5HIEA

Braf kinase domain b3ac loop deletion mutant in complex with dabrafenib
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
269
structure length
258
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Activation Mechanism of Oncogenic Deletion Mutations in BRAF, EGFR, and HER2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 258
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hieA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hieA01
5EH0A 2V7AA 3ENMA 4EH8A 4EOJA 4ANMA 2BAJA 4IX5A 4BDGA 3VQUA 3W8LA 4IB1A 3E62A 3EFWA 3IOKA 3TNIA 4GKHA 2J5FA 3P9JA 5AA8A 4XV9A 3NUAA 3MVLA 2JC6A 4W4VA 4AA4A 4FIEA 4E4XA 4FEUA 4N57A 5BQ0A 4O0YA 3ZLWA 3ZH8A 3JYAA 3CBLA 3PVGA 3SGCA 1KSWA 2ZAZA 4O7LA 1U59A 3ZTXA 4RLLA 5DEYA 4WRSA 4J96A 3VUDA 4F08A 2VTPA 4FTOA 3EFJA 4DHFA 2F57A 4R3PA 4UWCA 2YABA 4L3LA 2FSMX 3ZSHA 3PSBA 1STCE 1W82A 3R8UA 1QCFA 1ZY5A 3B2WA 4H1JA 4MXYA 1AD5A 3GU6A 4NFMA 4NWMA 4O27B 2WTDA 5M53A 4QP1A 2E9VA 4RIXB 3W2OA 4YTHA 1CKPA 4W8EA 1YOLA 2PVHA 2LAVA 4FV5A 3VC4A 4Y5HA 3DBFA 2WTCA 4FV4A 3MPAA 4EKLA 4AW2A 4ZSAA 4MKCA 2HENA 4RVKA 3TDWA 2Z2WA 3P4KA 4FSYA 3ATTA 1R1WA 4DGNA 2CLXA 2W17A 4N0SA 3EN5A 4CYIA 1XHAA 3EFLA 4FIHA 1B38A 1ZOGA 5GJGA 2KTYA 4YHJA 3FZ1A 2VU3A 4FKVA 4EHVA 4X0MA 3E8EA 2VV9A 5B0XA 3F3TA 4AZEA 1UV5A 3Q9ZA 3QC9A 1YI4A 4TYHA 4DG2E 4CT2A 4K1BA 3R0TA 3E7VA 4JT3A 5F20A 4LL5A 1PMUA 3B8QA 4YJOA 5ACKA 4O6EA 3MTFA 4K33A 3EN9A 3MJ1A 5FXRA 2C30A 4RX7A 1PXJA 2P33A 4TZRA 3CTQA 3NNUA 4CLIA 5EKOA 5M4UA 5BYLA 3H9FA 2B7AA 2C6EA 4HVHA 3ZZWA 3NPCA 3ROCA 5CXZA 3PXQA 4FSWA 3A99A 2C5OA 2ZJWA 3ZUVA 2UZLA 1GZNA 2DS1A 2AYPA 2QR7A 1CTPE 2UZNA 3PZHA 4FG8A 4TWOA 1MRUA 5FGKA 4XBUA 3W2PA 5AUUA 4W8DA 5HNIX 4BCOA 1MQ4A 2YCSA 2UW5A 4MBJA 4AOIA 4XV1A 5IA0A 4ARKA 4BCHA 5HHWA 4U40A 5A4CA 4QYFA 4W9XA 3WILA 5JKGA 3FI2A 2R3PA 2ITYA 3WZKA 1MUOA 4QPAA 4OBPA 2BUJA 2WFYA 5DMZA 1O9UA 2J90A 2FVDA 1GZOA 1KE9A 3GCQA 3PIZA 2OFUA 3IOPA 4MXZA 4MQ1A 4P5ZA 4O2ZA 3VIDA 2BILB 3R9NA 5KMNA 4DG0E 3QAME 2X2MA 1NVRA 3OFMA 2JDTA 3UG2A 3NCZA 2BR1A 2J0JA 4YBJA 1WBSA 3MFTA 2PVJA 3O0GA 4NM5A 1GAGA 3DBEA 5LMBA 5EQPA 4EUTA 5FDPA 4EOLA 3RCDA 5IUGA 4QP6A 1XWSA 4K18A 5CF8A 4KAOA 3V8SA 2CGXA 2R3HA 3OEZA 1H27A 4AA5A 3S4QA 5CASA 4BN1A 2PHKA 2RFNA 2WEVA 4XV2A 5FTGA 2W96B 2E9NA 3UNJA 3R1QA 4HVSA 4RIXA 3LFNA 3LFAA 4I92A 5AX3A 3ZZEA 4BKZA 3K3IA 5G6VA 4NW5A 4L45A 1Q8TA 3UVQA 2WXVA 5HVYA 3BWJA 4EH9A 1H4LA 2HZ4A 3MFUA 3W10A 2O63A 4FIJA 2ITXA 5FG8A 1O6KA 5AUWA 4AZTA 5CSWA 3UODA 5BNJA 5M56A 2R4BA 5IQGA 2ETRA 3D7ZA 4C8BA 2CNVA 2X1NA 4O2PA 3VAPA 4BCMA 3C4CA 2YITA 3HV3A 4F9BA 2IVTA 2XZSA 3SVVA 4BL1A 2W7XA 2XIZA 2R0IA 3COHA 3DGKA 2X7FA 3UQCA 3KVXA 2JIUA 2OJIA 2F2UA 2VTMA 4JAJA 4E4LA 4OBOA 1U4DA 2WQMA 2WTIA 1OBGA 3BHUA 5FWKK 4O83A 1VYWA 1KE6A 4IM3A 5JH6A 2ZDUA 3GFEA 4GIHA 4D2TA 1J7IA 3BYUA 3CJFA 4XG4A 2C3KA 2XIYA 3LMGA 4JLCA 3UTOA 2IO6A 3NS9A 3FY0A 4IX3A 2QQ7A 2J0MB 1SNXA 3RPYA 3SHEA 4PL5A 3OCGA 3MVMA 5FBNC 3MH1A 4BDKA 3QF9A 3IPHA 3QRKA 5E90A 5JFWA 2CKOA 1OPLA 2ZB0A 5JRSA 2VNYA 3R1SA 5BX0A 3MH3A 1XBAA 3RM6A 3H9RA 3WOWA 2YISA 3U8WA 4DITA 4O7NA 4J52A 2R64A 3RPSA 2XK8A 3QYWA 5EM5A 2WOTA 2R2PA 3NEWA 3QX2A 3QUDA 5AP4A 3O7LB 3MB7A 3D5XA 3MY5A 4S2ZA 3R8VA 1FVVA 1SVEA 1XJDA 2W99B 4B7TA 5KHXA 4OBQA 4IWPA 2BRHA 3BV3A 5CI6A 4I5PA 5CVHA 2W1GA 2W1FA 4J97A 2WKMA 4MXCA 4TN6A 4ZZNA 3I1AA 1Z5MA 4USEA 5I9YA 3HECA 3R73A 1BL6A 3VUHA 2YAKA 5M44A 1JKTA 1JSUA 4PMMA 3OZ6A 3QD4A 3NAYA 3A61A 4WOVA 3U87A 2OXYA 5DFPA 1RDQE 2UW4A 2PMOX 3DT1A 3QQGA 4WSYA 4FNXA 4AN9A 3C0IA 3CLYA 5G1XA 3RM7A 4MK0A 2A1AB 2QLQA 5CU2A 5HCXA 1OIUA 3EL7A 1ZZ2A 2B9JA 1OIQA 2WMSA 3C5IA 2UW6A 2YFXA 3RWQA 3VS0A 1OIRA 4PP9A 3O8TA 4M12A 4PF4A 4NW6A 4O1PA 4EUUA 2F9GA 3VO3A 2G1TA 4ACMA 3OTUA 3HGKA 1PMVA 3Q4ZA 4YJVA 3SC1A 4ZZMA 2HXLA 3R00A 4FV2A 5E8TA 1SVGA 4JOAA 2Z02A 4QOXA 1SYKA 2H96A 2ITQA 1OL5A 3R9RA 4ACCA 3F69A 3QC4A 2J0LA 4IE9A 2OSCA 4HYHA 4X7QA 2WD1A 2CNQA 1K2PA 3OCSA 4FSUA 2QKRA 3LMIA 1W0XC 3HRBA 1KV2A 2FSOX 4NJDA 4NCTC 3TJCA 4A4LA 5B2MA 2R3LA 3U6HA 3CGFA 2UZDA 2RGPA 2QU6A 4QTBA 3VHKA 3E93A 5DR6A 2YN8A 1J7LA 3FKLA 3FAAA 5FD2A 3V04A 3MPMA 5EG3A 4APPA 4NCTA 5E1EA 5AFVA 2XVDA 3UMWA 4XP0A 3SQQA 4WHZA 3GI3A 2JBOA 5HBJA 2QD9A 3IW5A 2X8DA 3E5AA 2C1AA 4G3EA 4FTJA 3H10A 4HPTE 3UMXA 4C4IA 1H00A 2W1ZA 3LXNA 1SZMA 5A6NA 3QD0A 3E63A 4C2VA 3DQWA 2HY81 4YLJA 4FV9A 5GZ9A 5T6KA 3GT8A 4HZRA 1JLUE 5FTQA 5J79A 4FV0A 5ETCA 2BRMA 2PZYA 5D9HA 2HELA 3C13A 3GC8A 3LE6A 3ZC6A 3DXNA 4C59A 3ETAA 4N70A 4UXLA 4HVGA 1PXPA 2XNNA 2WAJA 5BVFA 2CN8A 4J98A 4YR8A 4ITJA 2FO0A 5HTIA 4C4GA 4DA5A 1E1XA 3LHJA 4BDFA 5DBXA 3DTCA 3HDNA 1W83A 4IDVA 3IW6A 4QMYA 4E93A 5JT2A 5JN2A 3FZRA 2OK1A 3DNEA 1YWRA 4JRNA 1P2AA 4XG6A 5J1VA 4JQ7A 2ZMCA 2ZV8A 4F9AA 3IGGA 1WZYA 1JPAA 3I79A 4BCPA 5TE0A 3HA8A 2IN6A 3DKGA 5I9VA 3ZM4A 4HYIA 4WD5A 4CKJA 2GNLA 5HVJA 5CSHA 5JGDA 3TT0A 2VNWA 1B39A 4BBEA 2B53A 1W7HA 4JDJA 3TUBA 4RQVA 3AC3A 4EHEA 4X21A 4X6QC 2F7ZE 2QOCA 4F7LA 2X81A 5BVWA 4IDTA 4MBLA 4BCFA 2ITPA 3AGLA 2C5XA 4DFUA 3KL8A 2VTNA 4QP8A 3HDMA 4L68A 4D1XA 5EK7A 3V5JA 4JG6A 3WZDA 4M3QA 3R6XA 3E92A 2HK5A 