5HIEA

Braf kinase domain b3ac loop deletion mutant in complex with dabrafenib
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
269
structure length
258
Chain Sequence
b'DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Activation Mechanism of Oncogenic Deletion Mutations in BRAF, EGFR, and HER2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 258
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hieA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hieA01
4RWJA 3FLWA 2WQBA 4JG8A 2ZAZA 3BLQA 5EM6A 4TY1A 3QA0A 3GUBA 4KKEA 3ZFYA 2XK6A 4GJ2A 4BKJA 3AT4A 1W98A 3FUPA 3MH3A 3RAKA 4Z3VA 3AXWA 3ORTA 4C61A 2PE2A 2R3NA 5JK3A 3TI1A 3QUEA 4C4HA 5KMJA 1OIYA 4G6LA 4QYEA 2GNGA 5GZ9A 4P5ZA 3PXQA 3S2PA 1DS5A 1GZOA 1M2RA 2GHMA 2PVJA 2WMAA 2IVSA 3FI4A 4EZ7A 3Q9WA 2R3FA 3ET7A 2QOOA 3H9RA 5HG8A 4E4NA 4IMYA 2BTSA 4J7BA 2XK3A 2GFSA 5HCZA 4QTCA 3HMIA 3OWLA 4AFJA 5HNBA 5AA8A 4J1RA 4DTBA 4NCTC 4I41A 1WBTA 2BIKB 3K3JA 4F1MA 4XYFA 2IZUA 5A54A 1OL5A 4ZP5A 3DBDA 4M68A 4GKHA 3O2MA 2AC5A 3CQEA 4TT7A 1U46A 3ZLSA 2HWPA 3ZS5A 1UKIA 1FMKA 2XIKA 3FMNA 1YQJA 2XBAA 4ACDA 4FZDB 4F7LA 2OFVA 4D2SA 4Z7HA 5KO1A 4QMOA 4KAOA 4AZWA 2BAKA 1CMKE 5M57A 5GIOE 3PDTA 2PUUA 3MN3A 4TNDA 2R3JA 4QMXA 5AUYA 4IDTA 4JDKA 2OBJA 4N57A 5A46A 5CSVA 3DXQA 5HG9A 4G3DA 5CXHA 2W9ZB 4X6QC 4Y73A 4PPCA 3EKKA 4Z9LA 5I5ZA 4ANMA 5I9UA 5EKOA 1H1SA 5LVMA 1TQIA 3JY0A 4F6WA 3LLAA 2BFYA 1SNXA 2X39A 3WF9A 4RX5A 4E4XA 2P4IA 3KMMA 4H1MA 1PMEA 2VD5A 3RK9A 1XJDA 2XRWA 1FVRA 3LQ5A 3QGWA 1Q99A 3SW4A 3UTOA 2XCKA 3KF4A 4FTMA 4EOLA 5EOLA 3KK9A 3AMAA 5GJGA 5CU0A 2XIXA 1G5SA 1CSNA 2HY0A 3D5XA 1JOWB 3FYJX 3OBGA 3OXIA 3A60A 5HLPA 3RPVA 4CLJA 1YXUA 3DTCA 3K5VA 2ITNA 3QRTA 5HD4A 2J0IA 4IVAA 1NVRA 3OFMA 4IM3A 4L46A 4QNYA 4QTBA 3UGCA 3JVRA 3PJ3A 3Q60A 4HPUE 1X8BA 3VS6A 5KMOA 3N51A 4KINA 1O6KA 4YLKA 4FTNA 3O17A 2P33A 4GEOA 3ZO1A 3POOA 2AUHA 4IM0A 2R3OA 3VRYA 5KMKA 1PY5A 2C6KA 5AV1A 1U5RA 5CVHA 3BCEA 3QD2B 4QMQA 1SNUA 2XM9A 4ZTQA 5CT0A 3VF8A 3IG7A 2PZIA 4I4FA 1JAMA 4AE9A 4EQUA 1JLUE 3C1XA 4K1BA 3W2RA 4CG8A 4E4MA 4FA2A 4IX4A 3R1SA 2DWBA 4O0WA 4FNYA 4D2WA 5TKDA 1MUOA 1UNHA 3DKFA 4BB4A 2VTJA 4FSNA 1OPKA 1E9HA 2GNIA 3T3VA 4AW1A 4DEDA 2QHNA 3KL8A 2YWVA 4ZOGA 4GFMA 4O7RA 1ZMVA 5E92A 3NNUA 3R8UA 5F9EA 4LI5A 3R01A 2ERKA 2ZM3A 3C4WA 3BYSA 4PY1A 3P23A 4XLVA 5HLNA 4YHFA 4Z55A 4L52A 1J1CA 1Q24A 3DQWA 3I1AA 2IW8A 5CTPA 3ZRKA 4BDDA 2RIOA 3SXFA 3W2SA 5M08A 3W33A 1GIHA 3QGYA 4V05A 4XG6A 3V3VA 2YITA 4CKIA 5K0XA 4FKQA 4DBNA 3RPRA 1YVJA 2EUFB 3DJ6A 4JRVA 3V5TA 1Q4LA 3RWQA 4AT5A 1Z57A 5J9YA 3LPBA 2BKZA 1KOAA 4FC0A 2JDRA 3G6HA 3NIZA 3Q4CA 4BWPA 1XWSA 2YIQA 5LXMA 1YW2A 2B9FA 2CJMA 2F2CB 4FSWA 4UWBA 4BTJA 4E6AA 3ZC5A 1H26A 4JX7A 4PNKA 4D55A 5EYMA 3CKWA 4II5A 2YM8A 3CY2A 1XH9A 5E1EA 3OY3A 4ONAA 3O23A 4FKUA 3ALNA 3ZFXA 1V0OA 4OTWA 2W0JA 2V7OA 2WOUA 3FDNA 4DCEA 4FV6A 3QUDA 4NL0A 3TDVA 1S9IA 4HVDA 5DIAA 2UVXA 4QP1A 3W10A 3V5WA 1H27A 4FOBA 4I0TA 4I22A 5DG5A 5EQYA 4D1XA 3E8CA 3FMLA 3ROCA 4MD9E 4DGNA 2H9VA 4JI9A 5E8ZA 4XV3A 3BWJA 3QRJA 4IWQA 1M7QA 3PVWA 1RW8A 1PXOA 4MNEA 4FV5A 3VUDA 1UU8A 4XOYA 3UIUA 3I6UA 4I5CA 3G0FA 3P5KA 4F9WA 1FVVA 2ZM4A 3UC3A 5BMMA 5K3YA 4F09A 4AAAA 4AGCA 3NUPA 4J95A 3GFEA 3GB2A 5EHLA 4C37A 4O0TA 2VTIA 5BX0A 3F6XA 3ZBXA 2VTOA 4LL5A 4YHJA 4F7SA 2VWYA 3TT0A 3ZLWA 1XH8A 4BDGA 2GNLA 2UW4A 3LQ8A 4IB5A 3E8EA 4DH1A 2AC3A 3VS4A 3K5UA 2OH4A 4BWXA 2W4JA 2CPKE 4C4FA 4YC8A 3HA6A 3R9RA 5FEEA 2PE1A 3VW6A 4FGRA 4NEUA 4IJPA 3SC1A 2QG7A 4PL4A 4XG3A 5D12A 3RVGA 4R3CA 2JEDA 4IZ7A 4ZK5A 2VTHA 3ODYX 3A7GA 5K9IA 2PVKA 4FIFA 3VBXA 4AS0A 2XNOA 2NNWB 3FLSA 3EQCA 2RF9A 2BRMA 4RRVA 3G2FA 3R22A 4BYIA 4MX9A 3VUGA 3W16A 4GSBA 4DT8A 4AZFA 3CS9A 4GKIA 2V5QA 4JBQA 4EK3A 3EMGA 3GQLA 4GG7A 3SLSA 3FZRA 2OJFE 4MBJA 4C4EA 3TNIA 2VO7A 3WF7A 2BRGA 2YIWA 3PWYA 3UG1A 2F2UA 4YGAA 1OECA 3TUDA 4PP9A 3KKVA 5LOHA 4R7IA 4BI1A 4ZEGA 4JXFA 3H0ZA 3MFTA 1REJA 2XK8A 2J90A 5B7VA 4BICA 4XS2A 4RBLA 5LVNA 4OTFA 2IZRA 3GCSA 3GU4A 5DN3A 2C47A 2WFYA 1OB3A 5H8GA 4DC2A 2BIYA 3KQ7A 3A99A 1GZKA 2CMWA 3MPTA 3FEGA 3OS3A 1V0PA 2W5BA 4ZSGA 4GT3A 4FF8A 3VC4A 4RC2A 5CEQA 4IEBA 4KBAA 4IANA 4M0ZA 4L3JA 2VV9A 2IG7A 3E62A 1Q62A 3RJCA 1OPJA 1T45A 3DCVA 2W99B 2ITQA 4FV9A 4APPA 3NYVA 3OXTA 4J96A 2UZTA 4JDHA 3FKLA 4Y72A 3B2WA 4UY9A 4EC8A 3FSFA 1ZMUA 3BYVA 3P08A 3HA8A 4OBPA 2UW8A 4M12A 5E1SA 4N6YA 2JBPA 5FXSA 2C5NA 4D5HA 1BYGA 2RFNA 3EN5A 3NEWA 5CU6A 5DVRA 2ZDUA 4JAJA 3BHTA 3KRXA 3V8SA 3CLYA 3T9IA 1MRVA 2H96A 1M2PA 2J9MA 4HJOA 4MBIA 5M44A 5CU4A 3R2BA 5HEZA 3BBWA 3NYOA 2W7XA 3A7HA 4C57A 3R02A 5A4TA 4DGLC 2ZV9A 3DV3A 2YM5A 2HZIA 3WIGA 5IA1A 2W96B 3S1HA 2EU9A 4F7JA 1DI8A 3BZ3A 3PXFA 5HG5A 1W83A 4PL3A 3UP2A 2WMUA 2PU8A 3MIAA 3FMDA 4R3RA 2XB7A 4JQ8A 4QQJA 4ITHA 3DLSA 4MNEB 1Q41A 3ODZX 5ETFA 5J87A 4EC9A 3M2WA 2BRHA 3OHTA 2VWVA 2XRUA 3VQUA 5I3RA 5KX8A 2WQNA 3GC9A 3DB8A 2ITPA 1HOWA 4F1OA 4K2RA 3BI6A 4GJ3A 4LG4A 5F20A 2QOBA 4RT7A 3EJ1A 4K33A 5H8EA 2WTIA 4ZSEA 2A2AA 5HE2A 5L6PA 1SVEA 1YOMA 2J5FA 5CSXA 2SRCA 4U3YA 4QP6A 1EH4A 2YIRA 3RPSA 3G5DA 4HYUA 5E8YA 2GCDA 4ACMA 3G90X 3LFQA 4IFCA 4W9XA 5D41A 4ANOA 