6HA 3IEPA 4ZVMA 1JU9A 4M0CA 5FBHA 1EE1A 2EEZA 4AY3A 1BC5A 4OY3A 1TKAA 2GBFA 2QLLA 3ANYB 4BWFB 1E9VA 4P4SA 3C39A 2CK3D 1SU7A 2HYDA 1X8XA 1CQWA 1HEYA 1O8BA 3G2OA 3MWJA 2BGTA 4Z3DA 2FW0A 1QKIA 4R98A 4C04A 4L76A 4LV6A 4NE9A 1DO0A 1FTWA 4FR2A 1DELA 2AJBA 4DPKA 4IYRA 4RVNA 2XITA 4L2IA 2JK0A 2IDKA 1ADCA 3WWDA 4Q1FA 3E22A 4IF4A 2OGTA 4KI0A 5P8WA 3SZ3A 1GUBA 2C4UA 2P6OA 4TYNA 1NF9A 3NIFB 4LZOA 5ELMA 1KQOA 2D74A 3ISVA 4H6WA 2CYCA 3KQMA 2JIDA 4MMZB 2A0YA 4Q4HB 4CT0A 4JJ8A 3EGDA 2IYAA 4WJZA 2WTAA 3E6AA 3NFYA 1GPH1 2CJXA 4Y9UA 1XU7A 2FZCA 2YNMD 4Q1BA 4RELA 1MAVA 3ESXA 4I50B 3B82A 1I4TD 4KIGA 2V7EA 3GV0A 3OSUA 5KQLA 1H3FA 2AI1A 4J1NA 4UBLA 3TLMA 3COWA 3SCZA 2X40A 3G9UA 4GBJA 4RQUA 2OT3B 3DV0A 3O38A 3GDFA 2WUFA 1G2PA 2A5JA 4UOEA 3ZHCA 1SBIA 1CQZA 1KMIY 4RLFA 1ZMXA 3ONNA 4HT3B 2X2OA 3L41A 3QYAA 1CEYA 3E9RA 1UJCA 3LQKA 2FZ5A 3GRVA 3RJ5A 3G0CA 4BMNA 1JLKA 4ZICA 1QBGA 5AYVA 2O1WA 2OPBA 1BE0A 4DWWA 2Q07A 1JVSA 4ZQFA 2GA8A 5DM60 1TVKB 4Q66C 3ICQB 4ZC8A 2YVUA 5IUJC 3E7XA 3GLSA 4LZAA 3F46A 3KQLA 3HB1A 1BOOA 4WASA 1QGAA 1VLMA 2ZOSA 4MDYA 4ER3A 5K0JA 1A1VA 2BRUA 1QKJA 5I7OA 3JTEA 4DJDC 1SUBA 4I4TF 4QDXA 5FEUA 1U2GA 4DV7B 1VL8A 2EFHB 4ALLA 3W4IA 5IG2A 1E3LA 3G8BA 3M82A 1TZCA 4FFBB 2ZI7A 2Y71A 1C3EA 2JFUA 1RI4A 2DRIA 2LXNA 4X90A 1DLJA 4O2BA 2DBQA 3K53A 1ADGA 3IUMA 3SF8A 2F8TA 1LU9A 2I66A 3IOCA 4DV5B 2N9UA 5TC4A 4V0QA 5F23A 3CVUA 1K6XA 2ZJ1A 1P4GA 1VG8A 1TA0A 3I58A 2P41A 4MUAA 3P71T 2AG6A 4IGEA 2KLBA 3KOOA 4CLRB 2DETA 4UUBA 1BCRB 1DAOA 4YXWA 1QYWA 3P5BA 4PBTA 1CEEA 2QMZA 1KI2A 4KNVA 4G1UC 3STXA 4BC1A 1W73A 3W3AD 3GUYA 4WESA 4LPKA 4F8YA 3H5RA 1MW8X 4X8HA 2OSVA 3QMVA 3SGLA 3ORRA 5KVAA 2X9GA 1NE7A 5IJWA 5EJ9A 4NU6A 1OA1A 4DV6B 2RBKA 1X1RA 2B1RA 2GXQA 4NV0A 3BUSA 3WAKA 1DKPA 5AKGA 4EH1A 4C89A 5CT9A 1T3ZA 4I5IA 4JVSB 3W2FA 5LQKA 5C8XA 4C0XA 4HDCA 1NM5C 3MFYA 4V3BA 5G53C 4AZ3A 2VDWA 2ZT8A 3QK7A 4YJ3F 4BU1A 2FLVA 4LTDA 3MBKA 4UUMA 2QQ5A 4BBZA 3OBBA 1I1HA 1TVKA 5F3WB 5JS1A 3SS9X 2FR8A 2O52A 3WJAA 2F43A 3MTIA 3SLGA 2I1QA 4IOKA 1V5WA 5CLQA 3O21A 1ZR4A 5BSMA 4NYJR 3U39A 5AVJA 1TUEA 4ALJA 4QZVA 3GJ6A 1P2SA 1WCYA 5FADA 1GQYA 3ZIAD 2MYTA 5BN5B 3TW8B 1QHXA 5TPZD 3BM5A 5HKKA 1IM2A 2W6JA 3CUTA 1KIAA 1VIDA 1K63A 4BU0A 1UJNA 5F2NA 5L53A 3HP7A 3RVKA 3ZJ4A 5DI3A 4E11A 3EK2A 5AVQA 2Q6KA 5BURA 2O54A 1EX9A 2Y1LA 4KCGA 1Z82A 2XNJA 4EB0A 3EULA 4GUDA 1NXWA 1RPAA 3CN9A 4QPDA 3ZWXA 4KHZA 2X4IA 1IY0A 2FLKA 3SMVA 3AYXB 2X42A 1N92A 4AXXA 4K5QA 2P9BA 4EJSA 2FUG6 2XJ9A 4Q3NA 3N0XA 5HIMA 1V26A 4TN1A 5FWDA 2H2HA 4FHZA 3WLOA 3HSYA 4JUFA 1RHUA 2XCUA 4O2LA 5KIAA 5DX0A 4MS4A 1ETHA 1GAEO 1NJGA 4F6RA 1W5SA 3BS4A 1MOPA 1VIAA 2O6HA 1X77A 2QTAA 5TJHA 1KZYC 1FDVA 3ZPXA 1VL2A 1FDWA 1ACLA 2PAFA 3IX7A 3PNSA 5KEIA 4KX3A 1C8VB 2WFAA 3KQKA 4URHA 1WEKA 2AX4A 3ABOB 1GITA 3AOGA 2FEAA 3G68A 5KJEA 5JASA 3R7LA 5GZ1A 1KH2A 2VF7A 3ND9A 4L5BA 2PMFA 1AS3A 3WA6A 3WKAA 4DT1A 4FW9A 3C4VA 4BIIA 3QRWA 4Z8YA 1GTMA 2AJ8A 1V8FA 3DCJA 3MEQA 4FUQA 2XXJA 4IIJA 5D3MB 3UMJA 4KZKA 4YRLA 3CMCO 5JSZA 2ADOA 5L40A 1JSCA 1JFSA 1QR2A 2YXNA 1MX1A 4IIVA 2WUWE 4OHYA 1WW3A 4RL4A 1MH1A 3KQVA 5E6SA 1JT9A 2X0JA 3DG9A 5DHQA 2HHAA 1MB2A 3DVLA 5JDIC 2I2WA 3EF3A 2YC4C 5IKEA 1OFUX 3Q87B 5EJ7A 2V9ZA 1NN0A 3CEJA 3M3PA 2BM1A 4E6EA 4WK2B 3D6JA 1KO7A 1Y7HA 3LZCA 1KVQA 4LJYA 1U9IA 4WKOA 3LKVA 4EVQA 5LQRA 1IUKA 3D6HA 2EZ9A 3EGOA 4JOBA 4KGVA 5DHTA 4AAYA 