5HJFA

The apo form of dps4 from nostoc punctiforme
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
179
structure length
179
Chain Sequence
b'TQTLLRNFGNVYDNPVLLDRSVTAPVTEGFNVVLASFQALYLQYQKHHFVVEGSEFYSLHEFFNESYNQVQDHIHEIGERLDGLGGVPVATFSKLAELTCFEQESEGVYSSRQMVENDLAAEQAIIGVIRRQAAQAESLGDRGTRYLYEKILLKTEERAYHLSHFLAKDSLTLGFVQAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin, Dps family protein
publication title On the trail of iron and zinc bindning to Dps4 from N. punctiforme
rcsb
source organism Nostoc punctiforme
molecule tags Metal binding protein
total genus 71
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5hjfA00
3BVFA 2JD70 5E1UA 3PW8A 4EVDA 2IU2A 3RGDA 3QHCA 5C6FA 1UVHA 3E6RA 2GYDA 5AXSA 3T9JA 4ZKXA 1B71A 1RCDA 4CVSA 3H7GA 3F32A 3QHBA 3E1PA 2V2SA 3R2HA 1YUXA 4CYBA 3TA8A 4RC5A 5GN8B 2ZG9X 2ZA7A 1NFVA 1J30A 2CN6A 3Q4OA 2VZBA 4TOEA 2CHIA 1L8IA 2C2FA 2FZFA 3AF8X 4DZ0A 3SHXA 4ZMCA 2D5KA 4PG0A 1IESA 3SIDA 5CMRA 5IX6A 2FHAA 3WVVA 3U90A 2HR5A 2C2JA 1Z4AA 1JI5A 1JIGA 3PVYB 4KVQA 2HTNA 2V2RA 4CMYV 2GS4A 2X170 4Z3BA 4DE6A 3PVRA 2GYQA 4MUDA 5GU0X 4RC8A 1UMNA 4ZKHA 2FKZA 4OYNA 4LQHA 1MOJA 4TW3A 3E1NA 5LG2A 1TKOA 4M32A 2XJOA 1TKPA 5CMQA 3PWQA 3IS8A 4PG1A 1QYBA 1YUZA 4RC6B 4XKTA 3VNXA 5FFEA 5JKMA 5GN8A 2WLUA 4U3GA 2Z5PA 5LS9A 2CLBA 1JKUA 3SE1A 4ZLWA 4PGKA 1VJXA 4II4A 4CVRA 2YW6A 2BKCA 3EZ0A 3R2MA 2W0OA 3NP2X 5E2DA 3UOFA 3AJPA 1RCCA 1TJOA 4CYAA 4IWKA 4P18A 2QQYA 2WLAA 2RBDA 3RD0A 4ISPA 4EVBA 1F33A 4ITWA 4ZKWA 3UNOA 3BVIA 4QUWA 3KX9A 5D8SA 4ETRA 1RYTA 4AM5A 3IS7A 4AM2A 2F7NA 2Z90A 1AEWA 3Q4QA 2YJJA 1EUMA 3F35A 1S3QA 5GOUA 5D8OA 5J8SA 3QVDA 4TOBA 3R2OA 3F34A 2V2IA 3HIUA 3E2CA 3AJQA 4RC6A 1HRSA 4CVPA 5LG8A 3ERZA 5K53A 4E6KA 2PYBA 4DYYA 2ZA8A 3KWOA 3KA3A 5D8XA 4MJYA 1RCIA 3BVLA 2CHPA 2CIHA 5JKMG 1NF6A 2G4HA 2QF9A 2FG8A 1H96A 