5HIMA

Crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and dimethylglycine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
241
Chain Sequence
DHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
source organism Methanohalophilus portucalensis fdf-1
molecule tags Transferase
molecule keywords Glycine sarcosine N-methyltransferase
total genus 86
structure length 241
sequence length 244
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5himA02
4HH4A 3G88A 1N2XA 1JQ3A 3M4XA 3I58A 3PB3A 2ZLBA 2AOVA 2HV9A 3FUXA 3CJRA 1FP1D 3KPVA 3NMUF 5CVJA 2FCAA 3HVKA 5E2AA 1SG9A 1R74A 3BXOA 5FHRA 3MB5A 3BGVA 4ISCA 1VIDA 2G8NA 5CCXA 3PTAA 3ELYA 4IV8A 3M6UA 3P8ZA 3MCTA 2DPMA 2ONYA 3PVCA 5E1DA 3GRUA 4YMHA 1RJGA 5LQAA 2GB4A 4BLWA 2BH2A 3VSEA 1ZGJA 4PYLA 5HEKA 3L8DA 5C9ZA 2B3TA 1PJZA 3MHTA 3FUVA 2ZTHA 2PWYA 4H0NA 3KPJA 4DCMA 3UJDA 3LCUA 4C04A 2IH4A 4P58A 3CC8A 4X63A 4F84A 2P7HA 3HVHA 4PONA 2I9KA 4WVLA 5U4XA 3S68A 3PX2A 4E33A 5LQNA 1VP9A 3JWJA 2YX1A 2PT6A 4PIMA 3UJ6A 1JQDA 4QTUB 2BR5A 3G2PA 4ER7A 1QAOA 4PCLA 5CVDA 4ZTBA 5EKXA 5DWQA 3QV2A 1ZG3A 1N7IA 3AY0A 4AZWA 2EJUA 3FUUA 3U81A 5BP7A 3DR5A 1YZHA 2P41A 3MTEA 4M38A 3RW9A 4GBED 3P9CA 3P71T 3LDFA 3HCEA 5HIKA 2HR1A 4PYJA 2Z6UA 2ZCJA 1KXZA 2P40A 5FQNA 4V0RA 3UJBA 2PJDA 2ERCA 2ZBQA 3SM3A 5EHIA 5IH3A 4YUWA 4M7RA 3SR4A 2XBMA 4EMSA 3P9IA 3DXXA 2NNWB 1JSXA 1KPHA 2PY6A 2OKCA 1G8SA 4R05A 5DPMA 4PYOA 3NW9A 4X60A 3GU3A 3G89A 4X61A 3HCCA 3KQPA 5K0FA 2Z6QA 4PINA 2UYQA 5K0JA 5M5BA 3KPWA 3LGAA 1SUSA 3FYDA 3FTFA 3HNRA 2PBFA 3OCJA 1PRYA 2OBFA 2ZZNA 3M70A 3KR2A 3M6XA 3TLJA 2PSSA 2YXDA 3DLIA 4R6WA 5E1OA 5EEGA 4R8SA 1UIRA 2QM3A 3PS9A 5FA8A 2AVNA 4RVHA 5DSTA 3ER8A 2VDVE 3HA7A 3FRHA 5KS2A 2P8JA 4BY9E 2LD4A 5GIOE 5CIYA 3JWGA 1SVUA 4O29A 5CCBA 1RI3A 5HZMA 3I53A 4R6XA 4KWCA 2C7RA 4GF5A 4E2ZA 2JH8A 3OPNA 3B5IA 3R9XB 1WXWA 2B9EA 4YV2A 2FK8A 1BKYA 4A6DA 1V39A 5JUWA 3G7UA 9MHTA 1FBNA 4P7GA 3GCZA 3FTDA 5K03A 3RODA 1D2CA 2FYTA 1XTPA 2YXEA 2AS0A 3P2KA 4KVZA 2OXTA 2IDKA 1EG2A 1RJEA 3X0DA 1XDUA 4KDCA 5HIIA 1I4WA 7MHTA 3B3JA 4EK9A 2XYVA 4PCAA 3FPGA 4WXHA 5DTQA 3SSNA 4OQDA 5ICEA 2NP6A 4CXMA 1D2HA 2AN3A 4ER6A 4QDJA 1YB2A 2ZBRA 4OA8A 4KIGA 4CKCA 5K09A 2F8LA 2IIPA 2CWWA 1NW3A 2BM8A 2OY0A 4OX9Y 1FPQA 4KIFA 3E7PA 3R24A 3LCCA 1R6AA 4MTLA 2A14A 5GM2A 4DF3A 3G8BA 4ER3A 2PWPA 4DQ0A 1WZNA 4KW7A 2JJQA 1L1EA 3CGGA 2AVDA 3PT9A 4DCGA 2R3SA 1M6EX 3EGIA 2AOXA 2PX2A 3LX6A 2ZFUA 2ZIEA 3A7EA 3GNLA 5FQOA 4C03A 5LQCA 2NXJA 5DLYA 3LECA 5FTWA 4DA4A 4QTTB 3HVJA 3MGGA 3OFJA 3PLAE 2IBSA 2IH5A 3AJDA 1TW3A 3OZRA 2G72A 3E05A 3BT7A 3K6RA 1NV8A 4L7VA 2YUIA 3FUWA 5MHTA 3B89A 5EMKA 4GC9A 2OB1A 3ELUA 3UZUA 1Q0TA 3GJYA 2NYUA 2KW5A 2ZZKA 1EQAA 1AQJA 3OZSA 4HGYA 4QDKA 1RI4A 1TPYA 5DX8A 5K0BA 5KYGA 3QOXA 1RI5A 3KQYA 4PYNA 4RVGA 1BC5A 2PLWA 2NXEA 4HGZA 4PYKA 3NJRA 1KPIA 1UWVA 2Y1WA 3FPFA 4RWZA 2H00A 5EC8A 2PKWA 5FWAA 3JWIA 1WS6A 2IDJA 3EVAA 4R8RA 4ATNA 2GA9A 2YR0A 4C08A 1JG2A 1G60A 1YUBA 2GLUA 5JR3A 3NWEA 3LKDA 1NW5A 3UJ8A 3NDIA 2NP7A 2P3LA 4PNEA 3ELDA 3FUTA 3HP7A 5DXAA 2UYCA 3C3PA 1X1BA 3O7WA 4QVGA 1O9GA 5HILA 2XYRA 4A6EA 4X41A 3KQWA 3SXJA 3REOA 1JTEA 4MWZA 1YF3A 5LQUA 4FSDA 3UJCA 2ORED 4XUCA 2IP2A 2BZGA 5ICFA 2OPBA 5B1SA 2ZWAA 4GOMD 3TOSA 2V74B 1T43A 1XCLA 4QPNA 1QZZA 1JSZA 2ZZMA 2GH1A 3KQQA 4GOLD 5BW5A 5T64A 3GXOA 2QE6A 3Q7EA 2JH9A 3NTVA 3GWZA 4P7KA 1JQEA 5EVJA 3KU1A 1ZQ9A 3TFWA 3IEIA 3DOUA 3SGLA 1ORIA 4FGZA 4Y30A 2ZVJA 2B78A 3QOWA 3UWPA 5F2NA 4RTQA 4JXJA 2HMYB 2H11A 4FT4A 3GGDA 3OE4A 2AOTA 4P7JA 1L3CA 4HG2A 1JG1A 5DRYA 2ZIGA 3VC1A 1XDSA 5DM0A 4OQEA 3LBFA 4RTLA 8MHTA 3P9NA 3TR6A 2JHCA 2AOWA 5K8VA 5H02A 3GIWA 1YZ3A 2P7IA 1NV9A 3UBTA 3BWBA 3AXSA 1FP2A 1RJFA 2XYQA 5E8JA 5EIFA 5G02A 3SSMA 3T0IA 2EFJA 3EVGA 3HA3A 4LWOA 1KP9A 3P2EA 4FS8A 5DTMA 5EIWA 5EMLA 4DKJA 3DMHA 5EPEA 4AZVA 3EVCA 1ZHFA 2IH2A 3MCZA 3EVDA 3MERA 2HWKA 1MJFA 1JG3A 1P39A 4F86A 3TPZA 2P1DA 4E32A 3EEOA 5ICCA 4YV0A 5EHGA 2XVAA 4LWPA 5FADA 3UJ7A 2OO3A 1X1DA 3CCFA 2ZW9A 4PWYA 2AN4A 1D2GA 1DL5A 3OE5A 1DCTA 3HCAA 3FZGA 4GUAA 3THRA 2I6GA 1EIZA 3PFHA 2PVCA 5EQJB 5K0LA 5K01A 3KR1A 1X19A 4RTRA 3FPHA 5E8RA 4BLVA 3C3YA 1I9GA 1RI2A 4K6MA 3DLCA 2O05A 3CJQA 2PX4A 2QYOA 4DZRA 2C7PA 1N7JA 3LL7A 3BKXA 3GRYA 2IPXA 3C6KA 3LKZA 3O31A 5D1NA 1EJ0A 1NW7A 4GOND 1KYWA 3EGEA 3JWHA 2ZIFA 3P9KA 4M37A 5DXJA 5E9QA 4V0QA 1KIAA 2I62A 3GDHA 1ZGAA 5T6BA 4AZSA 4E31A 2XVMA 4OBXA 2PX8A 2YXLA 3K0BA 5EOVA 2O07A 4CWAA 5DX1A 3F4KA 2C7QA 5HOQA 4B17A 3SX0A 4MQ4A 3TM4A 3VYWA 4QPPA 1KPGA 1NE2A 3KQTA 3HM2A 2HTEA 3CKKA 3LPMA 4GOOD 4PIPA 3R3HA 1O54A 3CJTA 5EEHA 4DM3A 4HTFB 5DSXA 2WA2A 2ZSUA 1OR8A 3AWIA 2O0LA 3HA5A 4M36A 3EVBA 3RIEA 1HNNA 5FA5A 1NT2A 4RV9A 2UYOA 4QQKA 2EG5A 2VDUE 3ORHA 4PGGA 4QVKA 3DXZA 3KPUA 5HIJA 2JHAA 3O4FA 4GQBA 1KR5A 3FYCA 5LQRA 3T7TA 1NKVA 1QANA 1DUSA 4RTOA 1G55A 2E5WA 3EEYA 3KQSA 4FZVA 4HC4A 3A25A 3LBYA 4GEKA 2DULA 3DH0A 5F2KA 1XDZA 1P1BA 3BGDA 3KQVA 3G5LA 3LDGA 3NVKI 5CVUA 1L9KA 2IGTA 4Y2HA 1IXKA 2YTZA 2O06A 3BGIA 2ADMA 2PXCA 2PXAA 3UFBA 4RX1A 4C4AA 3GO4A 3NWBA 4E30A 2G70A 3BWYA 4G56A 3EVEA 4HRAA 3V97A 5FCDA 1JTFA 