3A25A 2QL5A 1PJTA 2XTMA 1V8OA 1MMFB 3JZDA 3GJTA 2ANBA 3NT5A 4OJYA 3DE6X 3COPA 1N3BA 1G291 2P0EA 4ND2A 4QPNA 5AICA 4HYTA 5EE0A 1M2EA 3MWGA 4XEHA 2AC7A 3IQIX 1E62A 4LJ7A 2BJVA 2WUGA 3UUGA 2JI4A 2QN6A 4WN9B 2XKKA 2VHQA 2FFJA 4XJXA 1L1FA 3RT1A 1EXDA 5BNTA 2B61A 3K16A 3SLRA 5EJ6A 1PK8A 2IP2A 1YQWA 4UHEA 2RGBA 3RASA 3C24A 5KQPA 2GZDA 1T9HA 3FYCA 2EHJA 2EZTA 1NNEA 3MCWA 1JKIA 1MJGA 4D4IA 3H1TA 1VIYA 4KVGA 4QASA 2X8JB 5H3HA 4A2PA 1O8CA 2BTQB 4TM8A 4D3XA 3Q8MA 3OF3A 4IS2A 2QYHA 3SZUA 2VUSA 2Q4EA 5CTAA 3U37A 1XAGA 3VH1A 1EINA 1KWGA 3H5IA 3R6LA 3EVZA 4YJKA 4B46A 4YTEA 4ARZA 5IM4F 1H2RS 3N0RA 1YJAA 3VC3A 3QQPA 2TMDA 4QUJA 3RBAA 3VYSB 2BCJQ 2JGRA 5IKMA 4UNSA 1F4VA 1V8PA 4YQZA 1PJRA 1DCMA 1PP4A 2PZAA 3NORA 1XTQA 4S24A 2BZ0A 3H1EA 4S1VA 2UUPA 2NOAA 4GMXA 3I72A 4K6FA 2GLUA 1IN7A 1K97A 2O57A 3A4TA 4DMGA 1ZK1A 1LDNA 5JS6A 3HGTA 2GI4A 4TZTA 3EGXA 3VJMA 2FEPA 3MJ4A 4UPDA 1I5OA 3TNLA 3RW9A 4RHFA 1AJEA 3JR3A 1WULS 2NYAA 3GLIE 1NX6A 2PT5A 2KM1A 3WLPA 3PYLA 3HSKA 2IYWA 1ULTA 3JYOA 4R7GA 5CXXA 4RIIA 1J0AA 1NUPA 1PR6A 2YZ7A 3H2YA 3ZDCA 2ES4A 1E1CB 1GHTA 2R6HA 3RRFA 3IULA 5C5CA 1YVDA 1XD2B 1FZTA 2VH2A 4AKTA 2PSJA 4LSZA 2GZSA 1K8QA 5ICEA 2P79A 4EHBA 1M6HA 3B6KA 3EISA 1JQKA 4IDGA 4R6WA 5ER6A 5FWAA 4BFUA 4XR4A 3E2PA 4JA0A 4K9DA 5CPBA 1M2OB 3ANXA 2EFGA 2IOYA 4RIHA 3LUHA 3EGCA 3O4HA 5KNCH 4KQXA 1NDQA 2Q1XA 5AM0A 1A9XB 2PUJA 1YULA 3AV3A 5EIHA 5CDUA 3BILA 4EHJA 2ZWOA 4U9IS 2HA6A 2PKQO 2TMKA 3Q3IA 1FDIA 3DKIA 2HX1A 2YHBA 4H0FA 4IMIB 1MGPA 4K81B 1I3LA 4W7IA 1NU6A 3QXXA 5A9SA 1E5XA 4C30A 2FDXA 5BV0A 3NHKA 1HI9A 4TV8A 2I4NA 2P90A 4Q4HA 2RH8A 2D1SA 2I80A 2H8KA 2OAEA 2O7NA 4XOUA 1Z63A 3HB0A 4Y1GA 2B92A 3GARA 2FXVA 1R4MA 2C9BA 1XZCA 4O5AA 5IVPA 3CZRA 1G8YA 1TECE 4K6HA 1C14A 1Y6RA 4JXJA 2QJRA 3CNLA 1DIRA 2DQKA 3HKEB 1BDMA 1WHSA 1DAHA 3WJ1A 5KQMA 1RD4A 5JRJA 2IF2A 3IUSA 3UT0A 2OGZA 1IM5A 3S1AA 4B76A 1E7RA 5IWCA 4KAAA 5KB3A 1U3DA 2C4WA 1UEJA 4BLRA 3NIBA 2OWEA 4A9AA 2MHCA 4UKDA 5M29A 2YZ2A 2R6R1 4G0ZA 3VKVA 1U1GA 3L4BA 4EB3A 5JZOA 3U3XA 2JFFA 1QC5A 2HDOA 3IB3A 3TE7A 5AHXA 1ZRHA 3KLBA 5H83A 4R16A 4YXFA 1AIPA 4J1QA 5DLDA 3N39C 3S28A 5FORA 1BG6A 4H7IA 2HFKA 3WDSA 1GPNA 1P62B 3C5CA 3CUSA 3IMEA 1RS0A 3IMFA 3P9QA 3SR4A 4DBVO 1YE3A 2N1MA 4F7WA 5KYKA 2IEGA 1GGFA 2ENWA 3IVMA 4LIPD 4ZQBA 4F9GA 1LW7A 2CWDA 1R0BA 3GUUA 3ZWOA 2FUCA 3BH6A 5EEHA 3RK1A 3UXEA 1YQ9A 3E3MA 1ACMA 1AK9A 5DIZA 4BTVA 4DAOA 1LW6E 2J0SA 1OHHA 2W22A 5JI3E 1QGYA 2HSDA 1YZ3A 1FNNA 1GRQA 1NXVA 2J0VA 1V25A 2ZQZA 4O02B 5F33A 5ITWA 5EHZA 5FH9A 2Q41A 2I3GA 1CUSA 2HADA 1V1MA 4I1SA 5FLXA 2XV1A 4WNIA 2K87A 4Y1RA 4EGJA 2QI9C 4JLWA 1A5AB 1GUFA 5J43A 1VPDA 1KBQA 3OCWA 3Q5DA 3ZX5A 4TM7A 1TLLA 1UDBA 2WU0A 2IPLA 4BEJA 1US8A 5CAEB 4OHBA 2JLAA 3H75A 5A1JA 3OE7A 4FJ1A 1E4VA 1U5BA 3U31A 3TTSA 4ZI7A 1EP3B 3VYUB 4DADA 2KB0A 2RGUA 2Y0EA 4ZEWA 3OECA 2P6RA 3S2UA 1DKNA 4MWGA 4ZZ2A 2RGCA 3TLZA 5L3VA 5F78A 1SB8A 2B37A 2DFNA 5CG1A 2VJMB 3HUFA 4WZBA 3DO6A 4HRAA 3F3KA 4OTZA 2DPYA 3EUAA 4KRXA 2O2DA 3H9CA 4JLPA 5EXEA 3BIXA 2C4VA 4QXOA 3OJXA 3TR0A 4IUCS 3SZGA 2W11A 1EMDA 4FQ8A 1TQ4A 4DA4A 4LNUA 3QE4A 4G6ZA 2V7UA 4XGKA 2IELA 1EUCB 4KGXA 1PQYA 3KO8A 4B80A 1ZVVA 2PDAA 1DEXA 4OHXA 1RM3A 3RLFA 4MITA 2P9CA 3QFCA 5BYJA 4BV8A 4WBNA 2Z5GA 3I3OA 1BEUB 4E6PA 4JQYA 4E94A 1CUYA 3NHSA 3EZ6A 2G82A 2ZK7A 4OM7A 1K8ZB 3EEQA 3WBBA 3Q9LA 3L01A 1JF8A 3X2FA 2NU7A 