5HTIA 4PL5A 3VS3A 3UJGA 3FZ1A 1SVHA 4NM0A 2IW6A 3NUAA 1QMZA 2W1EA 4L42A 1OKWA 4E5BA 1PKGA 4XH6A 5CZHA 4HPTE 1QPCA 1W8CA 2F7EE 4D2VA 3SW7A 4I0SA 3C13A 3QQLA 2VTPA 2UZOA 4RA5A 2PVFA 3DB6A 4FICA 5KCVA 5DT3A 1DAYA 3Q4UA 4GG5A 3UBDA 3KB7A 4LGGA 4LL0A 4O0VA 5IUIA 4B9DA 2OXXA 4YSJA 1PRYA 3EQFA 4U0IA 4ZZMA 3L9LA 4EEVA 2PUNA 4UMUA 4XP0A 4O1OA 2IVUA 5HGIA 4FTIA 4FIIA 3TZ7A 4B8LA 3HV3A 2B1PA 4WHZA 2HZNA 4RIXB 2VGOA 4RJ8A 3FZPA 3QBNA 3NSZA 2UVZA 4R5YA 2HELA 3L9NA 4FG7A 4KS7A 2NPQA 2YFXA 4AG8A 1XBBA 4UX9A 2RSVA 1ZAOA 4AA5A 1IAHA 1IEPA 3FZTA 4ALUA 3QRKA 4FKGA 2QKWB 4JBPA 4RIOA 4QP4A 4Y83A 5I3OA 4RVLA 4ANNA 5DMZA 3AMBA 4Q9ZA 3CD3A 1K9AA 1VR2A 4Y8DA 4BDCA 3FHIA 3NNVA 4FTUA 3UE4A 5HKMA 4BTKA 4C38A 4YMJA 4ZMEA 2JDTA 4AN3A 2X8DA 3UO6A 3FLYA 4ZS0A 3VWAA 5L8KA 1I44A 1XH6A 4I6QA 5FBNC 5J9ZA 4WG5A 4BIEA 3LFSA 4MXOA 4QP9A 4CFVA 5CF4A 3JS2A 3TACA 4BDEA 3V01A 4CFNA 4J97A 3V04A 5IH5A 4GCJA 3UZTA 5AIKA 3PP0A 2HOGA 2RFDA 1ZOEA 4JR7A 2PVYA 4RWIA 4UWCA 1IAJA 3MJ2A 5JGAA 3TEIA 4L45A 1Q8WA 4M67A 3BBTB 2Y6OA 3EYHA 4CZTA 2FSMX 3PVUA 5IEXA 2F9GA 4UALA 4U7ZA 1IA8A 4YTIA 4YNEA 5AP0A 4XRJA 3I7BA 5DWRA 4EH7A 3DU8A 3D0EA 4U44A 4GS6A 1BMKA 2J0KA 2VX1A 4YZMA 4V04A 4BCPA 3RAIA 3W1FA 3WE4A 4QPMA 3L1SA 3D83A 4TYHA 3ZM4A 3ZMMA 2GDOA 3KC3A 4RJ6A 5CNNA 5CEKA 5HTCA 2I1MA 2ITVA 5EHOA 3QL8A 2OZAA 5FDXA 3V5LA 4CTBA 2WO6A 3EB0A 3ZOSA 3ZRMA 2O63A 3HECA 1F3MC 4FBXA 5HVYA 5HE3A 5I9YA 1V0BA 3QU0A 4W4YA 1BUHA 4EI4A 3BLRA 5KE0A 4KUJA 4DTAA 1OKYA 1PYXA 4IAIA 5FEQA 3WIKA 4IB0A 5LQFA 2WOTA 2X7FA 3IS5A 3QA8A 4RC3A 1PHKA 4A9UA 2YERA 2QG5A 4MAOA 5L2IA 5T6KA 3HAVA 2ETKA 4C7TA 1U4DA 1H1QA 4BFMA 3N4TA 4NJ3A 1KOBA 4EUUA 3K54A 3O8TA 3F9NA 3FMMA 4PV0A 5JQ5A 5D1JA 2JKQA 3RZBA 4PQNA 4IVBA 4IX6A 2ESMA 1YI4A 4I6BA 4C3RA 5IDPA 4A07A 2QOCA 3RZFA 5BQ0A 3VW8A 1Q8TA 4CKRA 2VWBA 4G1WA 2VUWA 4EWHA 3RMFA 3POZA 2PZPA 3PXZA 5AUTA 4TZRA 4GT5A 2RG6A 3W2OA 4EYJA 3W2PA 4RC4A 2VTMA 5EYDA 3QC4A 1PXKA 2YHVA 4JQ7A 5ICPA 4YJTA 3BGQA 3LXPA 5HNGA 3MB7A 2PY3A 4RLKA 4E6QA 5A4CA 4IVDA 5F94A 1PXIA 4AFEA 2J4ZA 3MA6A 4BBFA 3QTIA 2UV2A 4BDHA 4FG8A 3KVWA 2BCJA 3E92A 2YZLA 3WF8A 4UXLA 5IQBA 2HCKA 3SOCA 4O2PA 4PDOA 2UW6A 4ACGA 1CM8A 2J0JA 4MH7A 3KF7A 4O7NA 4EUTA 3PJ2A 5J1WA 4FEXA 3Q9XA 4NIFA 3R63A 3NCGA 3IW6A 4DBXA 3CCNA 2IVVA 4O82A 1WBPA 4G6OA 1PXJA 4KA3A 4ZY4A 4QQCA 3UOJA 1ZYLA 2PE0A 4M13A 1R78A 2YEXA 2C1AA 3OT3A 4Q5EA 4LM5A 3LVPA 1ZRZA 5GNKA 4XCUA 4DFXE 4RFMA 3RHXA 3R7VA 4CMOA 4PMMA 5L2TA 2WPAA 4WNKA 2C6MA 4E7WA 4YJSA 3DXNA 2UZUE 3DDPA 3EKNA 4FL3A 3TNHA 5K5XA 2XM8A 3QC9A 4U41A 4X2JA 5GZ8A 5HO7A 3FLQA 4IWOA 5I9ZA 5AJQA 2R3MA 3ZRLA 3R9NA 3SGCA 4U43A 3F3ZA 4BCGA 4J99A 3BIZA 2OXYA 4RFZA 1ZOGA 2ZB0A 4QNAA 3A61A 3VUHA 4DEAA 4RIYB 3EQPA 2I6LA 2VX0A 4FVQA 4FEUA 4UB7A 3NUXA 4I5PA 4QPSA 4DEIA 2QD9A 3FL5A 5DBXA 4EORA 1GY3A 5CALA 4FVRA 5J8IA 4A06A 4CQEA 4RJ5A 1UV5A 5ACKA 4I93A 1L8TA 3LJ1A 2YACA 5DYJA 1JSUA 5CEPA 4IAAA 4AN2A 2CN8A 5H2UA 2XP2A 4BCOA 5F1ZA 4ZXTA 3BHHA 4USFA 2PHKA 3H0YA 4GFGA 4L9IA 4BL1A 3MA3A 2X2LA 4QRCA 4C34A 4EH2A 3T9TA 4RX9A 2ZDTA 3R7UA 4FL2A 5FTGA 5HESA 5DLSA 4YZBA 3ZTXA 3NUSA 4IM2A 3NZ0A 1O6LA 3V5PA 2VWWA 4QMNA 3DZOA 3OUKA 5ANEA 3HDMA 4HNFA 3D14A 4FSUA 1W82A 5EI8A 2DQ7X 3D7TA 1Q8YA 2IVTA 1TQPA 4C4JA 3DJ5A 2WMXA 5CAVA 3LW0A 3PG1A 2YJSA 1VJYA 4S2ZA 4WD5A 4QYGA 4UMTA 4HW7A 4XP2A 1YDTE 4BN1A 3OWPA 4DFLA 4EKLA 3E3BX 4TKSA 1YXTA 1A06A 4ALWA 3QYZA 4YO6A 3BYOA 5KZIA 1YXVA 4QYYA 2R64A 4WNMA 3G51A 3QD4A 2C69A 3QQGA 2C0OA 4A9TA 2JAMA 2ZV8A 2F7ZE 5HORA 3EQDA 4F6SA 2PULA 3L9MA 4L68A 3DNEA 1Y6BA 3I5NA 3TL8A 4BCFA 1YI6A 5HVJA 5HX6A 4FTTA 3WOWA 5LMBA 5CASA 4BTFA 4E93A 4UV0A 3R83A 2PVRA 5EI2A 4AWIA 2CGVA 3EHAA 4FE2A 4MQ1A 2QOKA 3DGKA 2HXLA 4I21A 3MVJA 4JDJA 2WMTA 3EQIA 2J2IB 1ZYCA 3DNDA 2VWZA 4XNEA 1FGIA 5JFVA 3LFAA 1STCE 5DNRA 2OGVA 4QO9A 3NDMA 3NWWA 4PX6A 3V5JA 2I40A 4D0XA 3I5ZA 4ASXA 1PW2A 5A6OA 2OLCA 2J0MB 4FT9A 1FPUA 3WYYA 4DA5A 2XYNA 4DITA 2BDFA 3P7AA 3D9VA 1JKTA 3ERKA 4IACA 4KKHA 4NIFB 1TQMA 2HWOA 2PWLA 4ALVA 3BELA 4G31A 1S9JA 3HGKA 4HNIA 4YZDA 4AP7A 5BUIA 4YJPA 4C35A 3RAHA 4O83A 4ZSAA 3P7BA 3W2CA 3DT1A 1Q8ZA 4DE4A 4YU2A 4WUNA 4FGBA 3VBYA 1KE9A 1DAWA 3KFAA 5CXZA 4LRMA 1H1PA 4NZWB 4WSYA 3I0QA 3CR0A 1O6YA 4FOCA 4CFUA 5CF5A 1JSVA 4ZS4A 4KS8A 3MYGA 2CLQA 4LV8A 1ATPE 3FXZA 3A8WA 5KNJA 5M06A 4C02A 3D7ZA 4ZY5A 5I4NA 3LFBA 3K3IA 1U5QA 3OTVA 4R1VA 2VNYA 3BYMA 4EK4A 1R0EA 4IAKA 1UVRA 4P7EA 1QPJA 5J7BA 3Q2JA 4YTFA 1R39A 3UPZA 4AA4A 1NY3A 4KRDA 4M84A 2R3LA 4PMTA 3RPYA 3H30A 4XV2A 3ORLA 4YLJA 5JQ8A 3DTWA 3GBZA 4FKRA 4PMSA 3E8NA 4U9AA 4J8MA 1SZMA 3L8VA 5K5NA 2Q83A 1WAKA 2NO3A 4ITIA 4M14A 2WB8A 2XNNA 1J91A 2ACXA 3COMA 4NCTA 4A4XA 2C5XA 5I9VA 1Y6AA 3C4CA 1ZWSA 2WMQA 5DRBA 3SVVA 2VTLA 2WMBA 3C9WA 3MS9A 3VNTA 4O7ZA 4JVGA 4P5QA 1JVPP 4M7IA 5EHYA 2YIXA 3HVCA 2A19B 3F88A 3Q6WA 4LMNA 5AA9A 3FPMA 2VX3A 1OIRA 4R77A 4TN6A 4L67A 3R73A 4FIJA 3PE2A 4IX5A 1Y8GA 4TRLA 3FPQA 3TKHA 2EXCX 4Q2AA 3Q53A 3RCJA 4S32A 1GOLA 3CQUA 4B0GA 3D7TB 5M53A 1R1WA 2QU5A 1FVTA 4IC7A 1YOLA 3HX4A 3PLSA 4CMTA 4FKIA 4MXAA 5E8VA 3NMUF 5JMSA 5AUUA 4M69B 4CKJA 4RG0A 5AV2A 1WBWA 4RIWB 