4KSQA 4EHZA 4D2SA 1OI9A 2IW6A 3QUEA 2GNGA 2YDJA 4K6ZA 5FTOA 4I5MA 4OR5A 4DEBA 4ERKA 3ZM9A 3QKMA 3SRVB 3UYTA 2QCSA 4QP4A 4DFNA 3S2PA 3L9PA 3DXQA 1YDTE 3JXWA 4JDKA 4XRJA 3H9OA 5EW3A 2UVXA 4XEYA 3RAIA 1YDRE 3WBLA 5M06A 3KMMA 1UNLA 2ACXA 3TKIA 3N51A 1OBDA 1JSTA 3S0OA 2DQ7X 1ZMUA 3D7TA 3MIAA 4I24A 2PMIA 4B4LA 3ZSIA 4WG5A 3ZS5A 4ZMEA 4RMZA 3WE8A 5IUHA 5K9IA 3Q9WA 2HW6A 2XK9A 3QUPA 1OB3A 3PRIA 4QO9A 2C6OA 3RHKA 1XH5A 5T68A 4C3RA 3D5VA 4FA2A 2PVLA 3V8WA 4C61A 4X2NA 3JR1A 4BIBA 5GJDA 2OZOA 5J87A 4OTPA 1JAMA 2GFCA 3Q4CA 5A4LA 5IU2A 5DT3A 4XX9A 1PYEA 3OCBA 1UU3A 3DPKA 2GQRA 4DT8A 2BIKB 3PP1A 4GFOA 4E26A 1R0PA 3OXIA 2C6TA 3SKCA 3FDNA 2JD5A 3CS9A 4CV9A 3DZQA 3GVUA 4S34A 3O71A 4AT5A 2W4JA 3VNTA 5KMKA 3QYZA 3MESA 2BZKB 3RWPA 3R2BA 2XH5A 4I4EA 2YIXA 3NNXA 4UV0A 4A9SA 4KKHA 2G2HA 3KRLA 4IFGA 4ZTRA 4A07A 4DFLA 5K4IA 4TNDA 5IF1A 4D5KA 5DHJA 1I44A 2ETKA 3K5VA 3OUKA 3WI6A 4ACHA 3HMMA 4RQKA 3ORXA 1GIJA 3DQXA 5CU0A 2YEXA 1G5SA 2PWLA 4B0GA 4R7IA 4H05A 3U54A 4ZTSA 4LOPA 1Q99A 2GS2A 1ZMVA 2ZV9A 3TZ8A 3EQGA 3UOJA 4IWOA 3QQKA 4C36A 5FEEA 2OICA 2BZJA 2H9VA 4WT6A 2XKDA 5IQHA 1SVHA 4CCUA 4E1ZA 5ANDA 2Y8OA 5LOHA 2NPQA 4RX8A 4F64A 4UYAA 5CLPA 3PG1A 3VS2A 4IZ7A 4D0WA 3LFSA 3PPKA 4BCGA 3LZBA 3G15A 2C0IA 3AC5A 3QRUA 2Z7QA 2OG8A 2PUNA 4UY9A 3I6UA 2WMWA 4WG3A 2REIA 2YIQA 4FTQA 5CX9A 1JVPP 2R5TA 4MD7E 2OIBA 4MWIA 4IB5A 2XCKA 4O0SA 2XJ0A 3KK8A 5AUYA 3KXHA 3TWJA 2Y7JA 4FT3A 4IJPA 5IUIA 5A14A 2E9OA 2GNHA 4H58A 2CDZA 3C4FA 3NUSA 5L6OA 4IM2A 5EHYA 4JQEA 3SRVA 3U9CA 5HU3A 3V6SA 1YXXA 4DTAA 1IG1A 4QMWA 2BHHA 4GK2A 4QMTA 4PV0A 4ZSLA 4DTKA 4ID7A 4UMQA 1BKXA 3QWJA 4GYIA 1FINA 5HIDA 3DXPA 4IC7A 4OTWA 5IQIA 3I7CA 4DGLC 2W5HA 2GU8A 3BEGA 3BKBA 2IW8A 4AAAA 3C9WA 5CEPA 1HCKA 1J1CA 3KCKA 3FXXA 2VWYA 4LRMA 1PJKA 2XM9A 2QKWB 4L46A 3SW7A 2Q0NA 2H8HA 3AMBA 4FVPA 3TM0A 1OITA 1TKIA 4UWBA 3OUNB 3AMAA 2X8IA 5BVNA 3PVUA 3QCXA 2CKQA 4FV6A 3D0EA 5CYIA 5KZIA 3OWLA 4IIRA 4MF1A 4OTHA 5AADA 2GNFA 1OL1A 2R3JA 3IDCA 2XCHA 5C1QB 3O8PA 3LCSA 2WMVA 4BVUA 3R01A 4BY9E 2WMUA 4AW0A 4AG8A 2PK9A 2ZOQA 3A4PA 4IFCA 4FIIA 5E8YA 3VW6A 3A60A 4V04A 2PTKA 4QMZA 4F6SA 3NZ0A 3VUTA 1GNGA 2VTSA 5AV3A 3E88A 3IECA 4FT0A 4RIWB 3R8MA 4BI1A 3DK7A 4ZMFA 3WIGA 3FMEA 4FK3A 1PXOA 3ALNA 4XG7A 5T3QA 4DEDA 3EOCA 3EQPA 4H36A 3Q96A 4GCJA 3FXWA 4QMOA 4R5SA 2OLCA 1JNKA 4KUJA 5E8ZA 3KGAA 1ZYSA 2YCRA 2PZRA 5JZNA 5ANGA 3I60A 5HU9A 1Q8ZA 4FKGA 2O64A 2ERZE 5IISA 2BZIB 2OXDA 3GUBA 4XLIA 5CY3A 4FICA 3NAXA 4I5HA 3UOLA 1OPJA 3KK9A 5HG8A 3BHTA 5AIRA 3CJGA 2CCIA 3GC9A 3CTJA 4MTAA 2A4LA 1IASA 2RIOA 3HMIA 3H30A 4FEVA 4U5JA 3R7GA 4HGLA 2J2IB 4NTSA 2X7GA 4I5CA 4QP7A 1H1RA 2DUVA 5HI2A 2AUHA 5H8BA 4EBWA 2GCDA 4NM3A 4UZHA 3SXSA 5DA3A 4FZ7A 3PJ1A 5FXQA 2VTQA 4K0YA 5EFQA 2UVYA 3R7OA 2RL5A 4KKGA 5M55A 3TZMA 2PMNX 2BCJA 2VUWA 3OOGA 3R8LA 4BDDA 4BI2A 4C4FA 3LLTA 3WYYA 4JR3A 4YBKA 4E6AA 1WVYA 3G5DA 1NVQA 3O50A 1AGWA 2QU5A 3QQLA 2C3IB 4YURA 3QZGA 4L67A 4CGAA 4EI4A 5ITAA 1VZOA 4DEAA 2GQGA 3D5UA 1W8CA 4A06A 4GK3A 5FP6A 1YI6A 3PXFA 2VX0A 1OECA 3R1YA 4UEUA 5I3OA 3VUIA 2CGWA 2P2HA 3PJCA 4IZ5A 4Z7HA 3NVMB 4R8QA 4Y5QA 4EK5A 4R78A 1XH9A 4OAVB 3QGYA 1JOWB 3QXPA 3KF4A 3K3JA 4F6UA 3AD4A 1XH4A 1PMNA 3FLNC 5LVMA 2I6LA 3RK7A 4IVAA 3SXRA 5I9WA 2X4FA 4TWNA 4ZSJA 3CKXA 4BDBA 2BFYA 4FKQA 2GTMA 3GU7A 2QHNA 5EM7A 3DK6A 5AUXA 4LGGA 5JFSA 2YWVA 4AF3A 5CEMA 5EI2A 2QC6A 3PIXA 4KB8A 2ZM1A 4J7BA 1IAJA 1Q61A 2B9HA 3MVHA 4S31A 4C33A 4D58A 3ORZA 5LCJA 3OWJA 3QALE 4IX4A 4NM0A 4ANOA 5CAPA 4PDOA 3V5PA 5AV2A 1LPUA 3C7QA 4D4YA 4A9UA 4OTRA 3LJ0A 4IZYA 4NZWB 4EZ3A 4H3QA 4EWHA 4WUAA 1IA9A 2X2KA 4BBMA 4CSVA 3OBJA 3G6HA 3P7AA 4FKWA 3TTJA 3UIUA 4TKSA 2C3LA 4AQCA 1PXLA 3VVHA 4YMJA 3DK3A 3Q6WA 4B8MA 4P90A 3OHTA 4BIDA 2X9FA 2VTOA 3OY1A 2YM3A 3CSVA 1H1PA 3BGQA 3QD3A 5M07A 2WMBA 3AT2A 4QNAA 2F7EE 2VWIA 3VQHA 1XR1A 4IJ9A 2W9FB 3UJGA 5CALA 3R9HA 3TCPA 5GZAA 5M08A 4II5A 4BTJA 4UMPA 3FZOA 3LFDA 5TF9A 2B55A 2VN9A 3EN6A 2OIDA 4P4CA 3GU4A 3F5GA 3NUYA 3W8QA 2UZUE 1K3AA 3LFFA 1OZ1A 4YTIA 3UDBA 3VS7A 3IQ7A 2G01A 2PVNA 4JXFA 2RFSA 2PVKA 4ZS4A 4FNWA 5LJJA 1OKZA 5DRDA 4QQ5A 3ZSGA 4EONA 5CEKA 1VR2A 5EW9A 5IQFA 3W2QA 5AP3A 1R78A 1WFCA 3L9NA 3EJ1A 4DEHA 2XKEA 3AMYA 4ZJJA 4CG8A 2XEYA 4H3PA 1OVEA 3ZO4A 4YUQA 2CKEA 2BROA 4DBNA 4EQUA 3VJNA 5CF6A 3GCUA 4U6RA 3EN4A 4U3ZA 5L2IA 4D55A 4BC6A 2OF2A 4BDCA 3KRWA 3KA0A 5L2SA 3LW0A 4CG9A 4FTMA 3GOPA 2XYNA 4GV1A 4CD0A 4JJRA 1OL7A 4F0FA 2GSFA 3V5QA 2E9PA 5L2WA 1XH8A 4B8LA 5FM3A 4NKSA 5ACBC 3W2RA 2P2IA 4EOOA 4KD1A 2QURA 3CXWA 3PLAE 3FLZA 4PTCA 3MJ2A 1LR4A 3OP5A 1XBCA 5FEQA 4XUFA 3E8DA 3TTIA 5GINE 3FLWA 2JKOA 3EB0A 2B54A 2CSNA 4KIPA 3ZU7A 3I5NA 5HG7A 4ASXA 3FZPA 1WVWA 5EOBA 5CEQA 2I0VA 3KULA 3BHVA 3RP9A 3ZDUA 4ZJVA 4GH2A 4XG8A 3ANQA 3M2WA 5CSVA 4FSRA 4O81A 4J8NA 3F5UA 4HVDA 1RE8A 3WARA 3NYXA 4M8TA 2PVMA 3H0ZA 3N4TA 4WSQA 2C6LA 2FA2A 4I1ZA 1YQJA 3U51A 3LFQA 2GMXA 3G90X 3NUNA 2PL0A 4U97A 1Y57A 2XF0A 5EQEA 3P23A 4K8AA 1WBPA 1DAYA 5M51A 3DS6A 3DOGA 4GL9A 4ONAA 5DR9A 5KHWA 1YW2A 3QCQA 5H9BA 5HG5A 2YM8A 4MF0A 2R3MA 4PUZA 4RJ7A 4WUNA 5EI6A 4BGGA 2YERA 1E1VA 3BHYA 4WNOA 4EOQA 4ZXTA 2X4ZA 