2F7SA 1JIIA 4KPFC 4HWPA 4HKTA 4QOEA 1USWA 1BS1A 1YT5A 2HQBA 5JE8A 4HNRA 1IN4A 1JKMA 1D4ZA 4U2EA 4GP7A 1EVYA 1KORA 4FGUA 3HCFA 2IU4A 4L7QA 3GPCA 3L6RA 3H1GA 2ZRGA 2CE2X 4MQUA 4RHYA 5AKKA 5ALOA 4JJ7A 1NVEA 4MKIA 2V7QD 3IEIA 3PJDA 1WZNA 4XWAA 1Y7LA 3D8SA 4MI9A 3DKKA 1OKKD 4TGLA 3AFOA 1Z0KA 4HEQA 1HDGO 1N2ZA 1WG8A 5JJIA 2PS1A 4I1IA 3N58A 5TX7A 3AI2A 3E7DA 1ZVQA 2CBXA 2Z2XA 1EVKA 1MO5A 7REQB 5L7WA 1DC3A 3I09A 5LZ8A 1ZR2A 1PR5A 1GIAA 1GKUB 3D5TA 3RJZA 4YGXB 4MV9A 2HK8A 4M76B 2R8YA 3ZV7A 4GBGA 1RYNA 3WDKA 2PHZA 2UYYA 3PGXA 1Z9BA 1Q6YA 2VKQA 4G1CA 4DGQA 3QX3A 1OZAA 4OUDB 4RKWA 3ZY6A 9ABPA 2WF7A 1OLOA 2I91A 5IABA 2C42A 4I4TB 1CR1A 3DNPA 2UZ1B 3S27A 2E4VA 2D0PB 1WCWA 5REQA 2XB6A 4PAWA 4BNZA 4DT1B 3K1ZA 1Z5GA 4MV1A 3RU9A 1W36C 1TNDA 2D2EA 3SOPA 4ZD6A 3OZWA 3M9LA 4FC6A 1XD2A 5DEIA 4ESHA 4LYGA 4BLSA 1YQQA 2O5CA 4KGZA 3P0JA 4YRMA 3ZDYB 3IIIA 5DKFA 1RFLA 1N32B 1J5XA 1MJHA 3HA2A 5DJ5A 1THMA 1Z3IX 4IXMA 4KIUA 4R69A 4X1KA 3SXUB 3ZUPA 1H6AA 3LT2A 5D1HA 4CLOA 1LY1A 2PLAA 3PDIA 4BMYA 4I66A 1J2RA 2BF7A 1Y5IA 2O7VA 3DPSA 2VPYA 3G8YA 5E1OA 4OBXA 3GEEA 3N2GB 4FDUA 3CH4B 1LB1B 3C0KA 3MTDA 4EBBA 8ATCA 3R7BA 2XUHA 1IRIA 2FPWA 1UKAA 3MJTA 3Q7SA 1S2GA 1UWKA 4NHEA 1BGWA 3O90A 4IHAA 1NBIA 2XEDA 2OLKA 4B8ZA 1AKQA 2ZGVA 3RE1A 2W8BB 3SZOA 2QD3A 2QT0A 3OSZA 1Q0RA 4CMEC 4D4MA 1IDOA 3BFJA 2BFEA 4KYTA 5DI9A 5KNBH 3GCGA 3O4GA 4IHKA 2BT4A 3K1AB 3NI2A 3PFBA 5AOCA 1JEDA 2YMQA 4PZCA 1BX3A 1G3MA 1Z26A 3LFHA 2CHEA 2WT4A 1HQYE 1N3YA 2X8JA 3JD3A 4IOLA 1WD7A 4RXTA 1QO0D 1P9OA 4K9SA 1BFDA 3VPAA 1K89A 1V71A 3Q6IA 1THTA 4MUNA 4W9NC 4LZJA 3WGIA 4MRSA 2PO7A 1HLFA 4MGKR 2CUNA 2Z43A 4RLQA 2NNLD 4QYIB 1C50A 4BX0A 5KQSA 4IRMA 1R3DA 3KNZA 1RQ2A 3L7BA 2HDHA 4ER5A 3TECE 4FEYA 3LGAA 2I7XA 3C70A 3IBGA 5TT0A 4NCBA 2ZITA 2XD9A 5IVIA 1O96B 3I45A 4RE6A 4NH0A 1UKVY 3V2UA 1XZAA 3WB0A 5CEEA 2J3QA 2B9EA 1T6ZA 4HZUA 4I55F 5IBPA 4MZXA 4HNVA 1KH1A 5FUMA 3NEPX 1PKEA 2Q5LA 3SJAA 4RLHA 5AKLA 5EE3A 4Z53A 1WB4A 1R0RE 1NHGA 1E3IA 5F1PA 2ID4A 4G5SA 3WYCA 1YZYA 1L5HB 3QEOA 4LW8A 2HHLA 2XDQA 3NRCA 5DP1A 5G4KB 1ZO8A 1R5JA 3QYJA 1GZVA 5CYPA 5AXDA 1CYEA 3ZHZA 3VU9A 4BZPA 3F7MA 4XQGA 5IW8A 1UC8A 1PG5A 2OG1A 1E5VA 1WS6A 2B7LA 2R84A 3EC7A 3FZGA 3I9NA 1UOOA 2Z57A 5TVKA 3KE8A 4F1JA 5AW2A 4IJ6A 2X15A 1UQRA 4Q82A 1XMIA 4MKHA 4QOFA 3BQNB 3HNPA 2NU9A 1VCOA 2ZFUA 3PDJA 2QRGA 2YW9A 3AEXA 2J32A 1OWOA 3MPOA 1N9ZA 3RAEC 1FLAA 1NWCA 1VSUA 4LDQA 2VJQA 1W88B 3WB1A 4HNAB 1AY0A 4CCYA 3V4ZA 1U3WA 4WZ6A 4C7VA 4LECA 2MMCA 3TZHA 1SGWA 4PN7A 1E89A 1PFVA 4LVOA 2O19A 3KTAA 3PNKA 2X3UA 1Q50A 1KDYA 3HO1A 3UJ3X 1RAFA 3INYA 4M88A 4IGFA 5E9WA 1IIRA 3TI9A 2BM9A 3BAZA 3TW6A 3H9JA 1QZ3A 1ZZGA 4LE0A 1RJFA 2ACWA 3T8YA 3GLFE 1Z0IA 2W2KB 4MQ5A 1F2UA 1Z39A 1WF3A 2WB2A 4LNUB 3R0VA 3RUFA 2WV9A 3FWZA 3O95A 3OX2A 5DTIA 1Y0BA 2EZUA 4L5CA 2WNSA 2WPNA 3TLXA 1NV8A 3HVJA 1YDGA 1USGA 1QH1A 2ZSHA 1YOVB 4AYXA 3ZVMA 3FSGA 4HGRA 1PD0A 4TPKA 4ZREA 1GSIA 2ZWVA 1NRWA 1KXJA 3B2QA 5H3CA 5BWNA 4FUTA 5BNWA 1YQEA 3KBOA 4LRYA 3VHXA 1FLDA 1DG9A 4N5NA 3OG9A 1VFNA 1KWKA 2VPIA 1JTEA 4OL9A 1XTKA 4QGSA 1A71A 1RWVA 2RGNA 1BDBA 5DXFA 1RDFA 3QNUA 3WLFA 3P4XA 4I6JA 2BC9A 2PBFA 1XNGA 4BVAA 3A37A 4O2BF 4EGSA 2IDJA 4RDCA 1GLGA 4AZ0B 2Z6UA 4G1MB 3CR3C 1YHZA 4YJ3B 1J09A 1NVFA 3DAPA 4PLZA 4Y0VA 3PWSA 2I3BA 3TLGB 2QI9F 2P27A 3MGCA 5EOVA 3GOHA 1P1RA 1T5IA 4GMFA 3WGJA 4KR7A 1O6FA 2H9IA 