1L3BA 3I64A 5FWDA 2VDWA 3TKYA 5FULA 1KYZA 2AN5A 5HIMA 3WSTA 4RTJA 2ESRA 4NECA 3OFKA 1G38A 3B7PA 4RSRA 3SVZA 1YFLA 3FRIA 1XJ5A 5E1BA 4AUKA 3HVIA 5HFJA 4YUYA 4C07A 2CL5A 1AF7A 3KPYA 3E23A 3G5TA 4IWNA 5T67A 3NDJA 2OZVA 1VL5A 5GIPE 3KR9A 5EGSA 3BWCA 4IV0A 2CMHA 4GC5A 5DT2A 4CKBA 2FPOA 2CMGA 3G2MA 5GM1A 4YUXA 2JHPA 3KQOA 5EMJA 3TKAA 4HSGA 5LR6A 1BOOA 4HTFA 4YUVA 5F2OA 1WXXA 1XCJA 3EGVA 3IYLW 4MIKA 3ER9A 2FK7A 4P7FA 4PYQA 1G6Q1 4AX8A 1SKMA 1I1NA 2N47A 2V7EA 2ZULA 2ZBPA 3MQ2A 5EZSA 4C06A 2UYHA 3C6MA 4FSXA 2PGXA 3B3FA 5GOZA 1P1CA 3VC2A 1VPTA 2AR0A 2EJTA 5CVVA 4LECA 1QAQA 2NXNA 1F3LA 3FTCA 1R00A 1Z3CA 4IKPA 1X1AA 5CD1A 3KQMA 4EVIA 2NXCA 3BZBA 2QY6A 1IY9A 3A26A 3ID6C 3OU6A 5DM1A 3EPPA 1WG8A 3OU2A 4FR0A 2G71A 4U7TB 4C05A 1QYRA 3T7RA 2ONZA 4X1OA 4KDRA 4BP3A 2WA1A 5E9WA 4PYIA 2R6ZA 2P3OA 1WY7A 1B42A 2B2CA 1F38A 5CUQA 3OU7A 3SSOA 3OZTA 4POOA 4E2WA 1INLA 1XXLA 3CBGA 4XCXA 4MHTA 4ER5A 1IM8A 3EVZA 1MHTA 1NW8A 3G2QA 4FT2A 3TMAA 1SQFA 2QRVA 5BXYA 4RTSA 1JG4A 2PXXA 3ELWA 2VZ9A 4E70A 5LQJA 1UFKA 1R8XA 5E9JA 4YUZA 5IKMA 5DTRA 4OA5A 1YFJA 3Q87B 4RVDA 5LSAA 2FHPA 1VBFA 1QAMA 5E2BA 3TQSA 2AOTB 3T7SA 3DP7A 3M6WA 3V8VA 4QQNA 1NW6A 3HCBA 5LQKA 1NBIA 3GRZA 5D1HA 4E2XA 2Q41A 2PX5A 3E8SA 4Z2YA 4U7PB 4YV1A 3BKWA 2JG3A 4RTMA 5ICGA 5DRTA 2BR4A 4LG1A 5C1IA 1KHHA 3KR0A 5CVEA 1EJ6A 2Z6AA 3DMFA 3I9FA 3R6TA 2G1PA 3GRRA 1VLMA 2GPYA 2PT9A 1XVAA 3A7DA 3M33A 2CKDA 5K0GA 3H2BA 4XUEA 2H1RA 2YQZA 3DULA 1L3IA 1RI1A 3EMDA 2I7CA 1JR4A 5FUBA 2AZTA 3TRKA 2C7OA 2AOUA 3B3GA 3LCVB 4RYLA 1AV6A 1EAMA 3DMGA 4FP9A 2AOUB 2WK1A 3DUWA 3IHTA 4BLUA 3UJAA 2FRXA 5EKUA 4XUDA 3SMQA 1P91A 2P3QA 5E1MA 2O57A 4PYMA 3ME5A 4CKEA 4RTPA 5P8WA 2OYRA 3PFGA 5K05A 5DM4A 1AQIA 1ORHA 3FPJA 5GINE 2PV0A 1M0EA 1X1CA 4BP1A 3BWMA 1ZKDA 3HCFA 5K0CA 3UA4A 3DXYA 3P2IA 5GP1A 3LSTA 3UJ9A 5EMMA 4RVFA 3PX3A 1SUIA 4KRGA 2VP3A 5KVAA 3P97A 3AXTA 5DX0A 4CTJA 3GRVA 3FTEA 1VE3A 1SQGA 2P35A 3HCDA 3DTNA 3LDUA 4DMGA 5KQRA 3CVOA 5KQSA 4F85A 1VP3A 2IFTA 3IV6A 4RTNA 5EZQA 4PGHA 3MTIA 3UA3A 4E2YA 5GWXA 1R8YA 4ER0A 1R18A 3A27A 3EMBA 3FPEA 3G2OA 3I5UA 1G8AA 3TM5A 2Y1XA 4CTKA 2GS9A 3HTXA 1TW2A 5EG5A 3LHDA 4UOEA 1Q0SA 3ANXA 4RTKA 1M6YA 1Y8CA 3R0QA 3HEMA 1BHJA 3BUSA 5K0EA 5ERGB 10MHA 2IBTA 5CM2Z 3KKZA 1NBHA 3ERCA 3C0KA 5K0NA 3KHKA 1O9HA 3MAGA 3NVMB 2VS1A 2B25A 4OBWA 5C0OE 1HMYA 3A4TA 3THSA 4EKGA 1H1DA 4EQZA 3D2LA 1RJDA 2HNKA 2ZWVA 3G8AA 4EKIA 2BM9A 5FHQA 2YVLA 4AZTA 2EX4A 1FJXA 2BR3A 2GAFA 4YMGA 2UZ4A 2K4MA 2OB2A 5DM2A 1VQ1A 1U2ZA 2QRVB 3M6VA 5BW4A 3EVFA
chains in the Genus database with same CATH superfamily
4KXFB 3DJYA 1F4LA 3JAWA 5C81A 2YRFA 3QEMB 3RV3A 3RFXA 5IKXA 4I1PA 3K1AB 4E0BA 3GFRA 5E2AA 2PANA 1HFEL 1YZGA 3OZ7A 1AKWA 4NNPA 5DI3A 2FR8C 3VQTA 1E9CA 1KJJA 2Q62A 4LFCB 4A1OA 5FYQA 1IPHA 4Z86A 3QG1A 3FSGD 4IV8A 3N7AA 4MVJF 3PFWO 4N7MA 3SEQA 2AW3A 4YMHA 3JV7A 4N82A 3OEYA 1OX5A 2ZBDA 2ZXFA 3AHIA 4GPAA 3RLFA 3AY3A 3FYHA 1Z6QA 3D59A 3L8DA 4LSWA 5IH7A 2PUAA 1T0JB 3FZEA 4KPUB 4LRWA 1E61A 2MTBA 1XXHB 3IQDB 3NIGB 1Y9ZA 4M7OA 4PONA 4AMUA 1OF1A 3U1TA 1U4NA 3Q7IA 4KIJA 1RZRD 1GRNA 3FUCA 3JWJA 3FF1A 2BW0A 3Q8WA 1REQA 5I9LA 4NV3A 4QTUB 1GGNA 2GWHA 2H5EA 3CX7A 3QLEA 2GJAA 4HGRA 5JWHA 2VJPA 1FDIA 4CF4A 3JQAD 1KJZA 1FSFA 1U3TA 4AZWA 1SXJC 5M7EA 3U40A 1SVWA 4W8GA 3HV0A 3KVYA 4G4IA 1L5NA 3VNQA 3D64A 2LR0A 3KLNA 3HCEA 3FOZA 4X7BA 4I3HA 3AYZB 3CF4G 3LRTA 4HS4A 4D4GA 1G3UA 1UMCA 3ICVA 1E3SA 5EZYF 1X94A 3EUWA 2JLVA 2R7LA 2C2WA 3GQBB 4YDQA 3BF7A 4PO9A 3ONDA 1YRYE 4DGQA 4HYQA 1QVRA 2DR0A 3H84A 3ANSA 2GT1A 1H9CA 2RKBA 3B1YA 3ZD8A 1LPBB 1QE3A 1RMQA 5JQGF 4LF4B 4W9NA 3M70A 3TLJA 2F00A 1NUPA 2YRXA 2FWPA 3QQ5A 3G68A 1HKUA 3QVOA 1UPFA 2QMUA 3C45A 4NYMR 5CHEA 5EFZA 3FCEA 5DSTA 3P2OA 5ECGC 4EBBA 5KS2A 2W00A 4KIUA 4S2EA 2VJLA 3BWEA 4N9QA 4XQGA 1ZSVA 4Y2YA 4PE5B 1L5LA 4H2DA 4BE4A 4AO8A 4JHLA 2BGGA 4CDGA 4IIEA 4TLAA 3E1SA 4Y2XA 4GF5A 3ND8A 4R31A 4RIHA 1DARA 2VVTA 2Q3JA 3K53A 3ENZA 4A6DA 2QQFA 2G9UA 2ZB3A 3QVSA 4DILA 5KHLB 2AN9A 2O1WA 1RYFA 1YRBA 4Z9AA 3FTDA 5G0TA 1F8XA 4C89A 1BE0A 2VQSA 3O9VA 3C3AA 2AG8A 3NKVA 3D8BA 3DYVA 1EG2A 5BSMA 4WIAA 3VDXA 1U8CB 4EKYA 1VDZA 1PX0A 3BGSA 4RH3A 3RVKA 4EK9A 3F4BA 1EZZA 1SJ9A 4ZJUA 1PQYA 5JMTA 3TRIA 4YAFA 2C95A 4OFZA 5DASA 3FGPA 3RS5A 3W3AH 4FK8A 3RU9A 3FB4A 5CLJA 1NXXA 2F8LA 1Y6RA 5G4KB 2JGIA 3EF1A 3F6RA 3FFBA 3H87A 1FPQA 4JUIA 4MTLA 4E07A 1R6AA 1XCBA 1N92A 4R0MA 2GUGA 4ER3A 1HQYE 3KT3A 4KW7A 2BJHA 4L2IA 3CQ9A 2OCAA 4ZZ1A 3K8OE 4DLAA 3BFKA 3AUKA 1P9RA 3DHYA 2ZDGA 4DA4A 1UBJS 1OXSC 4YRIA 5DNVA 3PQ7A 2OQIA 3RSOA 5BPHA 3AJDA 2D62A 2H9YA 3OZRA 2JHFA 4HBZA 4BBZA 5IDQA 1KDYA 1THTA 5HTOA 3WADA 3AEKB 4C4TA 5SYNA 5CBPA 1NVXQ 1ODKA 5IWCA 3U3XA 4S0XA 2H3EA 3GJ0A 3ZPXA 2ROQA 2XUOA 2R8ZA 2TMYA 4MS4B 5C51B 1CR6A 3EGDA 4G0NA 1AB6A 1X1RA 5ELXA 1PUXA 1BTOA 2I4TA 1TGVA 5JY6A 2RARA 2JIMA 4JLUA 1JQLB 1Z8NA 2WNHA 3CLKA 4Y2RA 2H29A 5E9AA 4F2WA 1MMFB 4MJ3A 4INAA 5KTPA 2FPSA 3CZMA 1T15A 4G2TA 1R0YA 2UZ1B 1NBMA 3JYLA 4IZHA 1YVRA 2H6EA 3FJOA 2IZOA 1KPIA 3N2LA 5L7YA 4ZTZB 1R4ZA 5ED0A 4EX6A 1QWOA 2V7XA 4R8RA 1WF3A 3EA5A 1N5KA 3DOCA 3U3ZA 4BDTA 1I7NA 