5HIEA

Braf kinase domain b3ac loop deletion mutant in complex with dabrafenib
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
269
structure length
258
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Activation Mechanism of Oncogenic Deletion Mutations in BRAF, EGFR, and HER2.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 258
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hieA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hieA01
4QP4A 2WEVA 4ACMA 1OIUA 2QG5A 2UZWE 3FI2A 3OBGA 3O17A 4U80A 4IMYA 2OZAB 4AOTA 3MVLA 3MPMA 3AMAA 4ZLZA 4O2ZA 4B8MA 2B53A 5HKMA 3VS1A 3CE3A 3ZUTA 4R1YA 3C4ZA 2OJGA 3BWFA 4QO9A 5HORA 1GIJA 4Z7GA 2VO6A 3PUPA 3QWJA 3AT4A 3FY2A 5J5SA 5FWKK 3ID6C 4C4GA 1FINA 4D5HA 3GC8A 2O0UA 5TOZA 3R2BA 4WA9A 4FBXA 3LFFA 2QURA 3BI6A 3OXTA 4PNIA 4X3FA 4GT5A 4C33A 4E5WA 3QC4A 2C4GA 2VO3A 4D4YA 2B0QA 5IEYA 4IZYA 3R8LA 5JFVA 4HYIA 4D55A 5FDPA 5FTGA 3TDVA 3LPBA 1OBDA 2C5YA 3Q32A 5HGIA 3ANRA 3Q5ZA 3DKGA 3AXWA 3BBTB 4S34A 4ZJIA 4M69A 4IHPA 3RJCA 3ZDUA 3W2RA 1FGIA 3GVUA 2ITWA 2P55A 4I0RA 4O27B 4O0TA 3ZLWA 4CMTA 1WVWA 4WNPA 1WMKA 3K5VA 3QGWA 4YJSA 4GUEA 5BNJA 2XNGA 3ULZA 4F6SA 1AGWA 4HJOA 3QTSA 2ERZE 4CFUA 4EUUA 5E1SA 3C5UA 5EW3A 5DWRA 3HNGA 3UNKA 5I9UA 1Q61A 4UWCA 5E8ZA 3UNZA 5CT0A 4ZY4A 3BHVA 3HP5A 2JD5A 3PZHA 4KRDA 4C02A 5ICPA 4RJ3A 3D2IA 3PVGA 3UO6A 4ZOGA 3GXLA 3F2NA 5T68A 4M84A 2HY81 2OZOA 3PIYA 1O6KA 3P7CA 3PVBA 2BAQA 4I5PA 3WI6A 4GK4A 3FSFA 1BLXA 4ANBA 3OEZA 3Q5IA 4WIHA 3BU5A 2OJFE 2J50A 3MY5A 3KMMA 3GEQA 1JKKA 1Q3DA 3UTOA 3QFVA 3M1SA 3LFDA 4CCUA 5BVKA 3AC1A 4IC7A 4YURA 4E93A 3SQQA 2EB3A 3VS7A 3ZFMA 3QTIA 4DGNA 4WG4A 4F7NA 4DG0E 4BFMA 5HG7A 5AR4A 5IQFA 3OCSA 4LOQA 2UW7A 4DEIA 3QRJA 2PZPA 4EWQA 2PMLX 4Z55A 2NRUA 2CNVA 3H0ZA 5CU6A 4BKJA 5C4LA 3E62A 4FR4A 4FV1A 4HCUA 3RGFA 4A4XA 4A9TA 2WB8A 4X3JA 4P7EA 3ZO2A 4BI1A 4IX6A 3BHHA 2P33A 4AZTA 4E6CA 5KMKA 3TJCA 3CBLA 3FLSA 4GJ2A 5L6WL 3DXQA 2XNPA 2UW5A 4O1PA 1X8BA 3KFAA 2X4FA 3NW5A 4F9BA 2GQSA 4YO6A 3R7IA 3FY0A 5EM7A 3KK8A 3ORXA 2BTSA 3TT0A 2W1CA 4K0YA 2XJ0A 3AQVA 3MPTA 4XEYA 2Y7JA 1PW2A 4NT4A 5CXHA 4EYMA 4MBIA 5HHWA 3GOPA 1RDQE 3DPKA 2VO7A 4BBMA 3VS4A 1GZNA 4GSBA 4K2RA 5BQ0A 3ZO4A 3EFWA 4LRKA 4X2NA 5LWMA 3N4TA 4BWPA 3OHTA 1REKA 2B9JA 2YM5A 4G5JA 4WBBB 5CVHA 2C47A 3MN3A 5IQAA 2OICA 3EFJA 1FMKA 4RWKA 3C4EA 2CNUA 3FHIA 3WZEA 2A4LA 3GENA 3BWJA 4RBLA 3KRJA 4UY9A 1TQIA 2W9FB 5JT2A 3L9MA 4FV5A 4JQ7A 3MY0A 2P4IA 5FQDC 2PVMA 3HUBA 4QMPA 3FMHA 3VBTA 4MH7A 3W18A 3FKNA 3QQKA 1PMEA 3ZDIA 1RJBA 3KCFA 2YCRA 2NPQA 4IZ5A 3PA3A 4RVLA 5CF6A 4BHNA 4C38A 4JDKA 4PL4A 4UWBA 1YI4A 4X2JA 3SD0A 5HQ0A 5AUWA 4O82A 4QQJA 5HCZA 5M4FA 3JVSA 4O38A 1FVVA 2J0IA 2W1DA 3I0OA 4E6AA 2NRYA 4FTJA 4ZP5A 4I0TA 5CAOA 3LJ0A 2W06A 3WYXA 3BYSA 4EK3A 1A48A 2XVDA 2CLXA 5A3XA 3DDQA 2UVZA 5D1JA 2GNGA 4AN3A 1H8FA 4ERWA 2QU5A 4D2TA 4FG9A 4CTBA 4RIWA 4KB8A 1JKTA 4YTHA 5HX8A 4IB3A 4ANMA 4I23A 4YTFA 3NGAA 5AA9A 4IFGA 4YLLA 1SMHA 2JFMA 4G6LA 3O7LD 2EUFB 5AP5A 4AOJA 4DAWA 1YOMA 3TZ8A 4U41A 4BDDA 1NVQA 2V7OA 3C4FA 2VX3A 5CI7A 2C5XA 2YCSA 5D7AA 3P7BA 3HRBA 3TUDA 3V5LA 2PULA 2XNNA 5EYCA 1LPUA 4ITHA 2WMTA 3ZCLA 2WKMA 4I41A 1XBAA 5FUTA 3RHKA 5JFWA 3R28A 3C1XA 2E2BA 4GS6A 4C4FA 1UA2A 3PXKA 5EM8A 4E5BA 4C4EA 2JFLA 3KK9A 5L2TA 5HNGA 5CU2A 3TNIA 1Z9XA 5EKNA 1U54B 3HVCA 4RQVA 4CRSA 5AV3A 4R78A 5E8TA 3HX4A 4JBPA 4IAFA 2NNWB 3AGMA 4JXFA 4QMWA 5IMXA 2X7OA 3EQFA 3RMFA 4EH4A 4BB4A 1URWA 2GTNA 2R7IA 3EN4A 1J7IA 4RQKA 1JLUE 1RW8A 4XLVA 4H05A 5HBJA 4MNEA 4X6RA 3CQEA 4XUFA 4XBRA 3TKIA 3RVGA 3UVQA 4CGAA 2IVSA 3PRIA 2VTAA 2QC6A 2Y8OA 5M57A 1UWHA 3MESA 1RE8A 2GHGA 3JS2A 4MYGA 4DH3A 4CFXA 4OTPA 4U43A 3R8PA 2QKRA 2BAJA 2C1BA 4TZRA 3ULIA 2ZB0A 3MVMA 5CQWA 5GZ9A 1KSWA 2C3LA 2XF0A 2BIYA 4E4MA 2PE1A 4IX3A 1K9AA 1Q8WA 5FEDA 2OFVA 4NEUA 1LEZA 3D5WA 2WXVA 4F08A 3WIGA 2GFSA 3K54A 3OWKA 3RPVA 2WIPA 4FKIA 1PMUA 3VBQA 3R9RA 3PRFA 4AE6A 2A2AA 4I5MA 3LQ8A 5E8VA 1GZOA 4CZTA 2XCKA 3EMGA 2YCQA 2R0IA 4LI5A 2FSOX 1I09A 3CSVA 1CMKE 4IWOA 3B8RA 4BDFA 4G3DA 2XZSA 4U44A 4CXAA 3I6UA 3PWDA 1H1WA 2PYWA 4RLLA 3VUDA 3MTFA 3A4OX 4ERKA 3S3IA 2J0MB 3VWAA 3BEGA 4ZEGA 2BRMA 4LG4A 4ORKA 2X2LA 4IWQA 4L8MA 4NIFB 4KIKB 5K3YA 4FKRA 2IZTA 2QU6A 2J51A 3HP2A 3PE2A 3DFAA 3QCXA 4GFMA 4I6FA 3VHKA 3Q2JA 2CMWA 3FAAA 4FKVA 1RQQA 2C5VA 2CN8A 3LFBA 4NKAA 5C8NA 1DI8A 4R7HA 4EOLA 3OY1A 4FIHA 4H39A 5FM3A 3IDCA 3LM0A 4ANNA 4D1SA 2GS7A 3MV5A 3DKCA 3UGCA 4O7NA 5DA3A 4XBUA 2OH0E 4OTGA 4DCEA 2QCSA 3QU0A 1WFCA 3UVPA 3VUHA 2Z7RA 1WCCA 4B99A 4HVDA 1QL6A 3M11A 1SZMA 4UMRA 2DUVA 4JOAA 2OFUA 2W17A 1IA9A 4JDIA 4X2KA 4C61A 2HZIA 2EB2A 4IB1A 3F5UA 4BI2A 1YXVA 4EONA 3KVWA 3DDPA 4D4RA 3ANQA 4L3LA 2Y4IB 4F7SA 4Y83A 2YJSA 4O6EA 3QC9A 2Y9QA 5CEKA 3EQGA 5KMLA 2WELA 2WTJA 3ACKA 3FQSA 4FEXA 1YXTA 2C0TA 2ITYA 2C6OA 5FXSA 1NXKA 3HGKA 3RWQA 4ITJA 2E9VA 3ZO1A 3LXLA 4I1ZA 3E93A 3R83A 5HESA 2JKKA 1OB3A 4O91A 3T3VA 2PVJA 3HUCA 4U9AA 3MA3A 1T45A 3QRTA 3C0HA 4FV7A 2YZLA 1WBWA 5D10A 3QHRA 4TWPA 4XG6A 2PL0A 3NNXA 2I0YA 2WD1A 3RAIA 4EHGA 4PMPA 4R8QA 2PVRA 3CTHA 3PXYA 3BELA 4V0GA 4IAKA 3W55A 3GC0A 2C30A 3NPCA 4G9RA 