3PLAE 5DNAA 2CBGA 3GRPA 5EMKA 3OOWA 4OKIA 5JPCA 1II8B 3A6GA 3MQ2A 3GLGE 3FTEA 3EPRA 1GILA 3HI4A 2D62A 1EIWA 5DN6A 1QO9A 5FAKA 1Z8HA 1FRFS 2X9VA 3ZTTA 1D5WA 4L57A 3EXHB 2RB4A 3PC8C 3S1SA 1GPWB 2OECA 2JD1A 4FD2A 3P2EA 4NDZA 2YFHA 4IR7A 5DHFA 4OREX 2XGOA 1HX7A 3HLYA 1CHDA 1VIMA 3EIFA 2R751 5DP2A 2EIHA 5KDLA 3LA6A 4UNIA 1FFHA 3E9EA 3LE8A 3VPFA 4LXUA 1PI3A 2C95A 3OM8A 3QUBA 1GKIA 2WAXA 5H3LA 4EYQA 3UG7A 4ZODA 1W52X 5TLSA 1E2GA 2O8FA 1XQ9A 2VF5X 4ZT5A 3AU8A 4B4WA 1C3LA 5DYTA 1XJ5A 2W6MA 3AEUA 3WG9A 1SC6A 1VGVA 1WMAA 5K7SA 1SJ9A 2JGEA 1DHTA 4PGGA 5M7EA 3D02A 2EGHA 3FPSA 1JX6A 2A7XA 2B35A 4PE5B 2H9YA 2W98A 3F6EX 3I5UA 3HCBA 1C4OA 3NWOA 1DAIA 1YQGA 1NP3A 1YUBA 4HDAA 4F5ZA 4MH0R 3PCXA 3X1WA 4J0GA 2R8RA 5FI1B 3B6ZA 3EGDB 3OZGA 2BGIA 1J5EB 1SUWA 1XZMA 1X42A 2FZKA 2WV7A 3FROA 3GFPA 3Q4GA 2D59A 2XZDA 1I4WA 4D41A 1T9CA 3T4EA 3E27A 1GG5A 2O7SA 4YMWA 3SHFA 5I7UA 2J09A 2XDYA 2QUBA 4NENB 3INTA 4O2AA 1XDDA 3QTLA 4I1UA 2F3PA 1G20E 1I4LD 3N0VA 4XVCA 2V7VA 4COOA 4RHXA 3F1LA 1I94B 2Y0BA 3TB6A 2G8NA 4FNGA 5I47A 5L3RA 3ECCA 4G8CA 3R6GA 3S7TA 1DKMA 1KZ6A 3NYIA 4PGMA 3KSUA 2QG4A 3RAPR 3T0IA 3AFNA 5FNVB 2EOAA 1MJGM 4E46A 3PNVA 2GKOA 1RVDA 1SHLA 2AQHA 2BF4A 4H7PA 4RQAA 3C7CB 1NQUA 2Q0SA 4C4RA 2G6BA 1QG4A 2J5XA 4R54A 2BVNA 1GM5A 2J4CA 4RK1A 3LECA 5ITZB 3ZCTA 3W3ZB 3CRRA 4PV7A 3H6KA 4LBWA 4JI1B 3K35A 5FEMA 2AMJA 1UBHS 5D84A 4ER7A 3SXJA 3UYKA 4A73A 1VKNA 4G1VA 4R1TA 4DNXA 2RHHA 2CW5A 3QVGA 3JQ8A 1CZHA 4RGVA 1G60A 1HXHA 4BFYA 1FYWA 2JCXA 2TRSB 3H13A 3U7FB 1WDMA 1IE3A 2HWYA 4MS1A 3SF8B 1E7YA 4IG9A 3Q3CA 4OI0A 4OYRA 4H27A 3NDIA 1M1XB 1ECFA 2VAXA 3ROGA 1WZEA 2RHWA 5U4XA 3WL6A 4DEVA 5BVHB 5JANA 2O8FB 1NVKA 3C3WA 4NCJA 4LHWA 1GG2A 1V7ZA 4YUZA 1GFSA 5L9AA 4CTOA 1RWWA 4ZIRA 1CQPA 5CNMA 2IYEA 3L40A 1X0VA 1FS4A 4L4RA 4P7KA 2PMEA 5G1NA 3ANTA 3OETA 5G3YA 1JLSA 1OLXB 2XZPA 3TNYA 2DR2A 2JLXA 4BGUA 2XTJA 4GLOA 5DGTA 2V55B 4HGQA 1H8EA 3NXKA 4GDMA 3WOVA 5B1EA 2OFPA 2WTXA 2QSUA 2G72A 3K0CA 1JA0A 3M1LA 3H65A 1XQ6A 1E0SA 2P9QA 2UXDB 4W5RA 1NASA 2B98A 3ACBA 4QU0A 3UJNA 1KRXA 4KQWA 5JWOA 3N75A 1WNFA 1LJLA 1Y37A 5MFPA 1NQ5A 2DH6A 3U3MA 1H0RA 4MVJM 2R7NA 4UMDA 1I2ZA 1B74A 1R8JA 2C2GA 3FWNA 5AM2A 5K09A 3ZGYA 1N6LA 3JALB 1L7AA 2JARA 3HDHA 3STVA 2RG1A 2VXOA 1TUGA 4Q48A 1JLRA 2N0SA 3IPCA 2E21A 1EZ4A 2NSYA 2NTVA 2PJDA 4L4XA 4ND4A 3RI3A 2WA2A 1R7RA 1RJ9B 1EUYA 2GZMA 1TCBA 2RHBA 4FFPA 3ZLBA 2PKCA 1P1JA 1AT1A 4JFAA 4ZAFA 3D81A 3H11A 4HDMA 5AKIA 3DW3X 4IAOA 1I4DD 1HYQA 4OO3A 1VE9A 2D8AA 4KGDA 1FXSA 4MQMA 1E3WB 3N9IA 3V1LA 3WLNA 3PFGA 1F9AA 4GL2A 4L85A 3CJQA 3G9QA 4GKKB 1YZQA 5IN5A 3AFHA 4M49A 4NPHA 2OXIA 4FR0A 2IYPA 5FV7A 1FF9A 3ZI4A 3EC2A 4FDAA 4CGYA 2IS2A 4C2BA 1XV5A 3KETA 1LPMA 3PBKA 1QH8B 1RCUA 5DNCA 4EX6A 1NKVA 3TQCA 2HOQA 2JFOA 4JYZA 1RWOA 3VZPA 1SKAA 3T5DA 2PFKA 3B60A 3IIMA 4QGBA 4R1OA 4BCDA 3MJVA 5CVCA 3UK7A 3CVWA 4C3OB 1SUSA 2X7XA 2ZS8A 1JDUA 3E1GA 2PNJA 1QLWA 1QQ6A 3GJ4A 1WUYA 4HH1A 2ZIXB 3B9RA 2DUNA 4DYHA 3O93A 2E49A 1J23A 2EF1A 1YJBA 5M2QA 1JHMA 2EFJA 3DA8A 5HQTA 5EC8A 3SOZA 1NUHA 3R3JA 2G9NA 4EENA 3PNQA 1X1SA 1Q2UA 4Z4FA 2H63A 3WRYC 4W5WA 1EDDA 1CPYA 2CXUA 3SEZA 3C48A 4CLOB 5KHOC 3QPCA 2Q1WA 2X4LA 2QVLA 3OJOA 2J9ZB 4XCVA 4IDOA 4Z0HO 5HUJA 3V5NA 4NCAA 1N5LA 2BSXA 5K6RA 2AYZA 2RI6A 1E2PA 1PR4A 2XY4A 4RX1A 3VHLB 3EDMA 3S29A 2CXXA 4LSMA 3TSYA 3LIIA 1HE4A 4LC1A 4RVCA 2PXAA 2E6UX 4RZXA 