4KNYA 3KSRA 4MZXA 4X20A 2G5GX 1QRSA 1G60A 4EHJA 2C77A 4IR7A 4ZVVA 4WH0A 1Z75A 4KZPA 1KYIA 4C3UA 3T61A 4BUCA 1TDJA 1JDSA 5SZKB 3N2KA 4RH1A 4CM9A 1UMCB 1Y7PA 2PEZA 2VI5A 3W4IA 3C8UA 4KGZA 4W8HA 1G20A 2O23A 3GRKA 5A2GA 3SXJA 2JFNA 3OFSA 2X0JA 1UXGA 2JATA 3H5RA 4O5AA 3OP1A 5TSDA 3BH0A 4XYBA 1NR7A 4Y7CA 3WQQA 1P74A 2OPBA 3RUIA 4N48A 1G20E 2AUMA 4LYHA 1QV7A 3EMVA 2EVWX 5GVRA 2M32A 1MIHA 3HP4A 3E53A 2OVFA 3GWZA 4X1YA 5K51A 3RIHA 421PA 4GPBA 1N9GA 2GRAA 4D9BA 1BG6A 3RE1A 1BXRB 4KVGA 3GLTA 3ZNQA 5BN3A 2VPIA 3GGSA 4D0RA 4FB4A 5TQ0B 1R12A 3UB2A 1N3LA 3FZYA 3LLUA 3OE4A 1Z6TA 3BTSA 4DV6B 1EBBA 4GT1A 4R9VA 2CKMA 4AJ2A 6LDHA 2F3TA 5B1YA 5KTKA 5KOYA 2O8EB 1PK8A 3EULA 2HX1A 3GIWA 2P7IA 4JBIA 3AIMA 4EZBA 4B3TB 1ZH4A 3SHOA 1SXIA 2RAFA 2XYQA 1ZM2A 3HLYA 1V0JA 5EUMA 2G04A 2ZPAA 4KK3A 3EVGA 3JYHA 3DYIA 4Q19A 3UFXB 1RXYA 2VRNA 1IAVA 1QMPA 3NGMA 1UINA 3WB1A 4QGGA 1AH2A 2BKXA 2YHIA 1ZGGA 4EB3A 2X58A 2IH2A 2QEQA 1MQ9A 3MCZA 3U3RA 2AEEA 1H5NA 3NU1A 1BE6A 1PT9A 1WCXA 4KGXA 1CJCA 3D31A 5A7HA 1WMSA 3PXUA 2FXIA 2IYQA 1UQUA 2EGGA 4KITB 2BFBA 2G06A 4LWPA 3WXBA 3NC4A 5DHPA 2ZATA 3CCFA 1S02A 2ZW9A 3ZCVA 4D3XA 1L5KA 2VDPB 1DL5A 3N5CA 3AL0C 1C9KA 3RU2A 4L5JA 1NLZA 2P4HX 2PPLA 2Z4RA 4ARSA 4CMEA 1BHO1 3B20A 3EXG2 1U8EA 2VYFA 3I9KA 4MUFA 5ESXA 3VGJA 4A92A 4CR7A 4IV5A 2AMJA 1XRJA 2F1HA 4DG5A 4ND2A 4GW3A 5AW3A 2IS2A 1UBRS 4M53A 4LJAA 4JQCA 2Z3VA 2ATVA 1EFRD 2A1UB 4U7GA 4OLAA 4RKFA 5HK9A 1FW8A 2DWCA 5KNCA 3NG1A 4D79A 3CLSC 1OWLA 3NTQA 3F78A 3G5MA 1G0OA 4I4TF 1QGOA 5AKYA 5DFAA 3QYJA 4J3NA 1RAEA 1XQXA 2VPYA 3GLIB 2P2LA 4Q7EA 5B37A 5I7WA 3ZLTA 2E4UA 3ZJ4A 2JGAA 1CJTC 3QFCA 2XVMA 3NTUA 2A33A 3KQLA 3DBLA 1T0UA 2A2ZA 5H4HA 3VSBA 5DX1A 4EARA 5A5DA 1V5EA 2ZTSA 1WOMA 1U9JA 4ESHA 2OHFA 1J9GA 4PS1A 4PIPA 1D6NA 2WWFA 3VYUB 3S8MA 1DAKA 1WP9A 1TI7A 4HUTA 2Z95A 2WA2A 4A0FA 1I3OA 1OI4A 3HA5A 4TXMA 4E5SA 3QM1A 4QBTA 5EHQA 1JIJA 3GJRA 5F51A 3SC4A 2JKYA 3GRFA 2XEXA 3KK0A 3M8KA 4CEIA 1G8PA 4M0EA 1UKEA 1O08A 2FGKA 3W5BA 4PN7A 2AX3A 2Q5LA 2EWVA 2GKOA 4MW2A 3WMGA 5HSGA 4CCYB 4HGQA 2F55A 1UBSB 4UNIA 2DULA 3DH0A 1SVKA 1XDZA 2YNMA 1FRVA 3LDGA 4J16A 1K6JA 5FBWB 1IM5A 2HMUA 4Y2HA 2C99A 2EIHA 2DT8A 4LXHA 4JBHA 1A9RA 4KODA 1WB5A 1HH4A 3GRPA 1LJ8A 4O1MA 2C3OA 3RSQA 3U7QB 2PR2A 4C4RA 3ZHOA 3W6OA 4H0CA 3OIVA 2QP9X 3H13A 4HVAA 3ESZA 3D1VA 4UXJA 4I55F 3MJEA 1GKYA 1RQNA 1Z8DA 4NECA 4OGGA 1G38A 1P4HA 1RU3A 1KI4A 1XHFA 3K4HA 3N7TA 4FPXA 5CLIA 4DLTA 2B20A 5IDXA 4CIYA 5LIPA 2CVQA 1T9DA 4AUKA 1A97A 1ACJA 4RM3A 1ES9A 3K20A 3MTQA 1IMJA 4O2LA 1NF3A 1XK7A 4II3A 3GY0A 3N8HA 4FE7A 4MOWA 5K3BA 4DJTA 3ACCA 2J0EA 1KL7A 3Q15C 5DT2A 3U1BA 3JALA 4ME6A 1OIVA 3TKAA 1N6PA 4Y67A 5EMJA 3AM3A 4FHZA 4HSGA 1C9YA 2O52A 4R1QA 3PC4A 4NOKA 5CT8A 5H7XA 3ZHQA 2AKAB 4CM7A 2QJOA 2HJVA 2B3DA 1GDDA 3P32A 3PD0A 4PYQA 5EXEA 1BKDR 1TJ5A 2P90A 2W7TA 4QXPA 5ALFA 2JD1A 4PAGA 5EZSA 4YP6A 1QP0A 4IUBS 1E2UA 3HNPA 4IIJF 4JNCA 1D5WA 1FLNA 1EM6A 2W6IA 2DECA 4JKOA 4QNNA 3NWOA 4Q9LA 5CXXA 3COVA 4B44A 3KQMA 1E5XA 1GPKA 3M7IA 3TLCA 1YS4A 3LG2A 4EFMA 1ZGZA 4B82A 2QAIA 4B8ZA 4OXIA 3NBZC 2MU1A 2PN1A 3ITKA 1LXCA 2DQYA 2Q3DA 1E0KA 4G1MB 4ES6A 4NZMA 1ZO8A 4KDRA 5AKXA 2WF9A 3TQRA 5IDWA 2RBEA 5CFMA 4DL9A 2R6ZA 3BWDD 1DUIA 2AMVA 3WGTA 4N49A 1F2TB 1LNSA 3L04A 3AEUB 1JECA 2WJJA 2V7WA 3OU7A 1GJRA 4G5YA 1XXLA 1DLIA 4CG1A 3MRTA 4YCLA 1DAOA 4HCJA 1KDPA 1RPAA 3ZZMA 2ZSJA 4KI7A 3GYBA 3TMAA 1FLDA 3DW3X 3MHPA 2PXXA 5IC5A 4YUZA 5IHXA 5IT4A 4D97A 1HFJA 4MKZA 2FHPA 1YDWA 1V8DA 2VDJA 1JH8A 4G8JA 4YRLA 5JNVA 4D9MA 2FPIA 2NU6B 1GGFA 2B1GA 3RO7A 4QDOA 3GRCA 1GD1O 3KUDA 1VE6A 2I6FA 5FFNA 3PGXA 2VUIB 2OSVA 1PFKA 2F3UA 5AJVB 1VKHA 1Z5ZA 3E7XA 1FQWA 4E2XA 1FDOA 3I2GA 3UUFA 1MXFA 3KJQA 1TYZA 2Q4TA 2X8WA 2A1TS 4RORA 3KR0A 4S1WA 3G1TA 1EJ6A 4P84A 1GR0A 3AOEC 3BSSA 3RC7A 4Z0NA 1OI2A 3TL6A 1KWGA 5BUZA 4V02A 2H54A 4B7AA 4FGJA 3TCXB 2PIAA 1EGAA 3ROMA 1B00A 3EMDA 4G63A 5BVGA 1AV6A 2BHTA 2H48A 3DMPA 5DM70 1NXVA 3E9NA 1S8NA 1RLTA 1VCNA 2P5TB 3ENWA 3QLUC 4PPGA 4LDRA 5IK2A 4C4ZA 2AK3A 2WUWE 2Q9BA 3E8XA 2P3QA 2PCLA 4KL8S 3KETA 1HURA 4KLNA 5HZHA 1TM3E 3DJFA 5DN6A 3Q85A 1C4WA 5BNZA 5KNBD 2C9DA 1AT1A 1PJ8A 4HYTA 1O96A 1RTKA 4YYEA 1R6VA 3HY6A 2VJQA 2OXCA 4Z1MD 1T25A 2IU6A 3M4JA 5EMMA 3RS0A 1Y5IA 3MAAC 4KRGA 3KYDB 4RGQA 1ST3A 4I3GA 5BR7A 1PZNA 3A36A 2PRKA 3HG7A 3DGFC 1SQGA 1MH1A 2AC2A 2EX1A 5REQA 4QXMA 3X1XA 1TQDA 4ZU1X 3AJRA 1ML4A 1EP3B 4HDOB 3QW4B 3W5AA 4ND3A 2QVXX 1T9BA 4OGLA 2D1RA 3V2UA 2C2BA 1VGVA 2AX4A 2HXSA 3UAWA 4KBGA 2X8AA 4EDFA 1VECA 2GD0A 3BRSA 5T4HA 4IJVA 2DRIA 4V0KA 3DW1X 2JFBA 4I9NA 2W2PA 1J22A 3H6GA 2VNJA 2UXBB 2GRJA 2PSDA 3IEXA 4HVTA 4RE6A 2VP5A 1ATZA 4DAOA 1C50A 1C8BA 2XWSA 2IHTA 2PKXA 1PCXA 3L7KA 4FONA 4WY5A 1HI9A 2R5NA 1T3HA 4LRQA 3ENQA 5C0OE 1FIUA 2MYPA 1O2DA 3ZJVA 3JSXA 1E9EA 5DISB 2ORIA 1N75A 1Z9BA 4TRMA 3QH4A 4ZOAA 4LEIA 2VT3A 5DCYA 4UHJA 2XT9A 2OCYC 3ITNA 5HKAA 1GDTA 2J6IA 2PK3A 1E8NA 2OB2A 4TMYA 1GCUA 1U2ZA 2OBMA 2QRVB 1KEEB 4QRIA 5L3RA 5JC1A 1RBMA 3X1DA 1WRBA 5HKLA 1IEXA 2BKVA 4YJHB 4XVUA 3V1NA 3ZGLA 1QHNA 2B7LA 1PBNA 1QJCA 1R8QA 2C2OA 2HV9A 2IP1A 3COSA 3KKPA 5UKDA 