4U79A 4EBVA 5KMNA 4JR3A 4IM2A 4FSWA 4FV4A 4FKTA 4X3FC 3N4UA 3TNWA 3SW7A 4FV8A 1FVTA 3UO5A 4RJ8A 4WRGA 3ZLYA 5A46A 2JDVA 4RJ4A 4QP9A 4GVAA 1J3HA 2OWBA 3R1NA 3WBLA 2PZRA 4BBFA 2HXQA 5CZIA 2HIWA 3VW6A 4KS8A 3VUKA 3R1YA 4XV9A 4DEGA 4LMUA 4W4YA 2ITZA 2OF2A 1DAYA 3M2WA 3ODZX 3QZHA 4OTIA 4M66A 5FEQA 2BZIB 2ETRA 2J0JA 3ZU7A 5FBNC 4CT2A 5J79A 4BDAA 3VS5A 3QD0A 4K1BA 4Y85A 3U6JA 2ONLA 2Y4PA 3I0QA 3SX9A 2YWVA 3W16A 2CGUA 2XCHA 2PMNX 1LR4A 5L2WA 1R0EA 2ZM1A 4JQEA 4YU2A 3NUAA 5DHJA 4TN6A 4DTKA 4AZSA 1H0WA 2W5BA 1JKLA 3D4QA 1H1QA 1VYWA 3QGYA 2WMUA 1PXKA 4BTFA 4HW7A 1YXSA 3H9OA 2GMXA 2UVYA 4AAAA 2ITNA 3QZFA 3LJ2A 4BCKA 5M4UA 4M14A 4MXAA 2J6MA 2X0GA 4C7TA 3EFKA 5LCKA 1B6CB 2O8YA 3V5WA 4DYMA 4FKSA 3FZRA 1YKRA 5CNNA 3ZLXA 3EQCA 2EXMA 1P2AA 2LGCA 3ORPA 4LV5A 4YSMA 4CG9A 4JG8A 3O71A 1QMZA 3EQPA 2WU6A 2R2PA 2XM8A 1H28A 5E91A 3W2PA 4ALVA 4CYIA 4JG7A 1E1XA 1L8TA 3V6RA 5GZAA 3IW8A 2XKEA 4ZSEA 3NVMB 5AAGA 4K33A 3LFCA 4Y73A 3KCKA 2UZBA 5CEMA 1V0OA 2QOBA 3HEGA 4FKQA 3UQGA 4W4VA 4OAVB 3Q2MA 1GOLA 2QODA 1BUHA 4AUAA 2BZJA 1OIRA 4IZAA 3CTQA 4GIIA 2VGPA 5JRSA 3RBWA 2XYUA 3BV2A 2WTCA 5AUVA 4DGOA 3NIZA 3ZBFA 4WSQA 2UZNA 3ZEPA 1GNGA 2G2FA 2WMXA 2GHLA 3LMGA 3AC5A 3GB2A 5DR9A 1BI8A 3L9LA 4PPBA 2ESMA 5BMSA 2J2IB 4H3PA 2OF4A 2WMBA 2X8DA 1LP4A 4FIEA 1TQMA 3QA0A 1Q8ZA 3BCEA 5L8LA 5K4IA 3WF6A 3PJ1A 5D7VA 5ANOA 3ZSIA 5EM5A 4OLIA 5I9XA 3REPA 3DQXA 4IAAA 1URCA 4MBJA 1ZARA 3DAJA 5HVYA 1Q41A 3FE3A 4GW8A 5M55A 1GY3A 4B8LA 1PF8A 3CGFA 3DNDA 4D58A 4M13A 4Y72A 3BE9A 5FTQA 2VUWA 5M4CA 1BKXA 4IQ6A 4E4LA 4TYHA 4AGCA 3PJ3A 4L46A 3FMMA 3MFSA 3UOLA 2OJIA 3H10A 1ERKA 2X6EA 3NYXA 3R7UA 4CLJA 1UKIA 4C3PA 3R7OA 5HO7A 4FVRA 5EHOA 4PL3A 3VO3A 1YHVA 2OU7A 5HIEA 5DGZA 3RPOA 3RPSA 4GU6A 5HE0A 4USEA 4BCFA 4X21A 1YRPA 5FRIA 2VU3A 2HY0A 3A8WA 3NWWA 4GVJA 2BR1A 4G16A 4K11A 4RVMA 3W2SA 2F7EE 4CG8A 4MQ2A 2ZV2A 4HYSA 5AAFA 4AA0A 2CN5A 3Q52A 3TTJA 3U54A 3KVXA 3EFLA 3O50A 3QTRA 3PA4A 4FIJA 5AAEA 2Q0BA 2X7FA 4UYAA 3VBWA 1KUTA 3A62A 4EK5A 4ENXA 2QHNA 4AU8A 2EVAA 1H25A 5JEBA 2VTTA 2FVDA 3EIDA 4S33A 3HMOA 1XBCA 1W84A 4HVIA 3QQHA 2R3LA 2J9MA 5DG5A 4MVFA 3QUPA 3V5TA 3D5VA 4FTLA 3QALE 4TYGA 2H8HA 4Q2AA 3WYYA 5IEXA 2XM9A 4FT0A 4YJPA 1YI3A 4W8DA 4Z3VA 5FXRA 1TQPA 2AUHA 4AX8A 1XH7A 4G1WA 4GV1A 2UZVA 3F5GA 3ZOSA 3D94A 5T6KA 2QOFA 2BHHA 4C3RA 4APPA 3PJ2A 2R3IA 5DR6A 2OZAA 4RC2A 3UPXA 3U87A 2PK9A 1UU3A 4Y5QA 2OXXA 3OS3A 5FXQA 3RNYA 3ZEWA 2WIHA 3C50A 3SXFA 1QPCA 1Z5MA 5IZFA 2UZUE 4FV3A 4DGGA 4OTQA 4XP2A 4RLKA 3FZTA 4RWJA 4ZTQA 4QNYA 3NW7A 4W4XA 2GQGA 3DLZA 4YJVA 5M07A 4U3ZA 3FYKX 4CNHA 2AC3A 3S4QA 1H1SA 2C6LA 3NUSA 3QRIA 4PDSA 3OT8A 3NR9A 1OGUA 5AP2A 3VS6A 1OECA 3DXNA 1WBOA 5AJQA 2OW3A 2CKPA 4PDYA 4QMYA 4QMOA 3KA0A 5KO1A 3DZOA 1TKIA 2X8EA 2YITA 3LXNA 3MB7A 4O0WA 4RJ7A 5CSHA 4FSQA 2QKWB 3QA8A 3O51A 4D9UA 1IEPA 2RL5A 4QTAA 1CKPA 4I5HA 4BDIA 4ACHA 2IZSA 4YZMA 3SLSA 5ACKA 4XG3A 5LARA 3VULA 4EH3A 4R7BA 3RK9A 4N57A 4CSVA 4W8EA 1WBSA 4FUXA 4XG7A 4Y5HA 4EUTA 4RIOA 2QOOA 4M0YA 2B1PA 3D5UA 3QQLA 3UODA 1XO2B 4AS0A 3V01A 2VO0A 2ETKA 2IVVA 3F3WA 5FD2A 4A4OA 3HZTA 2XP2A 3R9DA 1UNLA 4E4XA 2OH4A 3COMA 4FSTA 1XWSA 3VHEA 3EJ1A 3IKAA 4EQCA 5BVFA 4XLIA 5BVDA 4PTGA 1MP8A 4ZS0A 1J7UA 3EKNA 4RJ5A 5F94A 3FXZA 5HG8A 2WFYA 4IDTA 4QQTA 4FL1A 3Q96A 2RFSA 3AC8A 3QQGA 4IFCA 5E1EA 4DFUA 4TYIA 3IG7A 3EQRA 3UO4A 3UP7A 1DS5A 2HAKA 3P78A 5K9IA 4MAOA 2C6KA 4IE9A 3SG9A 5G6VA 3NRMA 2UVXA 3WF5A 3A7JA 4GT3A 4D5KA 5HOAA 1MQBA 4BWXA 3Q9YA 3R1SA 2XK7A 2AC5A 3QTWA 3SOAA 3EZRA 3Q6WA 2NO3A 4JG6A 2HOGA 3D0EA 3OG7A 4AZVA 4YGAA 1NW1A 4DEEA 2BALA 4GU9A 4U8ZA 3R73A 5AUXA 2LAVA 5DVRA 4E73A 4OTWA 4AOIA 3F3ZA 4FG8A 3BZ3A 4FVPA 1BL6A 2W1ZA 3LFNA 3ENMA 2PVKA 3F5XA 3MFTA 2F2UA 2OGVA 4RVTA 4ZSJA 3UC4A 3ZRMA 4Z7HA 4RFYA 4TT7A 3TIYA 4FG7A 3G33A 2ITQA 2XH5A 3NVKI 3VN9A 2W5HA 5HIBA 2DS1A 2QO2A 4OBPA 3V5PA 5IDPA 4QP2A 4G34A 5ANDA 3KULB 5AX3A 4B4LA 3DK6A 5AUZA 1U46A 4XP3A 2WNTA 4DFYA 5A6NA 3RAKA 2OLCA 3MB6A 2XNBA 3OTVA 3WZKA 4GYGA 4M8TA 1XH8A 2GNFA 4FF8A 1J1BA 4ANSA 4ACDA 2VGOA 3MYGA 1GAGA 4FEUA 3VRZA 3PG3A 5K0KA 2PVYA 4X2FA 4RGJA 4YMJA 1O6LA 2YDKA 3ZRLA 4PV0A 3IOPA 4TTHB 5CEPA 5J87A 2R3OA 4NUSA 4YO4A 2JGZA 3H9FA 2OXDA 3I81A 1SM2A 4QP3A 4TWCA 3PY0A 4QD6A 5L8KA 4XH6A 4JIKA 1SYKA 3EN5A 3A7FA 5BVEA 3HA8A 4TNDA 4XYFA 3BGQA 5DR2A 4D4VA 5HE2A 4D1ZA 3O2MA 4I94A 1JNKA 5AUYA 3RAWA 4C35A 4DH8A 4KBKA 4F9CA 1PXIA 3VUTA 4PMMA 3ZRKA 4E5AX 1F3MC 5JGBA 3IGGA 1IRKA 3D7ZA 2CJMA 3F3VA 3ITZA 3UIUA 3ZZWA 4BDCA 4TY1A 1FOTA 2WO6A 3R6XA 2GQRA 2WAJA 3V8WA 3F2AA 4UMUA 3FMLA 3BX5A 4ANLA 5CSVA 3UE4A 2GSFA 2XB7A 3HLLA 3PSBA 4BGQA 5JFSA 3W32A 1H01A 2YDJA 1UU7A 5E90A 3FWQA 1XBBA 3PVWA 3COIA 3LE6A 2ONLC 4GT4A 3NSZA 4O83A 4FKPA 3BU6A 4L67A 4V05A 3KQ7A 4QPMA 2VNYA 2QOKA 2EXEA 4AT5A 5IH6A 2Z60A 2OK1A 3LW0A 4IWPA 3ALOA 5KBQA 2V0DA 1GJOA 5C01A 5L6OA 3PPJA 2UW6A 2YERA 2B4SB 3FZ1A 4RC3A 4BN1A 4RWIA 4J8MA 5L2QA 1OL2A 5EM6A 3U8WA 1H0VA 3ODYX 4LFIA 3PPZA 3G9LX 4IXPA 4PTCA 3P5KA 1ZWSA 1Y91A 1YQJA 1T46A 2WTVA 3FXXA 3OEFX 4ANOA 3EQHA 3FDNA 2YISA 3NUXA 3R21A 3N4VA 4NZWB 3OOGA 3BYMA 4WUAA 3BYUA 2XRUA 5DEWA 4C36A 4IVAA 