2V3VA 3QFRA 1TM4E 4Y2VA 1XF1A 4JKIA 4TTTS 1U2DA 4WZAA 3JZMA 2XWQA 4YAJA 1BEEA 3OQBA 4XIFA 5GP1A 2HYIC 4MYUA 3LQQA 5EJ2A 4M9UA 1XJ0A 2QM8A 4NEQA 3CWZA 3GLIB 3LT4A 2NU6A 5FOTA 5IAAA 4TSFD 3I3SR 4S1PA 2Q62A 5CLLA 1T1RA 1LPOA 3GNLA 4ZOBA 2F4VB 3OLWA 1CS0A 4WDQA 5H0IA 3TSZA 5F77A 1CJTC 1QKKA 5CXQA 5EJ5A 4IV5A 1NI4B 1TU3A 2ZDHA 4PC6A 5ALFA 4QHYA 2OCIA 4PSAA 2VXCA 4XDGA 5AVOA 5ICCA 3HYCA 1H4SA 4YGYA 5EMMA 1UBJS 2FKNA 4HMQA 1VYHA 3D6VA 1H0KA 3PIDA 2EXXA 1V5FA 4X1YB 1C4KA 4DSNA 3C7KA 1C1DB 3IOMA 4CYMA 4I6EA 1UODA 5KCZA 1DADA 2PO5A 4EFLA 3H6HA 1MO2A 5FO1A 2VG8A 3NTOA 4IJVA 1QQBA 4OP1A 2R8ZA 1E1YA 3BJZA 1QHYA 4GOND 4KACA 5FUVA 4I4LA 2C5AA 1VI2A 2NVUA 4WXPA 3S40A 4Z4CA 4LXGA 1N6IA 3ZVNA 3I5MA 2O8EB 2WJGA 3WAGA 5E7QA 4LJLA 4YRPA 1UFVA 2XEXA 3VNSA 2H1LA 1BJRE 1P2VA 5FUBA 4HAYA 4WRRA 3C1UA 5CB0A 2AX3A 2LCFA 4K9PA 1OR8A 3P96A 4Z9XA 1OMOA 4G81A 1FTNA 4YP5A 4CEJA 1U04A 5EQJB 5T8KA 3QBVA 3MLEA 2G80A 1BJTA 2OD7A 4KODA 5AHWA 5ED0A 4S1TA 4YONB 4O1IA 4B33A 1EJ6A 3SD7A 2QW8A 2UYQA 5AW1A 2C9MA 1A5TA 3IQDB 1SY7A 1MX5A 4QBHA 4RJJA 1DTWA 5F1OA 2C2OA 4BV9A 3ZIAA 1EFUA 3LPAA 4MINA 4RMNA 3IRVA 1GAWA 4QJ4A 1P45A 5LD2B 5JNUA 4I50F 3SSMA 5BOSB 2C4MA 2QORA 2PV0A 3BWDD 4PTZA 2GJAA 5ESWA 1GRCA 8ADHA 3O4VA 2R6ZA 1PWXA 2YHSA 1Y9AA 2GXAA 5AKYA 1AZTA 3SHTA 3TN7A 4MV7A 2P9GA 3DTYA 4C06A 4K05A 4DDTA 1M6YA 3MTAA 2FWJA 5ILOA 4A36A 4YO7A 3RJTA 4IH4A 4CMJA 4BNHA 5E7MA 2VYVD 4DQXA 4BO5A 1F7UA 1XZIA 3A6LA 4XZ3A 1ZOOA 5LJIA 4I2VA 4X61A 2BN4A 1W46A 2DEUA 2YWXA 4Y0NA 4F2HA 1OJLA 1YCHA 4CI9A 5BMOA 3Q98A 2VJDA 3S5JA 3UJHA 2NGRA 1Z12A 1YNOA 2V96A 2GZHA 3PS9A 4JGBA 4LHEA 2BFOA 3STHA 3WL5A 4YHHB 3N05A 3C6KA 4JLDA 3EODA 3VZSA 1TEZA 2FPRA 3T1NA 3U3OA 2OBNA 2J0UB 1CR0A 1FU8A 2YWDA 3ZHVA 4R68A 4D4JA 2BGNA 2AN4A 4E12A 1SXJB 1KL7A 1DAMA 2C54A 2PU5A 3GQBB 4J3JA 3UB3A 1KYWA 1Z4QA 3TOSA 4EMSA 4F71A 1WUIS 1ENZA 2I2CA 3AB3A 3OE4A 3I73A 4DLNA 4F6CA 2QPTA 1TXGA 1CP3A 4GGOA 3ZIDA 2HSJA 3W34A 4EOGA 3B1WA 1SHZA 2E87A 3OQPA 1S7GA 4RD6A 3BGVA 1GOTA 3AFMA 1YKFA 2VBGA 3F4LA 1P4JA 1UK6A 1U8CB 1Z7EA 3FDXA 1OTYA 4K9LA 2Q99A 1ECLA 4ZA2A 3FZQA 1U94A 2W2OA 3B1YA 3HS3A 3RIEA 2ZSKA 4ALNA 1GKYA 4L8YA 2AJDA 3SIXA 3GXBA 4QYSA 1ADFA 2VHCA 3M0EA 5CYOA 2PZBA 3ZW9A 4EDHA 1BE6A 4IXWA 4Q9KA 1RE0A 1HZZC 2DT8A 4PGFA 5FPSA 1XEWX 5HM8A 1K0FA 2VP0A 2YJNA 2EX1A 1IBRA 4UAVA 4XE5A 1XJWA 2I54A 4EKNB 2JGNA 1KMHB 2OV3A 1R18A 2REBA 3EC1A 3I6ZA 3GFOA 3AIIA 4RVOA 1ESEA 1RC0A 2BOVA 2YQ4A 1KTVA 3BXPA 2I2DA 3D7NA 4XWTA 3ZV3A 3CRZA 2IPXA 3KKPA 3QW2A 4Y2SA 3NGMA 1M2OA 4UNNA 3PJGA 4Y18A 2XXBA 4LVNA 4ZDKA 1AKEA 1RAAA 1XDGA 4M0EA 4JYCA 3DYBA 4B9EA 1KZGB 3EG5A 1TZJA 4MARA 3KJFA 4LZNA 3BDAA 2H16A 3GCDA 4C0JA 2DQZA 3AETA 3QKSA 4XASA 1U5CA 3NBUA 4BUJA 3M5PA 3IILA 2IHBA 1AURA 2LWIA 4J03A 4OSEA 4FB4A 3I76A 3MLAA 3DDOA 3K0FB 3D7LA 2XBUA 3QV1A 4IIJF 4DLAA 5CITA 3RSQA 3AM1A 1BXRA 2VRNA 4IDDA 1XCPA 4LGMA 3ZQ6A 1KFCB 2OR3A 4F4DA 5HOEA 3EVGA 3JWPA 3R7WB 4D79A 2QTBA 2FPSA 3I9V1 2FFAA 3DV0B 3ER8A 3FETA 4C4XA 3UMRA 1X7ZA 1Y33E 1YZGA 1BQ4A 3VR4A 4J7UA 2K2QB 2QL7A 4P7JA 4Q5IA 3VR5D 1K4KA 4D97A 2X4DA 2VJBA 3AB8A 3VNRA 2ZYIA 3KZOA 1MDBA 2AMFA 2B6HA 1E58A 3UG6A 1VE7A 4TQUS 1X87A 5F12A 1WVMA 1E32A 1L5RA 2QRQA 1VJGA 3G13A 4U2GA 3QVUA 4YV2A 2EP7A 3DE0X 2UVQA 4RY0A 2J1LA 3K70B 3LYLA 5IC6A 2BL4A 3WLMA 1Q3HA 4CUZA 5FUWA 1V3TA 1P74A 4OGGA 4QX6A 4YRCA 1W96A 2A9OA 