4I24A 4AW2A 4ARKA 5CT7A 4P90A 3MJ1A 4LMUA 4LUDA 1A9UA 4CZUA 5EDPA 5FP5A 5K0KA 5J1VA 2V22A 2CDZA 4MXYA 4ERKA 4YPSA 3IECA 4ZTSA 4HCUA 2W1HA 2LAVA 5AM6A 4ID7A 2HZ4A 2FUMA 4YJQA 4JAIA 2C30A 3VBWA 4FKWA 5AR2A 1P4FA 5IQCA 3O51A 3ALOA 1OIQA 3EQHA 4TYEA 4X2KA 5CVGA 5L8JA 3W55A 4FV0A 4Y95A 3RM6A 5JH6A 2YDJA 4GVAA 4O0UA 4YUQA 4OBQA 4PF4A 4MTAA 3QZIA 4WO5A 5KZ0A 3UIMA 4PDSA 4G3EA 4RMZA 4Q5HA 4H3QA 5JRSA 4O7YA 3BRBA 2GMXA 2X6DA 3D2KA 4HZRA 4OTQA 3TZ9A 3ZXTA 4C3FA 5C8NA 1LR4A 2WEVA 3TWJA 4HGEA 2E9OA 3CPBA 3QRUA 4JR3A 4O96A 3VBTA 4CYIA 2X9FA 2YN8A 3MFUA 3QD0A 4GK4A 3DOGA 4AGWA 2XNGA 1UU3A 1XBCA 5FTQA 3BU6A 3JY9A 4BIBA 2JKMA 4IAFA 5CU3A 4KIPA 3S3IA 2VTSA 3NAXA 3QALE 4G5JA 4B4LA 1SYKA 2C6IA 3TJDA 3AC4A 4X2FA 2OXDA 4OR5A 3Q04A 2CCIA 2WD1A 3KXZA 5DHJA 2I7QA 2YCRA 5CF8A 3EZVA 4F0IA 2C5YA 3GEQA 2OF4A 3R6XA 2J7TA 2ZV2A 3UQGA 4NKAA 4BCQA 3ZC6A 3SQQA 1PMNA 4A9SA 4BCHA 2HAKA 2CNUA 2WGJA 3D5VA 1WBOA 2UUEA 3SD0A 1KE7A 4G34A 3PIYA 4B99A 4R7HA 2WMVA 3Q5IA 5CX9A 4BCKA 3LHJA 4GL9A 4EJNA 2VWXA 4ZSLA 4FKVA 4Z16A 5GINE 5KBQA 1H8FA 3GGFA 3MIYA 4N4SA 5G1XA 3TXOA 5L2WA 3KXMA 1YWNA 2PZRA 3F61A 4CCBA 3QLGA 3R28A 5KBRA 3ZLYA 2CN5A 2WTWA 4E1ZA 1BLXA 2REIA 2XK4A 3NVKI 2YWPA 3EN4A 3GCPA 1GNGA 2WEIA 4EYMA 4Z7GA 1I09A 2GNFA 3C4EA 5DT4A 4PP7A 3LCOA 3P86A 4WA9A 1H24A 1P5EA 1UWHA 3COHA 1WCCA 1YOJA 3EQRA 4FV2A 4DLIA 2F57A 3PRFA 1J7IA 3QXOA 4CFFA 1PMUA 1AD5A 3OXZA 5BPYA 4CV8A 3G33A 2BVAA 3ZCLA 2W4OA 5GZAA 5IDNA 3ZZWA 4HVIA 3JUHA 2JIIA 5IQGA 1MP8A 3C50A 2JDOA 3EFLA 4YJUA 2BZIB 4FVPA 2BDJA 4FEQA 3JVSA 4K6ZA 5D10A 1J7LA 3EFKA 5EW8A 4AOTA 1H25A 4Y5HA 5HU9A 4I3ZA 2OWBA 2Y7JA 3QTUA 4UMQA 4J8NA 5IQFA 4AOJA 1ZZ2A 2IZSA 3CEKA 3VBQA 3NW6A 1F5QA 3F2NA 4XV9A 4EH9A 5KMLA 3LFFA 3R8LA 2PVNA 2C1BA 4ITJA 4RWLA 4KKGA 4QMTA 4EOMA 4OTGA 1YWRA 3QTXA 4IXPA 4K9YA 4GH2A 4H3PA 4YBKA 5I9XA 3N9XA 4DH8A 4D28A 4UZDA 5IQDA 3QQHA 4U79A 3MI9A 4KB8A 4YSMA 3PP1A 2C3IB 4QPAA 3LJ0A 5HQ0A 3DLZA 4QMMA 4RX8A 3ZDIA 2UZWE 3Q6UA 2WZJA 2VTAA 3OW4A 4FSZA 3DBCA 2ITOA 4C59A 3HUBA 5D7VA 3IQ7A 2BKKA 2G1TA 4GIHA 2X7GA 5ETCA 4KNBA 1H0WA 4U45A 5G6VA 4NM3A 3PZHA 4JRNA 2BAJA 2NRYA 2W5HA 4XG4A 2G2FA 4GYIA 5HBEA 5HO8A 5CAPA 4DEBA 4I5HA 4PTEA 5D11A 4AGDA 4CQGA 3C0HA 3NW7A 4EOJA 1XR1A 3ENHA 3IONA 3O71A 3QWJA 3R9HA 4H39A 2FH9A 2XA4A 4Y85A 5FP6A 3H9FA 3RI1A 1Q5KA 3D4QA 3QHWA 4IAYA 4IW0A 5JRQA 3ULIA 4TYIA 3I79A 2A0CX 4EHGA 2CKOA 4WNPA 4U80A 5IA5A 1V1KA 5DA3A 4FTJA 5LCKA 4PTCA 5C26A 4ACHA 5BUEA 1XHAA 4ANLA 5AAEA 3TG1A 2W17A 3F5XA 4M97A 5EW9A 4ASEA 2ETMA 1GIJA 5EG3A 4RPVA 3MWUA 4RIXA 5EFQA 4D9TA 1OL7A 4Y5QA 4EOQA 4BZNA 3FMKA 5LWNA 2VZ6A 3F3WA 3ENMA 2BUJA 2WXVA 3MFRA 3WF6A 4HGTA 2C5OA 4QYHA 2IWIA 2QQ7A 3HP5A 3GNIB 2XYUA 4K77A 4FEVA 1H4LA 3MBLA 5H3QA 2GPHA 3GI3A 4RSSA 5EM7A 4K11A 5LCJA 4MKCA 2XJ2A 4U5JA 4CNHA 1JNKA 3HZTA 5HE0A 3F7ZA 3N4VA 3PFQA 3LCDA 2IZTA 3A8XA 3C51A 4XG2A 4ZZNA 2CKPA 3BV2A 5JGBA 1U54A 4L3LA 4KRCA 5KHXA 2WTCA 3BYUA 4NW5A 3DZQA 1PKDA 1SMHA 3ZUVA 3HV4A 2OSCA 2F49A 3R7EA 3HYHA 3D94A 5E8SA 4ZJVA 1UKHA 1H00A 3QFVA 4GT4A 3P79A 3KEXA 4K0YA 4QTAA 4BI0A 3WZKA 4R7BA 4I0RA 5DFPA 4CFWA 3LLTA 4ANBA 4OTDA 4USEA 3WZDA 4TYJA 5BYZA 4IJ9A 3E7OA 1M2QA 2PL0A 3EOCA 3OWJA 4J98A 2XKFA 4WIHA 2I0HA 4ZAUA 4BCIA 3UVRA 2G2HA 3CGOA 2GU8A 4NW6A 1E1XA 4YC6A 2CLXA 4S33A 3GU8A 4QQTA 3FBVA 3NYXA 4AUAA 4IB3A 3CPCA 4I4EA 5HCXA 4JS8A 3EQGA 4MF0A 4U8ZA 5HVKA 2FO0A 4IZ5A 3AD6A 3LM5A 4N6ZA 3MH0A 3SX9A 4JBOA 4MWIA 2B7AA 5LVOA 5AEPA 3TM0A 1QCFA 2ONLC 4IC8A 4IX3A 3UIBA 4CYJA 4O91A 4DAWA 4L53A 5LWMA 3ORKA 4GUEA 1REKA 4FV4A 5AMNA 4TWPA 4O7LA 3OW3A 5FM3A 5CSPA 3FKNA 4ZTHA 1QPDA 5CS6A 2GSFA 5IMXA 1OBDA 1B38A 2B0QA 1WMKA 3OCSA 2J51A 3O7LB 3CD8A 3KRJA 2HW7A 4EH4A 4I92A 1SM2A 3OP5A 2RKUA 4XMOA 5HIBA 3OTUA 1BX6A 3VAPA 2W1CA 3O0GA 1IG1A 3ACKA 2OKRA 3VIDA 1J7UA 4C0TA 5A4QA 2V0DA 2C6TA 1QL6A 3CTHA 2RFSA 3MVHA 3QCSA 4TNBA 4AQCA 4O0RA 2BMCA 2IJMA 3ZSIA 3QCQA 1QPEA 3UQFA 4YLLA 2FSTX 3KULB 5LARA 2UZDA 2JKKA 1GZNA 3PY0A 4C62A 3CSVA 3EN7A 3M1SA 4HYSA 2BROA 1WBNA 4IZAA 3LCTA 5CQUA 3V8WA 5GJDA 5FDPA 2UZEA 4J71A 2C6LA 4QTEA 2BHHA 1JBPE 3DAJA 3GC7A 4FL1A 4KIOA 3ZU7A 3BGZA 4AU8A 5IMEA 4EHEA 1WVXA 5HOAA 2UW3A 4JOAA 4F64A 5L2SA 3DK6A 4RQVA 5LVLA 4X2GA 2YDKA 4X2NA 2PPQA 1H0VA 2V62A 4O0XA 5IA4A 4G9CA 3FQEA 3SDJA 3UPXA 5CF6A 5JSMA 3CXWA 1PXNA 4G17A 1XO2B 4XBUA 5CU2A 4DGOA 3FC2A 3PZEA 4L3PA 3S4QA 3Q96A 4JBVA 4IE9A 4WSQA 5J5TA 5EQPA 3GU6A 5M07A 2PVHA 4WBBB 4TTHB 3PVBA 4A7CA 3ZSHA 4MXZA 3S00A 5DH3A 3BEGA 1K3AA 2WIHA 4KIKB 3OEZA 3MY5A 1LUFA 4AX8A 2DUVA 2XJ0A 4TWOA 3RCDA 3U4UA 4F65A 3I81A 2QOFA 4C2WA 4MQ2A 4UWYA 4BHZA 4OAUC 2FVDA 3LMHA 3KN5A 5AFVA 3PIZA 4ZZOA 2PMOX 5AP1A 4IB1A 4M15A 1U54B 3W2QA 4AF3A 3HMPA 3PYYA 2WTKC 2Z2WA 3KXNA 3WZUA 3O8UA 4A4LA 4RZVA 4RIYA 2UZVA 2YABA 5M55A 4L43A 3RALA 3P7CA 4FT5A 4X21A 3ZLXA 4EOKA 3FZOA 1NW1A 3EQBA 2W5AA 2X8EA 3UZRA 5AP5A 2Y4PA 3C5UA 3NAYA 4D0WA 3FWQA 3RWPA 3W8LA 2WMRA 5DR6A 3N4UA 2Z7LA 4QMWA 1AQ1A 2I0EA 4FIEA 4I94A 2WQMA 3V5QA 4HYHA 4OTPA 3JPVA 4XRLA 3TKIA 4E8AA 2H8HA 5HNIX 4P2KA 3P9JA 5CAQA 3KU2A 4B8MA 4O7VA 1FGKA 4UN0C 5J95A 3GVUA 1CTPE 5CLPA 5EYKA 3F82A 