3PSCA 4BTJA 4YJNA 4FSUA 2V22A 1PYXA 4BZDA 4CKRA 3FXWA 5FBOA 1H27A 1PJKA 2W4KA 3Q53A 3IGOA 3OW3A 2J7TA 3CIKA 4UXLA 4YTIA 4UN0C 5H3QA 3I60A 4C0TA 1NT2A 3NMUF 4F1OA 1JWHA 3HYHA 1G8SA 5AR7A 5KMMA 1KWPA 3ALNA 3JPVA 3MH1A 4GUBA 5D11A 3ZZEA 4ZZMA 4G3GA 1U59A 3CGOA 2YAAA 2IZUA 2OKRA 5IUHA 3PXFA 4QMXA 5IKWA 3ZHPC 3QQFA 3GU8A 4XV1A 5HO8A 2Q83A 4UALA 1QPJA 3H9RA 3D2KA 4TPTA 4QMVA 4E26A 2CKQA 2ITXA 3FC2A 4FTNA 4PY1A 3TKUA 3WE4A 3HV6A 1V0PA 4CQEA 3P1AA 3OXZA 4HGLA 5CSXA 4KUJA 2QLUA 1JOWB 2YZAA 3VUGA 4BKYA 1JVPP 5K0XA 5AV0A 4PQNA 4DC2A 4O7VA 2HCKA 1YHWA 3FKLA 1H4LA 5BYYA 3FLYA 4TWOA 2I7QA 1NVSA 3U6HA 4EH6A 3TIZA 1E1VA 3K5UA 4MXOA 4FMQA 3W8LA 4KIOA 3OOMA 3OWPA 4LM5A 4YPSA 2FO0A 3TN8A 4CTCA 3W1FA 4PUZA 4EOPA 5JFXA 4XRJA 4JLCA 1R1WA 4D0XA 4MBLA 3C0IA 4S30A 5HO6A 3P79A 4KIKA 4LGDA 4FV2A 5ANGA 5HCYA 5C03A 2HYYA 2OXYA 5GIPE 2G9XA 4IIRA 4KD1A 4PTEA 3CY3A 4CFWA 5HTBA 4JT3A 4KWPA 2VTOA 5AR2A 5TR6A 3NEWA 3UP2A 1JSTA 3KXGA 2R5TA 4Z9LA 3ZXZA 5A4EA 5EQYA 3A99A 3LXKA 4A9UA 3O8PA 4FEWA 4FTRA 2W1FA 3AGLA 4L52A 5CF5A 4J53A 4ZTRA 4O1OA 1LUFA 4RRVA 3FQEA 4PF4A 4XG9A 5CSPA 2QONA 4ENYA 5A54A 4FL2A 3KXXA 3JR1A 4KBAA 1FQ1B 3ELJA 3I5ZA 5ANKA 4BHZA 5KHXA 2BROA 3GQIA 4MD9E 3WOWA 4BDJA 3FLQA 4YJQA 2Q0NA 3QZIA 2P3GX 4YBJA 5BYLA 3GCVA 4GYIA 3KF7A 4OT6A 5J7HA 3OTUA 1QPEA 3VIDA 4QMZA 3QLGA 3D7TB 5DPVA 3O8UA 3P86A 4QP6A 3MI9A 4JS8A 2CKOA 5AP3A 2ZV7A 5IUGA 4O7YA 4XG4A 1BL7A 4J98A 3FBVA 3TM0A 4FTIA 2GS6A 3E87A 2RIOA 3MGYA 2UW0A 2WQNA 1ZY5A 3LJ1A 3OWJA 4O21A 5AIKA 4HNIA 3TZMA 3SDJA 1FMOE 1WBNA 2W9ZB 3LIJA 5CAUA 3EN6A 5HG5A 3A7IA 3LKMA 1YOLA 1UWJA 3QYZA 1BYGA 2O65A 4TRLA 3KMUA 3IW4A 4FIFA 2UZOA 3RALA 4F6UA 5KBRA 2XNOA 4JBOA 4GJ3A 1REJA 3LZBA 3PP0A 4X0MA 4IH8A 1OVEA 2PUIA 3EZVA 4B0GA 4YNEA 5KCVA 1K3AA 4X3FB 5CS6A 3G0FA 4AA5A 3VF9A 4BICA 3G9NA 3SRVB 4MK0A 4NCTA 4BC6A 5JQ8A 3ZC6A 5IA2A 3F82A 3PE1A 3FMNA 3KXNA 2X7GA 4O6LA 2I6LA 2A1AB 2V5QA 2WHBA 4EOOA 4C4HA 3QHWA 3AD4A 2R3GA 2HW7A 2XRWA 3F7ZA 4GK2A 4RC4A 4EC9A 4EBWA 1XHAA 4PDPA 1CTPE 3KREA 2OJ9A 1ZYJA 5EYDA 4BDKA 4K18A 1HCLA 4Y8DA 3JXWA 3KB7A 2ITOA 3SW4A 3MDYA 5I0BA 2EXCX 2VTIA 3QCQA 4FNZA 4IX5A 5H8EA 4IACA 2BTRA 4C2WA 4RFMA 1UNHA 3CKXA 3PWYA 1OMWA 3H3CA 1YXUA 3KKVA 3KRXA 4AZEA 2XIYA 4XG8A 2BZKB 4ACGA 4WUNA 2C5NA 3F5PA 3P4KA 2E9UA 2FUMA 3HMMA 4AXAA 3BHUA 2C6MA 5BYZA 5CXZA 3DV3A 2SRCA 3RCJA 4ZZOA 4JX7A 3SG8A 4YJUA 4DINA 1KE9A 1PYEA 4YUQA 5HIDA 3WARA 5J9YA 4WO5A 3LCOA 5IQCA 3DQWA 3ERKA 4AW1A 1S9JA 2R9SA 5HLNA 4ZXTA 4FICA 1ZYLA 4G17A 3NUNA 4N6ZA 3A8XA 4RMZA 4F7JA 1V0BA 3PVUA 3EWHA 2JDOA 3ZH8A 4EOQA 2CGXA 5KKRB 4J99A 2YDIA 4J96A 1IAJA 5KMIA 5CASA 1STCE 1OPKA 2JIIA 4KKEA 4XMOA 5IA1A 5GINE 2C68A 1Y57A 2RGPA 1OPJA 4NM5A 4NWMA 3UG1A 4DBXA 5AUTA 2QR7A 2WMWA 4PMSA 4BKZA 1B39A 1ZMVA 2ITPA 3W2OA 3PG1A 2UUEA 3DBQA 4GK3A 4M0ZA 2P0CA 2JBPA 2R3KA 1Y8YA 2VZ6A 4YJRA 3E88A 5CVFA 5FEEA 4EJNA 2GCDA 3QTUA 4ARKA 3O23A 3LAUA 3UG2A 3DGKA 2I0HA 2C6DA 5BVWA 4IVCA 2WTKC 3QQJA 5E9EA 5EI2A 3FEGA 4P5QA 5I5ZA 4DG3E 1Y6BA 2VWUA 3MSSA 4QMQA 5JGDA 1DI9A 4UX9A 2XK9A 3CJFA 2RG6A 3Q9WA 1PMNA 3TEIA 4EOSA 4KBCA 5BUJA 3FI4A 2XA4A 4R3PA 4W9WA 5LMAA 3VF8A 4J1RA 3QUEA 1ZZLA 1KV1A 4JL9A 4OUCA 5IQBA 4FKGA 4H58A 3GOKA 4IX4A 4OGRA 5AUUA 3BGPA 3QL8A 3E7VA 4BTMA 4K6ZA 3V6SA 4G3CA 1SNXA 1ND4A 1M2RA 3VW8A 2RFNA 3MFRA 3WF9A 3H4JA 1QCFA 2IVUA 4YLJA 5AEPA 4DHFA 1H08A 4GG5A 5CX9A 5A6OA 3ORZA 2UZDA 4DA5A 5CENA 2C5OA 4Q9ZA 2R7BA 2BRHA 3KXMA 3CPCA 4ZSAA 1OZ1A 4JRVA 4FV6A 4O7ZA 4PDOA 4A4LA 4C4IA 5M53A 3VJOA 4R7IA 4UYNA 2YWPA 4OTHA 1WZYA 4RX9A 4P5ZA 2V62A 3CD3A 3R9NA 2FSTX 3ORIA 3S0OA 1ZMWA 2VWVA 2QO9A 2WU7A 4AGWA 4MX9A 4LV8A 5FGKA 2YM8A 3HAMA 2ZAZA 3IECA 5E8SA 3LHJA 3BLHA 2XBAA 4A9RA 4O22A 1XJDA 2W1GA 3TV4A 3QTQA 1O6YA 4LGGA 5EW9A 4ZTLA 4O0XA 1H24A 1YXXA 4RX8A 3OBJA 1OL1A 1HOWA 3CR0A 1V1KA 5IU2A 3NYNA 5AX9A 3RKBA 3W2QA 5E7RA 2VTPA 1OUKA 4IAIA 3C7QA 3E8CA 1OL6A 4CKJA 4M12A 4A06A 5A9UA 4ZSLA 2IW8A 2IW6A 2YIRA 4F65A 5C1QB 3N9XA 3R1QA 2P2HA 5JRQA 5M56A 2P2IA 4MNEB 4S2ZA 4D4SA 4N4SA 2OIDA 4YC6A 4YJTA 2AYPA 4EH2A 5A4QA 3UZPA 4L9IA 5LQFA 5I4NA 3C4XA 4QMNA 5K5NA 5IQEA 3IQ7A 5EI6A 5CU4A 3OXIA 4BCMA 3KXZA 4MNFA 4KNBA 2OO8X 3DB8A 2A19B 3S2PA 2YIXA 4RIYB 4XNEA 2ZMCA 4LL0A 5GJFA 2JIUA 2PVNA 3QX2A 4HZRA 4J52A 4EHVA 4RX5A 3OROA 3ZONA 4RIXA 5B7VA 2XIZA 3HKOA 3PIXA 2W05A 2V55A 3FJQE 3FL5A 4DN5A 5BVOA 1MRYA 1VJYA 4NTTA 4J7BA 3QF9A 3KU2A 5A4LA 2B7AA 4C59A 5CALA 3QKKA 4EQMA 4F1MA 2G2HA 2EWAA 5AV1A 2QNJA 4XOYA 4D1XA 4ASZA 5D9HA 3U9NA 3ZYAA 5EFQA 3OCBA 1XH9A 4QMSA 5EOBA 5TT7A 5CAPA 5CZHA 3BE2A 4YHTA 3TTIA 1CKJA 3OP5A 3R8UA 4DTAA 2UW4A 3A61A 2CCIA 1M14A 4G2FA 1W83A 5KZIA 3LMHA 4U3YA 2UW8A 2KULA 5K4JA 3OCGA 3ZBXA 4IVDA 3RZFA 5DT4A 3QCYA 1UNGA 3PFQA 3G90X 2OG8A 4CFMA 3T9TA 1M2QA 5IG1A 2W5AA 3DJ7A 3IO7A 3ATSA 2B9IA 5H8BA 1XR1A 2XMYA 1G8AA 1KE6A 3DBEA 4QPSA 5EI8A 4AW0A 2W7XA 4LMNA 3NCGA 2VTNA 2B9HA 2FSMX 3CD8A 4O0YA 4NM0A 4LRJA 4NK9A 5M09A 4LOOA 3GFEA 3PTGA 5CVGA 5HTIA 3MBLA 3ZMMA 5ITAA 1YWRA 4ZMEA 4NJDA 3I5NA 2J5EA 5AM7A 5GJDA 1ZOHA 3DAKA 4EWHA 4I5CA 4EEVA 3A2CA 3C4CA 2RKUA 4KKGA 1Y6AA 3ET7A 4A9SA 3A60A 4BVUA 