3WLFA 1G59A 2OORA 1Q7GA 4WXEA 3CB4A 3CXRA 3LQKA 5ABPA 3O4JA 3TL3A 4B9AA 2L17A 1UQRA 2FPWA 1ZMRA 4UMFA 1LTQA 3LBHA 3P8ZA 121PA 3CEPB 1GA1A 3HBNA 2E1RA 4L7QA 1IWOA 4LDPA 4RZUA 1FXUA 1ZI8A 3IUPA 3CS3A 1URPA 4BZQA 5BWOA 1E1NA 2DKFA 5K8IA 3CONA 4Z0PA 5BSUA 3R75A 1YB6A 3MSXA 5C4GB 4TOIA 3UTCA 5L3SB 3IAFA 4X63A 4D6XA 1AGRA 1H2EA 1QP8A 1N3IA 2P30A 3P0HA 3VU8A 4X7PA 4CFSA 4JJAA 5DGXA 4YRRA 4A7PA 4B6EA 4KOAA 4C3OB 1J4AA 3DV0B 4ER7A 3OQPA 3DE7X 4LY3A 3U5TA 4I2VA 3IQGX 3PWZA 5I7SA 2EW2A 3AY0A 4BNZA 1FP7A 5CCEA 2IS6A 4FXOA 4L5IA 3FFXA 2G67A 5D87A 3GBPA 3T5AA 2BFEB 1JHOA 4DLZA 4LZOA 3IP1A 1MEJA 1R0KA 4ND5A 2R2GA 2D0DA 4HJRA 3GLRA 4LRSB 4YJGA 2GN0A 3REQB 3RTAA 1F0YA 4BC1A 5HQJA 1PSZA 4HUQA 2O2CA 3AUTA 3VMMA 1II8B 4DEYA 3ZWKA 3B53X 4RZSA 2P9YA 2EYQA 3EEQA 3FOAA 1L6IA 4H7EA 1GL3A 4LY6A 4LFAB 1CF4A 4MA4A 3MJFA 1CBUA 2QRHA 2QUAA 3GNSA 4PYOA 3NW9A 4M9XA 2VJBA 4MGKR 1I6LA 4LVNA 2BKEA 2DWQA 3U4DA 4B45A 2QRNA 4J2TA 5D3QA 5GV8A 1B74A 2GJKA 2ZAMA 4I1YA 4U7WA 4YHBA 4ON9A 2QS9A 4A03A 2A59A 4EVRA 4ZN6A 5JS1A 3SLRA 4J0KA 5E1OA 2Y1EA 1H1TA 1YH3A 4TT3A 4YCJA 4RU1A 3RARA 1RWQA 3ABZA 3TQQA 5CA0B 2ZDHA 2X9NA 4FFWA 4WTOA 3PTLA 3IB6A 3PXGA 1P61B 2YUTA 4BMZA 1VYVA 1XQ1A 5AP9A 2DOKA 3REQA 2J32A 3T3MB 4DG8A 1SU4A 5H1YA 3OZUA 4KWCA 3ILVA 3KYDA 4NPCA 1KETA 3BRWA 3R9XB 4M0FA 2G76A 2FP3A 2PUVA 1JEQA 4Z2AA 1LPPA 1KEUA 1HBJA 1RYEA 1YA4A 1BW9B 1V2HE 1UK9A 1Z6AA 2C3PA 2YC4C 3EIWA 2Y1OA 3O03A 4J7AA 1FBNA 5LXTA 4P7GA 2BM0A 1JI3A 3W1VA 1RWBA 1FFXB 4E5UA 4C29A 5E4YA 2Z56A 1LLFA 2C78A 2GFQA 4D0SA 3X0DA 3OY2A 4U6NA 2GUWA 3DHEA 1FP6A 2YVQA 1RHMA 5AXDA 3FPGA 1WSWA 5CMLA 5DTQA 4OQDA 2NP6A 2WU0A 2VJDA 2FH5B 3RCBA 2OV4A 2CC2A 3H1FA 4LHWA 1P6XA 5IDVA 5CNKA 5GPBA 1EHIA 2ES4A 1M1XB 3L7OA 4FXPA 4HAUA 3RFCA 3RSGA 2IIPA 3O47A 5MN5A 2BM8A 1RP1A 1ZESA 4JLPA 4GZ5A 2FX3A 3X44A 3O2NA 1G4HA 1YS1X 2ZI9A 3NBKA 3DCJA 4N39A 2JGDB 3VHRA 5LB4A 2OM6A 4UNNA 4LHYA 4CLRA 1TRHA 3ELBA 3GG2A 4HWPA 4D43A 5K6RA 4DV4B 4BC0A 3PJRA 2ZIEA 5FQOA 2JA2A 3BBPA 4ZGGA 5HS4A 3RYCB 4IXMA 2WC1A 4AWBA 4XM1A 1OSNA 1LI4A 2YN2A 4Q37A 3WJ1A 2JANA 2IBSA 3CO0S 4CW7A 2GTIA 3E6AA 1G4AE 3PF9A 3TI9A 1FDRA 1YASA 1QVVA 4RQAA 3D4LA 3OJFA 1CCWA 4F8JA 2GO7A 2E2WA 3FCSB 1C7IA 3GJYA 3RTEA 5JV5A 3DDCA 4J2HA 2ENUA 1NULA 3FTQA 2JJ1D 4B3GA 1Q11A 3ZK7A 2EC5A 3ZY6A 5ITZB 4WN9B 5H0IA 5LKRA 5KSWB 2ZYWX 3OC6A 4ITUA 4OI4A 3UT0A 3ACDA 4AECA 5LWHA 3LQYA 1HZJA 2H06A 2H8GA 1ZP6A 1L8XA 2I7VA 1OVGA 1WS6A 3QLJA 4C5BA 3DFUA 3ADCA 1ZUNA 2I03A 3NOQA 5AKEA 3WWCA 3P26A 3ZU2A 2DY0A 3CNNA 2V3CC 3VU9B 4B2PA 3W2EA 3WHIA 3U6BA 4C88A 1UJBA 1CP2A 3LIIA 2Y6UA 1XYVA 2DPHA 3QXGA 4LMPA 5AOAA 3SZLA 7REQA 2EFCB 4P54A 1Y1LA 5F1PA 2FKAA 2FZ4A 3TSAA 1GSIA 3UXEA 4EL5A 4YRBA 4LRYA 1X1QA 4MZDA 3AY6A 4TUYF 2VK1A 5EVCA 3CLTD 5DIZA 2HSWA 3H5VA 4OGWA 1AJEA 3CNEA 4I50B 1TCAA 1O7JA 1OD6A 2BEWB 5ICFA 3TTVA 1PVDA 1H05A 3IEVA 3B7WA 4Q4LA 2YIJA 2R65A 5J4HA 1HDOA 5A0VA 1FFBA 1JFRA 1FDTA 2NXWA 4XFJA 4GI7A 4R69A 1JEQB 4P3KA 4JLJA 4DIEA 4TZTA 3URMA 1I5OA 3GFVA 4MEBA 4RDHA 1ECBA 3WGQA 3LPLA 3ZBPA 3X1ZA 4BNIA 3L4KA 4NICA 1JHZA 1K63A 1MGPA 1ZQ9A 2R4UA 2VNIA 2FR0A 3AF3A 3H9UA 4ZT7A 2VF2A 2A3NA 3DAFA 4PVCA 2ZVJA 3V3KA 5ADUS 5DNAA 1GUBA 1KE2A 3D0RA 5BOVA 3PWKA 1E4OA 1ULZA 3C97A 4U5XA 2WJWA 4UZSA 1XDSA 1K4KA 1SKUA 4MS1A 3KZ1E 3TTWA 5KHOC 2JHCA 3LBNA 3ZZ1A 5K8VA 2B30A 1RKBA 4CIVA 4UTOA 4RY2A 4EYQA 3SKXA 1HWYA 2B8TA 3EWIA 4FYIA 4XVRA 1BXKA 2FMTA 5EHNA 1DVRA 3RRMA 1B0AA 4CT4B 2JLYA 4BCCA 5A9TA 3R6GA 4AJ1A 3RFTA 1KH1A 2LXNA 5HW0A 1KKUA 3V8RA 4DV0B 1LBEA 1I94B 2FEMA 3FF4A 3ILSA 1JXQA 4KLRA 2VHWA 2Y1CA 2GPAA 1VM6A 3OM0A 3STXA 2Q1WA 1TQ2A 1ZJ4A 5EHGA 3ZWYA 1T4CB 4JJFA 4BB5A 1XQVA 2CDAA 3LPAA 5ALVA 5ALKA 2GGSA 2IHYA 1G1AA 4NSNA 4Q0MA 1FZTA 5HIAA 1L7MA 6AT1A 3BQNB 2FUNB 5AHKA 5EXXA 3TI7A 4FCCA 2Q5JA 1EK0A 2Q3EA 5M29A 2AR7A 4PXYA 2W6JA 2PUFA 2EYUA 3HACA 1WX1A 4WZBB 4BO7A 3ZWBA 4XLZA 4QYIB 1DEKA 1ZIXA 1YVPA 1BCRB 2WAYA 3PZBA 4L2IB 5I7VA 2Q2NA 1NXWA 3N8DA 1U5AA 4WLOA 2NU9A 3C6KA 3MGKA 4JXKA 4MRAA 1XVTA 4RFSA 4TTAA 3O31A 3AF2A 5PGMA 4IEIA 3S81A 1N2GA 4FUTA 1DZIA 4CQMD 1LDNA 4RK5A 5DXJA 1OT5A 2E18A 4YPFA 3O9MA 4NYJQ 2BV3A 4JU8A 2RK6A 2CL7X 1T3TA 3SQWA 1LTKA 4RL6A 4UMVA 3UENA 1YI0A 1BDHA 2QX6A 2VBGA 3O82A 4CM1A 2DCMA 2A5LA 4IIUA 3F8SA 3ZWDA 2G9ZA 4JQSA 3R8CA 3CR7A 3L92A 4RY9A 2QYSA 1PJLA 2YZKA 4LHXA 2AG5A 4IQGA 3AX6A 5COBA 5FA5A 4ADSG 5TGZA 1CUFA 4PGGA 4QVKA 5KDOA 1UJ6A 4RJLA 4ZAZA 5DOVA 2JHAA 3PGMA 5HIJA 1GQQA 4DBVO 4RS4A 2AJDA 3QITA 5HXAA 1MFPA 2FP4A 3VR5A 1G55A 3GFTA 4I5EA 4F3KA 4QBIA 3NDBB 2P1RA 1MB4A 1WUKS 4M6WA 2ZBUA 3EZFA 5F2KA 4DDTA 1YQWA 2QMYA 4TVSA 1XMVA 4NXMB 4Q3KA 1R2QA 5EZ6B 4BO3A 5LZ5A 3EGWA 1K4YA 1ISHA 1YR8A 1RD4A 2ZAOA 4ZO7A 1ZIYA 3P2JA 4M22A 4UVIA 3OD5A 3EK2A 3WRXC 2BUBA 2G40A 3M3HA 1FA9A 2PUDA 1U2RA 1LDBA 1W5BA 3GLFE 2X23A 3SYRA 2IYRA 2QM7A 5I5EA 3OLZA 4ZAFA 4P0QB 3LIPA 3QNUA 4ZQIA 4CUJA 2R00A 3CBQA 4RSRA 3PHGA 4MA5A 2KHZA 5G41A 4MVXA 5C46F 1WOYA 1AKEA 2PD3A 4ZP1A 4G89A 3G5TA 1TO1E 4K3UA 1AZTA 3KYBA 4YN3A 5T67A 3L6UA 4AWXA 1XL1A 1G6OA 4HQFA 2ZR9A 3RB8A 4R1PA 1ZNWA 3H5OA 4MIYA 1T3GA 5I48A 3ZDQA 