4L7FA 5LMAA 2OK1A 5L6OA 2QVSE 3SXRA 3PSBA 2ITYA 4D1SA 3IDPA 3MW1A 3LE6A 3ZO2A 2C3LA 2VTQA 2WMSA 4NKSA 1ZLTA 3PSDA 4D4YA 3ZDUA 3KRRA 3R8ZA 5IQHA 5L8LA 1BL7A 3MB6A 3NUNA 3FLZA 4UEUA 5BYLA 1Q3WA 5CY3A 4MVFA 1YKRA 2XBJA 3FSKA 3UOHA 3ZONA 3SXSA 2GQRA 2O0UA 3OCTA 2WTJA 3HRCA 4A4OA 3E8DA 3QCYA 3QYWA 4BDIA 3C5IA 4U3ZA 2R7BA 4EJ7A 3QZHA 3VO3A 4BDJA 1MRYA 5ETAA 2UW9A 3SRVB 3Q2MA 4ACCA 3R7GA 3Q5ZA 4LV5A 3W32A 2CNVA 4BDFA 3R1NA 2XNMA 4RJ4A 3VUMA 2QR8A 5EH0A 4WUAA 3OEFX 4L8MA 3DXPA 2QONA 2QURA 2RGPA 3QRIA 5EQEA 2V7AA 4BHNA 4BZOA 1LEWA 2JAVA 4U81A 1XH7A 3EN9A 1JQHA 4ZLYA 3EWHA 2XEYA 4IWPA 3TJCA 4ZTMA 5AUVA 4EWQA 3E88A 4J53A 4DHFA 2GNJA 2ZJWA 2B52A 4QMVA 2BDWA 2R5TA 2GNHA 4F4PA 5HIEA 4L6QA 4WG4A 2R3HA 1R0PA 4FSMA 1PXPA 3MGYA 3NUYA 2G2IA 4W4VA 2YM3A 4PDYA 4DLJA 2BRNA 1OM1A 2H34A 2RFEA 4GYGA 2JLDA 5KHWA 3MTFA 3PG3A 4FT0A 3RHKA 2JC6A 3R7OA 5JKGA 3U51A 4O1PA 5JFWA 3UQCA 3JYAA 2J6MA 3P78A 5AP7A 2XNPA 5IKWA 2BZJA 4TWCA 3HMMA 4DGGA 3I60A 4UMPA 2UW0A 4USDA 3NVMB 5CNOA 4D9UA 3A4OX 2XCHA 3PRIA 5DPVA 3FXWA 3LFCA 4O81A 4RFYA 3BPRA 4XG9A 5C9CA 1Q8UA 5EYCA 3RP9A 3IOKA 3AT2A 4DFNA 3U4WA 5AAGA 3IGOA 3LXKA 3GCQA 3GCVA 5CQWA 2EVAA 5FTOA 4DCAA 4FKLA 2Y6MA 4C33A 2P0CA 2ITXA 1P4OA 4HVHA 5J79A 3AMYA 4W9WA 3CC6A 4RLLA 3TV4A 3EL7A 2VO3A 5TO8A 4ZLZA 3CJGA 3HL7A 4AZSA 5IU2A 5FBOA 1FINA 4PRJA 3ZUUA 5IH4A 4N70A 1PMVA 1M52A 4CRLA 4IHPA 5E91A 3LFNA 3PWDA 2X2MA 4DF3A 2R3PA 3RNYA 2R2PA 4FUYA 4XV1A 1ZARA 5CWZA 2Y4IC 3GC0A 2X0GA 1PXLA 2OW3A 4FI1A 3OC1A 4G2FA 4LQMA 3QTSA 3E93A 4CTCA 4YJVA 4ASZA 3FI3A 4HYIA 2E9PA 3L9PA 3GCUA 4G3GA 4UXQA 2YA9A 3G9LX 3ZSGA 3SA0A 3L8SA 3QQJA 5JFSA 3FHRA 3GT8A 3OBJA 5HBHA 4MEDA 4R8QA 4BWKA 3HUCA 2O3PA 3LIJA 2WTKB 3AT3A 3DQXA 3AGLA 3OROA 5FEDA 2JITA 4AW5A 5HIDA 3NNWA 3NCZA 3L8XA 4R6VA 5TE0A 3PY3A 2O5KA 3PTGA 2WKMA 4F1TA 1NVSA 2Z7QA 4LRJA 1K2PA 2QLQA 5LJJA 4AOIA 4P4CA 4NTSA 2EB2A 2WIPA 5ANIA 3T8OA 5AADA 3VJNA 4AW0A 3F2AA 3IO7A 3U87A 3V6SA 4CV9A 1M17A 4E73A 1URWA 2BPMA 4FKTA 4HVGA 5AV3A 5AR8A 5DR2A 3LOKA 1XBAA 3H10A 4X0MA 4D4SA 1YHSA 4OGRA 2B55A 4FMQA 3SKCA 4H1JA 2P55A 3DK3A 4IADA 3KCFA 3QTZA 2WELA 4M69A 5H8BA 3TIZA 3QX2A 4G6NA 4EK8A 1OITA 4RIWA 3PJ1A 1URCA 2BTRA 4F70A 3OUNB 4YJOA 3VS2A 3NYNA 3VRZA 4B6LA 4H58A 4C4GA 2Z8CA 4EBWA 1XKKA 2XZSA 2GFCA 3NLBA 1G8SA 5IA3A 2YJRA 3FYKX 3ULZA 3D5UA 3C4XA 4O2ZA 3O7LD 4DINA 4NM7A 3TTIA 3LFDA 2WAJA 3OWKA 5BVKA 1IA9A 1OUKA 5CSHA 3EYGA 5DT0A 5AX3A 2VTTA 4BGHA 3I0OA 5FRIA 3KREA 3AG9A 4NK9A 3MVLA 3KGAA 3IW4A 4KSQA 2OZOA 4OTRA 4AXAA 4D2RA 4D5KA 4EH3A 2BALA 5I0BA 2CGXA 4HGLA 3LFEA 3P1AA 5IEYA 4OAVB 3F5GA 3VUKA 1UWJA 4XOZA 4MHAA 3RINA 5AWMA 2XH5A 4M0YA 1WFCA 3DKGA 4JIAA 4F7NA 4XEYA 3MV5A 1PXMA 5AUWA 4QQ5A 5JZNA 2JBOA 4JQEA 3MY0A 1HCLA 4D58A 2PYWA 4G5PA 4IIRA 4IQ6A 2QOLA 5IQIA 3EL8A 4L44A 2HZ0A 4DFBA 2QO7A 4FNZA 4FK3A 4BKZA 4BY9E 3AD4A 2W1ZA 4QMUA 2XIZA 4V0GB 5AM7A 5EDQA 4O22A 4YZCA 5AR4A 4C2VA 4DH3A 3NX8A 3PLAE 3QF9A 3BE2A 3FMEA 3VULA 4QYFA 2BFXA 4MXXA 4AE6A 2W1FA 3T3UA 3FLNC 3MH1A 2XVDA 4WRSA 4WBOA 4CRSA 3LMIA 2C6OA 3HAMA 5EDRA 4RZWA 2OFUA 1PJKA 2YZAA 5BVDA 4FKOA 5KMNA 1OUYA 4YJNA 5J7HA 5IQAA 3QHRA 3UC4A 3ZXZA 3LXNA 4YR8A 3ORMA 5BNJA 2QLUA 3UMXA 2BR1A 1KE5A 2PK9A 4EQCA 5K4JA 3A62A 2VRXA 5LMKC 4EHVA 2CCHA 2F4JA 3WZJA 4BVUA 1G3NA 5DE2A 1WZYA 3Q32A 5D9HA 2R3IA 3G6GA 4FEWA 5FD2A 3IW7A 1KE8A 1MQ4A 5ANDA 4EH6A 5L2QA 5FLFA 3VUTA 4HGSA 3IGGA 4L00A 5C03A 3UP7A 1BKXA 5GIPE 3HDNA 5DR9A 3FKOA 4XJ0A 3F66A 5AP6A 3TNWA 3WBLA 3R9OA 1GAGA 5L6WL 2W1DA 5ANOA 5F4NA 1JSTA 4E20A 5LMKA 3O8PA 5DI1A 4AZEA 2JFMA 3WI6A 3AC1A 3FMJA 1RDQE 2ERZE 1NXKA 2GHGA 5BVFA 2OG8A 5L3AA 4GIIA 2XIYA 4BDKA 1SVGA 2Y4IB 3PSCA 2JDSA 1YXSA 4D2PA 4ENXA 4DYMA 4C3PA 3R1QA 1OKZA 1Q61A 3NS9A 3PUPA 3MESA 3HV6A 1ZYDA 3D2IA 4AT4A 3B8RA 5E8WA 4U6RA 2V55A 2XS0A 4F99A 4AN9A 4EHZA 3OY1A 4FTOA 4EOIA 5GJFA 5C4LA 3G9NA 2PSQA 1IR3A 4BBMA 2PMLX 2C6DA 2YDIA 4X3FC 3MPMA 4ZY6A 3ROYA 3BGPA 2Z02A 1NVQA 3CJFA 3GQIA 3F3TA 4B7TA 4FV8A 3G15A 4FSQA 2XNBA 4HCVA 4YC3A 4M3QA 3CIKA 2VNWA 5DGZA 4WG3A 3FQHA 4FR4A 5M4FA 4WNOA 1GIIA 2JIVA 3VS0A 4MXCA 4O7SA 3E3PA 2QCSA 3DBQA 5E9EA 1F0QA 5C8KA 2PMIA 3BU5A 5FUTA 2F7XE 3CE3A 3MTLA 1H07A 2ETRA 2XKDA 3ORIA 2VO0A 3CQWA 3BHVA 3F3UA 4FODA 4G16A 4RVKA 4WRGA 4X3FA 1ZY5A 2C0TA 2GHLA 4CVAA 2AYPA 4X3JA 5H9BA 4ZIMA 2YISA 3A7FA 2VTRA 3B2TA 3JXWA 4Y46A 3V51A 3EH9A 3FAAA 3KA0A 2J0LA 3OOGA 4YBJA 4XG8A 2XUUA 5HICA 1TKIA 3WARA 1JPAA 3OZ6A 3I7CA 2YLEA 4G9RA 4NUSA 3KXGA 2ZOQA 5K4IA 3ANQA 3NRMA 5CYIA 1UNLA 3FV8A 4QOXA 1YRPA 3BQRA 5C4KA 4GK3A 3ZFMA 4DN5A 2IW9A 1ZYSA 3DJ7A 4CSVA 4QMLA 1IRKA 4J52A 1J3HA 3BQCA 4FTCA 4AT3A 5DRDA 4XLIA 3W18A 3KK8A 3AC5A 2C4GA 3RAWA 5KKRC 2UZLA 3LAUA 4FKSA 1BL6A 4BIDA 2ITUA 2NRUA 4PWNA 3GFWA 4BTMA 1ND4A 2FGIA 5IA2A 4O86A 4U42A 5IA0A 4FUXA 5CANA 5CSWA 3OMVA 3I4BA 4ORKA 2OIBA 4KD1A 1LEZA 5CEOA 1MRUA 2DS1A 4YHTA 5L4QA 1OZ1A 4HZSA 2Z7RA 3IDBA 4DEGA 5JFXA 3UDBA 2EWAA 1CKPA 3Q4TA 3R0TA 3ZO4A 4DFZE 2KULA 4H3BA 3MY1A 3IW5A 3C4ZA 4C58A 3BKBA 4XP3A 2YCSA 4F63A 4FSRA 4I20A 3HMNA 2R4BA 3Q9YA 3UNJA 5A4EA 4DG0E 1J1BA 4CEGA 1OMWA 3UZPA 1OL1A 3C0GA 3RGFA 5KMIA 