1YFJA 2Y93A 4UM9D 3AF4A 4C6HA 1NSFA 1Z29A 1DJQA 4X54A 1IK6A 2ZJYA 4IDNA 5JR3A 2CT8A 3RTBA 1WXDA 4LWQA 4EB6B 3U3KA 2A33A 3CNNA 4HXGA 5HOQA 2HBRA 1XXHB 2IT1A 3AT1A 4NFSA 2I62A 1TAGA 3DBVO 4D6XA 6GPBA 3ZDBA 5E38A 4GH5A 1MC8A 4TYWA 3KKOA 3P9YA 2NIPA 3KEFA 4DXAA 3CF2A 3A32A 4P4UA 4WCDA 5JVDB 5JAIA 1E99A 2XUJA 1G55A 1B2RA 4MRAA 3K5HA 1AMNA 1RLOA 3L7CA 3PX7A 4CR7A 2HRCA 3R76A 3QA9A 3BXFA 4CLHA 4JSTA 5DASA 3VR6H 2WWYA 4D3SA 2JGMA 1QZXA 4ALKA 3H4MA 4GX1A 4LJ5A 4MRMB 1D2RA 2YVAA 4QEKA 4KUGA 4D4KA 1E4EB 3RS0A 4U2DA 1OH8A 4B2PA 3VR6A 4GGPA 2OCBA 1Z2AA 4H2DA 4JI3B 4BNJA 1MD9A 2YKGA 3OPXA 1IYZA 1YAJA 2GD0A 3ENQA 2NUPB 3OKCA 4IO0A 4Q34A 1SOVA 1AUVA 3BWVA 1ZL0A 2WIDA 3R77A 1RLUA 3A9RA 1PL8A 3LUPA 4H1HA 4YCJA 2J3IA 2WTBA 2V98A 3DD5A 1TLTA 3BFPA 3I8XA 3NU1A 4BX3A 1VE6A 4HGPA 3DT6A 3M7IA 1CY8A 3KXLA 1CQIA 1FYVA 4LA4A 4RYLA 3V8EA 1Z18A 3ZHYA 1UBUS 1W5AA 1FMFA 4M8LA 3ZKAA 2EKZA 4M9SA 3FNHA 1QJCA 3DZHA 2FK7A 2XODA 4CDRA 4ZU3A 1T6BY 1WMFA 2I2AA 4E2YA 4UAUA 3QE2A 4IIEA 4B5KA 1DX9A 4CDNA 3MJCA 2H1SA 2NZVG 2IZOA 2P91A 5DSXA 5DYYA 2QE6A 3WWCA 4IH1A 4X45A 1EQAA 1E6KA 1SBQA 4JY7A 2NN3C 5KYNA 2R1VA 2M2IA 2O1XA 1BA2A 1P2BA 3LUAA 2YY7A 4MA0A 2D0OB 3U9LA 1L3CA 4REQB 5A62A 4GOXA 1DKQA 1H9CA 3WK8A 4UM9B 4QARA 2O8BB 3IIJA 2PKYX 3QMWA 4AD8A 2CLHB 4YAGA 3T3MB 2AMLA 5BR8B 2B4QA 2IH2A 4IP0A 1E2EA 2BMWA 3KUCA 2JH3A 4UDXX 3DYIA 3ESRA 1MEJA 4UD6A 4ZHQA 4YQFA 3DOOA 2A92A 1Q0ZA 1RCFA 2DJ5A 2OKGA 4KE8A 3BD8A 4XVRA 1LNQA 1G0NA 2XB8A 2BKAA 2CYAA 5FXMA 1FJGB 1L5LA 1X38A 4G37A 3D4PA 3OIGA 1Y9DA 1TCUA 3T9DA 3ME5A 2NNWB 4QELA 3NBMA 1WKVA 2J08A 4A1OA 3QOFA 4PLGA 1EX7A 2C3YA 3O4IA 1OLSA 3C3AA 1NKSA 4IHQA 1YZKA 2JLRA 2VTKA 1MC1A 3BTSA 1RKBA 3B5IA 2ROQA 1ATZA 3ZR4B 2P11A 1GUYA 2HJRA 3WB2A 3A1FA 2WD9A 1BJKA 2PGIA 1Q74A 2R6FA 3LX4A 4NEHB 2GKSA 2XADA 1KVUA 3KIPA 1SVUA 4YP6A 3L8MA 2CVZA 4EPYA 1FZQA 4C76A 5TMBA 3GGCA 4Y9DA 4D9IA 4D46A 2Z6VA 1E3DA 1RYBA 2VJCA 1K8YB 3CRVA 4F8JA 5D3MA 3BIFA 3CVVA 1KMMA 4YROA 4NVRA 4S1OA 1ZBDA 2UZ3A 5C2JB 3M9XA 4MTLA 1EK5A 2VC2B 3KCNA 1PV1A 1JQBA 1S1MA 2OFOA 3CMMA 4GBMA 3EZ7A 1PWYE 2A57A 2YQZA 3FIUA 3P9NA 1BDHA 2ACKA 3TS1A 1UZMA 4C4AA 4YIKA 2DP4E 4GZMA 4UQOA 3H3XA 3TSCA 3VRHA 1BTOA 1MTOA 4MLPA 4RE5A 3NXSA 1HT3A 1LS6A 2V4UA 3N59A 2B2NA 1LPBB 4ND1A 2HB6A 4Q15A 3FYUA 4R2HA 5K3FA 3WLKX 4RTPA 4RVFA 2W0SA 3CEAA 1PR0A 1F8UA 4C9BA 1JHQA 1PUIA 5D5QA 1CDEA 1GSOA 1O5IA 1X1EA 3EXAA 3PUWA 5EP2A 2WJIA 3G8AA 3SWWA 1AC5A 2IKSA 4NONA 4S0ZA 3KT3A 1QONA 1NUUA 3OZFA 4C1BA 4AIIA 5HDQA 2BFMA 2CXSA 1GGHA 2YIJA 3RIXA 3U4QB 2WF5A 4N3NA 3T06B 2LV8A 1Y6QA 3IMGA 3PD7A 4U3JB 5KAPA 4RM2A 3GMSA 2XMZA 1O2DA 5HZMA 2PUCA 4ZYUA 5EXXA 3W6NA 4DN6A 4KH1A 1ILEA 1U3FA 2HPHA 3MWEA 4JASB 4MQ4A 4PBRA 3R5HA 2J07A 4YIHA 1ZA2A 3TUJC 1TJ4A 3MT0A 2B1IA 3P9SA 4QYMA 3THRA 1J8YF 1RHRA 3WTCA 3NB0A 5B3JC 4EI2A 3C7DB 1YKGA 2P7HA 1P19A 2IPNA 3BXHA 3O3MB 4MP6A 4UOQA 2I76A 4PVDA 1KETA 1ND6A 4O59O 5A2QA 5D6NA 1NUTA 1KYIA 1K2VN 1CNFA 2I8CA 3PR1A 2ZI9A 4XWWA 3GJRA 1QGZA 4QYXA 3KPWA 4KK3A 3VO9A 2QN8A 4X0EA 1RXUA 2ZE7A 1NNUA 2NTEA 4MQFB 4XX0B 3EEOA 1FP4A 4IMPA 4NQRA 4MV3A 3X1MA 3LDGA 3C5WP 3F8TA 1Y9ZA 1W29A 1WAMA 2CNNA 2HPVA 1OH7A 4NZOA 2R3SA 3PJEA 3PC3A 5IS2A 3GLHE 1PVOA 3BERA 1NAHA 3DULA 2WNHA 4NBVA 2P67A 4O6VA 5C32A 3I52A 2R6JA 4GR4A 1PJQA 3Q10A 4A3SA 1QCZA 1T8SA 2BHRA 3RFXA 2CY0A 4FM9A 5F35A 2IH4A 2CLSA 1N5DA 