3D9VA 1UNHA 1O6LA 2O8YA 3KRRA 2XNGA 2ZB1A 1Y6AA 2XNBA 3RVGA 3TL8A 5IQBA 1YHVA 1OKYA 2BKZA 4G1WA 2I1MA 4RC4A 4GS6A 3PJ2A 2C3JA 3ORMA 3O17A 5K4JA 3C0GA 3ZONA 1M17A 3R83A 4F9YA 4O0RA 1KV1A 2W1EA 3I7BA 3C4XA 2PUIA 2PZPA 2JKMA 1WAKA 3GXLA 5AIKA 4DEEA 2PSQA 2XBJA 2F4JA 2QOFA 2WOUA 3HKOA 3CIKA 1T46A 2V5QA 4CZYB 3KC3A 4RVTA 4I22A 3T8OA 3G0EA 4CQGA 3VHEA 3LJ1A 1FPUA 1QMZA 3ZCLA 4S30A 3FE3A 2RKUA 3FLYA 5IA5A 2Z7LA 3Q5IA 5IKWA 4EOIA 3QLGA 4EC8A 1Q3WA 1H01A 3ORNA 5J9YA 3G2FA 4RLKA 3UVRA 4BCJA 2WTVA 4I93A 2HW7A 2JDVA 3C0HA 1Q8UA 2OF4A 3DDPA 3DZOA 1I09A 3MV5A 3OD6X 3QRIA 5CVFA 3VS4A 4AE9A 3RBWA 4PDYA 1MRYA 3IW4A 3HRFA 3II5A 1EH4A 2ITZA 3GOKA 3D83A 4NIFB 3SG9A 3U4UA 1UVRA 2F7XE 5TR6A 4BWXA 2JLDA 3F3UA 2XNPA 5IMXA 3EZRA 2GS6A 2Z60A 1REJA 4KIOA 4EK4A 3E8CA 4YJQA 4HGSA 3U4WA 3R7YA 2BDFA 2C1BA 4UX9A 4AGWA 5BVKA 5D11A 4KINA 3FSKA 3ZBXA 4D9UA 3A8XA 2HZ0A 3O23A 3HL7A 5TOZA 4YNEA 1E9HA 2PVFA 5GJFA 5HO8A 1TVOA 3NYVA 4U8ZA 2XNMA 4D2VA 3WYXA 5AMNA 4DGOA 4TWPA 5IA1A 3BE9A 2PY3A 4FNYA 3F9NA 3AG9A 4A4OA 3MN3A 4Z3VA 1MQBA 5IEXA 5K5NA 1CMKE 3KKVA 3KXZA 3QRTA 4C4HA 3T3UA 5BVEA 4EHGA 4PY1A 4FVQA 4OGRA 2YM4A 3FLQA 3ELJA 5E7RA 3VBTA 5LVNA 4BDHA 4ZOGA 4M69A 4ZY5A 2J0KA 3OW4A 3M11A 4FVRA 2WMRA 2YIWA 4IAAA 5AM7A 4Z9LA 4XHKB 1XO2B 2YWPA 4L7FA 5KUPA 5GIOE 3NMUF 4YO4A 5EM8A 1W84A 4XP3A 5KMMA 4PMTA 4NT4A 3EKKA 3CPBA 3LXLA 3PVBA 4FKTA 4Q2AA 4EYMA 3NVKI 3DCVA 2QOHA 4O7ZA 3Q4TA 4LUDA 3Q32A 3QFVA 4NTTA 5L8JA 3MH0A 1H1QA 3DB8A 5DEWA 5FXSA 3VW8A 3FBVA 5M4CA 2JKQA 3I0QA 2DYLA 3ORLA 4JI9A 4MNFA 5ANKA 5CSXA 5I9UA 3ZO1A 3CD8A 4AT4A 4X3JA 4HCTA 4IWDA 1ZZLA 4WNKA 3QQFA 1LEZA 3S95A 4PPCA 3HAVA 1FGIA 4BR3A 3Q53A 5C8KA 4HZSA 2J4ZA 3HP2A 4RSSA 4JDHA 4U43A 3GCPA 5EYMA 5KX8A 4FEXA 4IMYA 5AR3A 4HCUA 4HJOA 2GNJA 2BTSA 5HCZA 3I6WA 4QTAA 5LWNA 2XS0A 4UB7A 4CVAA 3VJOA 5HD4A 5KZ0A 1QPCA 1YOMA 3E64A 3V8TA 4APCA 3LQ5A 3ENHA 2EUFB 3D4QA 3BV2A 5AP6A 4BZNA 1FQ1B 4GRBA 4RJ6A 4YPSA 4AGCA 4F7JA 1ZAOA 5H8EA 3F6XA 3TNHA 3PXRA 3EKNA 1KE5A 3ZFXA 2RSVA 2X39A 4NU1A 4BKJA 1OUKA 3AD6A 4AZSA 3GC0A 3HP5A 3NWWA 4GEOA 3P0MA 4D2WA 1AQ1A 1MRVA 1Y8YA 1GZKA 4GUBA 4LGDA 4F70A 5EDPA 4YJPA 3W2SA 2WQBA 3D7TB 3R7UA 1YXUA 4JIAA 4ANSA 1UU9A 4FX3A 4YZBA 5EI8A 4FT7A 4NIFA 3BBTB 4I94A 4WG4A 3F82A 2GQSA 3BI6A 4YSJA 3FZSA 3PXZA 3ALOA 2W1CA 2XIRA 3MB6A 5CF4A 4FKSA 3D2KA 1H8FA 4AW5A 2PMLX 1BX6A 1U46A 3NUUA 4NSTA 1ZWSA 4GYGA 3KU2A 3BLHA 4HPUE 4IQ6A 2VTIA 1Z9XA 3W18A 4BKYA 4E5BA 1OKWA 3ERKA 3KVWA 4PPAA 4AS0A 2OJFE 4NKAA 4UN0C 4AE6A 5LVPA 2XJ1A 2XM8A 3Q60A 1MP8A 4KKEA 4QMLA 5BYZA 4DFYA 3QX4A 4F4PA 5J5TA 4RGJA 4AFEA 4O7WA 3NIEA 1JBPE 4DH1A 4E8AA 5ETAA 5BMMA 3ZLYA 2XP2A 1YOJA 2JEDA 2WTWA 4WNMA 4YZCA 3ZOSA 4E6QA 4GVAA 1GOLA 3SAYA 4L44A 5IDPA 2QO7A 3R7VA 3QRJA 1WCCA 1ZARA 2JBPA 4JBQA 2VTAA 4TT7A 3UIXA 3CY2A 2WTKC 4RRVA 3UO6A 4YNOA 4O7VA 3LAUA 4RWLA 5FP5A 4DTBA 3OT3A 3KXNA 4ITIA 4RIYA 3TJDA 2C69A 3OC1A 5AR8A 3FHRA 4AP7A 4FSQA 1SMHA 4TYGA 5A46A 2IW9A 5I5ZA 2FB8A 4QYGA 4RZVA 2HXQA 5L4QA 2W1HA 4XYFA 2YIYA 2ZDTA 3TNPC 4BBFA 1PXKA 4I6FA 4WA9A 4BGHA 2YIRA 4FI1A 1QPEA 4FG7A 3VUMA 4X3FC 4CEGA 3FQHA 4JBPA 2P55A 2B1PA 4PNIA 4LRKA 3RZFA 4Q9ZA 3BEAA 4BF2A 3UO5A 4FOCA 3E7OA 3HVCA 5HQ0A 5IQEA 5E8VA 1RW8A 3MIYA 1DI9A 4TYIA 3UGCA 3K5UA 4IHPA 3FV8A 4X3FA 3GBZA 1Q24A 5C8MA 5HESA 4A9YA 4PMSA 3CGOA 2C5NA 3VRZA 3MDYA 4ENXA 4FL2A 4ZTMA 5C4KA 3EN7A 4QYEA 4RJ4A 5AR2A 2BAKA 3DA6A 1YXTA 2IWIA 5HNGA 3HRCA 3P08A 2QG5A 3MPTA 3UVPA 3COMA 3GCVA 4Y95A 4Z55A 1M52A 1GZ8A 2C5YA 3VWAA 5EYDA 3C4EA 3C4ZA 3VBYA 2C6MA 3RPVA 1SNUA 4BZOA 1ZYLA 3NW7A 3VN9A 4OTFA 3DV3A 5KMIA 2B9FA 3C5UA 4JR7A 4BWKA 3NDMA 2O65A 2VTRA 3A7FA 3PPZA 2VTHA 4GJ2A 4JX3A 3AQVA 3IGOA 4QP3A 2QONA 5E91A 1BL7A 4F7NA 1L8TA 4DF3A 3F7ZA 5M4IA 1IRKA 4IAZA 4PDSA 5K0KA 3QTSA 4J53A 3TUCA 3OF0A 5A9UA 4CFWA 2JFMA 4U41A 3EWHA 5D1JA 2BRGA 3JY0A 3KXXA 4O0UA 3UIBA 4ALVA 5CAUA 5FM2A 2GHMA 2X0GA 4G31A 2CKPA 2Z8CA 4EJNA 4N4SA 2YM6A 5JGBA 2OIQA 4FZAB 1Q8WA 2C6IA 3BWFA 3D14A 4DC2A 4C0TA 4ZP5A 5KE0A 1JQHA 2H34A 4ASEA 4TYEA 4ZAUA 4I23A 4HNIA 2IZUA 3OY3A 3OROA 3IONA 4I21A 4XS2A 3BLQA 3RNIA 3Q3BA 1KOBA 3K2LA 3VS3A 4DCAA 4ZLYA 3D94A 3W1FA 2V22A 3GU5A 3HV5A 5DH3A 5ANOA 3QTIA 2QHMA 4F0GA 4XG3A 4QMXA 4YJRA 1S9IA 4ZSEA 4AW1A 2XNEA 4H3BA 5D7VA 2RG6A 3CKWA 1J1BA 4FL3A 4GT3A 5CU4A 5DOSA 3WZJA 4E20A 3WF8A 5A4EA 2C0OA 3VBWA 5A6OA 2WQNA 4O38A 3R7EA 1YWNA 2J6MA 2YHVA 2XB7A 4O7YA 4CRSA 1Q41A 3LFEA 3EH9A 5AR5A 3MSSA 3UNKA 4YHTA 4AX8A 4DLIA 4F1TA 5KMJA 4HGTA 4AXAA 3A7HA 3LMHA 4AA0A 1H08A 3PIYA 2YZLA 3L8PA 3NYOA 3O96A 3KMUA 4FYOA 4UMTA 3S3IA 2BVAA 1Y8GA 4Y73A 3LCOA 4KA3A 3CD3A 2OBJA 3DKFA 4YHFA 5GHVA 3TDVA 5LXMA 2IZTA 4JNWA 1WBTA 3KB7A 3QXOA 4TXCA 1KE7A 4EH5A 3P79A 3EQIA 3I81A 3RZBA 4FIFA 3BYSA 5AUTA 2PU8A 3R28A 4Z16A 4YGAA 1X8BA 2XK3A 4P2KA 2ZV7A 4ZSGA 2QOKA 5EOLA 5HO6A 3UZRA 5BVOA 1IA8A 5IEYA 4Y8DA 4E3CA 1CSNA 3B2TA 4PRJA 2NP8A 4XOYA 3TNWA 3QTZA 2XIXA 3RHXA 4FE2A 4EH3A 4I0TA 1P5EA 1WBNA 2YAAA 3BHHA 4O96A 1YDSE 2BDWA 2X9EA 3LCTA 4FG9A 5L3AA 4JVGA 5FUTA 4YP8A 4E7WA 5BVDA 1QPDA 4NYEA 3VUGA 2YJSA 1H28A 2P0CA 1SM2A 5FDXA 3PVWA 4RG0A 1JKLA 3A8WA 