2I6QA 1X0XA 3R5KA 4YWJA 4FWBA 1I30A 2H4HA 3L6RA 3TAHA 3GEHA 2QMHA 2ZULA 2Y4OA 4QLOA 5CEFA 1BWQA 2BDEA 1QYCA 2FNAA 2PGXA 1MT0A 5J4KA 5JDIC 3UN1A 2XI4A 2Y3IA 4QGHA 3MBOA 2NXNA 2GTHA 3JQBC 4US1R 5FPSA 4BECA 4IKPA 4JXZA 1OX6A 4PZPA 3VV2A 2I8LA 4EZIA 2QX4A 3FYUC 2PS9A 3RU7A 4S3MA 3PITA 3GN2A 1VI2A 5DM1A 1DIHA 1GAEO 2A92A 4PY2A 2G09A 3L0ZA 1DC6A 3ZS9A 4DMKA 1TFRA 2YCBA 4P53A 1K0UA 2W6PA 3HWRA 4KR3A 4FYJA 1ZA1A 3P0FA 1G5QA 3SFZA 2FMXA 2DU8A 3ASYA 3C3BA 2IHZA 3EC2A 3AI2A 2B35A 3LJKA 2FUEA 5B64A 4CNQA 4AKIA 3STVA 4DBLC 2QVLA 3KM0A 2VSXA 1HYBA 2EBUA 1W581 1OBHA 2QYHA 2XMZA 4MJ7A 4OQMA 4P86A 3VR6A 4AAYA 4PNHA 1U7XA 3W9YA 1IM8A 2HBZA 5BYKA 2BGJA 5H83A 3G8DA 1P2GA 3PJDA 1JNXX 3L05A 3NHSA 3R3YA 5E9JA 3T38A 1DS6A 4U2EA 1GG2A 1PYGA 1YFJA 2VBCA 4D8UA 1UZNA 3SZUA 4DANA 1IULA 1L4MA 5LSAA 2YQ4A 4PLHA 1C3OA 1NAHA 4Q82A 3M6WA 2AI3A 4QQNA 4W1RA 1L8AA 2CLCX 1U8XX 2RHDA 2YWCA 3CZAA 1T26A 2K7FA 2YHUA 3PU6A 5FPKA 1OFTA 3W1WA 1EDEA 1CEEA 3AEQA 4S0ZA 1IZ9A 4U7PB 1GQRA 2IYTA 1NVWQ 1UKZA 4EHHA 3JZAA 3NWPA 3FR8A 3PDCA 4PLCA 5TQ2B 1E62A 3RT7A 2XUDA 3WB9A 5AK3A 5BURA 3GPLA 4Y7DA 2PPVA 3FWZA 3UHPA 3BWXA 4ZVNA 3EWNA 2X19A 4LJRA 4GG1A 4WX2B 3JQ7B 2PT9A 2NO6A 3CX8A 1H0HA 1Z83A 2P5UA 3AFOA 1XI2A 4XUEA 2GSWA 3K9CA 3SZOA 2R62A 3V9AA 1SY7A 1XRRA 2PZEA 4MDHA 1VSTA 4WDRA 5CB4B 4JB0A 1MBZA 4HRYA 2ACKA 4BDSA 2PRSA 4H59A 4KX3A 1SCJA 4BFLA 3V46A 1TYDE 1ULHA 1AF4A 2QUBA 3UGKA 2CLIB 1T6NA 1SXJB 4ZC8A 2WIAA 3WGKA 3FSRA 4DC9A 1ZBQA 2O7VA 4FEEA 2CXHA 1WL8A 3OOWA 3CINA 3M34A 5BNTA 4MQFB 4JI0B 5GINE 3D54D 4BQPA 2BHRA 1CD5A 3HE3A 2PV0A 1JKMA 1X1CA 4XWTA 3IKLA 4GXQA 3L18A 3OOYA 3NRCA 1C7JA 1NJ5A 1W34A 4F4HA 3M49A 2D3WA 2WIDA 2ZYGA 1E3LA 3P2IA 5GP1A 1P18A 2NUPA 2YN4A 3INNA 4CR6A 3O8DA 3I9MA 3PXBA 4X44A 3AHGA 3D6VA 1Y34E 3THXB 1KEPA 4AD8A 4JLMA 3A1VA 1HDCA 2PSFA 2XKAA 1ZMOA 4EF5A 3RC8A 1H65A 2PU7A 1HTTA 4UEOA 3N76A 4DOMA 3N58A 2QN9A 1E60A 4XIFA 1MEEA 9LDTA 1YR2A 5C3UA 4BP9A 3ZCTA 2VYCA 5EINA 3GT0A 3M2PA 5AI4A 3BWVA 3WLTA 1VLLA 4PC2A 4FS3A 4G85A 3MQFA 2HSJA 1I3KA 2QG6A 3E3NA 4NBVA 1T36A 3IL2A 2JC3A 4MV6A 2IBTA 3UNXA 4PZDA 2RHCA 3FYUB 3MAGA 1NM5A 3BA6A 3PUXA 2B25A 4Y6RA 3H5WA 3I12A 2ATEA 3LM8A 2W5UA 1ZD9A 4GPEA 4NBTA 1IFXA 1J2JA 3IP9A 1CRQA 2I87A 3LUPA 3QU7A 4HX5A 2BGUA 2AF3C 5CLGA 2X76A 1TRKA 5KINB 5ALJA 1LS1A 1KVTA 3EOZA 4Z7OB 5B30A 1RWKA 3PXAA 4JJGA 4JX9A 2VDNB 4MROA 3SOPA 4MV5A 2ZUEA 1XRPA 4TV9F 1JNYA 2HBRA 2NZUG 2YL2A 5BW8A 4P5PA 4XCVA 1M34A 3ZQJA 2F1KA 2H17A 2GNAA 2XMSA 4D45A 3C1AA 3OIWA 1H3FA 4BTEA 3DZIA 1GUZA 3DAHA 1J6UA 1F1BA 1DI0A 3JTMA 5G0WA 4E5VA 5AW6A 3JAMA 1JKIA 3A6DA 2P2NA 3BS4A 3IDQA 4IRMA 4KUGA 4NDAA 3RK1A 4EWLA 3TFOA 1MO4A 2CHFA 2CNKA 2GX6A 1E7RA 1UFRA 2CJYA 1FFXA 5F7ZA 1X3SA 3QJGA 1YHZA 4TVBA 4X6XA 2FEOA 1XZBA 4CNBA 1QDEA 4ZZ0A 4LOKA 4JXXA 4FFMA 2KBFA 1HG1A 1N77A 1J5XA 2IH4A 4MKFA 3PC8C 1SUAA 1ZH6A 4TYYA 3KXPA 4ZAGA 1Z2OX 5E4FA 3CRMA 1G3MA 3LX4A 1OJ7A 1YL6A 1F2VA 4LXQA 1QAOA 4PCLA 4F60A 2XSZA 3QUBA 1SOVA 2CHVA 1RAFA 4DV1B 1NF2A 1TQ8A 3KWJA 1N7IA 2QN6A 2YVKA 1SUCA 2PSJA 3FUUA 3PHHA 2PUCA 1YZUA 2FPUA 1ZN8A 3A1SA 4M76B 5FWXA 3SYMA 3GVIA 3N8KA 3P71T 4JOQA 5BSRA 4R2WA 4PYJA 2HF2A 2JEZA 2PHZA 4ZKDA 3KUXA 2V4UA 2DCUA 5FAXA 4F8EA 4YCNA 5AHXA 2VRCD 2GF9A 3IRVA 4MLZA 1EBFA 5E2IA 3CGWA 2WUVA 3EEIA 4NV0A 1B1CA 2B92A 1U2SA 3EBLA 4F2PA 3H2JA 1Z29A 2ZRIA 3G8YA 2F2TA 2JAWA 2Q99A 1HE1C 2XD9A 3V42A 4BLPA 5CXUA 1QRDA 1NP7A 1VFPA 3KPWA 3LGAA 3MTDA 4LWZA 4AW9A 4CL0A 2H1OA 4NJMA 1JU3A 2GEJA 1FXSA 1A9XB 2QTLA 1LF0A 3MUOA 1N2ZA 1TAHA 3DZJA 1UIRA 1K66A 1YBMA 4Q4AB 2QW0X 2W8ZA 3K0CA 2YW2A 3GQVA 3H1AA 4PZZA 4UKDA 5BWBA 2ZXUA 3NBXX 1JLLA 1ND6A 4XLLA 2AE2A 3A2NA 3WLHA 4YAUA 1VHQA 3I53A 5F7OA 4KU4A 2HAEA 2RHTA 4TUYA 2DR3A 3P27A 4KI0A 3S5JA 2AEMA 3UMCA 5AM2A 3CO5A 3Q8KA 4WADA 4Q7MB 4RD4A 2ZUFA 4AG5A 5GVSA 4KHPB 1CZRA 4D44A 3Q0TA 2ZIXB 4A5OA 1BU8A 2CXPA 4R9UC 1T9ZA 3ROKA 2WR8A 1NY6A 5FJJA 1M2WA 3JAKB 3N39C 1DO2A 1D2CA 1SC6A 1TU4A 4GBMA 5EQDA 3SE0A 1UXIA 3IAAA 4CG2A 3KDSE 3EXHC 1EFDN 3A32A 5G4KA 4Y0NA 2C58A 4L16A 5BQ3A 1CUWA 1LLDA 3OIYA 3HYCA 3TTTA 1JVNA 4L5BA 1P5ZB 1XFAA 2FQ1A 2XYVA 1R4NA 3D3EA 4K6HA 2AG0A 4L4YA 2H9IA 3TSCA 1RYZA 2IYUA 1H0RA 4WKNA 4B87A 4L3VA 4TMZA 2QVYX 4WK2B 1E4YA 2FJPA 4OA8A 1KO4A 4LY9A 5COQA 4DDWA 1L2TA 3MAJA 1BX1A 1YFKA 4MJLA 4X97A 1U0JA 2P9HA 3LWBA 5GM2A 1E2EA 3L8YA 1K86A 4OHWA 2NMVA 5BQOA 4NENA 3DTTA 4KN5A 4TTIA 3W5SA 3C14C 3OOJA 3Q88A 3WYDA 4BPRA 2Z3ZA 2WIFA 4X1IB 5KSYA 3C87A 3AOEA 4JAVC 3U1VA 3GP3A 5BYJA 2ZXEA 3LFHA 4B6PA 2IUTA 3MGGA 3NRBA 1ECFA 1QGZA 1EZ4A 1TW3A 1S8AA 1JJAA 3UXYA 2B1IA 4QYXA 4Q4CA 2C1XA 1NTRA 1LW6E 3IVMA 5FR1A 1YMVA 4C1BA 3B1XA 5EMKA 3ROQA 4MWTA 1JDZA 2QKYA 1MX5A 4J0IA 1Q91A 3ND9A 4UUBA 5DIFA 4ZDIA 5FV4A 5GMOA 3G0HA 1FNSA 2I2XB 5FNVF 2Z98A 3AB7A 2CBXA 1YR9A 2DLNA 4ZV4A 5L9AA 2R5FA 1PWHA 3UATA 3DQPA 4JBNA 4UDYX 1DO8A 2WIJA 1EX9A 3D7NA 5K0BA 3F73A 3BJRA 3PCRB 4PR3A 1OBVA 1U7ZA 3EDOA 4G01B 2BI4A 2H1SA 3A4MA 1FFCA 2QMQA 3EA0A 3K1TA 4IKOA 1AA6A 4OIFA 2DUNA 1PL0A 2QPAA 3RFFA 5IJ0A 2EKDA 4BBPA 1WMFA 1N0VC 2F9FA 4PGAA 5JAUA 1UT8A 4BV9A 3LCRA 1XIVA 3LZCA 