4AQDA 2O0MA 4QRDA 5SY9A 2OHIA 4PINA 3L0SA 4TL7A 4EAQA 2JIMA 3HO8A 2NXJA 3WY9A 4FYWA 3E1KA 4KQIA 1P3DA 2PGAA 1YA4A 3GFQA 3L0OA 4RIGA 2ZPTX 2RHTA 1NVXQ 4EHHA 1X0XA 3OKFA 3A6JA 4V0SA 1INLA 2QYOA 3DKPA 4M83A 1PNQA 5LM3A 4OB7A 3V1TC 4CQLA 4M8SA 4YI5A 3UAZA 4IF6A 5CA1F 2DB3A 4FE3A 4QLBA 1PGNA 2MMGA 2QTCA 3M1AA 3UB4A 2GEKA 4M6WB 3W05A 1JKJB 5ALXA 5C4IA 1N7HA 1O5TA 5K6AC 2IS1A 3MHTA 2V65A 4M1OA 1UXGA 4Z4GA 1Z5ZA 2JRLA 4ZOAA 5EKTA 3UA4A 2GK6A 2Q9AA 3UUFA 3V4LA 4YCLA 4NS4A 4L7VA 3IR7A 3AF6A 1M0SA 1TYZA 1FMJA 4MUGA 2GPBA 1JQ5A 3LWZA 5EZYB 2B4TO 2AJLI 2M6RA 3MS4A 2LBPA 4U02A 2WQZA 3WYDA 1QF7A 5J63A 3QNMA 4OB8A 5JROA 4INPA 3ST7A 5I6DA 1Q95A 2O2JA 2POQX 4WOCA 5KYXB 1V5IA 4K6OA 4U5QA 4WCFC 1TD9A 3R4CA 1OWNA 4KAJA 1XQYA 4JB3A 4PAOA 4ZT2A 2ATVA 4ISCA 3KU4A 5PGMA 1NW4A 3PKZA 2XSZD 3N6XA 1TF5A 1S2DA 3IEUA 3G2IA 5SZIA 2EFEB 1QQ5A 3I9MA 5IEJA 2OHGA 3G7NA 1XVUA 2GPSA 2XWJI 1Z68A 1F2TA 1NTOA 2QSJA 1YI8A 4RPJA 2R79A 4RVDA 4AXBA 4MMXB 1OWLA 3PXDA 2VHTA 5AJYA 5CYFA 4YT2A 1IZ0A 5ADUS 1K5GA 2P2YA 5CK5A 2QIOA 4R4JA 3BPSA 4RZIA 3N8NA 3AOEC 2WHXA 1N2CB 2GBPA 5BSUA 1A9TA 4CQNA 2ODQA 2C00A 1LBTA 2R7KA 4FSDA 3SQNA 4ZDJA 2I9PA 2CB9A 4DUGD 5C1BA 1ZD8A 4GZ6A 1JW9B 4C4TA 1O08A 1K75A 1P81A 3HACA 1H65A 3EVTA 2O14A 4LMRA 3TXYA 3ZDAA 2ZTMA 4JC4A 3A27A 1Z2EA 1Y4ZA 4BTEA 2B0CA 2JD0A 1VI6A 5HP4A 4G1FA 1YKSA 2ODBA 4QE3A 4ZEXA 5B7NA 4LMPA 1NC3A 3TIVA 1NR1A 1HYHA 5C8DA 3PCTA 4QUGA 5CU7A 3WGOA 4Q7LA 2HU8A 4B7ZA 3MS2A 5ADWA 1ZWLA 1KH3A 3ROMA 1D07A 5LMZA 2N42A 4JA2A 3X1KA 3FD8A 3HXPA 4NBTA 4D44A 2PIAA 2X4GA 1L2TA 16PKA 1EJ0A 1IB0A 2YUTA 3W8RA 3Q7RA 4UHHA 3RABA 5U4QA 3OTIA 2V8OA 4A8PA 4EDFA 4M9RA 3DZ8A 1EHIA 3I2YX 4Y2YA 3AF1A 1EVZA 2PK3A 1BXRB 3D9QX 2PX2A 4OGWA 3TAXA 1G5RA 3CGWA 1VL5A 3E23A 4XUCA 2VS1A 5DT2A 3P19A 2C77A 1XRRA 1H1LA 3NZEA 3CWQA 5B53A 1BHQ1 4KLNA 3K6JA 4BQIA 2YZMA 5EE5B 5CYGA 2X1MA 4YP1A 2VJMA 2BE9A 2W4QA 4FGKA 3JASB 3IP1A 5HBRA 2BLNA 3K0AA 1W9MA 3LK6A 4ZJUA 2HCBA 1JDNA 3CRW1 1OKKA 3P94A 4RUKA 4KMMA 1KI9A 4HRYA 4LHVA 3SZRA 2JHGA 2QRPA 1L4EA 1WLSA 1HL3A 2OAGA 3HDYA 5K4AA 4DWVA 4Z7OB 1XK6A 3N07A 4EUFA 1XALA 4Q7MB 5HQ3A 1IVYA 4JROA 4BMDA 1YOBA 4ZCPA 1NG9A 2P65A 2ZIEA 4QYTA 4V02A 3FKQA 3P0IA 5FOWA 4AKHA 1Z28A 1LLDA 1U7ZA 3A04A 4N5HX 4RDHA 1AQUA 5F51A 3TJMA 2J3DA 4DIEA 3AJRA 1BWRA 1U2QA 1XQ1A 2C7VA 2VSFA 3JRWA 1PJBA 4Y6OA 1QHSA 3U7JA 3H04A 4EG6A 1TVMA 1VCIA 1XB2A 2DHDA 1PHRA 1M1ZA 3CCCA 1FFAA 3QU7A 4I46A 3FDJA 4LYHA 4GL4A 5JZSA 4IGAA 1JYSA 1K3FA 1MVOA 1NOJA 3MJDA 2QP9X 4CMKA 4EHFA 3X1ZA 4E33A 3T5AA 2EFYA 5DCYA 4GI2A 4L8GA 4J2TA 3IQHX 1A7KA 3UICA 3L7JA 4Q3BA 4R9RA 1LK5A 3EZ9A 5KSOA 2O59A 3ZE7A 3SBDA 2G5GX 3KUDA 1NW8A 1TCVA 1B0AA 1POWA 1F3OA 1DT3A 2IOQA 2Q45A 4I1VA 1HTTA 3AF2A 4X7BA 4ZMRA 1F2VA 3C3JA 2AB0A 2YJGA 1J0EA 4MVJH 1EVJA 1G8MA 5JAZA 3FVRA 1NI4A 1E5TA 4N6NA 2HL6A 3C3CA 3CC8A 3MJSA 3EEYA 4HEHA 3G2KA 4NMMA 4C4YA 4DRYA 4EI9A 4OGFA 4RLSA 3TJRA 1OXSC 4X6UA 2C92A 4AIRA 2OO7A 3F7NA 2Z1DA 1UT8A 3FPBA 2ZYUX 3WGTA 3H3FA 5FLKA 1K06A 5EHNA 1DUVG 4QU9A 4PZAA 5DBFA 2LDXA 2C9OA 2ECOA 4XM1A 1I3MA 3WOHA 3D8TA 2IX9A 2XDAA 4BXOB 4GR5A 3LRPA 3GD7A 4QAQA 5IHPA 1MIHA 1KI7A 2RIRA 3AHCA 2PX5A 1C3VA 4NG5A 4QYIA 2F3UA 2OCDA 3DMRA 3BRWD 2RC6A 3IOYA 1J70A 1M2GA 5DTEA 1KYTA 3F6CA 1PVDA 4K3VA 5TPWB 1JQJC 4IIBA 3DMYA 1B43A 3I2JA 2PUGA 1WU8A 3BDVA 3W9SA 3WIUA 1E1KA 1G9TA 4LZWA 5K2OA 2JD2A 4MJXA 