4ASDA 4PWNA 4BYIA 2NRUA 2BHEA 3FLSA 3BIZA 4FC0A 2C68A 5IQAA 2EXEA 3S1HA 3G51A 5B2KA 1IAHA 3VF8A 4G6NA 4AZFA 5JMSA 3OXTA 2RFDA 4LOOA 5LVOA 1WBVA 2VD5A 1M2QA 2G15A 5DWRA 4I41A 1YWVA 3UO4A 4J99A 4ANBA 2VX1A 3TV6A 2HWOA 1UKHA 3AC2A 3C1XA 4D1SA 4GUEA 3ZUTA 3A7JA 3BELA 1H24A 3OS3A 5F95A 4G16A 5CF5A 3SLSA 4QYHA 3ID6C 4L8MA 4PP7A 1Q3DA 3F2RA 1XQZA 4QMQA 5I9ZA 2J50A 2CN5A 2SRCA 3QGWA 1PXIA 1NVSA 3Q9YA 5CT7A 4QTDA 4L3PA 1A06A 5EHLA 3HA6A 4R5YA 5J5SA 3LCKA 2I0EA 3F5PA 2A2AA 3MS9A 3ZMMA 4FSNA 5IG1A 3ZC5A 3RPRA 4D4VA 3UPZA 3DY7A 4D9TA 3AT3A 5HEZA 3O8UA 3ITZA 5E9EA 4TW9A 5C27A 3P7CA 4FKUA 4M68A 4RIOA 1W98A 3DTWA 1UA2A 5CNNA 5ANJA 4EEVA 3ZO3A 4FZ6A 1RJBA 2ZYBA 2W1DA 5HBEA 3TG1A 5ANIA 1PYXA 4ACDA 4BDJA 3A7GA 4FV3A 4BTKA 1K9AA 2QOLA 3ZLSA 4BIEA 2PZIA 4AOJA 3PWDA 3WE4A 4L43A 3M1SA 3OT8A 4EH2A 2WMQA 4XLVA 2WMAA 5CANA 5JK3A 4KSPA 4M97A 4AN2A 5BMSA 4OTDA 5A4TA 4Y83A 4O91A 4IAKA 2HY0A 5CVGA 2CGVA 2GHLA 3QKKA 5I3RA 3ATSA 2G2IA 2Y6OA 4V0GA 4DH8A 4Y46A 5IA3A 4C62A 2CNUA 2XKFA 4TYJA 3TKUA 3TXOA 5GIPE 2P3GX 3H0YA 4G5JA 4A4XA 1Q62A 4GIIA 5M4FA 3FQEA 2A19B 3F61A 1O6YA 5AEPA 4J71A 4HYSA 2IG7A 4O82A 4R77A 4O6LA 3U9NA 4E4NA 4UZDA 5J95A 2I40A 4WKQA 4CFMA 2VWXA 3ORKA 4DH3A 1YI3A 1M2PA 3UYSA 3W55A 2NNWB 2BAQA 4MBIA 4GJ3A 4IVDA 2C5VA 5L2QA 4F7SA 3HV6A 3ZDIA 3QA8A 4F1OA 4ACGA 4UMUA 4JQ8A 2VTLA 3OTVA 4WBOA 1FGKA 4U81A 5J9ZA 2O5KA 2W5AA 3BYMA 4I6QA 3UZPA 2R3GA 3QTQA 3Q04A 4C3PA 4PMPA 4ASZA 5AAGA 5DI1A 1Q4LA 3IW7A 2GNIA 3A7IA 3LFCA 1REKA 2LGCA 3JS2A 1R0EA 3LVPA 4RA5A 4RBLA 4AOTA 4BGQA 5EQYA 3L1SA 4USDA 4MHAA 4FBXA 3UOHA 1M7NA 3NCGA 4L53A 4D4RA 2ZV2A 3JY9A 4O0WA 3KULB 2VWWA 5AP7A 2OO8X 1OUYA 2W05A 2WGJA 3SD0A 4ANLA 2WQEA 4D2RA 1FVTA 2F2CB 2YJRA 3F7WA 5I9XA 2QI8A 5DNRA 4ANNA 4FSTA 2Y6MA 1TQPA 3QA0A 2QOBA 3DFAA 4MNEB 4CLJA 1QL6A 4K9YA 1Q8YA 2UZBA 4TY1A 2VX3A 4YLKA 5F1ZA 3LFBA 3BYOA 4O7SA 3T9IA 3PFQA 4WO5A 5KKRC 3HMOA 2OKRA 3PPJA 1P4OA 3F3WA 3S00A 3JUHA 5HCYA 5KBRA 3W2CA 3IW8A 3KCFA 3QQUA 4RPVA 4L9IA 2AC5A 4E5AX 3SXFA 3B8RA 4U44A 5TO8A 2ONLC 1URWA 3BE2A 4NUSA 3PTGA 4FSMA 1WBOA 5HIBA 2XJ2A 4U3YA 2R9SA 1J3HA 4EOMA 5HE1A 4ALUA 5AWMA 4EC9A 5IH6A 4ZEGA 3QHWA 4LI5A 2ONLA 1H25A 4LOQA 5CS6A 2OH0E 4Z7GA 4GW8A 5AV0A 3PSDA 3WIKA 2XK6A 5LMAA 3M42A 2JKKA 4F99A 3DKOA 4XG2A 5L6WL 4JBVA 3TIYA 5EDQA 2R3QA 3SV0A 4GVJA 5HVKA 2R7BA 1Z57A 3NX8A 5LCKA 3SA0A 4GMYA 1U54A 2F49A 3L8XA 4TRLA 4CMTA 3UOKA 4JBOA 4CFNA 5CNOA 3LQ3A 3ZRMA 4L00A 4DFBA 3HV4A 3PLSA 3JVRA 4RZWA 1KUTA 4KIKB 5J9LA 1VEBA 3KREA 2YCQA 4FR4A 4QTCA 4HYUA 3D5WA 2A27A 3O51A 1V0OA 4TL0A 4XOZA 4LQMA 4G34A 2I0HA 3REPA 5AP5A 1H1WA 4QT1A 1UNGA 2FUMA 5BPYA 5KCVA 4EORA 4MH7A 4QP9A 4F63A 5L6PA 4YZDA 5EKNA 3FMJA 2PYWA 2XMYA 1A9UA 2OJ9A 3T3VA 4YSMA 4CYJA 4ORKA 2C6KA 1BYGA 1KE8A 2X6EA 3AD5A 4QMUA 5LVLA 5JFXA 5CENA 1JKKA 2C6DA 2W06A 4JRVA 4ZTLA 4FIGA 4YJUA 4ZLOA 3QCSA 2OZAB 5AM6A 3NR9A 4YTCA 5HTBA 5IQCA 1BI8A 4I6HA 4OTGA 2HZIA 4YJNA 3RGFA 2R3OA 4ZZOA 3OOMA 4CFVA 1OIYA 4JAIA 1M2RA 3ZLXA 1BMKA 1FBNA 3Q52A 3DU8A 3QTXA 1ZLTA 3EQDA 2WNTA 2QOOA 3MWUA 1OMWA 4CZTA 1JKSA 2QO9A 4RT7A 4EZ5A 4IVCA 2B0QA 3GC7A 4ZJIA 4ERWA 4JS8A 3R02A 3DAKA 4D5HA 4BCQA 4WIHA 4EOKA 4B6LA 2YZAA 3F3ZA 4M0YA 1G8AA 3ACJA 4MNEA 3U6IA 3V6RA 3Q4UA 3BLRA 4M69B 5C4LA 3E3PA 3HUCA 4PTGA 1M7QA 5LARA 3CCNA 3GGFA 4X2KA 4UBAA 3N9XA 4P7EA 4DINA 2O3PA 3FKNA 2OXXA 4I0RA 4S32A 1H26A 4YO6A 3UP2A 2YA9A 5IMEA 3V5TA 4FEWA 4G3CA 5J8IA 4C4JA 4USFA 3MY1A 2CHLA 3T9TA 2CMWA 3BU5A 4QQCA 3IDPA 5JFVA 4RVMA 5K3YA 4R1YA 4ANQA 3KXMA 3UPXA 4PX6A 4QQTA 5HOAA 4FYNA 4XRLA 3WF9A 2XIKA 1F0QA 3DAEA 3MFRA 1HCLA 3ZXTA 2J5EA 2WMTA 4BB4A 3EFKA 4L52A 3ULZA 3LM0A 4DN5A 4ITHA 3R2YA 1PF8A 3R30A 3GB2A 4MXXA 4LMUA 3FEGA 3OMVA 1GIHA 4X2FA 4R7BA 4G6LA 3GENA 3RI1A 3MW1A 2WPAA 4FGRA 3ORIA 4DFXE 1NA7A 4QMSA 5HLWA 5HE2A 3PJ8A 2VGOA 4YJTA 5IPJA 2UZWE 3HUBA 2NRYA 3CQUA 3PP0A 2YACA 4OUCA 1UU7A 3POZA 1PKDA 1A48A 4DEIA 2C0TA 3TZ7A 3KRXA 4QNYA 1NY3A 4GG7A 5JEBA 4U45A 4YPDA 5JQ5A 3Q2JA 2HWPA 1YKRA 2V0DA 2R3NA 2R3KA 2X7OA 2ERKA 2B9IA 1XKKA 1OKVA 5A4QA 2QR8A 4QQJA 3RK5A 5HLPA 1UU8A 2EWAA 3PY1A 3QWKA 1DI8A 4KIKA 2W9ZB 3QZHA 3RTPA 4GFGA 4XH6A 4Y72A 5IQDA 2VWZA 2UZEA 2PUUA 5CEIA 2VZ6A 3DJ7A 3PWYA 3ZFYA 3PSCA 3ZUUA 4FTLA 3O7LD 4RFZA 3FL4A 5DVRA 4QRCA 3NGAA 5DE2A 4AN3A 4FK6A 3BRBA 4BWPA 5F9EA 3GFWA 4U7ZA 5GNKA 2VWUA 4K77A 4G2FA 1F5QA 2BZHB 2J51A 2WIPA 4C7TA 4H39A 4Y85A 3EQCA 2ITOA 4ZTHA 1B6CB 1R3CA 2X2LA 1BLXA 4KRDA 3PJ3A 4RA4A 4BTMA 5I4NA 2UUEA 5HNBA 3UQGA 1ND4A 4FTUA 4G9CA 2I0YA 4C4EA 4D2PA 4MXAA 1WBWA 2NO3A 2OZAA 2Y9QA 3R21A 5AJQA 5FBOA 3F2AA 4HOKA 1R39A 3ZRKA 4QMVA 5A54A 4GU9A 3RAWA 4C35A 5B7VA 5CQWA 3BYVA 5FEDA 4L7SA 5DIAA 3IO7A 4CKRA 4FL1A 3LXPA 4G17A 3PUPA 4FTTA 4XG9A 2J0IA 2X6DA 4ZIMA 5HD7A 3ZEWA 5IDNA 3OW3A 4BCNA 3UC3A 2BDJA 3EL8A 3NRMA 3L9LA 2PUPA 1YXVA 2QNJA 4RWIA 3R71A 3I4BA 5AUVA 4DEGA 4F6WA 1J91A 3VBXA 5AP1A 4CTBA 5BUJA 2GS7A 4J95A 3N4UA 4ZTNA 4WNPA 4R7HA 2FSLX 4EQCA 3A62A 3FMMA 3UBDA 5A3XA 2ITWA 3FC2A 3DLZA 4JX7A 5IZFA 3KRJA 3RJCA 3Q6UA 4DH5A 4QMNA 5DPVA 3OWKA 3KMWA 5AP2A 3SX9A 4GK4A 4DE4A 3GU8A 4TWCA 4CZUA 4IH8A 3H4JA 4RIYB 5H3QA 