2V2NA 2BK6A 3R2RA 4XKUA 1IERA 3BT5A 3ISEA 3FI6A 3AF9X 5FFDA 1SQ3A 2FFXJ 4R42A 4ITTA 3BVKA 3HL1A 1ZUJA 4PGIA 1VELA 5I4JA 5FFBA 2ZURX 1S2ZA 3R2SA 3RAVA 2BJYA 4DYUA 5GU3X 1O9RA 5FFCA 4TOHA 4Y08A 5D8QA 1L8HA 4DASA 3KXUA 5J9VA 2YW7A 1RCEA 1N1QA 3F33A 2V15A 3E1JA 5JKLA 3WNWA 1YV1A 1LKOA 2C2UA 5HQOA 2ZA6A 4RC5B 4ZL6A 3E1QA 1R03A 4M33A 3RE7A 4DYXA 3Q4NA 1QGHA 1MFRA 1VEQA 2V2MA 3QZ3A 3OGHA 2Z6MA 4LQJA 1JKVA 4EVCA 2CEIA 3EZUA 3KA6A 1TK6A 1F30A 4TO9A 3PVYA 3AK9A 4KVSA 3RBCA 3UOIA 1JREA 5HJHA 2OH3A 1VEIA 3A68A 3PVTB 3QD8A 3PVRB 1O9IA 3PWFA 3WVWA 1BG7A 1Z6OA 4MY7A 1DATA 2FJCA 2BW1A 4LYXA 2V2OA 1SOFA 4IXKA 4ZL5A 1JYBA 3ES3A 4A25A 3AK8A 2CF7A 3E1LA 4TOAA 4XGSA 4Z5SA 4CY9A 1FHAA 2Z5QA 3F36A 1DVBA 3F37A 5GU1X 3SH6A 2V2PA 1Z6OM 3E1OA 3MPSA 1JI4A 2Y3QA 4IWJA 4MN9A 5CZUA 2YJKA 1ZS3A 4LQVA 3GE4A 5JKLG 4RC7B 3R2KA 2XJMA 1LKMA 3PW1B 2CN7A 3NOZX 2JD80 5ERJA 4DI0A 4LPJA 2FL0A 3F38A 4MKUA 2ZG8X 1LKPA 1BFRA 2IB0A 4TOCA 4M35A 3PW8C 4II4B 5FEJA 1VLGA 2CLUA 5D8PA 2UX1A 3E1MA 1GWGA 1S30A 3FSEA 3QB9A 2V2LA 3AJOA 1XZ1A 3PVTA 4YKHA 5HJFA 3KA8A 2XGWA 5J8WA 4XKSA 4CVTA 2OC5A 4KVRA 1KRQA 3R2LA 4TOGA 4LPMA 1OTKA 5J93A 4EVEA 4ISMA 1NF4A 2IY4A 2C6RA 3KA4A 5D8RA 2V2JA 3KA9A 3NP0X 1XZ3A 4ML5A 1NNQA 2FG4A 3GHQA 3OJ5A 3IQ1A 4LPNA 4LYUA 3Q4RA 2VXIA 4ZJKA 3E6SA 3GVYA 3O7RA 2XKQA 2WTLA 4AM4A 3PZAA 5FFAA 5JACA 2VXXA 5K52A 3AF7X 1DPSA 3WVUA 2Z5RA 3EGMA 4RC7A 1LB3A 4TODA 3ISFA 1RCGA 3O7SA 3PW1A 5ERKA 2XJNA 2JD60 3BVEA 2ITBA 5D8YA 4M34A 2C41A 3BKNA 3FVBA 4ERUA 5LBHA 4CMYA 4TOFA 3A9QA 1JTSA 4LQNA 2ZG7X 3PWQC 5GU2X 1BCFA 1JGCA 4ZTTA 3F39A 4DYZA 4REUA
chains in the Genus database with same CATH superfamily