2O2UA 4F9AA 4QP7A 4LOQA 1T46A 4EK6A 2Z60A 3COIA 4DGMA 4RGJA 3IOPA 5CI6A 4FYNA 4M66A 3P4KA 4ANSA 1BI7A 2C5VA 3DA6A 5DEYA 5JN2A 4OUCA 3DDQA 1ZXEA 4FT3A 1B6CB 4I23A 5HE1A 2O65A 3M42A 4LOPA 4RA4A 4BC6A 3U6HA 3QKLA 3CP9A 1OL6A 3II5A 2YM7A 5IEVA 1NA7A 4DG2E 2GS7A 3BHYA 2YIYA 3SG9A 4KIQA 5GHVA 2WTVA 2UVYA 1LPUA 3F3VA 3HP2A 4X7QA 4FZFB 3ZYAA 5B0XA 4H36A 3ZHPC 1IASA 2JKOA 3O50A 4M8TA 3VN9A 5AR7A 2Y9QA 1Y91A 4QP3A 5KMMA 3JR1A 2G9XA 4R78A 3QCXA 3R8MA 1JKKA 4CT1A 3VJOA 5CVFA 4IAZA 4ZTLA 3Q3BA 2W4KA 3QUPA 4FKPA 4PNIA 4NFMA 4E26A 2HW6A 3QAME 2VWIA 4N0SA 4MYGA 4QD6A 4BKYA 4JJRA 4BRXA 3S95A 5C1QB 3SG8A 5EI6A 4NJDA 4OT5A 3TTJA 4OT6A 5T68A 3HV7A 4FTRA 4MD8E 3TKUA 5KUPA 3UNKA 4CG9A 3NR9A 4OTHA 4ANQA 4JG7A 3TV7A 3KULA 3Q9ZA 4QP8A 3EFJA 3ZUTA 3U6IA 3ORNA 5AP3A 4ZLOA 3CY3A 2VO6A 2VAGA 4QMYA 4EOPA 1U59A 1NT2A 1OL2A 2B54A 2HK5A 2WU7A 5IQEA 1O9UA 5EM8A 4XBRA 4IVCA 4TPTA 3L8PA 3DFCB 2ZM1A 4O27B 4AZTA 5IG1A 3LCKA 3MH2A 2YLFA 1OGUA 5CENA 5HG7A 3RKBA 2W06A 4D4RA 5AP4A 4PTGA 1CKJA 3FXXA 3KCKA 4FSYA 5ETIA 2XJ1A 1OPLA 2FB8A 5E8XA 3RTPA 3GOPA 1A48A 4L7SA 2GS2A 3R9DA 1FBNA 2GTNA 4LYNA 3NIEA 4X3FB 3CGFA 3SV0A 4EL9A 2UW5A 3KY2A 2HYYA 1Q97A 4FTKA 1ZMWA 5BMSA 3ITZA 3BHUA 1MQBA 2R3KA 4G3CA 2QO2A 3TN8A 5ANGA 3A7JA 4JNWA 4I5MA 4WOVA 4F0FA 1JKLA 1PF8A 2B9HA 4AZVA 5FXRA 4ZJIA 4MF1A 4CLIA 3QZGA 4FIHA 4YJRA 1L3RE 4EQMA 4FNWA 3FL4A 2OI4X 3EIDA 4FV1A 3QWKA 4I6FA 2P3GX 5M51A 4KIKA 1H1WA 5CEIA 4AACA 4OBOA 3REPA 4ASDA 3UOLA 2C3KA 4CD0A 2B9JA 2OJJA 2PZYA 4MBLA 2EXEA 4ZSJA 4D2TA 1B39A 1VEBA 4EONA 2JDVA 1OI9A 2C0IA 4RJ7A 2I0VA 2QOQA 3E7VA 4RJ3A 2WNTA 5AAFA 1FQ1B 3PJ8A 4NTTA 4QMSA 5M4IA 2R9SA 2BILB 3RM7A 4BCNA 1JWHA 3QKKA 2H6DA 4YPDA 3F7WA 1Y57A 4UZHA 3ZBFA 2QI8A 4GK2A 2X4FA 2XK9A 2DYLA 3UO4A 1AGWA 4HVSA 1Y8YA 3KN6A 4NFNA 4XX9A 4EK5A 4FZAB 1YWVA 5KKRB 5J9LA 4RQKA 1OBGA 5EK7A 2PTKA 4FTLA 3WE8A 2ITWA 2NP8A 4NT4A 3OD6X 3QQKA 1YXXA 2X9EA 3R30A 4X6RA 3UYSA 1E1VA 5ACBC 3Q52A 4QT1A 5JGDA 3CBLA 4O7TA 4E5AX 3R71A 5AP2A 3AOXA 5B2KA 3VBVA 3HEGA 4U97A 5HI2A 4PMPA 5CEMA 3VVHA 5M09A 4FV3A 2I0YA 2RG5A 4NM5A 3D5WA 2R3GA 2XMYA 3TUCA 5T3QA 3U54A 4HCTA 5B2LA 5M4CA 4WT6A 3U9NA 2XIRA 5D7AA 3TNPC 4EOSA 3K2LA 3P0MA 3TIYA 3IW8A 2WQEA 3LZBA 4G3FA 4CZYB 5A14A 2WQOA 5BVWA 4ZMFA 2B9IA 2JGZA 3NUUA 3R8VA 2OICA 2YCQA 3QQFA 4QP2A 5A4LA 4UYNA 2CKEA 2A27A 5ANKA 4WKQA 3ID6C 1XH4A 4PUZA 5AV4A 1P2AA 3OT8A 5HD7A 4F0GA 3TUBA 3F69A 3SRVA 4ERWA 4AA0A 3ATSA 5LVPA 2ONLA 3W8QA 3LQ3A 3UVPA 2JFLA 4E6DA 3HRBA 3A2CA 4PPAA 1OIUA 2W05A 4OW8A 3RNIA 4GU6A 4XHKB 5E90A 3LJ2A 4YNOA 4EZ3A 1G8AA 4DFUA 3F5UA 3VS5A 1WVYA 2FYSA 4QTDA 3UIXA 4E4LA 4MWHA 4EH8A 4PDPA 3VUIA 4UYAA 5CAUA 1LP4A 4U40A 3E63A 3GP0A 3PA5A 1H01A 1KV2A 2CKQA 2XNEA 2R7IA 4TXCA 3PVGA 4BDBA 2KTYA 3QQUA 4A9YA 2E2BA 4BDAA 4O84A 5I9WA 3U55A 2BRBA 4NSTA 4FZ7A 3DFAA 2OJGA 2W9FB 2CNQA 4BYJA 1ZOHA 2QHMA 2OO8X 3A7IA 4JLCA 4PPBA 4A9RA 4F9BA 4CGAA 2G01A 3VF9A 4XUFA 2W1GA 2VGPA 4OTIA 2FSLX 2IO6A 2O8YA 2RL5A 5BVNA 3AC3A 2BAQA 3ATTA 3CTJA 2PUPA 5TOZA 1M14A 3TV6A 3A4PA 4DT9A 4L01A 4RVMA 3PXRA 4O6EA 1Q3DA 3RK7A 4EH5A 2X6EA 3NGAA 3UVQA 4YURA 3SHEA 3VS1A 3MSSA 4CCUA 3ZM9A 4UMRA 1RE8A 4S34A 4CFMA 1ZYJA 3H4JA 3PY1A 5JEBA 5EOBA 1RJBA 4FG9A 4W4XA 2GQGA 3AC8A 3ORXA 5AUXA 4GUBA 1YDRE 3QLFA 4IH8A 4RWKA 1FOTA 4Q9SA 5M56A 5HCYA 3M11A 2BZKB 2C3JA 3TDWA 2P2IA 2YCFA 3KMUA 5HTBA 2X4ZA 4JG6A 3LXLA 3R8PA 3F5PA 3UODA 4E3CA 2XK7A 3GU5A 4BCJA 3LMGA 4GU9A 5ANJA 2GQSA 2OJIA 4FNXA 2FSOX 5CAOA 1VYZA 4FK6A 3R04A 3RK5A 3DAEA 1JKSA 2G15A 3QD3A 4BI2A 2OU7A 5AV0A 2R0UA 2ZMDA 3UG2A 3HMOA 3IK3A 1CDKA 3DAKA 1KSWA 1VZOA 4BCMA 5TF9A 4D1ZA 3HKOA 2R3QA 4JIKA 5BYYA 3S0OA 2JIUA 3AD5A 2B53A 5BVOA 2B4SB 4R1YA 2BZHB 2C6EA 4IBMA 5FGKA 4QMZA 4ENYA 1YHWA 4YO4A 4HOKA 2QU6A 4FYOA 3QXPA 4TWNA 2ZV7A 3ZEWA 3DS6A 3UNZA 5IUGA 3UOKA 4LGHA 3FE3A 3R00A 3F2RA 3FY2A 3LKMA 4MNFA 2OF2A 3ACJA 3FY0A 4FZ6A 4KWPA 5J5SA 5EKNA 1KE6A 3EN6A 4YTCA 4V01A 3BLHA 4R5SA 3IKAA 2WHBA 4DEEA 3GC8A 3BU3A 3DK7A 2FA2A 1P14A 1YI3A 4FT7A 2X7OA 5AUZA 4BR3A 2UZBA 2HY81 3BEAA 3FMHA 1R3CA 4NU1A 2CSNA 3TZMA 5E8UA 3IPHA 2CGUA 1XQZA 4S31A 4BF2A 5C01A 4ZTNA 4CT2A 4FTAA 3UMWA 4NH1A 5IISA 3AQVA 3TCPA 5FXQA 3TNQB 5B2MA 4RVTA 5DOSA 4YTHA 3G0EA 5BVEA 3BX5A 1KWPA 2A4LA 3FZSA 1H08A 3PE1A 1UU9A 5DEWA 3FQSA 3VS7A 3PJCA 3ZH8A 4OLIA 2ZMCA 3KXXA 2WU6A 4I1ZA 2J5EA 2HIWA 1CKIA 4FSTA 4LFIA 3DY7A 2YAAA 2QOIA 3R1YA 2X2KA 5BUJA 1DI9A 1FMOE 3IDCA 3AGMA 2X81A 3GXLA 5IF1A 1WBVA 2R0IA 4K18A 3ZZEA 5ITAA 3PA3A 3DKOA 4YZ9A 3QTRA 2LGCA 2XKEA 1GZ8A 4NYEA 2CGWA 3TZ8A 1W0XC 2YAKA 4CMUA 1Z5MA 2CHLA 3FI2A 3HNGA 4FV7A 4KSPA 5A9UA 4MD7E 1TVOA 5FWKK 1H28A 3D15A 3QZFA 1W7HA 2ZVAA 2QODA 2W1IA 4R3PA 2VU3A 4GV1A 2GS6A 2OIDA 3HV5A 1DM2A 3E5AA 4FTQA 3QKMA 4V0GA 3FC1X 4YZNA 3U9CA 4BGGA 4CFXA 2Q0BA 2HXQA 3HLLA 2XF0A 1OVEA 4C4IA 2PMNX 4KBKA 4MCVA 1YDSE 2UZNA 5JT2A 5AR5A 3ORZA 1M7NA 4D4VA 1Z9XA 3R2YA 3OF0A 3THBA 4UBAA 3UO5A 3RPOA 2GTMA 2YM6A 3ZEPA 1RQQA 1ZZLA 3GOKA 5CI7A 4BZDA 4IFGA 2R3RA 4AGUA 4O7WA 1KV1A 2QC6A 5EW3A 2X8IA 3GENA 3AC2A 5JZJA 1UNGA 3U6JA 3FJQE 2JD5A 2QNJA 4EZ5A 5IZFA 3QTWA 3NNXA 3R7IA 2IPXA 4W8DA 5HX8A 