4FUXA 5LMKC 2OH4A 3OEFX 5HTCA 5JZJA 4G3FA 4ZK5A 4DBXA 2WTKB 3BQRA 3COKA 1H0VA 2Y4IB 2BRBA 2OI4X 2WTJA 2W4KA 3QZFA 5LMKA 4KS7A 1P4FA 3NNWA 4JG7A 4YC6A 4ALWA 3FHIA 4FGBA 3MTLA 4QMMA 1T45A 1APME 3MI9A 1CKJA 1U5QA 1ZMWA 2BFXA 1S9JA 3R8PA 4CMUA 4ZLZA 4G9RA 2HOGA 4G3GA 3ZBFA 4PPBA 5FQDC 5TT7A 1M14A 3FWQA 3BBWA 3NUPA 4IBMA 1JWHA 4PNKA 2R3IA 3BZ3A 3EYHA 3PE2A 4X3FB 4IM0A 3TEIA 1QPJA 2ITNA 4AU8A 1CKIA 4MD9E 1DS5A 3V51A 3PA5A 4E6CA 3PXKA 4IAFA 4DCEA 5KMLA 4E4MA 2RF9A 2UZOA 2Y4PA 2AC3A 3TACA 3OVVA 4J1RA 4O84A 2XYUA 5J7BA 4FT9A 3RINA 4Q5EA 3MA3A 4FZFB 5AX9A 4GKIA 3DLSA 1IR3A 2UZVA 2WU6A 5I0BA 5DN3A 5ICPA 3EHAA 2JDSA 3BCEA 3IK3A 4NH1A 4W4WA 3ZRLA 4O0XA 4KBKA 1FMKA 2ZM4A 3L8SA 4XNEA 3LPBA 3DKCA 4R3RA 2P4IA 3EQFA 3QLFA 4LV5A 1LP4A 4GT4A 4LGHA 4FKPA 5DLSA 4UWYA 3R8ZA 3DNDA 3P5KA 3R1NA 3HV7A 3QQJA 1H0WA 2G9XA 5H8GA 5H2UA 2EU9A 3QHRA 3RAKA 1ATPE 5CTPA 4J8MA 3ACKA 1H1SA 1PY5A 4FTAA 3VS6A 2VO6A 3QBNA 4W4XA 4CMOA 3P7BA 2OW3A 3I5ZA 2DWBA 4G5PA 2H6DA 3P86A 2X8EA 4IW0A 2R0UA 3O2MA 4LRJA 1VYZA 1YXSA 2A0CX 4MCVA 4S33A 5HBHA 4C37A 3TZ9A 1UKIA 3SOCA 4EL9A 4X6RA 4FNZA 4DG3E 4M84A 2XBAA 4IC8A 3FZTA 2BTRA 1GIIA 2WZJA 4R1VA 3RAHA 5GZ8A 2YLFA 4QPSA 2JGZA 4Q5HA 3G9LX 3F5XA 4ZS0A 2WB8A 2VO0A 2BMCA 1P14A 3LIJA 5CXHA 4B99A 5HIEA 3ODZX 4FODA 5JRQA 2QVSE 3E87A 3FJQE 4H1MA 3WZUA 4YC3A 1VJYA 3MVJA 2PZ5A 5JQ8A 3HAMA 5CZIA 2VGPA 4FV7A 3THBA 3VRYA 5D10A 2XA4A 2YLEA 3QTRA 4EYJA 4HW7A 5E8UA 4E6DA 4DLJA 4RC2A 2Y4IC 2R3FA 2XRWA 4BDEA 1Q5KA 3FI3A 4KBCA 4DAWA 2ZMDA 3IG7A 4KS8A 4O22A 5D12A 4MXOA 4RC3A 4BZDA 4E73A 4A9TA 1OL2A 4FF8A 3FKOA 3MYGA 4BDIA 2VTTA 2UVZA 1ZYCA 2JITA 4IWQA 1JSVA 4M0ZA 2XUUA 3DBCA 3HNGA 3ORPA 5HLNA 4O0VA 2O0UA 3E3BX 3F3VA 4FZDB 3COIA 4UXQA 4CRLA 4EOSA 5KNJA 3DB6A 3FI4A 4IAIA 4IANA 5E92A 4FSZA 2J7TA 4UYNA 4IB0A 5AR7A 3VUKA 5L8LA 3AXWA 3G33A 4TTHB 5EW8A 3V5LA 1HOWA 4MQ2A 4FV1A 4ENYA 4KNBA 3F88A 1ZOHA 2ETMA 2JIIA 5CI7A 2RFEA 4V01A 2ZM3A 1TQMA 4RVLA 2IZSA 3LCDA 3L9MA 3G6GA 3Q9XA 4NK9A 2FH9A 5CT0A 3RPOA 3SOAA 4BTFA 2WO6A 4EWQA 5AR4A 3AC1A 3BQCA 4C38A 3WF5A 1UWHA 4DYMA 4GT5A 4YU2A 4DT9A 4ZY6A 5AV1A 4BHNA 2JAVA 4AWIA 4EZ7A 4F9WA 1ERKA 1ZRZA 4HGEA 3ORTA 4LM5A 4F0IA 3TUDA 5ANEA 1DM2A 5BYYA 3TIZA 4D1ZA 2QOIA 2XK7A 4MX9A 4FKIA 2V55A 4RFYA 2FSTX 4BRXA 2WQOA 3GP0A 4CFUA 4EKKA 4PL4A 5AA9A 2IVSA 2QODA 5E1SA 2BKKA 1XBBA 5IH5A 2Q0BA 4V05A 4M7IA 4GU6A 3FXZA 2QG7A 5M09A 1H07A 4TNBA 3UNZA 3W33A 4W9WA 4LG4A 4O0TA 4QYYA 4NL0A 2VRXA 4YTFA 4IACA 2UW8A 3FMNA 4I3ZA 4MVFA 4AFJA 4QD6A 1V0BA 3VULA 3ULIA 2YDIA 3UIMA 4FTNA 2EXMA 3R9OA 3TV7A 4CXAA 3NNVA 3Q2MA 2HIWA 3ODYX 1OGUA 4M67A 5EYKA 4C2WA 3A4OX 3P1AA 4FTKA 3L8VA 3EQRA 2PE0A 3POOA 4W4YA 4L3JA 4MYGA 2HZNA 1LEWA 3DDQA 2KULA 2UW3A 5EYCA 4X2JA 5K0XA 4G3DA 2O2UA 3CTHA 3LOKA 3PE1A 3DAJA 4MAOA 4CCBA 2Z7RA 1RQQA 4OT5A 3GNIB 4HNFA 4I0SA 5DT4A 3ZO2A 1GY3A 1YRPA 2OFVA 3ROYA 4EQMA 4CV8A 5JGAA 1NW1A 2UW9A 3QCYA 4N6ZA 2WEIA 3TNQB 2XKCA 1DAWA 1URCA 3EIDA 4BI0A 4D4SA 3W16A 3OXZA 3V5WA 3CQEA 3QTWA 4KWPA 3KEXA 4HVIA 4UMRA 4BFMA 2HCKA 4XV3A 3G9NA 2OGVA 1FOTA 3QTUA 4NM7A 4KBAA 4R6VA 3FY2A 4G6OA 3PG3A 3KFAA 5BUIA 5C9CA 4JG8A 3RKBA 3MY0A 3F66A 4RWKA 3HX4A 5HORA 2ITVA 4RWJA 4O86A 3R7IA 4BHZA 4CFXA 3I0OA 3V3VA 4C58A 3MGYA 2ZVAA 3FQSA 5HG9A 1CDKA 5CSPA 3UG1A 3VS1A 3NSZA 4JL9A 4EK8A 3N4VA 4A9RA 2RG5A 3DJ6A 4K2RA 5J7HA 4HCVA 4FTRA 4CT1A 2V7OA 3LM5A 3RMFA 5C26A 4M13A 2G2FA 3OBGA 5TKDA 4ZY4A 4V0GB 5HO7A 3PDTA 3AOXA 4FMQA 2YCFA 1ZY4A 4RX9A 1J7UA 4L01A 4D28A 2XNOA 1XH7A 2GPHA 5C8NA 4MD8E 5E4HA 4L6QA 3V01A 2UW7A 4QTEA 4U79A 5E8XA 3FYJX 1BI7A 4LV8A 4KIQA 3LXKA 5HZNA 3GCSA 4EH4A 1NXKA 4U9AA 2BPMA 1GJOA 2PVRA 4RJ8A 4FKJA 1NT2A 4PDPA 3VBQA 5EM6A 4FTCA 5KMOA 2IJMA 1Y91A 2IPXA 2C4GA 5D7AA 3NUXA 2EB3A 3CR0A 2JDRA 4DGGA 3QQHA 3TI1A 1YHSA 4I4FA 4AGDA 5AAFA 1PXMA 3R04A 1PKGA 2ESMA 3FMHA 4P5QA 4FT5A 3QL8A 1TQIA 3JVSA 3KN6A 5FLFA 5AUZA 4O7TA 4CTCA 2VWBA 2WELA 2QLUA 4IVBA 4BYJA 3QKLA 5HKMA 3PXYA 2FGIA 3CP9A 3FMKA 4IEBA 5HGIA 2YDKA 4GFMA 4AACA 1WVXA 2UZTA 3RALA 3ZEPA 4EOPA 4C57A 3C50A 5CU3A 3BGZA 3HMPA 1OL6A 3HLLA 5FRIA 4YZ9A 3RNYA 4EH6A 4F65A 1ZOEA 4YC8A 4YLLA 4CNHA 5DRBA 1PXNA 4MEDA 4CFFA 3PZEA 2Y0AA 1PMEA 3HZTA 3ET7A 2VTJA 2FYSA 3HEGA 4RFMA 4BDAA 4D0XA 4EBVA 5K5XA 3LKMA 3AC4A 3D2IA 3PRFA 1ZYDA 4OLIA 4WRGA 4A7CA 4CQEA 3IS5A 2PE2A 3ZHPC 3EZVA 2B52A 2WIHA 2CGUA 5ETFA 2PE1A 4X2GA 4XBRA 2YM7A 4IZAA 4NEUA 4ZTQA 5HX8A 2PULA 4LMNA 3E8NA 4WBBB 4F1MA 4MWHA 2IVUA 4OAUC 2UV2A 4IX6A 3VF9A 4LL0A 1L3RE 3FPMA 4AUAA 5KKRB 4C3FA 5D41A 2B4SB 5DR2A 3UE4A 4JIKA 1BUHA 3R9DA 4NFNA 2OWBA 3H3CA 3FC1X 3VS5A 2J9MA 4O21A 4RJ5A 4BICA 4E5WA 1F3MC 5EDRA 3BU6A 3MBLA 3TN8A 2I7QA 4FUYA 5C03A 2BIYA 2EVAA 3OWPA 4OT6A 5DYJA 4EK6A 5E8WA 3D15A 2JDOA 3KF7A 3HYHA 1OM1A 4LFIA 4CKIA 5AP0A 3U55A 3C51A 1U5RA 3ZXZA 2GFSA 5F4NA 3WF7A 2W1IA 3TV4A 4LUEA 1G8SA 5CQUA 5LWMA 2ITUA 1IEPA 2CJMA 3KN5A 3LJ2A 3FI8A 1U54B 1ZXEA 4JDIA 3U6JA 2PVYA 3ANRA 4FOBA 2OU7A 3FPQA 4RJ3A 2ITTA 4EJ7A 5AV4A 3CC6A 2JFLA 3PA3A 4DFZE 4C34A 3IDBA 2YM5A 3OCTA 3JPVA 3QD2B 3OG7A 4Q9SA 2OJGA 3C4WA 4BCIA 3PY0A 2V62A 4F9CA 4DGMA 1WMKA 3AGMA 2CLQA 3R63A 