4QUHA 4D4MA 2HDWA 2BDTA 4R7ZA 3A9VA 2C1EA 2W48A 1MB3A 4KFCA 2VF8A 5JD6A 1U2TA 1WU8A 4RYDA 3AKEA 2VXYA 2QL5A 2ONJA 4YJ2F 1EAYA 1YHYA 1Z3IX 3HUFA 4NMMA 3B1KA 3C3PA 2AH5A 3AVOA 3BMCA 4ICIA 1R4NB 1NVMB 3Q1KA 4DR4B 1XA3A 1XTRA 4LF7B 1U3CA 3B8HA 3E4CA 4LDJA 3IUBA 4B3SB 2QTZA 3OJLA 3QE4A 4X1YB 4CKXA 3G7SA 2GAIA 2F48A 2XCUA 1QHHA 2HSDA 3VR2D 1GTMA 1HLDA 4N5NA 4U2CA 4IJ5A 3RTDA 1L4YA 1SOMA 2OGZA 2DJIA 4OHBA 3WV5A 4BQEA 1GPDG 4HNUA 3CUTA 1XHEA 1NX9A 2XECA 4YAGA 5J43A 5IC6A 3KTFA 2PT7A 1P2DA 2A1UA 1EFCA 4U2BA 2GPJA 4RELA 5CJPA 5CNIA 1L9XA 3TBFA 3SY8A 4G0WA 3KEMA 2ZI7A 2J07A 2ZRMA 4AQ7A 3TRHA 4W1PA 3E3OA 3DMTC 2JBWA 3GJ6A 3ADDA 2EOAA 1J5PA 2NPOA 3ETEA 2R8RA 1SA0A 4JXJA 4RULA 1ZXXA 4V2UA 4JI3B 3ZXSA 4H1WA 2W70A 3VTKA 5DYYA 1PT8A 2AOTA 2MSLA 3PHCA 2AN1A 2MSDB 1U9IC 1UXJA 1Z47A 3P9YA 1VLZA 4K9KA 1FJGB 2W90A 3MWLA 4FI3C 1OA0A 1RR6A 2CNDA 2NO7A 3H42B 3QPVA 4AZ0A 5AWFC 4G0PA 1NV9A 3L7CA 2WWVD 3VRHA 3OTOB 1ZCJA 1B2LA 1ZM4A 2C42A 2XTNA 4HXEB 3DE4X 1PUJA 4KKXB 4KO4S 2BLLA 4GVLA 4XX0B 2ZR0A 4J7UA 4NYMQ 4LSGA 3WHLA 3UTDA 4I4NA 3ZGXA 1T5TA 1YNOA 1KP9A 3I9V6 3PP8A 4FS8A 4BFXA 2VHUA 2A9OA 1S5PA 2WI8A 3WIBA 1JHYA 5I9TA 1XHLA 4RUKA 2Z6VA 2GKSA 4YBRA 3MCUA 5CA0F 4OHPA 4Y18A 2QBYA 1X74A 1FVXA 2MSCB 1G6HA 2Q2WA 2P1DA 2BLNA 3F0TA 3HQ4O 1VL8A 4M1MA 1IE3A 3F1KA 2H65A 3UMVA 1CRPA 1MAUA 4TVOA 1SB9A 1DFIA 2OZPA 2QNIA 4JYPA 3V2GA 2CLKB 1I24A 3IBSA 5BRNA 5BVHB 1AS3A 3VR4A 1KEEA 4X71A 1ATIA 3DEJA 3O73A 3R7NA 1GCAA 1U1DA 4ZAWA 3ZCUA 5J3JA 1A50B 2VYVA 2CFRA 3L77A 4QAJA 4LQ4A 3Q8XB 1THZA 1G16A 4TL9A 3SCZA 3QVLA 1RLJA 2C07A 1MCZA 1RI2A 3PPIA 4R1MA 4YAIA 2AJCA 3O1LA 2XA9A 1UMKA 1L7DA 2FFRA 3A04A 1H4VB 2VNKA 5B4UA 4MKRA 4D82A 4H7HA 4GNRA 1W0KA 1D2NA 4DCNA 4Z7QB 4IDFA 5IAEA 2JK1A 1G5PA 3RVRA 4C6RA 2I4OA 3A10A 3PQ3A 4OFXA 2HO4A 4ZPXA 2X5XA 5FFFA 1QIIA 3K0BA 3I01A 2EERA 4FJ1A 2O2JA 1IUKA 1I4OA 1V3UA 2IEGA 4TMKA 4BU1A 3UHFA 2Y9MB 3GXBA 1KZHA 5ITWA 4DA8A 2X15A 1E9BA 4NFHA 2O2IA 3LW7A 1NIPA 3KX2A 4HWSA 3FTPA 4AWAA 2V45A 1GILA 3ENNA 1BRTA 1W35A 2GCEA 4HTFB 5JMPA 3G8CA 1RT9A 5IJ9B 4YROA 3WK5A 4C7XA 4EUHA 1NAIA 2QLMA 2I3GA 3BB4A 2NWQA 2QWXA 4I81A 5J5AA 3GP8A 1N6RA 2OFXA 5EWMB 1OC4A 2VDUE 3KL4A 1B76A 3KOWA 4Q9HA 2BFDA 2Y27A 4K88A 2FSUA 4R4JA 1ECLA 1OV6A 3O4FA 2QOEA 1TMGE 3PYXA 5SYMA 3EBPA 1NKVA 1QANA 1L4EA 1XL0A 1T36B 2HUPA 2REXB 5EIAA 1DV2A 5BSFA 4WT7A 4F45A 1OKKD 4HC4A 3R3ZA 5AK4A 1ZVKA 4YLGA 1WDMA 1P1BA 4FVTA 4PCUA 5KOIA 1KZ6A 3IEUA 4Q7KA 1H94A 4FFRA 3K2EA 4DN6A 1Z82A 5H3CA 4N47A 2G82A 3OF3A 1UJNA 3IERA 5JLAA 1PNRA 1TYCA 4OQPA 3ESBA 4TQ9A 3LOPA 2LV8A 5FWDA 4W7HA 2OXRA 4EFNA 3WSTA 2OOKA 3ET5A 1SOAA 1TT7A 2ZJ0A 3B7PA 3C3WA 3OZBA 3WGLA 3ZHUA 2REQA 4EJ0A 1KFEB 3LUJA 1XDBA 2Y2VA 2XIJA 3KAQA 2OZEA 4JB3A 4RGVA 4YUYA 1N7GA 4ZMBA 4J4HA 4MLPA 5CYGA 1XTUA 1XCOA 1LBQA 2ST1A 4GLLA 4PBSA 1B6GA 5BQPA 3AF0A 4IWNA 1HEYA 4QTYA 3U17A 1XZNA 2O8NA 4FYKA 2BCEA 2RHWA 4FYYA 5EGSA 5HRCA 2QTMA 3DT8A 3M81A 3T5GA 2DZDA 4MUEA 4ZYYA 3OEEA 5LLDA 2DEUA 3C16C 1T0HB 5LL6P 3AR3A 4YUVA 4DPKA 4DZZA 1LSSA 1P62B 2F17A 4PFKA 3V00A 2N47A 5HQTA 4HK4A 1RPZA 2I2WA 1RE1A 1RNLA 3CW9A 4N76A 2VP4A 3OWOA 3OLYA 4MINA 2EQ5A 4LECA 3W77A 1R00A 2OV3A 4GMDA 3K96A 2QQ0A 4WK6A 2OLJA 1KDOA 4AJOA 5KJFA 3OU6A 2X0IA 4LY0A 5B5SA 5HM6A 4QA9A 3OU2A 3A3KA 4CI9A 3KB6A 2ZKLA 1AK9A 1ZN9A 1KY3A 2JAUA 2O7QA 1WCV1 3AB8A 4WLEA 1M1UA 3JPYA 3USZA 2JBAB 3O9ZA 4PTYA 4V1CI 3ZQUA 3N53A 2BONA 1OZ0A 5H82A 3M89A 2B4YA 2VNSA 1T13A 1Q7TA 4ZCRA 1HYHA 1R0BA 2PA0A 4MQBA 5JSUA 3JWPA 1QIHA 1S3GA 4L6CA 1ZUD1 4QECA 1QIGA 4JVSB 1NUQA 2CZCA 4I66A 1P9LA 2GBLA 1DAEA 3G2QA 3F3KA 1KO7A 4F97A 3M6LA 1EFKA 3B1ZA 2VZ9A 1GADO 1CVLA 4EW2A 1JEYA 1RW4A 4HFMA 4E5PA 4WOPA 2WTNA 2O8EA 2VP2A 2W0SA 5KKAA 4RKYA 3AF4A 1VBFA 3I3SR 3QKSA 4P6VF 1EK5A 2BF7A 5AQEA 5A5FA 4ZKEA 2A35A 1XN4A 1Y8QA 3K6SA 2AOTB 3QKIA 4URFA 4RVSA 3NHFA 4HOYA 2CL6X 3ZWOA 3ANNA 3GN1A 2WHXA 4LS3A 1Q17A 3IKMB 1NBIA 5D1HA 1GSHA 2V5VA 5DLDA 5JJ5A 5FLYA 3OE7A 1SCUB 5ADHA 1JKJA 3C1OA 5KNDD 5AKLA 3L46A 3H2HA 3NHMA 3OLQA 5EJAA 4MPTA 2JLZA 4NCKA 4NU5A 3DS8A 1SXHA 3FDZB 2G1PA 4A0SA 1DEOA 2GZ2A 3O4RA 2BFEA 4U0JA 1XVAA 4MW7A 4BATA 3GLKA 1HZZC 3V7UA 4ZOBA 1SFRA 1MJGM 3U5ZB 3RSFA 1R5BA 3PE3A 4QGFA 4TQUS 4EHFA 1LBTA 2BT4A 3EIOA 5EQFA 3GJ8A 1SUFA 4E51A 3KVVA 4NTZA 4FX5A 4ZU6X 4FP9A 1H2ZA 2DM6A 1NHGA 2OC9A 3UJAA 4CIAA 3EZGA 3RR2A 1YFZA 2EX0A 4F6LA 1EFPA 3SMQA 1JWLA 3DLHA 1MOQA 2ZB7A 1YUNA 4Z6KA 1VE7A 4PYMA 2W2LD 3VISA 1DBRA 4CEJA 2HMVA 2QYTA 4DYHA 4MITA 1ORHA 1QPBA 2BUAA 3KXIA 1FMLA 1SURA 4BP1A 1ZKDA 3FNHA 4J0FA 5DNCA 3IT2A 4G5RA 4IO1A 4FCVA 2Q27A 4UJ5A 2X9LA 3FI9A 3UJ9A 4BQQA 1EA7A 4NMWA 4DY6A 1DJLA 5HUJA 2QTHA 1H4QA 3C8HA 1ZCZA 1GN8A 2OESA 2R751 4TT8A 1SZJG 5CG2A 3GH1A 1DV1A 1NVUQ 4G1VA 4JB2A 5AVOA 2WYOA 3HCDA 4DMGA 2FZEA 5D3MB 3MOGA 5JSZB 1PUIA 4F9TA 1NUHA 4M9CA 2NG1A 3AONB 4XWAA 2UUCB 3P9PA 3RREA 4EYOA 2ET6A 3HUDA 3NBQA 4N7RA 5CLLA 2MIIA 5JNWA 1QX3A 4D8VA 1R18A 2IXTA 5HX7A 2K2WA 2NSDA 2Q3CA 2B99A 2ZE6A 1PS0A 4J1TA 4QNMA 3RBZA 5IM4F 1QVZA 5K2MA 2B1RA 1M8KA 2H4ZA 4QJ4A 3REFA 3DLPX 4UU7A 5H81A 4XJSA 2H1LA 3IPCA 1OXKB 3PKZA 