4ANQA 4C3FA 4YP8A 5HX6A 3ORKA 4LUEA 4U81A 5KX8A 1Y8GA 1CKIA 4G6NA 3GCSA 2H9VA 4PL5A 4I6BA 3HRCA 2OJJA 5CY3A 3KRLA 4II5A 2WOUA 5DRBA 3TL8A 3C4WA 3E5AA 4WRSA 2WQOA 2UZTA 4XHKB 2JKMA 3KULA 5CT7A 4B9DA 2Z2WA 3IW6A 4DT9A 4FE2A 4DFNA 4I4EA 4F0IA 4N70A 3QXOA 3BRBA 4LQMA 2C3IB 4U7ZA 4BCQA 4MWIA 4QYYA 3AD6A 3L8SA 3R2YA 5LMKA 2VRXA 4FNXA 4GH2A 5F95A 3E63A 3ZS5A 2Z7QA 4CLIA 4DH7A 1KOBA 1NVRA 5ETCA 4HGEA 2CCHA 3RZBA 3BGZA 5L6PA 1ATPE 4HZSA 5ANJA 3EL7A 4HPTE 4BZOA 4O0VA 4F7LA 3R04A 1SNUA 3JY0A 2WZJA 3P23A 5E4HA 3UIMA 4PNKA 5D12A 1M2PA 4IAYA 4BY9E 1HCKA 3GU7A 4V0GB 4GL9A 4NU1A 2BCJA 4O7LA 5CAVA 1FVRA 2O2UA 5H2UA 4CYJA 5CEOA 4FK3A 4FODA 5A14A 3L9PA 2G01A 5BPYA 1XH6A 5EG3A 3EN9A 5EQEA 4AP7A 4EQUA 2R3MA 5DI1A 5HI2A 3EQBA 4E3CA 5CQUA 4FT7A 4NCTC 4GEOA 2XK4A 1A06A 4NM3A 3UPZA 3K3JA 3LCSA 3DJ6A 4FEQA 4RJ6A 2WQEA 2XEYA 2IG7A 5F20A 4RA4A 3WF7A 4E8AA 4FGBA 5EHYA 4F9AA 2VWBA 3WF8A 2PY3A 2REIA 4RZWA 5AADA 3LCTA 3MVJA 4XOZA 4G3EA 4NYEA 5GJGA 3AMYA 5LVOA 2CDZA 2I0EA 3RCDA 1OPLA 1P14A 4AG8A 2JIVA 2XNMA 3Q4TA 1CDKA 3KN6A 4RWLA 4YZ9A 4TYJA 3RINA 2EU9A 1ZYCA 2BMCA 1OKZA 5B2LA 4WNKA 3AOXA 4FTOA 3GCPA 3I7BA 5AP6A 3FKOA 3UMXA 5F9EA 4P90A 3DZQA 4IDVA 3MPAA 4WSYA 4CQGA 4ZTNA 4U0IA 4JRNA 3UIBA 3RNIA 3V5JA 3F2RA 3TUCA 4D2RA 2CSNA 4YHJA 5KMJA 3GU5A 4ITIA 2PHKA 3DFCB 4E7WA 3QKMA 3BV3A 3KY2A 5M4IA 4Y95A 2YIWA 2J0LA 4CV9A 3VBVA 2YHVA 1M7NA 3W8QA 4DH5A 4UXQA 3VS0A 1OBGA 5EDRA 5JKGA 5HE1A 3A7HA 3NUUA 5M51A 4QOXA 4XP0A 2PVLA 5J1WA 4LL5A 3QRKA 1GZ8A 1PXJA 3HRFA 3G2FA 2VTHA 5EDPA 3AG9A 1KE7A 5K5XA 4U6RA 4J95A 3DT1A 2OBJA 2XK8A 3RI1A 4FKWA 4I3ZA 4EJ7A 2FA2A 1A9UA 4JI9A 3F3UA 4EL9A 2B55A 3OD6X 3NS9A 5C27A 1JKSA 3CP9A 3G5DA 3R02A 1KOAA 3SV0A 2WMRA 1Q8UA 3L1SA 4NM7A 4O84A 1AQ1A 4BIEA 4YZBA 5F1ZA 3C5IA 5BVNA 4BDGA 4EK6A 4PRJA 3I7CA 4IJ9A 3E3PA 3IPHA 2YN8A 1IASA 4IWDA 4ASDA 3MIAA 2W1IA 4DEAA 3DTWA 1GZKA 3FLNC 2R3PA 3JY9A 2OI4X 3NAXA 4GG7A 4QMTA 3UOKA 2QG7A 2X2KA 3CC6A 3L8XA 3ZM4A 5CU0A 4KIQA 4QTCA 3MA6A 3SA0A 4C4JA 4LUDA 2YFXA 3MH2A 4KIPA 5CF8A 4F70A 2R3JA 1PKDA 2R3RA 3DJ5A 3R30A 4BCOA 5M08A 3GBZA 4BBEA 4BZNA 1M17A 5TF9A 3RM7A 2QR8A 3FC1X 3QBNA 2CKEA 2F7ZE 3DKOA 2YAKA 3DNEA 4R3RA 4AZFA 4F09A 2Z02A 2JAMA 2OIBA 4YZNA 1ZOGA 4GIHA 4JAIA 2O63A 4JBVA 4ZY6A 5JMSA 1TVOA 4CFNA 4ID7A 1FBNA 3LQ3A 4M97A 2ZJWA 4MXXA 3R0TA 3UQFA 1ZAOA 3KL8A 4O7RA 4TYHB 5AV4A 4QQ5A 3FQHA 4IW0A 2VX1A 3HL7A 3RK5A 4E1ZA 2YEXA 2VD5A 3Q4ZA 3T9IA 4EK8A 2C0OA 3RPYA 5GZ8A 2J5FA 4O7TA 4U40A 5C4KA 2QOCA 4WD5A 4UMTA 3CEKA 3HECA 3CY2A 2WEIA 3ZLSA 3DAEA 1WBPA 3LFAA 5EYMA 3BHTA 3SC1A 5FP5A 1AD5A 1ZOEA 1FGKA 4PP7A 1OM1A 4HNFA 2F2CB 3RM6A 5CAQA 2WTDA 5LMBA 1YWNA 2PZ5A 3EQDA 4BIBA 4NFNA 2UZLA 3DBFA 3Q3BA 5AP4A 3RWPA 5KHWA 3FZOA 4ZMFA 4CRLA 4AW2A 4QYGA 2FGIA 3R00A 3FPMA 2PMIA 1H00A 1ZY4A 2Y6OA 4XJ0A 5CTPA 4RT7A 3VJNA 4L3JA 4C34A 4EKLA 5LCJA 3ZXTA 4BIDA 2PTKA 4KINA 1OKVA 5TKDA 2R3HA 4XV3A 4FSRA 3ROCA 3IK3A 4FKOA 3LVPA 1F0QA 2PWLA 2ITVA 5EQPA 3II5A 3O8TA 5E92A 3NNWA 3R22A 5FTOA 3MVHA 3UYSA 4QMLA 4BCIA 5KUPA 3LCKA 1YDSE 2XKDA 4DH1A 3VQUA 4L01A 2QQ7A 3A4PA 2RSVA 5HLPA 3DU8A 3NZ0A 3UBDA 3ZC5A 2IJMA 3LOKA 4JQ8A 5HNBA 5I9VA 5AP1A 3PYYA 3LLAA 4FTAA 2QOIA 3ACJA 4ZK5A 4IEBA 3K3IA 4FA2A 4NTSA 3RPRA 3IONA 4FNYA 2VTJA 5FP6A 5JSMA 4ZS4A 4YJOA 3ZUUA 3QUDA 3V8TA 3R7EA 4L42A 1R3CA 1J91A 4I21A 4QP7A 2IW9A 4L43A 3RHXA 2XKFA 4N0SA 2WQMA 4W4WA 5DH3A 3UOHA 2QHMA 4EKKA 2GTMA 1KE8A 4IM0A 2XBJA 3OCTA 3TI1A 4RVKA 3UC3A 3PJ8A 1G3NA 1MQ4A 3EYHA 3SRVA 1PMVA 4BTKA 3DOGA 2XYNA 3Q4CA 4EOKA 1U54A 5ETFA 4DGLC 3KRRA 3HMPA 3MH3A 1ZXEA 1W0XC 2FH9A 2XEZA 4H3QA 4QMMA 4QYEA 5J95A 4UZDA 4DGMA 3F6XA 5G1XA 4ZAUA 1BX6A 4ZTMA 1M52A 4YSJA 4KSQA 1P4FA 1XH5A 3LXPA 5DNRA 1FPUA 2ZOQA 4I93A 4CMUA 5C26A 3LQ5A 4O0UA 4U97A 1WVYA 3FMJA 2J90A 4L00A 3ZSGA 2C1AA 3ZFXA 1VR2A 5KE0A 1G5SA 4PWNA 2PUUA 4O86A 2JKQA 3GT8A 3V5QA 4USDA 2UV2A 4KABA 5LOHA 3DTCA 2W1EA 3I6WA 3P9JA 2YM3A 5IA5A 1JBPE 3FYJX 5B2KA 3R8ZA 4USFA 3C0GA 1H07A 5E8UA 3PLAE 4F0GA 5JGAA 4FEVA 3SVVA 4QP1A 5IA3A 1UU9A 2XKCA 1U5QA 3VBYA 1JSUA 5HU9A 2Y0AA 4EORA 4F63A 1YHSA 5HTCA 2VV9A 2W96B 5J8IA 2YIYA 2QO7A 4LGHA 4U42A 3ORTA 3Q6UA 3VAPA 3DBDA 4M15A 3NNVA 5IH5A 4KA3A 4JVGA 4NSTA 2IVTA 4V01A 4OTFA 5IMEA 2PE0A 4JJRA 3ZTXA 1W98A 4R5YA 2E9PA 5ANIA 4FSYA 3F7WA 4FV0A 4JDHA 3CQWA 3DK3A 4MEDA 4ZTSA 3CCNA 3ETAA 4L44A 5HE3A 3PY1A 4EZ3A 4MXYA 3R9OA 5HICA 3GNIB 3PP1A 3QWKA 3V51A 2ERKA 2F7XE 3CS9A 4RPVA 2G2IA 4ZLYA 4QT1A 5AFVA 4NIFA 3OUNB 4EI4A 1M7QA 4GKHA 3PDTA 2IO6A 3HV5A 3BLQA 1J1CA 4O2PA 3GC9A 2I0VA 2VTSA 3R63A 3C13A 3S95A 2C3KA 2C6EA 4C57A 3DBCA 4ZJVA 5TO8A 4AN9A 5GNKA 3QCSA 3WIKA 3AC3A 3ROYA 5EH0A 3Q9ZA 4OTDA 1P4OA 3ATTA 3TUBA 3POOA 4HCTA 4OR5A 2WPAA 3PPKA 5LVNA 4NL0A 3DCVA 4DEBA 3COHA 4UBAA 3WE8A 4ZY5A 4UZHA 2F9GA 2WTKB 3W10A 3G15A 4RG0A 2X2MA 5LMKC 3VBXA 2C69A 4BYIA 2VWIA 3KC3A 2H6DA 3Q60A 2ZYBA 1H1PA 3E92A 1PXLA 3ORMA 4L7FA 2VN9A 3FSKA 5J9LA 1XKKA 4BCPA 3UYTA 5I3OA 1S9IA 3IDPA 2W0JA 4L53A 4FL3A 1OITA 3GC7A 5HBHA 5DN3A 1GIIA 3AC4A 4G31A 5I9ZA 2FSLX 4G6OA 3F88A 1O9UA 1VZOA 3P08A 1PHKA 2F57A 3UIXA 4JR7A 1I44A 4BCHA 3NW6A 1KE5A 4IBMA 