4IADA 4PTEA 3SG8A 3MH2A 5L8KA 3W32A 3KQ7A 3R22A 5KO1A 4FV8A 2WHBA 4M15A 1OPKA 2GDOA 2BALA 4XJ0A 3UZTA 3G0FA 4IAYA 5CWZA 5IA4A 3MA6A 4XP2A 5DGZA 3LLAA 2GHGA 3EMGA 5C01A 2CPKE 3NW5A 2JIVA 3AC8A 3DJ5A 1UWJA 5CAVA 1Q97A 2R7IA 3NLBA 1V0PA 3TKHA 2VAGA 4EH7A 5CAOA 1YVJA 4I6BA 4TPTA 5B2LA 4QMPA 4BCKA 4FKOA 1V1KA 1KWPA 2VO7A 4KABA 5KBQA 4KRCA 4M14A 5AAEA 5LQFA 3WZEA 4AT3A 4B9DA 2PPQA 4LYNA 5DG5A 2XRUA 3K54A 3PYYA 1YHWA 3P78A 2HYYA 1PW2A 1LUFA 4N6YA 5IA2A 5CZHA 5CAQA 3CQWA 3QU0A 4FTIA 1PRYA 2JAMA 3ZFMA 3PY3A 5HICA 3DFCB 4U42A 3KY2A 4TYHB 3FMDA 3QZIA 2E2BA 4O7RA 3BU3A 4AZVA 2VO3A 4YZMA 2QO2A 4NJ3A 3SDJA 1PHKA 2Z7SA 3DBQA 4PQNA 3LQ8A 3PA4A 3CPCA 4RX5A 2C47A 2W0JA 4AZWA 5DT0A 4C02A 2CCHA 1CM8A 3RCJA 2XK4A 4FEQA 5CU6A 3GEQA 4EK3A 3CY3A 2WU7A 3CE3A 2E9UA 4F09A 3EQBA 4U0IA 3BX5A 3MFSA 2W4OA 5IEVA 3UC4A 5HE0A 3CEKA 5BUEA 5HX6A 3AT4A 5M57A 4IXPA 1FMOE 4OTIA 3UP7A 2GTNA 5ETIA 3NYNA 3BPRA 4QP2A 5F94A 4O1OA 4DH7A 3SW4A 4L42A 4OW8A 3UQFA 4OTQA 3HMNA 3IKAA 2VWVA 3FSFA 3DBDA 4IB3A 3FMLA 3FUPA 4AGUA 3GQLA 3FYKX 3Q5ZA 5L2TA 3NIZA 4M66A 4U80A 4K11A 1KOAA 1G3NA 3GQIA 2OJJA 1FVRA 3VBVA 3FL5A 2WMXA 5HE3A 3NW6A 1XH6A 3A2CA 4FKRA 2HAKA 3RK9A 2Q83A 3EYGA 3ZYAA 3EQHA 4I20A 4QPMA 5CEOA 4YZNA 4RIWA 4XMOA 4PL3A 2XEZA 4R3CA 2EB2A 5EHOA 2IVVA 2QOQA 4GSBA 4UALA 2W5BA 3KXGA 2EXCX 2IZRA 4GG5A 4YJSA 4XCUA 2BRNA 3F2NA 4FKLA 3BGPA 5E8SA 3WF6A 1ZYJA 2R3RA 5IH4A 2UW0A 5JSMA 5J1WA 1Y6BA
chains in the Genus database with same CATH superfamily
5EH0A 2V7AA 3ENMA 4EH8A 4EOJA 4ANMA 2BAJA 4IX5A 4BDGA 3VQUA 3W8LA 4IB1A 3E62A 3EFWA 3IOKA 3TNIA 4GKHA 2J5FA 3P9JA 5AA8A 4XV9A 3NUAA 3MVLA 2JC6A 4W4VA 4AA4A 4FIEA 4E4XA 4FEUA 4N57A 5BQ0A 4O0YA 3ZLWA 3ZH8A 3JYAA 3CBLA 3PVGA 3SGCA 1KSWA 2ZAZA 4O7LA 1U59A 3ZTXA 4RLLA 5DEYA 4WRSA 4J96A 3VUDA 4F08A 2VTPA 4FTOA 3EFJA 4DHFA 2F57A 4R3PA 4UWCA 2YABA 4L3LA 2FSMX 3ZSHA 3PSBA 1STCE 1W82A 3R8UA 1QCFA 1ZY5A 4I6LA 3B2WA 4H1JA 4MXYA 1AD5A 3GU6A 4NFMA 4NWMA 4O27B 2WTDA 5M53A 4QP1A 2E9VA 4RIXB 3W2OA 4YTHA 1CKPA 4W8EA 1YOLA 2PVHA 1G8JA 2LAVA 4FV5A 3VC4A 4Y5HA 3DBFA 2WTCA 4FV4A 3MPAA 4EKLA 4AW2A 4ZSAA 4MKCA 2HENA 4RVKA 3TDWA 2Z2WA 3P4KA 4FSYA 3ATTA 1R1WA 4DGNA 2CLXA 2W17A 4N0SA 3EN5A 4CYIA 1XHAA 3EFLA 4FIHA 1B38A 1ZOGA 5GJGA 2KTYA 4YHJA 3FZ1A 2VU3A 4FKVA 4EHVA 4X0MA 3E8EA 3UDSA 2VV9A 5B0XA 3F3TA 4AZEA 1UV5A 3Q9ZA 3QC9A 1YI4A 4TYHA 4DG2E 4CT2A 4K1BA 3R0TA 3E7VA 4JT3A 5F20A 4LL5A 1PMUA 3B8QA 4YJOA 5ACKA 4O6EA 3MTFA 4K33A 3EN9A 3MJ1A 5FXRA 2C30A 4RX7A 1PXJA 2P33A 4TZRA 3CTQA 3NNUA 4CLIA 5EKOA 5M4UA 5BYLA 3H9FA 2B7AA 2C6EA 4HVHA 3ZZWA 3NPCA 3ROCA 5CXZA 3PXQA 4FSWA 3A99A 2C5OA 2ZJWA 3ZUVA 2UZLA 1GZNA 2DS1A 2AYPA 2QR7A 1CTPE 2UZNA 3PZHA 4FG8A 4TWOA 1MRUA 5FGKA 4XBUA 3W2PA 5AUUA 4W8DA 5HNIX 4BCOA 4QEBA 1MQ4A 2YCSA 2UW5A 4MBJA 4AOIA 4XV1A 5IA0A 4ARKA 4BCHA 5HHWA 4U40A 5A4CA 4QYFA 4W9XA 3WILA 5JKGA 3FI2A 2R3PA 2ITYA 3WZKA 1MUOA 4QPAA 4OBPA 2BUJA 2WFYA 5DMZA 1O9UA 2J90A 2FVDA 1GZOA 1KE9A 3GCQA 3PIZA 2OFUA 3IOPA 4MXZA 4MQ1A 4P5ZA 4O2ZA 3VIDA 2BILB 3R9NA 5KMNA 4DG0E 3QAME 2X2MA 1NVRA 3OFMA 2JDTA 3UG2A 3NCZA 2BR1A 2J0JA 4YBJA 1WBSA 3MFTA 2PVJA 3O0GA 4NM5A 1GAGA 3DBEA 5LMBA 5EQPA 4EUTA 5FDPA 1ST0A 4EOLA 3RCDA 5IUGA 4QP6A 1XWSA 4K18A 5CF8A 4KAOA 3V8SA 2CGXA 2R3HA 3OEZA 1H27A 4AA5A 3S4QA 5CASA 4BN1A 2PHKA 2RFNA 2WEVA 4XV2A 5FTGA 2W96B 2E9NA 3UNJA 3R1QA 4HVSA 4RIXA 3LFNA 3LFAA 4I92A 5AX3A 3ZZEA 4BKZA 3K3IA 5G6VA 4NW5A 4L45A 1Q8TA 3UVQA 2WXVA 5HVYA 3BWJA 4EH9A 1H4LA 2HZ4A 3MFUA 3W10A 2O63A 4FIJA 2ITXA 5FG8A 1O6KA 5AUWA 4AZTA 5CSWA 3UODA 5BNJA 5M56A 2R4BA 5IQGA 2ETRA 3D7ZA 4C8BA 2CNVA 2X1NA 4O2PA 3VAPA 4BCMA 3C4CA 2YITA 3HV3A 4F9BA 2IVTA 2XZSA 3SVVA 4BJJB 4BL1A 2W7XA 2XIZA 2R0IA 3COHA 3DGKA 2X7FA 3UQCA 3KVXA 2JIUA 2OJIA 2F2UA 2VTMA 4JAJA 4E4LA 4OBOA 1U4DA 2WQMA 2WTIA 1OBGA 3BHUA 5FWKK 4O83A 1VYWA 1KE6A 4IM3A 5JH6A 2ZDUA 3GFEA 4GIHA 4D2TA 1J7IA 3BYUA 3CJFA 4XG4A 2C3KA 2XIYA 3LMGA 4JLCA 3UTOA 2IO6A 3NS9A 3FY0A 4IX3A 2QQ7A 2J0MB 1SNXA 3RPYA 3SHEA 4PL5A 3OCGA 3MVMA 5FBNC 3MH1A 4BDKA 3QF9A 3IPHA 3QRKA 5E90A 5JFWA 2CKOA 1OPLA 2ZB0A 5JRSA 2VNYA 3R1SA 5BX0A 3MH3A 1XBAA 3RM6A 3H9RA 3WOWA 2YISA 3U8WA 4DITA 4O7NA 4J52A 2R64A 3RPSA 2XK8A 3QYWA 5EM5A 2WOTA 2R2PA 3NEWA 3QX2A 3QUDA 5AP4A 3O7LB 3MB7A 3D5XA 3MY5A 4S2ZA 3R8VA 1FVVA 1SVEA 1XJDA 2W99B 4B7TA 5KHXA 4OBQA 4IWPA 2BRHA 3BV3A 5CI6A 4I5PA 5CVHA 2W1GA 2W1FA 4J97A 2WKMA 4MXCA 4TN6A 4ZZNA 3I1AA 1Z5MA 4USEA 5I9YA 3HECA 3R73A 1BL6A 3VUHA 2YAKA 5M44A 1JKTA 1JSUA 4PMMA 3OZ6A 3QD4A 3NAYA 3A61A 4WOVA 3U87A 2OXYA 5DFPA 1RDQE 2UW4A 2PMOX 3DT1A 3QQGA 4WSYA 4FNXA 4AN9A 3C0IA 3CLYA 5G1XA 3RM7A 4MK0A 2A1AB 2QLQA 5CU2A 5HCXA 1OIUA 3EL7A 1ZZ2A 2B9JA 1OIQA 2WMSA 3C5IA 2UW6A 2YFXA 3RWQA 3VS0A 1OIRA 4PP9A 3O8TA 4M12A 4PF4A 4NW6A 4O1PA 4EUUA 3VONA 2F9GA 3VO3A 2G1TA 4ACMA 3OTUA 3HGKA 1PMVA 3Q4ZA 4YJVA 3SC1A 4ZZMA 2HXLA 3R00A 4FV2A 5E8TA 1SVGA 4JOAA 2Z02A 4QOXA 1SYKA 2H96A 2ITQA 1OL5A 3R9RA 4ACCA 3F69A 3QC4A 2J0LA 4IE9A 2OSCA 4HYHA 4X7QA 2WD1A 2CNQA 1K2PA 3OCSA 4FSUA 2QKRA 3LMIA 1W0XC 3HRBA 1KV2A 2FSOX 4NJDA 4NCTC 3TJCA 4A4LA 5B2MA 2R3LA 3U6HA 3CGFA 2UZDA 