4IOMA 5C7LO 2R47A 3I52A 5JBIA 1M2GA 3NHYA 1Q1ZA 4ECEA 5A3QA 2F1OA 1K6MA 3EIHA 3KHKA 4NZPA 2PEYA 4BHTA 1N6HA 2D2VA 4GVXA 2XF8A 1FRZA 2XUHA 5ES4B 3A9UA 1ZD4A 2X5JO 2GHRA 1QYIA 2QL9A 2ISSD 4L5AA 3EXHB 3ESDA 4QICA 1RQPA 4C3ZA 7GPBA 1BE8A 2QPTA 4J1QA 3KV1A 3D0QA 3GCDA 1X7WA 3K92A 1GGVA 3DKKA 3ETCA 3LI2A 3N0TA 2V9PA 3QPCA 4IH4A 5DHTA 5BW4A 2DJ5A 1SXJA 4RK4A 3HDQA 3M4XA 3W7VA 3BZUA 3TIIA 1W36C 3KJHA 2ZS7A 3OICA 4LXGA 3CZ4A 4RMIA 3DLAA 1E66A 1IH8A 2RGEA 3MB8A 1T8YA 1WTAA 3IMCA 1JQBA 4PPYA 5CM8B 5AVSA 5JYBA 3DM5A 1U0SY 1SVMA 2FEKA 2KWIA 3Q9NA 4D4IA 3U16A 2DPMA 2ZT7A 4RFSB 3CM0A 2F3SA 3ZLUA 1QF9A 2XUJA 5LA6F 4BLWA 2FSIA 1ZGJA 4KACA 5EKSA 1JLRA 1XRQA 4QHYA 1Y98A 5DHSA 1O89A 1GQOA 2IF0A 3M2TA 4IMRA 3D1JA 5HWSA 5KYYB 2H7YA 4A0QA 3I01M 2P7HA 3KZCA 1OAAA 1GNQA 4BRUA 2ZRJA 2ZJ3A 4I19A 4OK3A 3UCEA 4REQB 1GPNA 2LBPA 1KIFA 1CRZA 2I0FA 1B6TA 1I5RA 3KZOA 5EIOA 4E4RA 4LF5B 5LNK1 1LPOA 5AKKA 2P2YA 5EKXA 2N1BA 3GA7A 2EJUA 4LX0A 4E1BA 1PG2A 4QU5A 1ZISA 1XGKA 4PRKA 4EUFA 5AVTA 5EJ4A 5JC8A 1U0BB 1ZUNB 2P69A 4M60A 3BB3A 3T1YB 3EXFA 5K4AA 3C6QA 1LTHR 4TKVB 3WIDA 1CNMA 1Y6JA 4FZ3A 5TDHA 4BO2A 3PV0A 3BA1A 3UJBA 4W5NA 1QIEA 2ERCA 4UUNA 5G3ZA 3Q3VA 5IH3A 2P9FA 1QH1A 1CJBA 1Y5MA 4O2AB 3WO0A 1D0SA 2F43A 3ML1A 4CL8A 5BOSB 3GQBA 5DPMA 1B3RA 1WBDA 4O33A 2WSIA 4NATA 1M6NA 3F5QA 2XHZA 3F8WA 1TVKA 2I4RA 1C9EA 2N75A 2RC6A 3GU3A 3QXHA 3CNBA 6ABPA 5CEJA 2YVUA 5LWQA 5CH3A 3UB4A 3BXHA 4COOA 4EI7A 4ZCTA 1JHXA 3KRTA 1JDNA 1LWOA 2PSSA 4AY2A 3MT8A 4RETA 3B52X 2F4NA 3EXG1 1W59A 1GYPA 1R50A 4PG7A 1E98A 3WQBA 3WRVA 5JDCC 1U7HA 4FC7A 1MC4A 4NDNE 3T1QA 2XGOA 3RWOA 4FGWA 5E6SA 3VJLA 3QX9A 4EUEA 1SVUA 2WZQA 4HWTA 3L1UA 4LK2A 2C5AA 2O8BA 3QKSB 5ALHA 4YB8A 1GTVA 2YV1A 2AD5A 4C4PA 1EWYA 5DBFA 4YV2A 2X77A 2WFZA 3Q1LA 1MUUA 1VKOA 4KTVE 4MVJI 5JO0A 2IUYA 2F90A 3QELA 1CERA 4NLLA 3QEBZ 1EXVA 4Q9AA 3HDGA 5EXSA 3TTUA 1SUPA 4RK6A 4GL2A 2ZRNA 3A3NA 2CNLA 2WABA 1VKZA 4NZNA 1AS2A 3UWOA 2WD7A 4FLMA 1TIPA 3DEAA 4Z4HA 5IK2D 3B9BA 2BEJA 5KTRA 1N1EA 2FW0A 1DQPA 2W2NA 1XB2A 4DQDA 4OHXA 3DUFA 2H2AA 4JC8A 4HN4B 4Q34A 2ZYHA 3RNLA 1K08A 3CUEF 3S5UA 2NVBA 2AFHB 1ZJJA 4JLAA 4UOZA 3NH9A 1XWIA 4N7BA 3K5HA 5KHAA 2OY0A 1G8MA 1CUSA 2VT6A 3OSZA 4P4LA 3RYHA 1SU6A 2P5YA 3K16A 2VQEB 3L8FA 1WA5A 4GR4A 1RRVA 5FL3A 4AKTA 1EVIA 4BLRA 5IAOA 1GUYA 1KZ1A 3CLRC 1E3QA 1CQPA 2JJQA 2DMRA 3ENVA 1GZSA 4RHXA 4X1KB 1M6EX 3WYGA 4CLXA 3C3MA 2PX2A 4JL8A 3PEWA 1XNJA 4F96A 4C03A 3Q72A 2NXJA 4OI2A 5F5LA 4XA8A 1MQAA 3OFJA 3HPQA 3V4SA 2OD7A 1QCCA 4P2BA 2PD6A 2Q7XA 3C48A 4YDHB 3THWA 4LXTA 5HMMA 1Y7HA 3VH2A 3HMKA 4DMFA 1UJ2A 1CR0A 2HMSA 2WJHA 4BGUA 2R9VA 1C81A 3B89A 1UANA 2HPVA 3LXXA 2VKTA 1UWKA 2IQ5A 2JEYA 1Z8HA 2BRUA 2YICA 3CG0A 3TX2A 5BNWA 1XMQB 2I34A 1B8VA 2J46A 3UVEA 3BFVA 3CUSA 2AFIB 3D4BA 3DZDA 1N5DA 2HEGA 3HP1A 1N2IA 2R25B 4IZ6A 2VP6A 2HSZA 3EJ6A 2OCDA 3EG9B 4CM8B 2JCVA 2XX3A 1KJNA 3DYBA 1M2EA 1CZLA 4S1OA 4E4YA 2Y99A 4ZGBA 3M1IA 1V26A 3TZCA 3EWSA 4OV6B 1OPXA 1Y89A 2NXEA 4HGZA 3VJMA 4YWHA 1T24A 1MVLA 1L1QA 1JPVA 2J9FB 4XFDA 2WVJA 4WN3A 1KP2A 3C6YA 1P4SA 3DOHA 4HAYA 4GO1A 3H5NA 4D98A 3A6LA 3OPXA 1NE7A 2GNOA 1T91A 2PX3A 1NVEA 3PNBA 3UJ8A 2NP7A 5DW0A 1HE4A 3MPUA 4LQDA 3SN6A 1EM8A 4G0OA 5EN4A 1I2AA 1KSFX 4WK0B 4E03A 2CMKA 3VFDA 1AY0A 2QY9A 3O83A 4N40A 3PPWA 4YBZA 3TLEA 4IXDA 1T9AA 3I37X 5HK8A 4M1QA 3FKJA 2WOJA 3DDSA 1NTOA 3G5AA 4BNDA 4QQRA 4XSHA 4W5TA 4QATA 1E1MA 1NDHA 2IV3A 3WYCA 4R1TA 1RPNA 1TF7A 4YAWA 1A9PA 5JAPA 4EUNA 1OW3B 2YV4A 4EHIA 3D81A 3CUUA 4EW6A 1H6CA 4JOSA 1QU2A 2I4MA 3KU1A 5IAAA 1NRWA 3THYA 3SGLA 1ZJ6A 1XO1A 2GCGA 1KSHA 2ETVA 2B78A 3PEFA 3UWPA 3DWIA 2RHOA 3ISTA 4FJ2A 4PZYA 4R2KA 2BSQA 2HQBA 4EGJA 3ZVNA 1ST2A 2C00A 2NLOA 2L18A 3AUAA 2V6FA 4KCGA 4K9QA 4CKBB 1PIWA 1GGMA 3OZWA 4TS1A 3S3TA 1OV4A 2ZIVB 3A37A 1REQB 4M0LA 5AHRA 1F9AA 2JAOA 3DZHA 3QNWA 4J03A 4OB6A 1NLFA 3O7MA 4JYCA 1OWMA 3OAAD 4C0SA 1FVFA 1UBTS 4H17A 4D9GA 3ZD6A 1QLJA 2DHDA 5F78A 3T3HA 1G7TA 1A5SB 2ZRFA 2V6IA 1ODSA 5J2UF 5FWNA 3WBBA 3CURA 2O7NA 5E8JA 1KJ8A 1CZOA 4FKMA 4ASUD 1GFWA 1NJGA 1XD2A 3DKIA 5BY2A 1OFVA 3MS4A 4Z0HO 1SRQA 1B43A 4E3ZA 3I92A 4KNVA 5EPEA 4UHEA 3HYRA 1GL9B 2HWKA 3FPAA 4JT8A 5EUCA 5JCOA 2CLDX 5LU9A 4G1UC 2E49A 1TUBA 4IFEA 4X92A 2XNDA 3LUAA 3SICE 4L9AA 3RANA 5JWRA 1T8WA 3OX1A 4UXHA 2YWBA 4C1NA 2AA3A 3F2IA 3JVUA 4AF7A 5D85A 3NORA 3Q0IA 4Y2QA 5A1JA 1PS9A 1W87A 2XYHA 1RQXA 5JI3E 1N5IA 2C2GA 3PFHA 1AHPA 4JP5A 1WV0A 1EM8B 2QI9C 4FOSA 3GL9A 3TXXA 2O3QA 4LSZA 2WSBA 4J43A 4IILA 2PAFA 1LDMA 5A4FS 1TZMA 4NYIR 3JVVA 3DMYA 4BJ6A 3KZNA 3GT4A 3LKZA 2YIVX 2KS6A 3DVAB 3MC1A 4KYUA 3NEPX 1NW7A 5DGCA 1ZMTA 5T41A 1MJ5A 4D9NA 4XPIA 3DTYA 4DQLA 1F51E 1I36A 2ZTVA 1CQJA 1TEHA 2D7CA 3DC2A 3I0ZA 4PLZA 4CWAA 5SY6A 1SQ0A 2OHOA 2J7KA 4PQYA 4MQ4A 2QUZA 1NASA 4HNHA 1F0KA 3SQLA 1UDCA 5AQ1A 4DM3A 4ARZA 3R3HA 4AJKA 2V6GA 4CG3A 1MB9A 5EPUA 4ZRMA 2F7SA 5SZJA 3CA8A 1ZM7A 1DBVO 5AVZA 2VQ3A 3UWSA 1JWAB 1ZCAA 2XLBA 2UYOA 1SHTX 4X20B 1GRQA 2GN4A 4HNSA 1X14A 4IH1A 5IASA 2VTVA 3KVRA 1Q3KA 2VHCA 3OZVA 1SVOA 4O3FA 4EPYA 1JJ7A 4OLHA 3QY0A 4QUDA 3GJQA 3DCYA 4A2PA 2XW6A 4X85A 3IHKA 1GO2A 3ZCPA 