3BVFA 2JD70 5E1UA 3PW8A 4EVDA 2IU2A 3RGDA 3QHCA 5C6FA 1UVHA 3L0MA 3E6RA 2GYDA 5AXSA 3T9JA 4ZKXA 1B71A 1RCDA 4CVSA 2V8TA 3H7GA 3F32A 3QHBA 3E1PA 2V2SA 3R2HA 1YUXA 4CYBA 3TA8A 5JDOB 4RC5A 5GN8B 2ZG9X 2ZA7A 1NFVA 1J30A 2CN6A 3Q4OA 2VZBA 4TOEA 2CHIA 3VVAA 1L8IA 2C2FA 2OKCA 2FZFA 3AF8X 4DZ0A 3SHXA 4ZMCA 2D5KA 4PG0A 1IESA 3SIDA 5CMRA 5IX6A 2FHAA 3WVVA 3U90A 2HR5A 2C2JA 1Z4AA 1JI5A 1JIGA 3PVYB 4KVQA 2HTNA 2V2RA 4CMYV 2GS4A 2X170 4Z3BA 4DE6A 3PVRA 2GYQA 4MUDA 5GU0X 4RC8A 1UMNA 4ZKHA 2FKZA 3UFBA 4OYNA 4LQHA 1MOJA 4TW3A 4E40A 3E1NA 5LG2A 1TKOA 2XJOA 4M32A 1TKPA 5CMQA 3PWQA 3IS8A 4PG1A 1QYBA 1YUZA 4RC6B 4XKTA 3VNXA 4W4LB 5FFEA 5JDOA 5JKMA 5GN8A 2WLUA 4U3GA 2Z5PA 5LS9A 2CLBA 1JKUA 3SE1A 4ZLWA 4PGKA 1VJXA 4II4A 4CVRA 2YW6A 2BKCA 3EZ0A 3R2MA 2W0OA 3NP2X 5E2DA 3UOFA 3AJPA 1RCCA 1TJOA 4W4KB 4CYAA 4IWKA 4P18A 2QQYA 2WLAA 2RBDA 3RD0A 4ISPA 4EVBA 1F33A 4ITWA 4ZKWA 3UNOA 3BVIA 3JZ9A 4QUWA 3KX9A 5D8SA 4ETRA 1RYTA 4AM5A 3IS7A 4AM2A 2F7NA 3FRSA 2Z90A 1AEWA 3LKDA 3Q4QA 2YJJA 1EUMA 3F35A 1S3QA 5GOUA 3FRRA 5D8OA 3QVDA 4TOBA 3R2OA 5J8SA 3F34A 2V2IA 3HIUA 3E2CA 3AJQA 4RC6A 1HRSA 4CVPA 5LG8A 3ERZA 5K53A 3VV9A 4E6KA 2PYBA 4DYYA 2ZA8A 3KWOA 3KA3A 5D8XA 4MJYA 1RCIA 3BVLA 2CHPA 2CIHA 5JKMG 1NF6A 2G4HA 2QF9A 2FG8A 1H96A 2V2NA 2BK6A 3R2RA 4XKUA 1IERA 3BT5A 3ISEA 3FI6A 3AF9X 5FFDA 1SQ3A 2FFXJ 4R42A 4ITTA 3BVKA 3HL1A 1ZUJA 4PGIA 1VELA 5I4JA 5FFBA 2ZURX 1S2ZA 3R2SA 3RAVA 2BJYA 4DYUA 5GU3X 3D19A 1O9RA 5FFCA 4TOHA 4Y08A 5D8QA 1L8HA 4DASA 3KXUA 5J9VA 2YW7A 2MGYA 1RCEA 1N1QA 3F33A 2V15A 3E1JA 5JKLA 3WNWA 1YV1A 1LKOA 2C2UA 5HQOA 2ZA6A 4RC5B 4ZL6A 3E1QA 1R03A 4M33A 3RE7A 4DYXA 3Q4NA 1QGHA 1MFRA 1VEQA 4YXMA 2V2MA 3QZ3A 3OGHA 2Z6MA 4LQJA 1JKVA 4EVCA 4KXRB 2CEIA 4WJG4 3EZUA 3KA6A 1TK6A 1F30A 4TO9A 3PVYA 3AK9A 4KVSA 3RBCA 3UOIA 1JREA 4MXPA 5HJHA 2OH3A 1VEIA 3A68A 3PVTB 3QD8A 3PVRB 1O9IA 3PWFA 3WVWA 1BG7A 1Z6OA 4MY7A 1DATA 3KHKA 2N02A 2FJCA 2BW1A 4LYXA 2V2OA 1SOFA 4IXKA 4ZL5A 1JYBA 3ES3A 4A25A 3C21A 4X0JA 3AK8A 2CF7A 3E1LA 4TOAA 4XGSA 4Z5SA 4CY9A 