2Y8OA 5TR6A 3OCGA 1HCKA 4IDVA 4GW8A 2WMWA 5E7RA 5M4UA 5AR3A 4BGQA 2E9UA 4LRKA 4GRBA 3NPCA 5A3XA 1WVWA 1PYEA 3QX4A 2ZYBA 3WF5A 5IUHA 2PVMA 4GVJA 3KMWA 4JX3A 5C8MA 2E9VA 2PZ5A 4YP8A 4O0SA 2OIQA 4F9YA 5AX9A 4APCA 4DFYA 3C7QA 2C68A 4O6LA 5FQDC 4RX7A 3MDYA 4FIGA 2HENA 2YM4A 2XKCA 3DBFA 3PPKA 3ELJA 3V8TA 3UYTA 3RBWA 3OCBA 3C4FA 2PUIA 5E4HA 2VN9A 3E87A 3OVVA 4LUEA 2J50A 2QO9A 2Y0AA 3BWFA 4E5WA 1UA2A 4IWDA 3PPZA 3VHEA 5E8TA 3CTQA 3PXKA 1VYWA 3BE9A 4F6UA 3MVMA 4KBCA 3KVXA 2EXMA 4JDIA 5CZIA 4O38A 3DPKA 3PXYA 4K8AA 3ORPA 2E9NA 4O21A 4E6CA 1W84A 4TYGA 4DEHA 4I6HA 4IZYA 5EM5A 4LOOA 3MFSA 3MPAA 4C8BA 4KABA 4EOOA 4O0YA 4W4WA 2P2HA 4FKJA 3H9OA 5HBJA 4TYHB 2VTNA 5FG8A 1KUTA 2WTDA 4TL0A 4FX3A 3ZO3A 2OZAB 3HRFA 3LCSA 2Z7SA 1YHVA 2IN6A 5IPJA 1XH5A 1APME 3BV3A 3PIXA 5F95A 3R21A 5FM2A 3KRWA 2ITZA 2A1AB 4H05A 2O64A 4W8EA 4QMPA 1WBSA 4TW9A 4DTKA 1H1RA 3WILA 3LM0A 4GFOA 4DH5A 5AIRA 3OOMA 3O96A 3H3CA 3U8WA 4F08A 2VWUA 4MK0A 5HHWA 3ETAA 5HO6A 2X1NA 3PA4A 3CKXA 3R7YA 5HU3A 3VQHA 3KRLA 4LGDA 4ZTRA 3I6WA 3Q4ZA 3FI8A 5A6NA 4C36A 3B8QA 3DKCA 1ZY4A 3OG7A 2QKRA 3SAYA 2EB3A 2QR7A 2BHEA 3GU7A 5TT7A 3WYXA 5C27A 1ERKA 3SOAA 1BI8A 2OH0E 3DBEA 4EKKA 3EZRA 5IH6A 2ITTA 4JT3A 4BBEA 2OJ9A 4F9CA 2ZB1A 3C0IA 4DH7A 3VHKA 2Q0NA 2QOHA 3QTQA 4XG7A 3NW5A 3WZEA 2PVLA 3E64A 5HLWA 4GMYA 4JL9A 1OKVA 3COKA 5HZNA 3PPJA 3V6RA 3KXHA 1UU7A 4ZJJA 1GJOA 4CXAA 4S30A 3ANRA 4EBVA 2UW7A 2XEZA 4DG3E 3EFWA 4NWMA
chains in the Genus database with same CATH superfamily
4RWJA 3P5JC 3FLWA 2WQBA 4JG8A 2ZAZA 3BLQA 5EM6A 4TY1A 3QA0A 3GUBA 4KKEA 3ZFYA 2XK6A 4GJ2A 4BKJA 3AT4A 1W98A 3FUPA 3MH3A 3RAKA 4Z3VA 3AXWA 3ORTA 4C61A 2PE2A 2R3NA 5JK3A 3TI1A 3QUEA 4C4HA 5KMJA 1OIYA 4G6LA 4QYEA 2GNGA 5GZ9A 4P5ZA 3PXQA 3S2PA 1DS5A 1GZOA 1M2RA 2GHMA 2PVJA 2WMAA 2IVSA 3FI4A 4EZ7A 3Q9WA 2R3FA 3ET7A 2QOOA 3H9RA 5HG8A 4E4NA 4IMYA 2BTSA 4J7BA 2XK3A 2GFSA 5HCZA 4QTCA 3HMIA 3OWLA 4AFJA 5HNBA 5AA8A 4J1RA 4QEBA 4DTBA 4NCTC 4I41A 1WBTA 2BIKB 3K3JA 4F1MA 4XYFA 2IZUA 5A54A 1OL5A 4ZP5A 3DBDA 4M68A 4GKHA 3O2MA 2AC5A 3CQEA 4TT7A 1U46A 3ZLSA 2HWPA 3ZS5A 1UKIA 1FMKA 2XIKA 3FMNA 1YQJA 2XBAA 4ACDA 4FZDB 4F7LA 2OFVA 4D2SA 4Z7HA 5KO1A 4QMOA 4KAOA 4AZWA 2BAKA 1CMKE 5M57A 5GIOE 3PDTA 3BL7A 2PUUA 3MN3A 4TNDA 2R3JA 4QMXA 5AUYA 4IDTA 4JDKA 2OBJA 4N57A 5A46A 5CSVA 3DXQA 5HG9A 4G3DA 5CXHA 2W9ZB 4X6QC 4Y73A 4PPCA 3EKKA 4Z9LA 5I5ZA 4ANMA 5I9UA 5EKOA 1H1SA 5LVMA 1TQIA 3JY0A 4F6WA 3LLAA 2BFYA 1SNXA 2X39A 3WF9A 4RX5A 4E4XA 2P4IA 3KMMA 4H1MA 1PMEA 2VD5A 3RK9A 1XJDA 2XRWA 1FVRA 3LQ5A 3QGWA 1Q99A 3SW4A 3UTOA 2XCKA 3KF4A 4FTMA 4EOLA 5EOLA 3KK9A 3AMAA 5GJGA 5CU0A 2XIXA 1G5SA 1CSNA 2HY0A 3D5XA 1JOWB 3FYJX 3OBGA 3OXIA 3A60A 5HLPA 3RPVA 4CLJA 1YXUA 3DTCA 3K5VA 2ITNA 3QRTA 5HD4A 2J0IA 4IVAA 1NVRA 3OFMA 4IM3A 4L46A 4QNYA 4QTBA 3UGCA 3JVRA 3PJ3A 3Q60A 4HPUE 1X8BA 3VS6A 5KMOA 3N51A 4KINA 1O6KA 4YLKA 4FTNA 3O17A 2P33A 4GEOA 3ZO1A 3POOA 2AUHA 4IM0A 2R3OA 3VRYA 5KMKA 1PY5A 2C6KA 5AV1A 1U5RA 5CVHA 3BCEA 3QD2B 4QMQA 1SNUA 3W0PA 2XM9A 4ZTQA 5CT0A 3VF8A 3IG7A 2PZIA 4I4FA 1JAMA 4AE9A 4EQUA 1JLUE 3C1XA 4K1BA 3W2RA 4CG8A 4E4MA 4FA2A 4IX4A 3R1SA 2DWBA 4O0WA 4FNYA 4D2WA 5TKDA 1MUOA 1UNHA 3DKFA 4BB4A 2VTJA 4FSNA 1OPKA 1E9HA 2GNIA 3T3VA 4AW1A 4DEDA 2QHNA 3KL8A 2YWVA 4ZOGA 4GFMA 4O7RA 1ZMVA 5E92A 3NNUA 3R8UA 5F9EA 4LI5A 3R01A 2ERKA 2ZM3A 3C4WA 3BYSA 4PY1A 3P23A 4XLVA 5HLNA 4YHFA 4Z55A 4L52A 3UDSA 1J1CA 1Q24A 3DQWA 3I1AA 2IW8A 5CTPA 3ZRKA 4BDDA 2RIOA 3SXFA 3W2SA 5M08A 3W33A 1GIHA 3QGYA 4V05A 4XG6A 3V3VA 2YITA 4CKIA 5K0XA 4FKQA 4DBNA 3RPRA 1YVJA 2EUFB 3DJ6A 4JRVA 3V5TA 1Q4LA 3RWQA 4AT5A 1Z57A 5J9YA 3LPBA 2BKZA 1KOAA 4FC0A 2JDRA 3G6HA 3NIZA 3Q4CA 4BWPA 1XWSA 2YIQA 5LXMA 1YW2A 2B9FA 2CJMA 2F2CB 4FSWA 4UWBA 4BTJA 4E6AA 3ZC5A 1H26A 4JX7A 4PNKA 4D55A 5EYMA 3CKWA 4II5A 2YM8A 3CY2A 1XH9A 5E1EA 3OY3A 4ONAA 3O23A 4FKUA 3ALNA 3ZFXA 1V0OA 4OTWA 2W0JA 2V7OA 2WOUA 3FDNA 4DCEA 4FV6A 3QUDA 4NL0A 3TDVA 1S9IA 4HVDA 5DIAA 2UVXA 4QP1A 3W10A 3V5WA 1H27A 4FOBA 4I0TA 4I22A 5DG5A 5EQYA 4D1XA 3E8CA 3FMLA 3ROCA 4MD9E 4DGNA 2H9VA 4JI9A 5E8ZA 4XV3A 3BWJA 3QRJA 4IWQA 1M7QA 3PVWA 1RW8A 1PXOA 4MNEA 4FV5A 3VUDA 1UU8A 4XOYA 3UIUA 3I6UA 4I5CA 3G0FA 3P5KA 4F9WA 1FVVA 2ZM4A 3UC3A 5BMMA 5K3YA 4F09A 4AAAA 4AGCA 3NUPA 4J95A 3GFEA 3GB2A 5EHLA 4C37A 4O0TA 2VTIA 5BX0A 3F6XA 3ZBXA 2VTOA 4LL5A 4YHJA 4F7SA 2VWYA 3TT0A 3ZLWA 1XH8A 4BDGA 2GNLA 2UW4A 3LQ8A 4IB5A 3E8EA 4DH1A 2AC3A 3VS4A 3K5UA 2OH4A 4BWXA 2W4JA 2CPKE 4C4FA 4YC8A 3HA6A 3R9RA 5FEEA 2PE1A 3VW6A 4FGRA 4NEUA 4IJPA 3SC1A 2QG7A 4PL4A 4XG3A 5D12A 3RVGA 4R3CA 2JEDA 4IZ7A 4ZK5A 3NFFB 2VTHA 3ODYX 3A7GA 5K9IA 2PVKA 4FIFA 3VBXA 4AS0A 2XNOA 2NNWB 3FLSA 3EQCA 2RF9A 2BRMA 4RRVA 3G2FA 3R22A 4BYIA 4MX9A 3VUGA 3W16A 4GSBA 4DT8A 4AZFA 3CS9A 4GKIA 2V5QA 4JBQA 4EK3A 3EMGA 1ST4A 3GQLA 4GG7A 3SLSA 3FZRA 2OJFE 4MBJA 4C4EA 3TNIA 2VO7A 3PUFC 3WF7A 2BRGA 2YIWA 3PWYA 3UG1A 2F2UA 4YGAA 1OECA 3TUDA 4PP9A 3KKVA 5LOHA 4BJJA 4R7IA 4BI1A 4ZEGA 4JXFA 3H0ZA 3MFTA 1REJA 2XK8A 2J90A 5B7VA 4BICA 4XS2A 4RBLA 5LVNA 4OTFA 2IZRA 3GCSA 3GU4A 5DN3A 2C47A 2WFYA 1OB3A 5H8GA 4DC2A 2BIYA 3KQ7A 3A99A 1GZKA 