2VX0A 4YHFA 3CXWA 3BPRA 3GQLA 3QD2B 4W9XA 3LMIA 2QI8A 1BMKA 3TACA 2WOTA 2YM7A 4MF1A 3UVRA 3GP0A 4R77A 5CNOA 2GNJA 2O64A 3QXPA 4K8AA 1YVJA 5FLFA 4QTBA 2HZNA 4FT9A 4C58A 3POZA 3U9CA 2WMQA 4QQCA 2G15A 5CI6A 3ZUVA 4DF3A 3COKA 3O7LB 3UQCA 2X4ZA 3ZFYA 4X7QA 3OF0A 4JIAA 4OT5A 4FX3A 1L3RE 3Q4UA 4MHAA 5L8JA 5E8XA 5I3RA 4BL1A 3FMEA 1JAMA 3NIEA 3T3UA 3RTPA 2DWBA 2BFXA 2DYLA 4AFEA 4TL0A 5I9YA 2RF9A 4M69B 3P0MA 5J5TA 4C37A 1JSVA 3U6IA 3B8QA 3V04A 4PX6A 1JPAA 4CZUA 3EOCA 2PMOX 2HW6A 4OBQA 1CM8A 2CNQA 3TNQB 4X2GA 1W82A 2JEDA 4CCBA 4I0SA 5T3QA 4EOIA 4FNWA 4TNBA 3HV7A 4Z16A 3PSDA 5A4TA 4O96A 4BGGA 2ITUA 4YBKA 4FTMA 3CLYA 3GUBA 2YA9A 1PXNA 3BIZA 4AQCA 1IAHA 3C51A 3EYGA 2X81A 4UMQA 1BI7A 2W1HA 2J4ZA 5CWZA 4AA4A 3HMIA 5AV2A 5AIRA 2UW9A 4IVBA 4M68A 2XS0A 4KS7A 3S1HA 3MJ2A 2B9FA 2XK3A 5KNJA 2GNIA 2WMAA 3IOKA 5DLSA 3SHEA 4MWHA 1OL7A 2W4OA 4ZJJA 4EH9A 4D2PA 3HDMA 1WAKA 3CJGA 4DFXE 2GDOA 5CLPA 4EH8A 4GKIA 3HV3A 1U5RA 3MFUA 1R78A 4FOCA 2JITA 4RIYA 4MF0A 2VWZA 4S32A 4FSZA 5ETIA 4Y46A 2H34A 4XX9A 2BIKB 3OVVA 3SKCA 4AW5A 3EKKA 4A07A 4A7CA 5IA0A 1J7LA 3HA6A 4PMTA 3DY7A 4JNWA 4DLIA 4UMPA 3I1AA 2BUJA 4GFGA 4KRCA 3UZTA 5C8KA 5HEZA 4XG2A 3QTZA 2IN6A 2C6IA 4RSSA 3IDBA 3NYVA 5HU3A 4D9TA 4B7TA 4Q5HA 1Q5KA 4RX7A 4HYHA 2W99B 3PIZA 4GMYA 4FTKA 2UW3A 5HG9A 4BYJA 5M06A 1OKYA 4WNMA 3PZEA 2J0KA 2O5KA 2E9NA 4NH1A 4HPUE 3QZGA 4AGDA 5EOLA 4I24A 2ACXA 2XUUA 4GFOA 3EB0A 3LCDA 4YTCA 3HMNA 5JK3A 2BRBA 3R01A 5AWMA 3VC4A 3MWUA 4HGTA 2BFYA 3GFWA 4FK6A 5IH4A 5JH6A 4CFFA 2OSCA 5LWNA 3VNTA 3S00A 5DMZA 3OUKA 3QD3A 3ZM9A 1UV5A 3GCUA 4LOPA 4AT4A 1MRUA 2A27A 2BDFA 2HZ0A 2Z7SA 3LFEA 1Q99A 4EH7A 5HVKA 3FI3A 5IQDA 3E8NA 3SAYA 4D0WA 3F9NA 3FV8A 3VVHA 4CZYB 1XH4A 2E9OA 3OW4A 5IEVA 1WVXA 2WMVA 1K2PA 3K2LA 3NUYA 2A0CX 1R0PA 5C8MA 4E20A 1YDTE 4ACCA 4EK4A 1YDRE 3L8PA 4I22A 4O0SA 5JQ5A 3FMKA 3VUIA 4JX3A 1PKGA 1QPDA 2V7AA 2H96A 2ZM3A 3M42A 4NW6A 4QRCA 2IZRA 4QNAA 2ZMDA 3L9NA 4F99A 3MTLA 4FZ6A 2ZB1A 3R8VA 4O0RA 5A4CA 3D5XA 4MQ1A 1IR3A 3MW1A 2BAKA 4R1VA 2WQBA 3MS9A 3PLSA 4DFZE 2YCFA 3FL4A 2GPHA 2HWPA 3G51A 4U5JA 1VYZA 3GI3A 4RIWB 2IWIA 1ZZ2A 2R0UA 4IB5A 1PXPA 2BRGA 2GNLA 3IW7A 4YLKA 3BBWA 4F0FA 3R7GA 2QOHA 2I1MA 4LYNA 1Q4LA 1NA7A 3OY3A 1E9HA 4JDJA 3GU4A 2OIQA 2YABA 3JUHA 4HVSA 1WBVA 2XIXA 4F64A 3D83A 4L6QA 3EL8A 3TZ7A 2GU8A 5GIOE 1MRVA 4R5SA 4S31A 4ZIMA 3BQRA 3BYVA 3U4WA 2Y6MA 4EZ7A 3W33A 4P2KA 2JBOA 2R3NA 3NNUA 3QD4A 3KF4A 2JKOA 4H3BA 3TNPC 3BLRA 4OBOA 2VTRA 3NUPA 3O96A 4FTUA 4G5PA 4XCUA 4CKIA 4E6QA 4DFLA 5IF1A 2BKKA 1Q62A 2R4BA 3L8VA 1R39A 4AGUA 1JQHA 5LXMA 4FTTA 4HGSA 3LM5A 3UNJA 1YW2A 2VWWA 3LFQA 4G3FA 4WT6A 3FHRA 3UDBA 4HVHA 2QD9A 4DFBA 4MTAA 4AN2A 3JVRA 1U4DA 4FZ7A 1Q8YA 2CPKE 2HZ4A 2PZIA 3AT2A 4NJ3A 2GFCA 2ETMA 2XK6A 5FM2A 2CLQA 5ETAA 2B54A 4C62A 3BKBA 3F3TA 3OT3A 4F9YA 4D2SA 3D14A 5BX0A 4ONAA 2F4JA 2XJ1A 4UB7A 5AP0A 4HVGA 5F4NA 3I4BA 4ASXA 4TYEA 4AE9A 3FLZA 4YNOA 2R3FA 3U51A 4V04A 4UWYA 4BRXA 3UJGA 3QX4A 5J9ZA 4AF3A 5L3AA 4ASEA 5DYJA 2BHEA 3EH9A 4YZCA 3I79A 2RFDA 5AP7A 3AC2A 5CEQA 4AACA 3R8MA 2YM4A 3E7OA 4MXZA 5L4QA 4BR3A 3FLWA 3FUPA 4LRMA 4WG5A 1PXMA 1UVRA 4FTQA 5HCXA 5JZNA 4H36A 4RZVA 5CYIA 3FZPA 4O7WA 1CSNA 4JAJA 5AR8A 5DE2A 3R7VA 5TE0A 2PE2A 5IISA 3U55A 4QP8A 2BPMA 4IZ7A 1ZRZA 4R3CA 2VWYA 4O7SA 2ZV8A 2I40A 2VAGA 1PXOA 3KGAA 5AA8A 3PXQA 3FPQA 1OKWA 3BYOA 3TV7A 4YPDA 3E8DA 3P7AA 3NX8A 4NW5A 4IC8A 3N51A 5CU3A 1YI6A 2JDSA 4TKSA 2JDTA 2X9FA 5AR3A 3ENHA 5BMMA 4CT1A 5CF4A 1W7HA 5IA4A 3DLSA 4HCVA 5EYKA 5AMNA 2KTYA 2BKZA 5LVLA 4FT3A 1ZMUA 5HD7A 3TNHA 2JAVA 3SGCA 5EK7A 4FIGA 3THBA 1B38A 2GNHA 2HWOA 2ITTA 4DBNA 5KKRC 2PPQA 5CEIA 3D15A 3E8EA 3CPBA 3QQUA 2PUNA 3QLFA 5KMOA 5BUEA 4CFVA 1OUYA 1PRYA 2QLQA 4P4CA 3R7YA 3AMBA 1ZYDA 4FI1A 3DS6A 2ZV9A 1SVHA 1F5QA 3OMVA 4IM3A 4WBOA 4QTEA 2R64A 2Z7LA 4EH5A 4DE4A 5EW8A 5DBXA 4QYFA 5H8GA 3VQHA 3QRUA 1WBTA 2VNWA 5I9WA 5JZJA 1Q3WA 3PXRA 2BRNA 3HDNA 2HENA 3BEAA 3WZJA 1GIHA 3JYAA 3Q04A 4PP9A 4IANA 4FSNA 3DB6A 5GHVA 2WTIA 2ZVAA 3WZDA 2Y4IC 4CV8A 3ORNA 1DM2A 4OW8A 2GHMA 4YZDA 2XNEA 4CEGA 1IG1A 2WMSA 3V3VA 5ANEA 5IQIA 4TWNA 2Z8CA 1OIQA 3VS3A 4EHZA 4CVAA 5J1VA 3BQCA 4BDBA 2RFEA 4G9CA 3A7GA 5DIAA 1ZLTA 4FT5A 4I92A 5EKOA 3QKLA 3RP9A 3DK7A 4M67A 4RA5A 4MKCA 2IPXA 2PUPA 4DEDA 3NYOA 4I20A 1P5EA 4J8NA 2DQ7X 3QYWA 3B2WA 3LFSA 5EHLA 2YACA 4F1TA 3E64A 2QOLA 4I4FA 4FTCA 4GRBA 5DT0A 2R3QA 4BCJA 4OTRA 2QVSE 4WOVA 2HELA 4AFJA 3G0EA 4MCVA 3HAVA 3MY1A 4FKLA 2BILB 4ALWA 4E4NA 2B52A 3MIYA 5M44A 3AD5A 4EOJA 2PU8A 3H0YA 4YC3A 4DTBA 3AT3A 1NY3A 2ZDUA 3TV6A 4BDEA 1EH4A 4IADA 4FZFB 4MXCA 4R6VA 2C0IA 5HZNA 2G1TA 3OWLA 2NP8A 3IW5A 4DLJA 1SVEA 1XQZA 2VTMA 3KEXA 3KRWA 4K77A 5LVMA 5IQHA 1VEBA 5B2MA 4HYUA 3VS2A 4QYHA 3F61A 3CQUA 2JLDA 4JBQA 3TKHA 4DG2E 4F4PA 3TDWA 5DFPA 1Q97A 3SXSA 4UV0A 3G6GA 4FZDB 2JDRA 5FDXA 3PA5A 4AZWA 4H1MA 3EHAA 5AR5A 2YJRA 2C3JA 3EQIA 3BU3A 4BWKA 4PPCA 2PSQA 4H1JA 5C9CA 1DAWA 4FKJA 4HOKA 4L3PA 2BDJA 3F69A 4DT8A 4TW9A 4L68A 3DA6A 4D28A 5IDNA 4APCA 4KAOA 3Q9XA 4XRLA 4FC0A 1APME 2WGJA 3RAHA 3TJDA 4M3QA 4KSPA 5DT3A 1IA8A 2YIQA 3SOCA 4QTDA 4BGHA 3MJ1A 5L2IA 3GGFA 2CGVA 5DEYA 2CHLA 