2RGPA 2QU6A 4QTBA 3VHKA 3E93A 5DR6A 2YN8A 1J7LA 4BJJA 3FKLA 3FAAA 5FD2A 3V04A 3MPMA 5EG3A 4APPA 4NCTA 3UDZA 5E1EA 5AFVA 2XVDA 3UMWA 4XP0A 3SQQA 4WHZA 3GI3A 2JBOA 5HBJA 2QD9A 3IW5A 2X8DA 3E5AA 2C1AA 4G3EA 4FTJA 3H10A 4HPTE 3UMXA 4C4IA 1H00A 2W1ZA 3LXNA 1SZMA 5A6NA 3QD0A 3E63A 4C2VA 3DQWA 2HY81 4YLJA 4FV9A 5GZ9A 5T6KA 3GT8A 2XAOA 4HZRA 1JLUE 5FTQA 5J79A 4FV0A 5ETCA 2BRMA 2PZYA 5D9HA 2HELA 3C13A 3GC8A 3LE6A 3ZC6A 3DXNA 4C59A 3ETAA 4N70A 4UXLA 4HVGA 4AXCA 1PXPA 4O4BB 2XNNA 2WAJA 5BVFA 2CN8A 4J98A 4YR8A 4ITJA 2FO0A 5HTIA 4C4GA 4DA5A 1E1XA 3LHJA 4BDFA 5DBXA 3DTCA 3HDNA 1W83A 4IDVA 3IW6A 4QMYA 4E93A 5JT2A 5JN2A 3FZRA 4O4EA 2OK1A 3DNEA 1YWRA 4JRNA 1P2AA 4XG6A 5J1VA 4JQ7A 2ZMCA 2ZV8A 4F9AA 3IGGA 1WZYA 1JPAA 3I79A 4BCPA 5TE0A 4AXDA 3HA8A 2IN6A 3DKGA 5I9VA 3ZM4A 4HYIA 4WD5A 4CKJA 2GNLA 5HVJA 5CSHA 5JGDA 3TT0A 2VNWA 1B39A 4BBEA 2B53A 1W7HA 4JDJA 3TUBA 4RQVA 3AC3A 4EHEA 4X21A 4X6QC 2F7ZE 2QOCA 4F7LA 2X81A 5BVWA 4IDTA 4MBLA 4BCFA 2ITPA 3AGLA 2C5XA 4DFUA 3KL8A 2VTNA 4QP8A 3HDMA 4L68A 4D1XA 5EK7A 3V5JA 4JG6A 3WZDA 4M3QA 3R6XA 3E92A 2HK5A 4FRFA 4KSQA 4EHZA 4D2SA 1OI9A 2IW6A 3QUEA 2GNGA 2YDJA 4K6ZA 5FTOA 4I5MA 4OR5A 4DEBA 4ERKA 3ZM9A 3QKMA 3SRVB 3UYTA 2QCSA 4QP4A 4DFNA 3S2PA 3L9PA 3DXQA 1YDTE 3JXWA 4JDKA 4XRJA 3H9OA 5EW3A 2UVXA 4XEYA 3RAIA 1YDRE 3WBLA 5M06A 3KMMA 1UNLA 2ACXA 3TKIA 3N51A 1OBDA 1JSTA 3S0OA 2DQ7X 1ZMUA 3D7TA 3MIAA 4I24A 2PMIA 3W0PA 4B4LA 3ZSIA 4WG5A 3ZS5A 4ZMEA 4RMZA 3WE8A 5IUHA 5K9IA 3Q9WA 2HW6A 2XK9A 3QUPA 1OB3A 3PRIA 4QO9A 2C6OA 3RHKA 1XH5A 5T68A 4C3RA 3D5VA 4FA2A 2PVLA 3V8WA 4C61A 4X2NA 3JR1A 4BIBA 5GJDA 2OZOA 5J87A 4OTPA 1JAMA 2GFCA 3Q4CA 5A4LA 5IU2A 1TZDA 5DT3A 3W0RA 4XX9A 1PYEA 3OCBA 4DHIB 1UU3A 3DPKA 2GQRA 4DT8A 2BIKB 3PP1A 4GFOA 4E26A 1R0PA 3OXIA 2C6TA 3SKCA 3FDNA 2JD5A 3CS9A 4CV9A 3DZQA 3GVUA 4S34A 3O71A 3BLAA 4AT5A 2W4JA 3VNTA 5KMKA 3QYZA 3MESA 2BZKB 3RWPA 3R2BA 2XH5A 4I4EA 2YIXA 3NNXA 4UV0A 4A9SA 4KKHA 2G2HA 3KRLA 4IFGA 4ZTRA 4A07A 4DFLA 5K4IA 4TNDA 5IF1A 4D5KA 5DHJA 1I44A 2ETKA 3K5VA 3OUKA 3WI6A 4ACHA 3HMMA 4RQKA 3ORXA 4AXFA 1GIJA 3DQXA 5CU0A 2YEXA 1G5SA 2PWLA 4B0GA 4R7IA 4H05A 3U54A 4ZTSA 4LOPA 1Q99A 2GS2A 1ZMVA 2XAMA 2ZV9A 3TZ8A 3EQGA 3UOJA 4IWOA 3QQKA 4C36A 5FEEA 2OICA 2BZJA 2H9VA 4WT6A 2XKDA 5IQHA 1SVHA 4CCUA 4E1ZA 5ANDA 2Y8OA 5LOHA 2NPQA 4RX8A 4F64A 4UYAA 5CLPA 3PG1A 3VS2A 4IZ7A 4D0WA 3LFSA 3PPKA 4BCGA 3LZBA 3G15A 2C0IA 3AC5A 3QRUA 2Z7QA 2OG8A 2PUNA 4UY9A 3I6UA 2WMWA 4WG3A 2REIA 2YIQA 4FTQA 5CX9A 1JVPP 2R5TA 4MD7E 2OIBA 4MWIA 4IB5A 2XCKA 4O0SA 2XJ0A 3KK8A 5AUYA 3KXHA 3TWJA 2Y7JA 4FT3A 4IJPA 5IUIA 5A14A 2E9OA 3KIOC 2GNHA 4H58A 2CDZA 3C4FA 3NUSA 5L6OA 4IM2A 5EHYA 4JQEA 3SRVA 3U9CA 5HU3A 3V6SA 1YXXA 4DTAA 1IG1A 4QMWA 2BHHA 4GK2A 4QMTA 4MUQA 4PV0A 4ZSLA 4DTKA 4ID7A 4UMQA 1BKXA 3QWJA 4GYIA 1FINA 5HIDA 3DXPA 4IC7A 4OTWA 5IQIA 3I7CA 4DGLC 2W5HA 2GU8A 3BEGA 3BKBA 2IW8A 4AAAA 3C9WA 5CEPA 1HCKA 1J1CA 3KCKA 3FXXA 2VWYA 4LRMA 1PJKA 2XM9A 2QKWB 4L46A 3SW7A 2Q0NA 2H8HA 3AMBA 4FVPA 3TM0A 1OITA 1TKIA 4UWBA 3OUNB 3AMAA 2X8IA 5BVNA 3PVUA 3QCXA 2CKQA 4FV6A 3D0EA 5CYIA 5KZIA 3OWLA 4IIRA 4MF1A 4OTHA 5AADA 2GNFA 1OL1A 2R3JA 3IDCA 2XCHA 5C1QB 3O8PA 3LCSA 2A98A 2WMVA 3R01A 4BVUA 2WMUA 4AW0A 4BY9E 4AG8A 2PK9A 2ZOQA 3A4PA 4IFCA 4FIIA 5E8YA 3VW6A 3A60A 4V04A 2PTKA 4QMZA 4F6SA 3NZ0A 3VUTA 1GNGA 2VTSA 5AV3A 3E88A 3IECA 4FT0A 4RIWB 3R8MA 4BI1A 5BV3A 3DK7A 4ZMFA 3WIGA 3FMEA 4FK3A 1PXOA 3ALNA 4XG7A 5T3QA 4DEDA 3EOCA 3EQPA 4H36A 3Q96A 4GCJA 3FXWA 4QMOA 4R5SA 2OLCA 1JNKA 4KUJA 5E8ZA 3KGAA 1ZYSA 2YCRA 2PZRA 5JZNA 5ANGA 3I60A 5HU9A 1Q8ZA 4FKGA 2O64A 2ERZE 5IISA 2BZIB 2OXDA 3GUBA 4XLIA 5CY3A 4FICA 3NAXA 4I5HA 3UOLA 1OPJA 3KK9A 5HG8A 3BHTA 5AIRA 3CJGA 2CCIA 3GC9A 3CTJA 4MTAA 2A4LA 1IASA 2RIOA 3HMIA 3H30A 4FEVA 4U5JA 3R7GA 4HGLA 2J2IB 4NTSA 2X7GA 4I5CA 4QP7A 1H1RA 2DUVA 5HI2A 2AUHA 5H8BA 4EBWA 2GCDA 4NM3A 4UZHA 3SXSA 5DA3A 4FZ7A 3PJ1A 5FXQA 2VTQA 4K0YA 5EFQA 4F78A 2UVYA 3R7OA 2RL5A 4KKGA 5M55A 3TZMA 2PMNX 2BCJA 2VUWA 3OOGA 3R8LA 4BDDA 4BI2A 4C4FA 3LLTA 3WYYA 4JR3A 4YBKA 4E6AA 1WVYA 3G5DA 1NVQA 3O50A 1AGWA 2QU5A 3QQLA 2C3IB 4YURA 3QZGA 4L67A 4CGAA 4EI4A 5ITAA 1VZOA 4DEAA 2GQGA 3D5UA 1W8CA 4A06A 4GK3A 5FP6A 1YI6A 3PXFA 2VX0A 1OECA 3R1YA 4UEUA 5I3OA 3VUIA 2CGWA 2P2HA 3PJCA 4IZ5A 4Z7HA 3NVMB 4R8QA 4Y5QA 4EK5A 4R78A 1XH9A 2ZFYA 4OAVB 3QGYA 1JOWB 3QXPA 3KF4A 3K3JA 4F6UA 3AD4A 1XH4A 1PMNA 3FLNC 5LVMA 2I6LA 3RK7A 3W0QA 4O4CA 4IVAA 3SXRA 5I9WA 2X4FA 4TWNA 4ZSJA 3CKXA 4BDBA 2BFYA 4FKQA 2GTMA 3GU7A 2QHNA 5EM7A 3DK6A 5AUXA 4LGGA 5JFSA 2YWVA 4AF3A 5CEMA 5EI2A 2QC6A 3PIXA 4KB8A 2ZM1A 4J7BA 1IAJA 1Q61A 2B9HA 3MVHA 4S31A 4C33A 4D58A 3ORZA 5LCJA 3OWJA 3QALE 4IX4A 4NM0A 4ANOA 5CAPA 4PDOA 3V5PA 5AV2A 1LPUA 3C7QA 4D4YA 4A9UA 4OTRA 3LJ0A 4IZYA 4NZWB 4EZ3A 4H3QA 4EWHA 4WUAA 1IA9A 2X2KA 3NFFB 4BBMA 4CSVA 3OBJA 3G6HA 3P7AA 4FKWA 3TTJA 3UIUA 4TKSA 2C3LA 4AQCA 1PXLA 3VVHA 4YMJA 3DK3A 3Q6WA 4B8MA 4P90A 3OHTA 4BIDA 2X9FA 2VTOA 3OY1A 2YM3A 3CSVA 1H1PA 3BGQA 3QD3A 5M07A 2WMBA 3AT2A 4QNAA 2F7EE 2VWIA 3VQHA 1XR1A 4IJ9A 2W9FB 2IEWA 3UJGA 5CALA 3R9HA 3TCPA 5GZAA 5M08A 4II5A 4BTJA 