3TRJA 3L0PA 2XRZA 1ZSVA 3QTTA 2D5AA 2PH7A 2C0CA 3PL5A 2GPJA 2EKLA 2GTIA 3E0XA 1JG3A 1DQSA 1IJBA 2JJMA 3PYXA 2WZCA 4HC4A 5EL0A 3OMXA 3QVSA 5A9RA 4ZVLA 3RNOA 4OV6B 1GXSB 3BQMB 4L95C 5ESDA 4RXMA 3EZLA 3RHTA 2X5OA 1AQJA 4JQCA 1KEEB 2FVXA 5K8IA 4YV1A 4UBIA 5IT9A 1GA1A 2QTZA 3W4KA 5AVRA 3HBLA 4DDMA 1P1BA 1CNEA 1N3IA 4M0DA 1JDTA 3UKDA 3IC5A 3QJYA 3V42A 1WP9A 2M6SA 2FE4A 2Q1UA 3TE6A 2WD7A 2OCKA 2FCRA 1N0UA 2PVSA 3KB1A 2OAQ1 4C5BA 3H2SA 5IKPA 1TAUA 5JY1A 1GKLA 2HCRA 2VLIA 4UZEA 4HNSA 1I7QB 3MYYA 1YTUA 3AVVA 5CVTA 4ZRDA 2IYNA 1JYFA 4DMHA 1ZNYA 5E95A 3I01M 3QVWA 1B0ZA 2CUKA 2VJPA 3H97A 2XJ4A 5DYNA 3TZKA 3CF0A 3LTNC 2XE4A 5CX1B 4L73A 4O0MA 3EBLA 3MWDA 2E5FA 2QD4A 3G49A 1JDBB 3TLKA 3GNQA 4B6FA 3C98A 4BQSA 3GDHA 3BSWA 3GW8A 4RC9A 4X66B 4PHGA 2WJ4A 4MJ3A 3V7UA 4IVRA 2I34A 1CUGA 4PXAA 3HEMA 3GMDA 5CXSA 5KOYA 1KJNA 1RNLA 4MAMA 4ICIA 1IPEA 1WPXA 2IU6A 2VWPA 4OMCA 4BO2A 1JDSA 2ZVDA 3WC4A 3RC8A 3P5SA 1AZWA 2Y67A 4PY2A 1LX7A 2OHJA 2ZWMA 4D9NA 3JAKB 3MD9A 3W2HA 3QFFA 2GKGA 2IVFA 1M3SA 1Z83A 4PYRA 2IXTA 1P3JA 2IEDA 3F8SA 5E4JA 4DA8A 2ZT5A 2EKPA 4YMUA 5BVGA 3D5EA 3OZSA 4AWBA 1Z22A 3QQ5A 4OFWA 4PZ9A 3PE6A 2Q49A 3ZKWA 4GOJA 2OD2A 3DBHA 3FSGD 4IPTA 2ZUSA 3EF1A 5LQDA 3E05A 3CJTA 5FTNA 4ZI3A 9GPBA 5DZSA 4KYIB 1AS0A 3NS7A 2FKAA 3WJ7A 1E59A 1G8FA 3TQHA 1YRWA 3UTDA 5CVVA 3PJFA 2XSZA 4OYYA 3CZCA 1IUPA 5HF6A 5HX7A 2OK8A 4I55B 3A8TA 4JBWA 2VA8A 4QNRA 4BKMA 4KFSA 4MULA 3G5AA 1DWQA 2X0NA 1JPVA 1SMKA 3R9KA 4NJEB 2VJLA 4O2RA 5AW5A 2PJZA 4CDMA 2HRZA 5HM6A 4MS1B 1EBUA 3OJ0A 5LBTA 3OH8A 3Q7EA 3TK1A 3V2HA 4MJLA 3WLTA 4TVKA 1SBNE 1QCYA 1Y3HA 5JDCA 5MHTA 3KYCB 4ZPXA 1BS2A 1ND5A 2I4RA 4HFRA 1MO4A 2PKWA 3KRTA 4AUNA 3U7QA 1A1SA 3EMDA 4OSOA 4DMRA 1T3HA 3EXHA 1G7SA 2GN0A 1SEPA 4B82A 1E66A 3GZ4A 1UMKA 3NHBA 2HFJA 2ZJ4A 3CBGA 2D1FA 3IMKA 3DXYA 3UJPA 2LW7A 3R3WA 4E14A 2OV8A 2OZEA 2RAFA 4E4TA 2XUZA 2IIBA 5JS8A 4QLAA 2Y1DA 1I3OA 5BSHA 3LC7O 3MJFA 3M6WA 2F00A 3EXG2 3D3QA 4BNWA 3UTCA 3L1KA 4HEA1 4NJMA 4RKYA 1S89A 3BJRA 1IEWA 3UH0A 3K6SA 1AX9A 2A9QA 3MNFA 1TAQA 4NATA 3URKA 4JELA 2BGWA 2ZRPA 4I5DA 5GVRA 1U2RA 2LGJA 4IEFB 1ZNXA 4YECA 5KJ6A 1IOWA 1CY2A 4EUNA 3HU2A 3DGFC 4W9MC 2Q8PA 2PCLA 1CLUA 3GQVA 4G5GA 3VYRB 1UC9A 1U0TA 4RMIA 5EWMB 5DBIA 1F17A 1WXGA 3EVCA 3N0WA 3OEEA 3TVDA 4L16A 5C8ZA 3AJDA 3G7UA 1V16B 4OH7A 4K6GA 1QG2A 3QY9A 3ODPA 3T0FA 1E9DA 1KY4A 1CX9B 3P9XA 4G4IA 4KVFA 2ZR7A 4J43A 3LWNA 4ID9A 1TF7A 2GYWA 1Q21A 1YGPA 3WLRA 4NYIR 4JLVA 3W79A 4EBFA 2COUA 3J7AC 1R10A 1TZ2A 1DRUA 4BLQA 3KXKA 1RQLA 3A3PA 3O92A 2I4LA 4LCBA 2NM0A 1QIEA 1LGYA 5CG2A 3ZBQA 1CR4A 3FAKA 4MR9B 5FOVA 1J49A 1T5DX 2AXPA 1U8ZA 2O7QA 4YRBA 4KFUA 5CDFA 2WUEA 4AF7A 4DLXA 1YZHA 1XTIA 3V2GA 5D1NA 5BW5A 2BFFA 4IJ5A 1CUEA 3AMVA 3REOA 4QDZA 4IILA 4BNXA 2Z1NA 3E35A 3A2LA 1V7CA 4X9XA 3L8DA 4G0NA 4GLLA 5AUPB 4I9UA 4Y2GA 4XYBA 5JMTA 3PLRA 4TTPA 1MV8A 4N0MA 3FBGA 3LRTA 3DL4A 5KNDH 1WV0A 3NEYA 5JUWA 3E82A 4HOYA 5FL7D 4QDTA 4CKYA 5LLDA 3K31A 2AF3C 2GCOB 5F76A 3NDBB 4TKLA 2J3EA 2HNAA 4OPMA 3ADOA 4ITVA 2FE1A 2MR5A 2FJ0A 2WMYA 4QJ5A 3TZLA 1DARA 4JJ4A 1K7CA 5T41A 2AQIA 4DM7A 4MWCA 2EZ4A 3Q7QA 4ERNA 1NBMA 4RY2A 3AKZA 3LZ6A 2YWFA 5HR5A 4K46A 2VZ8A 4LXIA 3LC2O 4OQPA 1PJ2A 2NX2A 3RS4A 4K1LA 4ZI7B 1LPPA 5MGNA 4GYJA 2OO3A 2A14A 4R1MA 4XRRA 1YK1A 3UMGA 3ICPA 4MB2A 2GN2A 3EAFA 5ALWA 2A0KA 2REOA 4MVYA 2VJOA 2OFWA 1RP7A 5CIWA 1SUCA 2WJHA