4QMUA 4MD7E 3QAME 3C9WA 5DOSA 3TG1A 2XIKA 3SXRA 3ZO3A 2UZEA 3H30A 2WTWA 2PZYA 4FYOA 5IQGA 2BDWA 5LJJA 3TWJA 1MUOA 2BVAA 2PVHA 2VTQA 5CSWA 4FUYA 4QPAA 3VRYA 3R71A 4RFZA 3ORLA 4RIXB 1OL5A 3NAYA 3BHYA 3U4UA 4C2VA 3E3BX 5HLWA 1Z57A 4ZZNA 3D9VA 2X9EA 5EDQA 2XJ2A 3DXPA 4I6HA 4XV2A 3V8SA 3PJCA 5AM6A 5H9BA 2X39A 4KKHA 3ZSHA 4YC8A 4D2WA 4UEUA 2X6DA 4WNOA 4PPAA 3T8OA 3VUMA 3TCPA 3MH0A 4EZ5A 4AT3A 3B2TA 3WILA 2ZM4A 5IPJA 4NFMA 3OC1A 4WG3A 3KXHA 5HVJA 4ALUA 1OI9A 3LLTA 4FV9A 1KV2A 3WZUA 4FGRA 4IJPA 2YLEA 2ZDTA 4TXCA 4BCNA 4DEHA 2FB8A 4J71A 2HXLA 3O0GA 4BF2A 2C6TA 3NCZA 4FOBA 5B0XA 1PY5A 5L2SA 2BZHB 2X8IA 2VTLA 2PVFA 3HV4A 5E8WA 3FMDA 3NLBA 3OZ6A 5ACBC 4Q5EA 1UU8A 4ZSGA 3KN5A 4F9WA 4K9YA 4U45A 3QTXA 4I6QA 4N6YA 4IB0A 4IAZA 4FZAB 1H26A 5KZ0A 3FI8A 1LEWA 3PXZA 3DKFA 4CMOA 4FYNA 4DCAA 3GCQA 3GU6A 3OFMA 5JN2A 4Q9SA 4BCGA 4ZLOA 1SVGA 4OAUC 2W4JA 2VWXA 3PY3A 4FIIA 2HK5A 4F6WA 1W8CA 3UZRA 1H1RA 1ZYSA 4FKUA 3TZ9A 4EC8A 4DITA 3FZSA 4E6DA 4BDHA 2YM6A 4AWIA 5HBEA 5CANA 5E8YA 2GS2A 4EYJA 1YOJA 4XS2A 1OIYA 3W2CA 4MD8E 5IUIA 4YR8A 1Q24A 2RG5A 4EHEA 4FVQA 3TXOA 4X6QC 4C8BA 3NDMA 2X1NA 4D2VA 4WHZA 1YWVA 4J97A 3RK7A 4BI0A 4B6LA 2CGWA 3G6HA 4WKQA 3CTJA 2O3PA 4ZTHA 1UKHA 2F49A 4A9YA 4EOMA 3UOJA 2XIRA 3KMWA 3D7TA 2JC6A 5DRDA 4CD0A 3CKWA 5D41A 4GCJA 3UMWA 4NKSA 1Q8TA 3EN7A 5BUIA 5J7BA 5LVPA 4O81A 5HNIX 5FG8A 4L7SA 3IS5A 3R9HA 4FSMA 2YLFA 4L45A 2QOQA 4M7IA 3F66A 2FYSA 5HD4A
chains in the Genus database with same CATH superfamily
4QP4A 2WEVA 4ACMA 1OIUA 2QG5A 2UZWE 3FI2A 3OBGA 3O17A 4U80A 4IMYA 2OZAB 4AOTA 3MVLA 3MPMA 3AMAA 4ZLZA 4O2ZA 4B8MA 2B53A 5HKMA 3VS1A 3CE3A 3ZUTA 4R1YA 3C4ZA 2OJGA 3BWFA 4QO9A 5HORA 1GIJA 4Z7GA 2VO6A 3PUPA 3QWJA 3AT4A 3FY2A 5J5SA 5FWKK 3ID6C 4C4GA 1FINA 4D5HA 3GC8A 2O0UA 5TOZA 3R2BA 4WA9A 4FBXA 3LFFA 2QURA 3BI6A 3OXTA 4PNIA 4X3FA 4GT5A 4C33A 4E5WA 3QC4A 2C4GA 2VO3A 4D4YA 2B0QA 5IEYA 4IZYA 3R8LA 5JFVA 4HYIA 4D55A 5FDPA 5FTGA 3TDVA 3LPBA 1OBDA 2C5YA 3Q32A 5HGIA 3ANRA 3Q5ZA 3DKGA 3AXWA 3BBTB 4S34A 4ZJIA 4M69A 4IHPA 3RJCA 3ZDUA 3W2RA 1FGIA 3GVUA 2ITWA 2P55A 4I0RA 4O27B 4O0TA 3ZLWA 4CMTA 1WVWA 4WNPA 1WMKA 3K5VA 3QGWA 4YJSA 4GUEA 5BNJA 2XNGA 3ULZA 4F6SA 1AGWA 4HJOA 3QTSA 2ERZE 4CFUA 4EUUA 5E1SA 3C5UA 5EW3A 5DWRA 3HNGA 3UNKA 5I9UA 1Q61A 4UWCA 5E8ZA 3UNZA 5CT0A 4ZY4A 3BHVA 3HP5A 2JD5A 3PZHA 4KRDA 4C02A 5ICPA 3KIOC 4RJ3A 3D2IA 3PVGA 3UO6A 4ZOGA 3GXLA 3F2NA 5T68A 4M84A 2HY81 2OZOA 3PIYA 1O6KA 3P7CA 3PVBA 2BAQA 4I5PA 3WI6A 4GK4A 3FSFA 1BLXA 4ANBA 3OEZA 3Q5IA 4WIHA 3BU5A 2OJFE 2J50A 3MY5A 3KMMA 3GEQA 1JKKA 1Q3DA 3UTOA 3QFVA 3M1SA 3LFDA 4CCUA 5BVKA 3AC1A 4IC7A 4YURA 1ST4A 4E93A 3SQQA 2EB3A 3VS7A 3ZFMA 3QTIA 4DGNA 4WG4A 4F7NA 4DG0E 4BFMA 5HG7A 5AR4A 5IQFA 3OCSA 4LOQA 2UW7A 4DEIA 3QRJA 3VONA 2PZPA 4EWQA 2PMLX 4Z55A 2NRUA 2CNVA 3H0ZA 5CU6A 4BKJA 5C4LA 3E62A 4FR4A 4FV1A 4HCUA 3RGFA 4A4XA 4A9TA 2WB8A 4X3JA 4P7EA 3ZO2A 4BI1A 4IX6A 3BHHA 2P33A 4AZTA 4E6CA 5KMKA 3TJCA 3CBLA 3FLSA 4GJ2A 5L6WL 3DXQA 2XNPA 2UW5A 4O1PA 1X8BA 3KFAA 2X4FA 3NW5A 4F9BA 2GQSA 4YO6A 3R7IA 3FY0A 2X0QA 5EM7A 3KK8A 3ORXA 2BTSA 3TT0A 2W1CA 4K0YA 2XJ0A 3AQVA 3MPTA 4XEYA 2Y7JA 1PW2A 4NT4A 5CXHA 4EYMA 4MBIA 5HHWA 3GOPA 1RDQE 3DPKA 2VO7A 4BBMA 3VS4A 1GZNA 4GSBA 4K2RA 5BQ0A 3ZO4A 3EFWA 4LRKA 4X2NA 5LWMA 3N4TA 4BWPA 3OHTA 1REKA 2B9JA 2YM5A 4G5JA 4WBBB 5CVHA 2C47A 3MN3A 5IQAA 2OICA 3EFJA 1FMKA 2IEWA 4RWKA 3C4EA 2CNUA 3FHIA 3WZEA 2A4LA 3GENA 3BWJA 4RBLA 3KRJA 4UY9A 1TQIA 2W9FB 5JT2A 3L9MA 4FV5A 4JQ7A 3MY0A 2P4IA 5FQDC 2PVMA 3HUBA 4QMPA 3FMHA 3VBTA 4MH7A 3W18A 3FKNA 3QQKA 1PMEA 3ZDIA 1RJBA 3KCFA 2YCRA 2NPQA 4IZ5A 3PA3A 4RVLA 5CF6A 4BHNA 4C38A 4JDKA 4PL4A 4UWBA 1YI4A 4X2JA 3SD0A 5HQ0A 5AUWA 4O82A 4QQJA 5HCZA 5M4FA 3JVSA 4O38A 1FVVA 2J0IA 2W1DA 3I0OA 4E6AA 2NRYA 4FTJA 4ZP5A 4I0TA 5CAOA 3LJ0A 2W06A 3WYXA 3BYSA 4EK3A 1A48A 2XVDA 2CLXA 5A3XA 3DDQA 2UVZA 5D1JA 2GNGA 4AN3A 1H8FA 4ERWA 2QU5A 4D2TA 4FG9A 4CTBA 4RIWA 4KB8A 1JKTA 4YTHA 5HX8A 4IB3A 4ANMA 4I23A 4YTFA 3NGAA 5AA9A 4IFGA 4YLLA 1SMHA 2JFMA 4G6LA 3O7LD 2EUFB 5AP5A 4AOJA 4DAWA 1YOMA 3TZ8A 4U41A 4BDDA 4AXFA 1NVQA 2V7OA 3C4FA 2VX3A 5CI7A 2C5XA 2YCSA 5D7AA 3P7BA 3HRBA 3TUDA 3V5LA 2PULA 2XNNA 5EYCA 1LPUA 4ITHA 2WMTA 3ZCLA 2WKMA 4I41A 1XBAA 5FUTA 3RHKA 5JFWA 3R28A 3C1XA 2E2BA 4GS6A 4C4FA 1UA2A 3PXKA 5EM8A 4E5BA 4C4EA 2JFLA 3KK9A 5L2TA 5HNGA 5CU2A 3TNIA 1Z9XA 5EKNA 1U54B 3HVCA 4RQVA 4CRSA 5AV3A 4R78A 5E8TA 3PFYA 3HX4A 4JBPA 4IAFA 2NNWB 3AGMA 4JXFA 4QMWA 5IMXA 2X7OA 3EQFA 3RMFA 4EH4A 4BB4A 1URWA 2GTNA 2R7IA 3EN4A 1J7IA 4RQKA 1JLUE 1RW8A 4XLVA 4H05A 5HBJA 4MNEA 4X6RA 3CQEA 4XUFA 4XBRA 3NFGB 3TKIA 3RVGA 3UVQA 4CGAA 2IVSA 3PRIA 2VTAA 2QC6A 2Y8OA 5M57A 1UWHA 3MESA 1RE8A 2GHGA 3JS2A 4MYGA 4DH3A 4CFXA 4OTPA 4U43A 3R8PA 2QKRA 2BAJA 2C1BA 4TZRA 3ULIA 2ZB0A 3MVMA 5CQWA 5GZ9A 1KSWA 2C3LA 2XF0A 2BIYA 4E4MA 2PE1A 4IX3A 1K9AA 1Q8WA 5FEDA 2OFVA 4NEUA 1LEZA 3D5WA 2WXVA 4F08A 3WIGA 2GFSA 3K54A 3OWKA 3RPVA 2WIPA 4FKIA 1PMUA 3VBQA 3R9RA 3PRFA 4AE6A 2A2AA 4I5MA 3LQ8A 5E8VA 1GZOA 4CZTA 2XCKA 3EMGA 2YCQA 2R0IA 4LI5A 2FSOX 1I09A 3CSVA 1CMKE 4IWOA 3B8RA 4BDFA 4G3DA 2XZSA 