2X4DA 4I14A 1MO6A 2R6AA 3WWZA 1HTWA 3DTVA 1M2HA 5D84A 2Z2KA 5C8YF 4ZJZA 3DPSA 1KU0A 2W6QA 4TMFA 1K9SA 1Y3CE 2IGTA 2OGWA 3EDCA 1BO6A 3TLXA 2O06A 1P5JA 1D9ZA 5CYOA 4OJMX 4QL3A 1NJSA 4CF6A 4Q1CA 4F56A 4EEKA 3BWYA 1T3SA 2E4ZA 1R0CA 3HR7A 1E2LA 1JTFA 1V11B 1YRHA 2B4TO 1U1FA 2OZLB 4ZYXA 5CBPB 3CWCA 4U7FA 3AILA 1V48A 2HEIA 1SELA 4EQ6A 1P1JA 2W2QA 1EEXB 3CF2A 4H9GA 4JMLA 4CMEC 1U0GA 3SVZA 2A84A 1YFLA 1E9SA 4YCCA 5MGNA 2FLKA 4EFLA 4UBJA 3W34A 2CL5A 1O96B 2IEDA 1YS9A 4OXYA 3ZHCA 3KPYA 2NTYC 2VJYA 3NB0A 4DB4A 2NZYA 1ZXBA 3FVRA 1OH5A 5CDSA 4GE0A 1Y33E 2C8JA 1SM4A 2P6RA 4AY3A 1A7JA 1UFOA 4UFOA 3ETHA 4F6RA 3CT4A 4RC9A 3V1UA 3ZVLA 1ORVA 1WXXA 4D3FA 1Z26A 4Q9KA 1IOLA 4WFQA 4BKQA 4UTNA 4URYR 2Q5QA 2XQFA 1JF8A 2EAUA 4R0VA 3WBJA 4WK4B 2J85A 2ZBPA 4KLAA 2YBDA 1KDZA 2ZRDA 2UYHA 3UIEA 3BCUA 2FEXA 3IIKA 4DSAA 2X8BA 2ZETA 3OD1A 4C4SA 1WDLA 4H7JA 1CJMA 1Z3CA 5DNWA 1EK6A 4C0BA 2NXCA 5AVVA 1IY9A 1QFMA 2QY6A 1W4LA 2Z83A 4RVOA 4AM8A 4B3DA 1TKAA 2PMWB 1LPNA 3O75A 2O6HA 4KR6A 1QG6A 3BL5A 1RTTA 2GPSA 2H2WA 4Q3LA 4NMLA 3V3TA 4C05A 1VHLA 2CBZA 1H1LA 2LRHA 3H5TA 3LF1A 3NHKA 1E3WB 1O77A 4EI2A 4JWTA 1SKAA 1RPTA 2AWNA 3VU3A 4POOA 1WY7A 2B2CA 1Y5NA 2G63A 4KP7A 3JYQA 3P52A 2VQFB 3BK2A 1GPH1 1A0OA 5BOSA 4HEJA 1C3XA 1QZUA 1U1GA 1EGVB 4M87A 5TPZD 4MHTA 4IVNA 3SHTA 1ZK3A 5KOHA 1GCIA 2PZAA 3OCUA 1IZZA 3H05A 1OTYA 4CCWA 1GTSA 1IXZA 1E6LA 1L4HA 4QU8A 3WX0A 1TM2A 1ZM3A 3PIIA 1H42A 2JIZD 1PJTA 1BEUB 1ZS9A 4G84A 5I47A 3U9LA 3Q87B 2Q7DA 5DRTA 1U9ZA 1Y9JA 5JJBA 1D3AA 1M1YE 1SBNE 2B4QA 3DP7A 1V95A 2ASEA 3HLKA 3RHTA 4EABA 4YI3A 3HVRA 4GDFA 5AW9A 3IULA 4F8YA 4AK9A 2QZZA 1V4NA 4MGYR 4IDDA 3GC6A 3AL3A 3GLUA 4MVJH 2PX5A 3T3OA 2SICE 1J0AA 1C1XB 2DFNA 2RHBA 3KSMA 4BYMA 4RTMA 4S1VA 2H31A 2ATIA 2ECFA 3H4MA 5F76A 4CM9D 3OTWA 1DP4A 2HU2A 3FTNA 3BMOB 5ALWA 3FYUA 2GPYA 2VH2A 2ZM5A 1T2FA 4F6RB 1QIFA 1FX0B 3P4XA 3AYXB 3LO5A 1EBUA 1RWXA 3P2YA 2F64A 2FFAA 1PO7A 3U44B 5ALTA 1HDEA 1MU0A 2JGKA 4H15A 3B3GA 2YHSA 3V1MA 4WINA 1WY5A 2YZGA 1M10A 3GLHA 4KOEC 2CV2A 5CM9C 4D41A 1OHHA 2AQIA 1BCRA 1TYEB 4BLUA 5FIUA 1QTNA 2VP9A 1QONA 3LLVA 5IM4A 1WO8A 3MWDA 4V39A 3PDWA 5LUAA 2BFBB 4YR9A 3PQDA 3SP1A 1Y3IA 2HJGA 3NXSA 4OQZA 4DJ5X 3DXYA 3ZGYA 2WTMA 3S2EA 5JT1A 3IUQA 5AESA 8GPBA 5FUMA 1BJRE 3GHHA 3N2GB 1AIPA 4OXQA 4AP6A 2LDXA 2HLNA 5BV8A 2HFJA 3RF7A 4A23A 4NDZA 3DTNA 1KJWA 1DX4A 1X7DA 1DFGA 1EWRA 3LVQE 3R0JA 4OHUA 3IV6A 2IFTA 5KMGA 3EIXA 3Q40A 3QYPA 2AJBA 2PLNA 4DV5B 1RQRA 1VLVA 2NU7B 3G9UA 3WKAA 3VO8A 3ABRB 3CSSA 2XZDA 1CS4C 5KYGA 3BORA 1EQUA 1VMAA 4N9WA 5IFKA 2FI1A 4GE3A 2O2HA 1UJMA 1KKLA 4TRNA 4UASA 1QIJA 2HMTA 3A6KA 1HQKA 3F96A 4AVYA 4EDHA 2AC7A 1V6AA 2D1SA 2RONA 4EVSA 3DVQX 1YB5A 2VT7A 3IOEA 2M1XA 3HEMA 2I1QA 4HZGA 1GVHA 1CIJA 4JT4A 1C9JA 2P67A 5CM2Z 5FL7A 4RD2A 3ZIAD 3ZUPA 3U62A 3INGA 2AFVA 1ZQ1A 3FOWA 3UC9A 3KAKA 5EZ5A 2GM5A 3MJCA 2ZI5A 3WDKA 4FOOA 2PDAA 1WKVA 3PNQA 1VLQA 2J9RA 2OQ2A 2R6DA 3BHIA 3OZAA 3PFKA 3T0FA 1DGQA 3RS8A 3W05A 4GM4A 1VKNA 1VYHA 1R9MA 2QX9A 3B3AA 1X70A 3UQZA 5KOHB 1K3UB 5JO9A 1HSOA 4DXDA 5MGBA 2ORYA 2YDYA 2JW5A 2EQAA 1YBVA 2QN2A 3MJDA 4XDZA 2H1VA 1FP1D 3TGWA 4ESEA 3NMUF 3IH5A 4WZ6A 1R74A 1OQAA 1CDOA 4A5SA 2A9JA 1HFKA 5A03A 2WF7A 3R7LA 4HY3A 2QW1A 3L1JA 2HHHB 1Z28A 2A9RA 4PZEA 2FWNA 4GLFA 3HXTA 1QU3A 1RJGA 2XMRA 1SHKA 4UM5A 4IXNA 5C9ZA 3TVDA 1TKBA 4D8TA 2C4KA 1CQWA 4UVDA 1YVEI 4LC1A 4AJJA 3HI6A 3KPJA 3H1TA 1ZW6A 4P58A 2OCBA 4L6AA 1P81A 1K8YB 2EEPA 2WT8A 2CDBA 5ILGA 3KDPA 3S40A 3KJEA 1QE0A 4KX5A 3T3IA 4FYWA 2PT6A 1K27A 4KIWA 2PKYX 5CVDA 3S1LA 4Q03A 4ZTBA 5A4DA 2O8BB 4NL4H 4MS3B 1ZG3A 3V32A 4PSAA 1T1JA 5FNZA 3CLVA 3FNIA 4FQ5A 1DOAA 1FNNA 3F7NA 5EWLB 1XPJA 4EFKA 4K9DA 4NCIA 1XZDA 3DKVA 1MD9A 2HR1A 4EIWA 2N1MA 3QVMA 1YA8A 4OSEA 4XRGA 3UHOA 3W6UA 4YMTA 2AJ8A 1Z39A 1DKPA 5EHIA 2P0EA 9ABPA 5H9WA 5HJEA 1AHHA 2H1WA 3U0BA 4E11A 1MFZA 3KQPA 4M8SA 1U8UA 1OLXA 3TSOA 2GHIA 4R01A 4AMGA 4F91B 3FJYA 4WXPA 3RTGA 1JIKA 3N86A 2C5BA 1DEHA 2C8VA 5HTKA 2D54A 4EKDA 4FCWA 4F9GA 3GUUA 1OFHA 2O0KA 3I28A 4NJEB 1FFHA 1EPUA 4H18A 4DLRA 3O0TA 5A9SB 5AMXA 3HA7A 4Y6PA 1GQSA 2P8JA 3I2KA 3IESA 1DX9A 2BFOA 3AUJB 1Z06A 4GQAA 3RS2A 4DC1A 5BVHA 3MTAA 3EF0A 5C37A 3R0IA 3SVTA 5IEJA 3RFUA 4D9HA 1ACLA 4ZQEA 4TSRA 5CFPA 1EP1B 1NRIA 3RT9A 2RHRA 1DTSA 2FK8A 1BKYA 2VPPA 4ID3A 5H8WA 2XEDA 3RVOA 1GTZA 3FNQA 4QBHA 3TKLA 4YV7A 4JJKA 1TK3A 3D7LA 3VR4H 4BEJA 2EHJA 4IJQA 4M1ZA 1JHQA 5JY1A 2Q8QA 3CVJA 2V98A 3P2KA 4YMIA 4UCWA 3GJTA 3J7TA 4Z9XA 5KWJA 1CUVA 2JGRA 3DWGA 2CK3D 3D2AA 3WK6A 2JJ8A 1AXEA 2TRSB 2JAXA 2WBLC 2FQYA 2CSUA 1GR1A 4GBGA 1NMXA 4GLOA 4C6SA 2ILTA 4B35A 2QVZX 1UPTA 2I2AA 4HQLA 4Q18A 5BV7A 4O2AF 3K72B 1IG3A 3LCCA 4Y3UA 3AMVA 2A14A 1AA9A 1C41A 4GI5A 1LDEA 3FD8A 2ZRCA 1W0JD 1SVNA 4EGCB 3EOAI 1W1IA 3S4YA 4TV8F 1TYBE 3ZG6A 3IE2A 1VC2A 3UAYA 2CL0X 1T8PA 4TLMB 5GONB 3VPHA 2ERYA 3C5VA 2WIGA 2B1QA 2C4HA 2ZVDA 1BMFA 3PLAE 3RS3A 2I80A 3WWOA 1E69A 2YINC 3MMPA 5IVKA 1N8TA 3AF6A 3HGMA 4XR4A 2V0CA 3OTQA 4X3CA 1Z16A 2IYZA 3FKSD 5E38A 4F5YA 5B6JA 3FW1A 3LT5A 1K2WA 4NC9A 1KP3A 4ESVA 1OX4B 1PEKE 3R5FA 1UT5A 2SHKA 4JLKA 2ZI4A 4IDQA 2OXEA