4UMPA 3FZOA 3LFDA 5TF9A 2B55A 4FJVA 2VN9A 3EN6A 2OIDA 4P4CA 3GU4A 3F5GA 3NUYA 3W8QA 2UZUE 1K3AA 3LFFA 4O4DA 1OZ1A 4YTIA 3UDBA 3VS7A 3IQ7A 2G01A 2PVNA 4JXFA 2RFSA 2PVKA 4ZS4A 3PFYA 4FNWA 5LJJA 1OKZA 5DRDA 4QQ5A 3ZSGA 4EONA 5CEKA 1VR2A 5EW9A 5IQFA 3W2QA 5AP3A 1R78A 1WFCA 3L9NA 3EJ1A 4DEHA 2XKEA 3AMYA 4ZJJA 4CG8A 2XEYA 4H3PA 1OVEA 3ZO4A 4YUQA 2CKEA 2BROA 4DBNA 4EQUA 3VJNA 5CF6A 3GCUA 4U6RA 3EN4A 4U3ZA 5L2IA 4D55A 2AQXA 4BC6A 2OF2A 4BDCA 3KRWA 3KA0A 5L2SA 3LW0A 4CG9A 4FTMA 3GOPA 2XYNA 4GV1A 4CD0A 4JJRA 1OL7A 4F0FA 2GSFA 3V5QA 2E9PA 5L2WA 1XH8A 4B8LA 5FM3A 4NKSA 5ACBC 3W2RA 2P2IA 4EOOA 4KD1A 2QURA 3CXWA 3PLAE 3FLZA 4PTCA 3MJ2A 1LR4A 3OP5A 1XBCA 5FEQA 4XUFA 3E8DA 3TTIA 5GINE 3FLWA 2JKOA 3EB0A 3AKKA 2B54A 2CSNA 4KIPA 3ZU7A 3I5NA 5HG7A 4ASXA 3FZPA 1WVWA 5EOBA 5CEQA 2I0VA 3KULA 3BHVA 3RP9A 3ZDUA 3W0SA 4ZJVA 4GH2A 4XG8A 3ANQA 3M2WA 5CSVA 4FSRA 4O81A 4J8NA 3F5UA 4HVDA 1RE8A 3WARA 3NYXA 4M8TA 2PVMA 3H0ZA 3N4TA 4WSQA 2C6LA 2FA2A 4I1ZA 1YQJA 3U51A 3LFQA 2GMXA 3G90X 3NUNA 2PL0A 4U97A 3BL9A 1Y57A 2XF0A 5EQEA 3P23A 4K8AA 1WBPA 1DAYA 5M51A 3DS6A 3DOGA 4GL9A 4ONAA 5DR9A 5KHWA 1YW2A 3QCQA 5H9BA 5HG5A 2YM8A 4MF0A 2R3MA 4PUZA 4RJ7A 4WUNA 5EI6A 4BGGA 2YERA 1E1VA 3BHYA 4WNOA 4EOQA 4ZXTA 2X4ZA 3D9VA 1UNHA 1O6LA 2O8YA 3KRRA 2XNGA 2ZB1A 1Y6AA 2XNBA 3RVGA 3TL8A 5IQBA 1YHVA 1OKYA 2BKZA 4G1WA 2I1MA 4RC4A 4GS6A 3PJ2A 2C3JA 3ORMA 3O17A 5K4JA 3C0GA 3ZONA 1M17A 3R83A 4F9YA 4O0RA 1KV1A 2W1EA 3I7BA 3C4XA 2PUIA 2PZPA 2JKMA 1WAKA 3GXLA 5AIKA 4DEEA 2PSQA 2XBJA 2F4JA 2QOFA 2WOUA 3HKOA 3CIKA 1T46A 2V5QA 4CZYB 3KC3A 4RVTA 4I22A 3T8OA 3G0EA 4CQGA 3VHEA 3LJ1A 1FPUA 1QMZA 3ZCLA 4S30A 3FE3A 2RKUA 3FLYA 5IA5A 2Z7LA 3Q5IA 5IKWA 4EOIA 3QLGA 4EC8A 1Q3WA 1H01A 3ORNA 5J9YA 3G2FA 4RLKA 3UVRA 4BCJA 2WTVA 4I93A 2HW7A 2JDVA 3C0HA 1Q8UA 2OF4A 3DDPA 3DZOA 1I09A 3MV5A 3OD6X 3QRIA 5CVFA 3VS4A 4AE9A 3RBWA 4PDYA 1MRYA 3IW4A 3HRFA 3II5A 1EH4A 2ITZA 3GOKA 3D83A 4NIFB 3SG9A 3U4UA 1UVRA 2F7XE 5TR6A 4BWXA 2JLDA 3F3UA 2XNPA 5IMXA 3EZRA 2GS6A 2Z60A 1REJA 4KIOA 4EK4A 3E8CA 4YJQA 4HGSA 3U4WA 3R7YA 2BDFA 2C1BA 4UX9A 4AGWA 5BVKA 5D11A 4KINA 3FSKA 3ZBXA 4D9UA 3A8XA 2HZ0A 3O23A 3HL7A 5TOZA 3UDTA 4YNEA 1E9HA 2PVFA 5GJFA 5HO8A 1TVOA 3NYVA 4U8ZA 2XNMA 4D2VA 3WYXA 5AMNA 4DGOA 4TWPA 5IA1A 3BE9A 2PY3A 4FNYA 3F9NA 3AG9A 4A4OA 3MN3A 4Z3VA 1MQBA 5IEXA 5K5NA 1CMKE 3KKVA 3KXZA 3QRTA 4C4HA 3T3UA 5BVEA 4EHGA 4PY1A 4FVQA 4OGRA 2YM4A 3FLQA 3ELJA 5E7RA 3VBTA 5LVNA 4BDHA 4ZOGA 4M69A 4ZY5A 2J0KA 3OW4A 3M11A 4FVRA 2WMRA 2YIWA 4IAAA 5AM7A 4Z9LA 4XHKB 1XO2B 2YWPA 4L7FA 5KUPA 4DDIA 5GIOE 3NMUF 4YO4A 5EM8A 1W84A 4XP3A 5KMMA 4PMTA 4NT4A 3EKKA 3CPBA 3LXLA 3PVBA 4FKTA 4Q2AA 4EYMA 3NVKI 3DCVA 2QOHA 4O7ZA 3Q4TA 4LUDA 3Q32A 3QFVA 4NTTA 5L8JA 3MH0A 1H1QA 3DB8A 5DEWA 5FXSA 3VW8A 3FBVA 5M4CA 2JKQA 3I0QA 2DYLA 3ORLA 4JI9A 4MNFA 5ANKA 5CSXA 5I9UA 3ZO1A 3CD8A 4AT4A 4X3JA 4HCTA 4IWDA 1ZZLA 4WNKA 3QQFA 1LEZA 3S95A 4PPCA 3HAVA 1FGIA 3TYKA 4BR3A 3Q53A 5C8KA 4HZSA 2J4ZA 3HP2A 4RSSA 4JDHA 4U43A 3GCPA 5EYMA 5KX8A 4FEXA 4IMYA 5AR3A 4HCUA 4HJOA 2GNJA 2BTSA 5HCZA 3I6WA 4QTAA 5LWNA 2XS0A 4UB7A 4CVAA 3VJOA 5HD4A 5KZ0A 1QPCA 1YOMA 3E64A 3V8TA 4APCA 3LQ5A 3ENHA 2EUFB 3D4QA 3BV2A 5AP6A 4BZNA 2XARA 1FQ1B 4GRBA 4RJ6A 4YPSA 4AGCA 4F7JA 4LV7A 1ZAOA 5H8EA 3F6XA 3TNHA 3PXRA 3EKNA 1KE5A 3ZFXA 2RSVA 2X39A 3TMOA 4NU1A 4BKJA 1OUKA 3AD6A 4AZSA 3GC0A 3HP5A 3AKLA 3NWWA 4GEOA 3P0MA 4D2WA 1AQ1A 1MRVA 1Y8YA 1GZKA 4GUBA 4LGDA 4F70A 5EDPA 4YJPA 3W2SA 2WQBA 3D7TB 3R7UA 1YXUA 4JIAA 4ANSA 1UU9A 4FX3A 4YZBA 5EI8A 4FT7A 4NIFA 3BBTB 4I94A 4WG4A 3F82A 2GQSA 3BI6A 4YSJA 3FZSA 3PXZA 3ALOA 2W1CA 2XIRA 3MB6A 5CF4A 4FKSA 3D2KA 1H8FA 4AW5A 2PMLX 1BX6A 1U46A 3NUUA 4NSTA 1ZWSA 4GYGA 3KU2A 3BLHA 4HPUE 4IQ6A 2VTIA 1Z9XA 3W18A 4BKYA 4E5BA 1OKWA 3ERKA 3KVWA 4PPAA 4AS0A 2OJFE 4NKAA 4UN0C 4AE6A 5LVPA 2XJ1A 2XM8A 3Q60A 1MP8A 4KKEA 4QMLA 5BYZA 4DFYA 3QX4A 4F4PA 5J5TA 4RGJA 4AFEA 4O7WA 3NIEA 1JBPE 4DH1A 4E8AA 5ETAA 5BMMA 3ZLYA 2XP2A 1YOJA 2JEDA 2WTWA 4WNMA 4YZCA 3ZOSA 4E6QA 4GVAA 1GOLA 3SAYA 4L44A 5IDPA 2QO7A 3R7VA 3QRJA 1WCCA 1ZARA 2JBPA 4JBQA 2VTAA 4TT7A 3UIXA 3CY2A 1VLRA 2WTKC 4RRVA 3UO6A 4YNOA 4O7VA 3LAUA 4RWLA 5FP5A 4DTBA 3OT3A 3KXNA 4ITIA 4RIYA 3TJDA 2C69A 3OC1A 5AR8A 3FHRA 4AP7A 4FSQA 1SMHA 4TYGA 5A46A 2IW9A 5I5ZA 2FB8A 4QYGA 4RZVA 2HXQA 5L4QA 2W1HA 4XYFA 2YIYA 2ZDTA 3TNPC 4BBFA 1PXKA 4I6FA 4WA9A 4BGHA 2YIRA 4FI1A 1QPEA 4FG7A 3VUMA 4X3FC 4CEGA 3FQHA 4JBPA 2P55A 2B1PA 4PNIA 4LRKA 3RZFA 4Q9ZA 3BEAA 4BF2A 3UO5A 4FOCA 3E7OA 3HVCA 5HQ0A 5IQEA 5E8VA 1RW8A 3MIYA 1DI9A 4TYIA 3UGCA 3K5UA 4IHPA 3FV8A 4X3FA 3GBZA 1Q24A 3NFGB 5C8MA 5HESA 4A9YA 4PMSA 3CGOA 1W2CA 2C5NA 3VRZA 3MDYA 4ENXA 4FL2A 4ZTMA 5C4KA 3EN7A 4QYEA 4RJ4A 5AR2A 2BAKA 3DA6A 1YXTA 2IWIA 5HNGA 3HRCA 3P08A 2QG5A 3MPTA 3UVPA 3COMA 3GCVA 4Y95A 4Z55A 1M52A 1GZ8A 2C5YA 3VWAA 5EYDA 3C4EA 3C4ZA 3VBYA 2C6MA 3RPVA 1SNUA 4BZOA 1ZYLA 3NW7A 3VN9A 4OTFA 3DV3A 5KMIA 2B9FA 3C5UA 4JR7A 4BWKA 3NDMA 2O65A 2VTRA 3A7FA 3PPZA 2VTHA 4GJ2A 4JX3A 3AQVA 3IGOA 4QP3A 2QONA 5E91A 1ST4A 1BL7A 4F7NA 1L8TA 4DF3A 3F7ZA 5M4IA 1IRKA 4IAZA 4PDSA 5K0KA 3QTSA 4J53A