4U44A 4CXAA 3I6UA 3PWDA 1H1WA 2PYWA 4RLLA 3VUDA 3MTFA 3A4OX 4ERKA 3S3IA 2J0MB 3VWAA 3BEGA 4ZEGA 2BRMA 4LG4A 4ORKA 2X2LA 4IWQA 4L8MA 4NIFB 4KIKB 5K3YA 4FKRA 2IZTA 2QU6A 2J51A 3HP2A 3PE2A 3DFAA 3QCXA 4GFMA 4I6FA 3VHKA 3Q2JA 2CMWA 3FAAA 4FKVA 1RQQA 2C5VA 2CN8A 3LFBA 4NKAA 5C8NA 1DI8A 4R7HA 4EOLA 3OY1A 4FIHA 4H39A 5FM3A 3IDCA 3LM0A 4ANNA 4D1SA 2GS7A 3MV5A 3DKCA 3UGCA 4O7NA 5DA3A 4XBUA 2OH0E 4OTGA 4DCEA 2QCSA 2XALA 3QU0A 1WFCA 3UVPA 3VUHA 2Z7RA 1WCCA 4B99A 4HVDA 1QL6A 3M11A 1SZMA 4UMRA 2DUVA 4JOAA 2OFUA 2W17A 1IA9A 4JDIA 4X2KA 4C61A 2HZIA 2EB2A 4IB1A 3F5UA 4BI2A 1YXVA 4EONA 3KVWA 3DDPA 2X0OA 4D4RA 3ANQA 4L3LA 2Y4IB 4F7SA 4Y83A 2YJSA 4O6EA 3QC9A 2Y9QA 4DHZA 5CEKA 3EQGA 5KMLA 2WELA 2WTJA 3ACKA 3FQSA 4FEXA 1YXTA 2C0TA 2ITYA 2C6OA 5FXSA 1NXKA 3HGKA 3RWQA 4ITJA 2E9VA 3ZO1A 3LXLA 4I1ZA 3E93A 3R83A 5HESA 1OGYA 2JKKA 1OB3A 4O91A 3T3VA 2PVJA 3HUCA 4U9AA 3MA3A 1T45A 3QRTA 3C0HA 4FV7A 2YZLA 1WBWA 5D10A 3QHRA 4TWPA 4XG6A 2PL0A 3NNXA 2I0YA 2WD1A 3RAIA 4EHGA 4PMPA 4R8QA 2PVRA 3CTHA 3PXYA 3BELA 4V0GA 4IAKA 3W55A 3GC0A 2C30A 3NPCA 4G9RA 4U79A 4EBVA 5KMNA 4JR3A 4IM2A 4FSWA 4FV4A 4FKTA 4X3FC 3N4UA 3TNWA 3SW7A 4FV8A 1FVTA 3UO5A 5BV3A 4RJ8A 4WRGA 3ZLYA 5A46A 2JDVA 4RJ4A 4QP9A 4GVAA 1J3HA 2OWBA 3R1NA 3WBLA 2PZRA 4BBFA 2HXQA 5CZIA 2HIWA 3VW6A 4KS8A 3VUKA 3O5AA 3R1YA 4XV9A 4DEGA 4LMUA 4W4YA 2ITZA 2OF2A 1DAYA 3M2WA 3ODZX 3QZHA 4OTIA 4M66A 5FEQA 2BZIB 2ETRA 2J0JA 3ZU7A 5FBNC 4CT2A 5J79A 4BDAA 3VS5A 3QD0A 4K1BA 4Y85A 3U6JA 2ONLA 2Y4PA 3I0QA 3SX9A 2YWVA 3W16A 2CGUA 2XCHA 2PMNX 1LR4A 5L2WA 1R0EA 2ZM1A 4JQEA 4YU2A 3NUAA 5DHJA 4TN6A 4DTKA 4AZSA 1H0WA 2W5BA 1JKLA 3D4QA 1H1QA 1VYWA 3QGYA 2WMUA 1PXKA 4BTFA 4HW7A 1YXSA 3H9OA 2GMXA 2UVYA 4AAAA 2ITNA 3QZFA 3LJ2A 4BCKA 5M4UA 4M14A 4MXAA 2J6MA 2X0GA 4C7TA 3EFKA 5LCKA 1B6CB 2O8YA 3V5WA 4DYMA 4FKSA 3FZRA 1YKRA 5CNNA 3ZLXA 3EQCA 2EXMA 1P2AA 2LGCA 3ORPA 4LV5A 4YSMA 4CG9A 4JG8A 3O71A 1QMZA 3EQPA 2WU6A 2R2PA 2XM8A 1H28A 5E91A 3W2PA 4ALVA 4CYIA 4JG7A 1E1XA 1L8TA 3V6RA 5GZAA 1W2FA 2XKEA 3IW8A 4ZSEA 3NVMB 5AAGA 4K33A 3LFCA 4Y73A 3KCKA 2UZBA 5CEMA 1V0OA 2QOBA 3HEGA 4FKQA 3UQGA 4W4VA 4OAVB 3Q2MA 1GOLA 2QODA 1BUHA 4AUAA 2BZJA 1OIRA 4IZAA 3CTQA 4GIIA 2VGPA 5JRSA 3RBWA 2XYUA 3BV2A 2WTCA 5AUVA 4DGOA 3NIZA 3ZBFA 4WSQA 2UZNA 3ZEPA 1GNGA 2G2FA 2WMXA 2GHLA 4AAYA 3LMGA 3AC5A 3GB2A 5DR9A 1BI8A 3L9LA 4PPBA 2ESMA 5BMSA 2J2IB 4H3PA 2OF4A 2WMBA 2X8DA 1LP4A 4FIEA 1TQMA 3QA0A 1Q8ZA 3BCEA 5L8LA 5K4IA 3WF6A 3PJ1A 5D7VA 5ANOA 3ZSIA 5EM5A 4OLIA 5I9XA 3REPA 3DQXA 4IAAA 1URCA 4MBJA 1ZARA 3DAJA 5HVYA 1Q41A 2A98A 3FE3A 4GW8A 5M55A 1GY3A 4B8LA 1PF8A 3CGFA 3DNDA 4D58A 4M13A 4Y72A 3BE9A 5FTQA 2VUWA 5M4CA 1BKXA 4IQ6A 4E4LA 4TYHA 4AGCA 3PJ3A 4L46A 3FMMA 3MFSA 3UOLA 2OJIA 3H10A 1ERKA 2X6EA 3NYXA 3R7UA 4CLJA 1UKIA 4C3PA 3R7OA 5HO7A 4FVRA 5EHOA 4PL3A 3VO3A 1YHVA 2OU7A 5HIEA 1ST0A 2NYAA 5DGZA 3RPOA 3RPSA 4GU6A 5HE0A 4USEA 4BCFA 4X21A 1YRPA 5FRIA 2VU3A 2HY0A 3A8WA 3NWWA 4GVJA 2BR1A 4G16A 4K11A 4RVMA 3W2SA 2F7EE 4CG8A 4MQ2A 2ZV2A 4HYSA 5AAFA 4AA0A 2CN5A 3Q52A 3TTJA 3U54A 3KVXA 3EFLA 3O50A 3QTRA 3PA4A 4FIJA 5AAEA 2Q0BA 2X7FA 4UYAA 3VBWA 1KUTA 3A62A 4EK5A 4ENXA 2QHNA 4AU8A 2EVAA 1H25A 5JEBA 2VTTA 2FVDA 3EIDA 4S33A 3HMOA 3W0SA 1XBCA 1W84A 4HVIA 3QQHA 2R3LA 2J9MA 5DG5A 4MVFA 3QUPA 3V5TA 3D5VA 4FTLA 3QALE 4TYGA 2H8HA 4Q2AA 3WYYA 5IEXA 2XM9A 4FT0A 4YJPA 1YI3A 4W8DA 4Z3VA 5FXRA 1TQPA 2AUHA 4AX8A 1XH7A 4G1WA 4GV1A 2UZVA 3F5GA 3ZOSA 3D94A 5T6KA 2QOFA 2BHHA 4C3RA 4APPA 3PJ2A 2R3IA 5DR6A 2OZAA 4RC2A 3UPXA 3U87A 2PK9A 1UU3A 4Y5QA 2OXXA 3OS3A 5FXQA 3RNYA 3ZEWA 2WIHA 3C50A 3SXFA 1QPCA 1Z5MA 5IZFA 2UZUE 4FV3A 4DGGA 4OTQA 4XP2A 4RLKA 1W2DA 3FZTA 4RWJA 4ZTQA 4QNYA 3NW7A 4W4XA 2GQGA 3DLZA 4YJVA 5M07A 4U3ZA 3FYKX 4CNHA 2AC3A 3S4QA 1H1SA 2C6LA 3NUSA 3QRIA 4PDSA 3OT8A 3NR9A 1OGUA 5AP2A 3VS6A 1OECA 3DXNA 1WBOA 5AJQA 2OW3A 2CKPA 4PDYA 4QMYA 4QMOA 3KA0A 5KO1A 3DZOA 1TKIA 2X8EA 2YITA 3LXNA 3MB7A 4O0WA 4RJ7A 5CSHA 4FSQA 2QKWB 3QA8A 3O51A 4D9UA 1IEPA 2RL5A 4QTAA 1CKPA 4I5HA 4BDIA 4ACHA 2IZSA 3AKLA 4YZMA 3SLSA 5ACKA 4XG3A 5LARA 3VULA 4EH3A 4R7BA 3RK9A 4N57A 4CSVA 4W8EA 1WBSA 4FUXA 4XG7A 4Y5HA 4EUTA 4RIOA 2QOOA 4M0YA 2B1PA 3D5UA 3QQLA 3UODA 1XO2B 4AS0A 3V01A 2VO0A 2ETKA 2IVVA 3F3WA 5FD2A 4A4OA 3HZTA 2XP2A 3R9DA 1UNLA 4E4XA 2OH4A 3COMA 4FSTA 1XWSA 3VHEA 3EJ1A 3IKAA 4EQCA 5BVFA 4XLIA 5BVDA 4PTGA 1MP8A 4ZS0A 1J7UA 3EKNA 4RJ5A 5F94A 3FXZA 5HG8A 2WFYA 4IDTA 4QQTA 4FL1A 3Q96A 2RFSA 3AC8A 3QQGA 4IFCA 5E1EA 4DFUA 4TYIA 3IG7A 3EQRA 3UO4A 3UP7A 1DS5A 2HAKA 3P78A 5K9IA 4MAOA 2C6KA 4IE9A 3SG9A 4DHJA 5G6VA 3NRMA 2UVXA 3WF5A 3A7JA 4GT3A 4D5KA 5HOAA 1MQBA 4BWXA 3Q9YA 3R1SA 2XK7A 2AC5A 3QTWA 3SOAA 3EZRA 3Q6WA 2NO3A 4JG6A 2HOGA 3D0EA 3OG7A 4AZVA 4YGAA 1NW1A 4DEEA 2BALA 4GU9A 4U8ZA 3R73A 5AUXA 2LAVA 5DVRA 4E73A 4OTWA 4AOIA 3F3ZA 4FG8A 3BZ3A 4FVPA 1BL6A 2W1ZA 3LFNA 4DHIB 3ENMA 2PVKA 3F5XA 3MFTA 2F2UA 2OGVA 4RVTA 4ZSJA 3UC4A 3ZRMA 4Z7HA 4RFYA 4TT7A 3TIYA 4FG7A 3G33A 2ITQA 2XH5A 3NVKI 3VN9A 2W5HA 5HIBA 2DS1A 2QO2A 4OBPA 3V5PA 5IDPA 4QP2A 4G34A 5ANDA 3KULB 5AX3A 4B4LA 3DK6A 5AUZA 1U46A 4XP3A 2WNTA 4DFYA 4O4EA 3RAKA 