2CMWA 3MPTA 3FEGA 3OS3A 1V0PA 2W5BA 4ZSGA 4GT3A 4FF8A 3VC4A 4RC2A 4O4CA 5CEQA 4IEBA 4KBAA 4IANA 4M0ZA 4L3JA 2VV9A 2IG7A 3E62A 1Q62A 3RJCA 1OPJA 1T45A 3DCVA 2W99B 2ITQA 4FV9A 4APPA 3NYVA 3OXTA 4J96A 2UZTA 4JDHA 3FKLA 4QDVA 4Y72A 3B2WA 4UY9A 4EC8A 3FSFA 1ZMUA 3BYVA 3P08A 3HA8A 4OBPA 2UW8A 4M12A 5E1SA 4N6YA 2JBPA 5FXSA 2C5NA 4D5HA 1BYGA 2RFNA 3EN5A 3NEWA 5CU6A 5DVRA 2ZDUA 4JAJA 3BHTA 3KRXA 3V8SA 3CLYA 3T9IA 1MRVA 2H96A 1M2PA 2J9MA 4HJOA 4MBIA 5M44A 3TMOA 5CU4A 3R2BA 5HEZA 3BBWA 3NYOA 2W7XA 3A7HA 4C57A 3R02A 5A4TA 4DGLC 2ZV9A 3DV3A 2YM5A 2HZIA 3WIGA 5IA1A 2W96B 3S1HA 2EU9A 3BLAA 4F7JA 1DI8A 3BZ3A 3PXFA 5HG5A 1W83A 4PL3A 3UP2A 2WMUA 2PU8A 3MIAA 3FMDA 4R3RA 2XB7A 4JQ8A 4QQJA 4ITHA 3DLSA 4MNEB 1Q41A 3ODZX 5ETFA 5J87A 4EC9A 3M2WA 2BRHA 3OHTA 2VWVA 2XRUA 3VQUA 5I3RA 5KX8A 2WQNA 3GC9A 3DB8A 2ITPA 1HOWA 4F1OA 4K2RA 3BI6A 4GJ3A 4LG4A 5F20A 2QOBA 4RT7A 3EJ1A 4K33A 5H8EA 2WTIA 4ZSEA 2A2AA 5HE2A 5L6PA 1SVEA 1YOMA 2J5FA 5CSXA 2SRCA 4U3YA 4QP6A 1EH4A 2YIRA 3RPSA 3G5DA 4HYUA 5E8YA 2GCDA 4ACMA 3G90X 3LFQA 4IFCA 4W9XA 5D41A 4ANOA 5HTIA 4PL5A 3VS3A 3UJGA 3FZ1A 1SVHA 4NM0A 2IW6A 3NUAA 1QMZA 2W1EA 4L42A 1OKWA 4E5BA 1PKGA 4XH6A 5CZHA 4HPTE 1QPCA 1W8CA 2F7EE 4D2VA 3SW7A 4I0SA 3W0QA 3C13A 3QQLA 2VTPA 2UZOA 4RA5A 2PVFA 3DB6A 4FICA 5KCVA 5DT3A 1DAYA 3Q4UA 4GG5A 3UBDA 3KB7A 4LGGA 4LL0A 4O0VA 5IUIA 4B9DA 2OXXA 4YSJA 1PRYA 3EQFA 4U0IA 4ZZMA 3L9LA 4EEVA 2PUNA 4UMUA 4XP0A 4O1OA 2IVUA 5HGIA 4FTIA 4FIIA 3TZ7A 4B8LA 3HV3A 2B1PA 4WHZA 2HZNA 4RIXB 2VGOA 4RJ8A 3FZPA 3QBNA 3NSZA 2UVZA 4R5YA 2HELA 3L9NA 4FG7A 4KS7A 2NPQA 2YFXA 4AG8A 1XBBA 4UX9A 2RSVA 1ZAOA 4AA5A 1IAHA 4BJJB 1IEPA 3FZTA 4ALUA 3QRKA 4FKGA 2QKWB 4JBPA 4RIOA 4QP4A 4Y83A 5I3OA 4RVLA 4ANNA 5DMZA 3AMBA 4Q9ZA 3CD3A 1K9AA 1VR2A 4Y8DA 4BDCA 3FHIA 3NNVA 4FTUA 3UE4A 5HKMA 4BTKA 4C38A 4YMJA 4ZMEA 2JDTA 4AN3A 2X8DA 3UO6A 3FLYA 4ZS0A 3VWAA 5L8KA 1I44A 1XH6A 4I6QA 5FBNC 5J9ZA 4WG5A 4BIEA 3LFSA 2X0PA 4MXOA 4QP9A 4CFVA 5CF4A 3JS2A 3TACA 4BDEA 3V01A 4CFNA 4J97A 2AQXA 3V04A 5IH5A 4GCJA 3UZTA 5AIKA 3PP0A 2HOGA 4O4FA 2RFDA 1ZOEA 4JR7A 2PVYA 4RWIA 4UWCA 1IAJA 3MJ2A 5JGAA 3TEIA 4L45A 1Q8WA 4M67A 3BBTB 2Y6OA 3EYHA 4CZTA 2FSMX 3PVUA 5IEXA 2F9GA 4UALA 4U7ZA 1IA8A 4YTIA 4YNEA 5AP0A 3TYKA 4XRJA 3I7BA 5DWRA 4EH7A 3DU8A 3D0EA 4U44A 4GS6A 1BMKA 2J0KA 2VX1A 4YZMA 4V04A 4BCPA 3RAIA 3W1FA 3WE4A 4QPMA 3L1SA 3D83A 4TYHA 3ZM4A 3ZMMA 2GDOA 3KC3A 4RJ6A 5CNNA 5CEKA 5HTCA 2I1MA 2ITVA 5EHOA 3QL8A 2OZAA 5FDXA 3V5LA 4CTBA 2WO6A 3EB0A 3ZOSA 3ZRMA 2O63A 3HECA 1F3MC 4FBXA 5HVYA 5HE3A 5I9YA 1V0BA 3QU0A 4W4YA 1BUHA 4EI4A 3BLRA 5KE0A 4KUJA 4DTAA 1OKYA 1PYXA 4IAIA 5FEQA 3WIKA 4IB0A 5LQFA 4DHZA 2WOTA 2X7FA 3IS5A 3QA8A 4RC3A 1PHKA 4A9UA 2YERA 2QG5A 4MAOA 5L2IA 5T6KA 3HAVA 2ETKA 4C7TA 1U4DA 1H1QA 4BFMA 3N4TA 4NJ3A 1KOBA 4EUUA 3K54A 3O8TA 3F9NA 3FMMA 4PV0A 5JQ5A 5D1JA 2JKQA 3RZBA 4PQNA 4IVBA 4IX6A 2ESMA 1YI4A 4I6BA 4C3RA 5IDPA 4A07A 2QOCA 3RZFA 5BQ0A 3VW8A 1Q8TA 4CKRA 2VWBA 4G1WA 2VUWA 4EWHA 3RMFA 3POZA 2PZPA 3PXZA 5AUTA 4TZRA 4GT5A 2RG6A 4O4EA 3W2OA 4I6LA 4EYJA 3W2PA 4RC4A 2VTMA 5EYDA 3QC4A 1PXKA 2YHVA 4JQ7A 5ICPA 4YJTA 3BGQA 3LXPA 5HNGA 3MB7A 2PY3A 4RLKA 4E6QA 5A4CA 4IVDA 5F94A 1PXIA 4AFEA 2J4ZA 3MA6A 4BBFA 3QTIA 2UV2A 4BDHA 4FG8A 3KVWA 2BCJA 3E92A 2YZLA 3WF8A 4UXLA 5IQBA 2HCKA 3SOCA 4O2PA 4PDOA 2UW6A 4ACGA 1CM8A 2J0JA 4MH7A 3KF7A 4O7NA 4EUTA 3PJ2A 5J1WA 4FEXA 3Q9XA 4NIFA 3R63A 3NCGA 3IW6A 4DBXA 3CCNA 2IVVA 4O82A 1WBPA 3BL9A 4G6OA 1PXJA 4KA3A 4ZY4A 4QQCA 3UOJA 1ZYLA 2PE0A 4M13A 1R78A 2YEXA 2C1AA 3OT3A 4Q5EA 4LM5A 3LVPA 1ZRZA 5GNKA 4XCUA 4DFXE 4RFMA 3RHXA 3R7VA 4CMOA 4PMMA 5L2TA 2WPAA 4WNKA 2C6MA 4E7WA 4YJSA 3DXNA 2UZUE 3DDPA 3EKNA 4FL3A 3TNHA 5K5XA 2XM8A 3QC9A 4U41A 4X2JA 5GZ8A 5HO7A 3FLQA 4IWOA 5I9ZA 5AJQA 2R3MA 3ZRLA 3R9NA 3SGCA 4U43A 3F3ZA 4BCGA 4J99A 3BIZA 3UDZA 2OXYA 2IEWA 4RFZA 1ZOGA 2ZB0A 4QNAA 3A61A 3VUHA 4AXCA 4DEAA 4RIYB 3EQPA 2I6LA 2VX0A 4FVQA 4FEUA 4UB7A 3NUXA 4I5PA 4QPSA 4DEIA 2QD9A 3FL5A 5DBXA 4EORA 2AEGA 1GY3A 5CALA 4FVRA 5J8IA 4A06A 4CQEA 4RJ5A 1UV5A 5ACKA 4I93A 1L8TA 3LJ1A 2YACA 5DYJA 4DHJA 1JSUA 5CEPA 3AKKA 4IAAA 4AN2A 5BV3A 2CN8A 5H2UA 2XP2A 4BCOA 5F1ZA 4ZXTA 3BHHA 4USFA 2PHKA 3H0YA 4GFGA 4L9IA 4BL1A 3MA3A 2X2LA 4QRCA 4C34A 4EH2A 3T9TA 4RX9A 2ZDTA 3R7UA 4DDGA 4FL2A 5FTGA 5HESA 5DLSA 4YZBA 3ZTXA 3NUSA 4IM2A 3NZ0A 1O6LA 3V5PA 2VWWA 4QMNA 3DZOA 3OUKA 5ANEA 3HDMA 4HNFA 3D14A 4FSUA 1W82A 2NYAA 5EI8A 2DQ7X 3D7TA 1Q8YA 2IVTA 1TQPA 4C4JA 3DJ5A 2WMXA 5CAVA 3LW0A 3PG1A 2YJSA 1VJYA 4S2ZA 4WD5A 4QYGA 4UMTA 4HW7A 4XP2A 1YDTE 4BN1A 3OWPA 4DFLA 4EKLA 3E3BX 4TKSA 1YXTA 1A06A 4ALWA 3QYZA 4YO6A 3UDTA 3BYOA 2X0QA 5KZIA 1YXVA 4QYYA 2R64A 4WNMA 3G51A 3QD4A 2C69A 3QQGA 2C0OA 4A9TA 2JAMA 2ZV8A 2F7ZE 5HORA 2XAOA 3EQDA 4F6SA 2PULA 3L9MA 4L68A 3DNEA 1Y6BA 3I5NA 3TL8A 4BCFA 1YI6A 5HVJA 5HX6A 4FTTA 3WOWA 5LMBA 5CASA 4BTFA 4E93A 4UV0A 3R83A 2PVRA 5EI2A 4AWIA 2CGVA 3EHAA 4FE2A 1W2FA 4MQ1A 2QOKA 3DGKA 2HXLA 4I21A 3MVJA 4JDJA 2WMTA 3EQIA 2J2IB 1ZYCA 3DNDA 2VWZA 4XNEA 1FGIA 5JFVA 3LFAA 1STCE 5DNRA 2OGVA 4QO9A 3NDMA 3NWWA 4PX6A 3V5JA 2I40A 4D0XA 3I5ZA 4ASXA 1PW2A 