5A6NA 2OLCA 3MB6A 2XNBA 3OTVA 3WZKA 4GYGA 4M8TA 1XH8A 2GNFA 4FF8A 1J1BA 4ANSA 4ACDA 2VGOA 3MYGA 1GAGA 4FEUA 3VRZA 3PG3A 5K0KA 2PVYA 4X2FA 4RGJA 4YMJA 1O6LA 2YDKA 3ZRLA 4PV0A 3IOPA 4F78A 4TTHB 5CEPA 5J87A 2R3OA 4NUSA 4YO4A 2JGZA 3H9FA 2OXDA 3I81A 1SM2A 4QP3A 4TWCA 3PY0A 4QD6A 5L8KA 4XH6A 4JIKA 1SYKA 3EN5A 3A7FA 5BVEA 3HA8A 4TNDA 4XYFA 3BGQA 5DR2A 4D4VA 5HE2A 4D1ZA 3O2MA 4I94A 1JNKA 5AUYA 3RAWA 4C35A 4DH8A 4KBKA 4F9CA 1PXIA 3VUTA 4PMMA 3ZRKA 4E5AX 1F3MC 5JGBA 2ZFYA 3IGGA 1IRKA 3D7ZA 2CJMA 3F3VA 3ITZA 3UIUA 3ZZWA 4BDCA 4TY1A 1FOTA 2WO6A 3R6XA 2GQRA 2WAJA 3V8WA 3F2AA 4UMUA 3FMLA 3BX5A 4ANLA 5CSVA 3UE4A 2GSFA 2XB7A 2AQXA 3HLLA 3PSBA 4BGQA 5JFSA 3W32A 1H01A 2YDJA 3PUFC 1UU7A 5E90A 3FWQA 1XBBA 3PVWA 3COIA 3LE6A 2ONLC 4GT4A 3NSZA 4O83A 4FKPA 3BU6A 4L67A 4V05A 3KQ7A 4QPMA 2VNYA 2QOKA 2EXEA 4AT5A 5IH6A 2Z60A 2OK1A 3LW0A 4IWPA 3ALOA 5KBQA 2V0DA 1GJOA 5C01A 5L6OA 3PPJA 2UW6A 2YERA 2B4SB 3FZ1A 4RC3A 4BN1A 4RWIA 4J8MA 5L2QA 1OL2A 5EM6A 3U8WA 1H0VA 3ODYX 4LFIA 3PPZA 3G9LX 4IXPA 4PTCA 3P5KA 1ZWSA 1Y91A 1YQJA 1T46A 2WTVA 3FXXA 3OEFX 4ANOA 3EQHA 4FRFA 3FDNA 2YISA 3NUXA 3R21A 3N4VA 4NZWB 3OOGA 3BYMA 4WUAA 3BYUA 2XRUA 5DEWA 4C36A 4IVAA 3PSCA 4BTJA 4YJNA 4FSUA 2V22A 1PYXA 4BZDA 4CKRA 4JMQA 3FXWA 5FBOA 1H27A 1PJKA 2W4KA 3Q53A 3IGOA 3OW3A 2J7TA 3CIKA 4UXLA 4YTIA 4UN0C 5H3QA 3I60A 4C0TA 1NT2A 3NMUF 4F1OA 1JWHA 3HYHA 1G8SA 5AR7A 5KMMA 1KWPA 3ALNA 3JPVA 3MH1A 4GUBA 5D11A 3ZZEA 4ZZMA 4G3GA 1U59A 3CGOA 2YAAA 2IZUA 2OKRA 5IUHA 3PXFA 4QMXA 5IKWA 3ZHPC 3QQFA 3GU8A 4XV1A 5HO8A 2Q83A 4UALA 1QPJA 3H9RA 3D2KA 4TPTA 4QMVA 4E26A 2CKQA 2ITXA 3FC2A 4FTNA 4PY1A 3TKUA 3WE4A 3HV6A 1V0PA 4CQEA 3P1AA 3OXZA 4HGLA 5CSXA 4KUJA 2QLUA 1JOWB 2YZAA 3VUGA 4BKYA 1JVPP 5K0XA 5AV0A 4PQNA 4DC2A 4O7VA 2HCKA 1YHWA 3FKLA 1H4LA 5BYYA 3FLYA 4TWOA 2I7QA 1NVSA 3U6HA 4EH6A 3TIZA 1E1VA 3K5UA 4MXOA 4FMQA 3W8LA 4KIOA 3OOMA 3OWPA 4LM5A 4YPSA 2FO0A 3TN8A 4CTCA 3W1FA 4PUZA 4EOPA 5JFXA 4XRJA 4JLCA 1R1WA 4D0XA 4MBLA 3C0IA 4S30A 5HO6A 3P79A 4KIKA 4LGDA 4FV2A 5ANGA 5HCYA 5C03A 2HYYA 2OXYA 5GIPE 2G9XA 4IIRA 1TZDA 4KD1A 4PTEA 3CY3A 4CFWA 5HTBA 4JT3A 4KWPA 2VTOA 5AR2A 5TR6A 3NEWA 3UP2A 1JSTA 3KXGA 2R5TA 4Z9LA 3ZXZA 5A4EA 5EQYA 3A99A 3LXKA 4A9UA 3O8PA 4FEWA 4FTRA 2W1FA 3AGLA 4L52A 5CF5A 4J53A 4ZTRA 4O1OA 1LUFA 4RRVA 3FQEA 4PF4A 4XG9A 5CSPA 2QONA 4ENYA 5A54A 4FL2A 3KXXA 3JR1A 4KBAA 1FQ1B 3ELJA 3I5ZA 5ANKA 4BHZA 5KHXA 2BROA 3GQIA 4MD9E 3WOWA 4BDJA 3FLQA 4YJQA 2Q0NA 3QZIA 2P3GX 4YBJA 1G8KA 3GCVA 5BYLA 4GYIA 3KF7A 4OT6A 5J7HA 3OTUA 1QPEA 3VIDA 4QMZA 3QLGA 3D7TB 5DPVA 3O8UA 3P86A 4QP6A 3MI9A 4JS8A 3TMOA 2CKOA 5AP3A 2ZV7A 5IUGA 4O7YA 4XG4A 1BL7A 4J98A 3FBVA 3TM0A 4FTIA 2GS6A 3E87A 2RIOA 3MGYA 2UW0A 2WQNA 1ZY5A 3LJ1A 3OWJA 4O21A 5AIKA 4HNIA 3TZMA 3SDJA 1FMOE 1WBNA 2W9ZB 3LIJA 5CAUA 3EN6A 5HG5A 3A7IA 3LKMA 1YOLA 1UWJA 3QYZA 1BYGA 2O65A 4TRLA 3KMUA 3IW4A 4FIFA 2UZOA 3RALA 4F6UA 5KBRA 2XNOA 4JBOA 4GJ3A 1REJA 3LZBA 3PP0A 4X0MA 4IH8A 1OVEA 2PUIA 3EZVA 4B0GA 4YNEA 5KCVA 1K3AA 4X3FB 5CS6A 3G0FA 4AA5A 3VF9A 4BICA 3G9NA 3SRVB 4MK0A 4NCTA 4BC6A 5JQ8A 3ZC6A 5IA2A 3F82A 3PE1A 3FMNA 3KXNA 2X7GA 4O6LA 2I6LA 2A1AB 2V5QA 2WHBA 4EOOA 4C4HA 3QHWA 3AD4A 2R3GA 2HW7A 2XRWA 3F7ZA 4GK2A 4RC4A 4EC9A 4EBWA 1XHAA 4PDPA 1CTPE 3KREA 2OJ9A 1ZYJA 5EYDA 4BDKA 4K18A 1HCLA 4Y8DA 3JXWA 3KB7A 2ITOA 3SW4A 3MDYA 5I0BA 2EXCX 2VTIA 3QCQA 4FNZA 4IX5A 5H8EA 4IACA 2BTRA 4C2WA 4RFMA 1UNHA 3W0QA 3CKXA 3PWYA 1OMWA 3H3CA 1YXUA 3KKVA 3KRXA 4AZEA 2XIYA 4XG8A 2BZKB 4ACGA 4WUNA 2C5NA 3F5PA 3P4KA 2E9UA 2FUMA 3HMMA 4AXAA 3BHUA 2C6MA 5BYZA 5CXZA 3DV3A 2SRCA 3RCJA 4ZZOA 4JX7A 3SG8A 4YJUA 4DINA 1KE9A 1PYEA 4YUQA 5HIDA 3WARA 5J9YA 4WO5A 3LCOA 5IQCA 3DQWA 3ERKA 4AW1A 1S9JA 2R9SA 5HLNA 4ZXTA 4FICA 1ZYLA 4G17A 3NUNA 4N6ZA 3A8XA 4RMZA 4F7JA 1V0BA 3PVUA 3EWHA 2JDOA 3ZH8A 4EOQA 2CGXA 5KKRB 4J99A 2YDIA 4J96A 1IAJA 5KMIA 5CASA 1STCE 1OPKA 2JIIA 4KKEA 4XMOA 5IA1A 5GINE 2C68A 1Y57A 2RGPA 1OPJA 4NM5A 4NWMA 3UG1A 4DBXA 5AUTA 2QR7A 2WMWA 4PMSA 4BKZA 3BLAA 1B39A 1ZMVA 2ITPA 3W2OA 3PG1A 2UUEA 3DBQA 4GK3A 4M0ZA 2P0CA 2JBPA 2R3KA 1Y8YA 2VZ6A 4YJRA 3E88A 5CVFA 5FEEA 4EJNA 4O4FA 2GCDA 3QTUA 4ARKA 3O23A 3LAUA 3UG2A 3DGKA 2I0HA 2C6DA 5BVWA 4IVCA 2WTKC 3QQJA 5E9EA 5EI2A 3FEGA 4P5QA 5I5ZA 4DG3E 1Y6BA 2VWUA 3MSSA 4QMQA 5JGDA 1DI9A 4UX9A 2XK9A 3CJFA 2RG6A 3Q9WA 1PMNA 3TEIA 4EOSA 4KBCA 5BUJA 3FI4A 2XA4A 4R3PA 4W9WA 5LMAA 3VF8A 1VLRA 4J1RA 3QUEA 1ZZLA 1KV1A 4JL9A 4OUCA 5IQBA 4FKGA 4H58A 3GOKA 4IX4A 4OGRA 5AUUA 3BGPA 3QL8A 3E7VA 4BTMA 4K6ZA 3V6SA 4G3CA 1SNXA 1ND4A 1M2RA 3VW8A 2RFNA 3MFRA 3WF9A 3H4JA 1QCFA 2IVUA 4YLJA 5AEPA 4DHFA 1H08A 4GG5A 5CX9A 5A6OA 3ORZA 2UZDA 4DA5A 5CENA 2C5OA 4Q9ZA 2R7BA 2BRHA 3KXMA 3CPCA 4ZSAA 1OZ1A 4JRVA 4FV6A 4O7ZA 4PDOA 4A4LA 4C4IA 5M53A 3VJOA 4R7IA 4UYNA 2YWPA 4LDTA 4OTHA 1WZYA 4RX9A 4P5ZA 2V62A 3CD3A 3R9NA 2FSTX 3ORIA 3S0OA 1ZMWA 2VWVA 3ML1A 2QO9A 2WU7A 4AGWA 4MX9A 4LV8A 5FGKA 2YM8A 3HAMA 2ZAZA 3IECA 5E8SA 3LHJA 3BLHA 2XBAA 4A9RA 4O22A 1XJDA 2W1GA 3TV4A 3QTQA 1O6YA 4LGGA 5EW9A 4ZTLA 4BJJA 4O0XA 1H24A 1YXXA 4RX8A 3OBJA 1OL1A 1HOWA 4QDVA 3CR0A 1V1KA 4AXEA 5IU2A