5A6OA 2OLCA 2J0MB 4FT9A 1FPUA 3WYYA 4DA5A 2XYNA 4DITA 2BDFA 3P7AA 3D9VA 1JKTA 3ERKA 4IACA 4KKHA 4NIFB 1TQMA 2HWOA 2PWLA 4ALVA 3BELA 4G31A 1S9JA 3HGKA 4HNIA 4YZDA 4AP7A 5BUIA 4YJPA 4C35A 3RAHA 4O83A 4ZSAA 3P7BA 3W2CA 3DT1A 1Q8ZA 4DE4A 4YU2A 4WUNA 4FGBA 3VBYA 1KE9A 1DAWA 3KFAA 5CXZA 4LRMA 1H1PA 4NZWB 4WSYA 3I0QA 3CR0A 1O6YA 4FOCA 4CFUA 5CF5A 1JSVA 4ZS4A 4KS8A 3MYGA 2CLQA 4LV8A 1ATPE 3FXZA 3A8WA 5KNJA 5M06A 4C02A 3D7ZA 4ZY5A 5I4NA 3LFBA 3K3IA 1U5QA 3OTVA 4R1VA 2VNYA 3BYMA 4EK4A 1R0EA 4IAKA 1UVRA 4P7EA 1QPJA 5J7BA 3Q2JA 4YTFA 1R39A 3UPZA 4AA4A 1NY3A 4KRDA 4M84A 2R3LA 4PMTA 3RPYA 3H30A 4XV2A 3ORLA 4YLJA 5JQ8A 3DTWA 1TZDA 3GBZA 4FKRA 4PMSA 3E8NA 4U9AA 4J8MA 1SZMA 3L8VA 5K5NA 2Q83A 1WAKA 2NO3A 4ITIA 4M14A 2WB8A 2XNNA 1J91A 2ACXA 3COMA 4NCTA 4A4XA 3W0RA 1ST0A 2C5XA 5I9VA 1Y6AA 3C4CA 1ZWSA 2WMQA 5DRBA 3SVVA 2VTLA 2WMBA 3C9WA 2XANA 3MS9A 3VNTA 4O7ZA 4JVGA 4P5QA 1JVPP 4M7IA 5EHYA 2YIXA 3HVCA 2A19B 3F88A 3Q6WA 4LMNA 5AA9A 3FPMA 2VX3A 1OIRA 4R77A 4TN6A 4L67A 3R73A 4FIJA 3PE2A 4IX5A 1Y8GA 4TRLA 3FPQA 3TKHA 2EXCX 4Q2AA 3Q53A 3RCJA 4S32A 1GOLA 3CQUA 4B0GA 3D7TB 5M53A 1R1WA 2QU5A 1FVTA 4IC7A 1YOLA 3HX4A 3PLSA 4CMTA 4FKIA 4MXAA 5E8VA 3NMUF 5JMSA 5AUUA 4M69B 4CKJA 4RG0A 5AV2A 1WBWA 4RIWB 4I24A 4AW2A 4ARKA 5CT7A 4P90A 3MJ1A 4LMUA 4LUDA 1A9UA 4CZUA 5EDPA 5FP5A 5K0KA 5J1VA 2V22A 2CDZA 4MXYA 4ERKA 4YPSA 4AXEA 3IECA 4ZTSA 4HCUA 2W1HA 2LAVA 5AM6A 4ID7A 2HZ4A 2FUMA 4YJQA 4JAIA 2C30A 3VBWA 4FKWA 5AR2A 1P4FA 5IQCA 3O51A 3ALOA 1OIQA 3EQHA 4TYEA 4X2KA 5CVGA 5L8JA 3W55A 4FV0A 4Y95A 3RM6A 5JH6A 2YDJA 4GVAA 4O0UA 4YUQA 4OBQA 4PF4A 4MTAA 3QZIA 4WO5A 5KZ0A 3UIMA 4PDSA 4G3EA 4RMZA 4Q5HA 4H3QA 5JRSA 4O7YA 3BRBA 2GMXA 2X6DA 3D2KA 4HZRA 4OTQA 3TZ9A 3ZXTA 4C3FA 5C8NA 1LR4A 2WEVA 3TWJA 4HGEA 2E9OA 3CPBA 3QRUA 4JR3A 4O96A 3VBTA 4CYIA 2X9FA 2YN8A 3MFUA 3QD0A 4GK4A 3DOGA 4AGWA 2XNGA 1UU3A 1XBCA 5FTQA 3BU6A 3JY9A 4BIBA 2JKMA 4IAFA 5CU3A 4KIPA 3S3IA 2VTSA 3NAXA 3QALE 4FRFA 4G5JA 4B4LA 1SYKA 3W0OA 2C6IA 3TJDA 3AC4A 4X2FA 2OXDA 4OR5A 3Q04A 2XAMA 2CCIA 2WD1A 3KXZA 5DHJA 2I7QA 2YCRA 5CF8A 3EZVA 4F0IA 2C5YA 3GEQA 2OF4A 4FJVA 3R6XA 2J7TA 2ZV2A 3UQGA 4NKAA 4BCQA 3ZC6A 3SQQA 1PMNA 4A9SA 4BCHA 2HAKA 2CNUA 2WGJA 3D5VA 1WBOA 2UUEA 3SD0A 1KE7A 4G34A 3PIYA 4B99A 4R7HA 2WMVA 3Q5IA 5CX9A 4BCKA 3LHJA 4GL9A 4EJNA 2VWXA 4ZSLA 4FKVA 4Z16A 5GINE 5KBQA 1H8FA 3GGFA 3MIYA 4N4SA 5G1XA 3TXOA 5L2WA 3KXMA 1YWNA 2PZRA 3F61A 4CCBA 3QLGA 3R28A 5KBRA 3ZLYA 2CN5A 2WTWA 4E1ZA 1BLXA 2REIA 2XK4A 3NVKI 2YWPA 3EN4A 3GCPA 1GNGA 2WEIA 4EYMA 4Z7GA 1I09A 2GNFA 3C4EA 5DT4A 4PP7A 3LCOA 3P86A 4WA9A 1H24A 1P5EA 1UWHA 3COHA 1WCCA 4MUQA 1YOJA 3EQRA 4FV2A 4DLIA 2F57A 3PRFA 1J7IA 3QXOA 4CFFA 1PMUA 1AD5A 3OXZA 5BPYA 4CV8A 3G33A 2BVAA 3ZCLA 2W4OA 5GZAA 5IDNA 3ZZWA 4HVIA 3JUHA 2JIIA 5IQGA 1MP8A 3C50A 2JDOA 3EFLA 4YJUA 2BZIB 4FVPA 2BDJA 4FEQA 3JVSA 4K6ZA 5D10A 1J7LA 3EFKA 5EW8A 4AOTA 1H25A 4Y5HA 5HU9A 4I3ZA 2OWBA 2Y7JA 3QTUA 4UMQA 4J8NA 5IQFA 4AOJA 1ZZ2A 2IZSA 3CEKA 3VBQA 3NW6A 1F5QA 3F2NA 4XV9A 4EH9A 5KMLA 3LFFA 3R8LA 2PVNA 2C1BA 4ITJA 4RWLA 4KKGA 4QMTA 4EOMA 4OTGA 1YWRA 3QTXA 4IXPA 4K9YA 4GH2A 4H3PA 4YBKA 5I9XA 3N9XA 4DH8A 4D28A 4UZDA 5IQDA 3QQHA 4U79A 3MI9A 4KB8A 4YSMA 3PP1A 2C3IB 4QPAA 3LJ0A 5HQ0A 3DLZA 4QMMA 4RX8A 3ZDIA 2UZWE 3Q6UA 2WZJA 2VTAA 3OW4A 4FSZA 3DBCA 2ITOA 4C59A 3HUBA 5D7VA 3IQ7A 2BKKA 2G1TA 4GIHA 2X7GA 5ETCA 4KNBA 1H0WA 4U45A 5G6VA 4NM3A 3PZHA 4JRNA 2BAJA 2NRYA 2W5HA 4XG4A 2G2FA 4GYIA 5HBEA 5HO8A 5CAPA 4DEBA 4I5HA 4PTEA 5D11A 4AGDA 4CQGA 3C0HA 3NW7A 4EOJA 1XR1A 3ENHA 3IONA 3O71A 3QWJA 3R9HA 4H39A 2FH9A 2XA4A 4Y85A 5FP6A 3H9FA 3RI1A 1Q5KA 3D4QA 3QHWA 4IAYA 4IW0A 5JRQA 3ULIA 4TYIA 3I79A 2A0CX 4EHGA 2CKOA 4WNPA 4U80A 5IA5A 1V1KA 5DA3A 4FTJA 5LCKA 4PTCA 5C26A 4ACHA 3AKJA 5BUEA 1XHAA 4ANLA 5AAEA 3TG1A 2W17A 3F5XA 4M97A 5EW9A 4ASEA 2ETMA 1GIJA 5EG3A 4RPVA 3MWUA 4RIXA 5EFQA 4D9TA 1OL7A 4Y5QA 4EOQA 4BZNA 3FMKA 5LWNA 2VZ6A 3F3WA 3ENMA 2BUJA 2WXVA 3MFRA 3WF6A 4HGTA 2C5OA 4QYHA 2IWIA 2QQ7A 3HP5A 3GNIB 2XYUA 4K77A 4FEVA 1H4LA 3MBLA 5H3QA 2GPHA 3GI3A 4RSSA 5EM7A 4K11A 5LCJA 4MKCA 2XJ2A 4U5JA 4CNHA 1JNKA 3HZTA 5HE0A 3F7ZA 3N4VA 3PFQA 3LCDA 2IZTA 3A8XA 3C51A 4XG2A 4ZZNA 2CKPA 3BV2A 5JGBA 1U54A 4L3LA 4KRCA 5KHXA 2WTCA 3BYUA 4NW5A 3DZQA 1PKDA 1SMHA 3ZUVA 3HV4A 2OSCA 2F49A 3R7EA 3HYHA 3D94A 5E8SA 4ZJVA 1UKHA 1H00A 3QFVA 4GT4A 3P79A 3KEXA 4K0YA 4QTAA 4BI0A 3WZKA 4R7BA 4I0RA 5DFPA 4CFWA 3LLTA 4ANBA 4OTDA 4USEA 3WZDA 4TYJA 5BYZA 4IJ9A 3E7OA 1M2QA 2PL0A 3EOCA 3OWJA 4J98A 2XKFA 4WIHA 2I0HA 4ZAUA 4BCIA 3UVRA 2G2HA 3CGOA 2GU8A 4NW6A 1E1XA 4YC6A 2CLXA 4S33A 3GU8A 4QQTA 3FBVA 3NYXA 4AUAA 4IB3A 3CPCA 4I4EA 5HCXA 4JS8A 3EQGA 4MF0A 4U8ZA 5HVKA 2FO0A 4IZ5A 3AD6A 3LM5A 4N6ZA 3MH0A 3SX9A 4JBOA 4MWIA 2B7AA 5LVOA 4AQKA 5AEPA 3TM0A 1QCFA 2ONLC 4IC8A 4IX3A 3UIBA 4CYJA 4O91A 4DAWA 4L53A 5LWMA 3ORKA 4GUEA 1REKA 4FV4A 5AMNA 4TWPA 4O7LA 3OW3A 5FM3A 5CSPA 3FKNA 4ZTHA 1QPDA 5CS6A 2GSFA 5IMXA 1OBDA 1B38A 2B0QA 1WMKA 3OCSA 2J51A 3O7LB 3CD8A 3KRJA 2HW7A 4EH4A 4I92A 1SM2A 3OP5A 2RKUA 4XMOA 5HIBA 3OTUA 1BX6A 3VAPA 2W1CA 3O0GA 1IG1A 3ACKA 2OKRA 3VIDA 1J7UA