1FHAA 2Z5QA 3F36A 1DVBA 3F37A 5GU1X 3SH6A 2V2PA 2V8UA 1Z6OM 3E1OA 3MPSA 1JI4A 2Y3QA 3N6OA 4IWJA 4MN9A 5CZUA 2YJKA 1ZS3A 4LQVA 3GE4A 5JKLG 4RC7B 3R2KA 2XJMA 1LKMA 3PW1B 2CN7A 3NOZX 2JD80 5ERJA 4DI0A 4LPJA 2FL0A 3F38A 4MKUA 4YXJA 2ZG8X 1LKPA 1BFRA 2IB0A 4TOCA 4M35A 3PW8C 4II4B 5FEJA 1VLGA 3V3KB 2CLUA 5D8PA 3KDQA 3GGZA 2UX1A 4YVZA 3E1MA 3DBYA 1GWGA 1S30A 3FSEA 3QB9A 2V2LA 3AJOA 1XZ1A 3PVTA 4YKHA 5HJFA 3KA8A 2XGWA 5J8WA 4XKSA 4CVTA 2OC5A 4KVRA 1KRQA 3R2LA 4TOGA 2CWLA 4LPMA 1OTKA 3C23A 5J93A 4EVEA 4ISMA 1NF4A 2IY4A 3GGYA 2C6RA 3KA4A 5D8RA 2V2JA 3KA9A 3NP0X 1XZ3A 4ML5A 1NNQA 2FG4A 3GHQA 3OJ5A 3IQ1A 4LPNA 4LYUA 3C1YA 3Q4RA 2VXIA 4ZJKA 3E6SA 3GVYA 3O7RA 2XKQA 2WTLA 2WWXB 4AM4A 3PZAA 5FFAA 5JACA 2VXXA 5K52A 3AF7X 1DPSA 3WVUA 2Z5RA 3EGMA 4RC7A 1LB3A 4TODA 3ISFA 1RCGA 3O7SA 3JZAB 2Y44A 3PW1A 5ERKA 2XJNA 2JD60 3BVEA 2ITBA 5D8YA 3M6JA 4M34A 2C41A 3BKNA 3FVBA 4ERUA 5LBHA 4CMYA 4TOFA 3A9QA 1JTSA 4LQNA 2ZG7X 3PWQC 5GU2X 1BCFA 5HU6D 1JGCA 2AR0A 4ZTTA 3F39A 3W54A 2G38B 4DYZA 3C1ZA 4REUA
chains in the Genus database with same CATH topology
3BVFA 2JD70 5E1UA 3PW8A 4EVDA 2IU2A 3RGDA 3QHCA 5C6FA 1UVHA 3L0MA 3E6RA 2GYDA 5AXSA 3T9JA 4ZKXA 1B71A 1RCDA 4CVSA 2V8TA 3H7GA 3F32A 3QHBA 3E1PA 2V2SA 3R2HA 1YUXA 4CYBA 3TA8A 5JDOB 4RC5A 5GN8B 2ZG9X 2ZA7A 1NFVA 1J30A 2CN6A 3Q4OA 2VZBA 4TOEA 2CHIA 3VVAA 1L8IA 2C2FA 2OKCA 2FZFA 3AF8X 4DZ0A 3SHXA 4ZMCA 2D5KA 4PG0A 1IESA 3SIDA 5CMRA 5IX6A 2FHAA 3WVVA 3U90A 2HR5A 2C2JA 1Z4AA 1JI5A 1JIGA 3PVYB 4KVQA 2HTNA 2V2RA 4CMYV 2GS4A 2X170 4Z3BA 4DE6A 3PVRA 2GYQA 4MUDA 5GU0X 4RC8A 1UMNA 4ZKHA 2FKZA 3UFBA 4OYNA 4LQHA 1MOJA 4TW3A 4E40A 3E1NA 5LG2A 1TKOA 2XJOA 4M32A 1TKPA 5CMQA 3PWQA 3IS8A 4PG1A 1QYBA 1YUZA 4RC6B 4XKTA 3VNXA 4W4LB 5FFEA 5JDOA 5JKMA 5GN8A 2WLUA 4U3GA 2Z5PA 5LS9A 2CLBA 1JKUA 3SE1A 4ZLWA 4PGKA 1VJXA 4II4A 4CVRA 2YW6A 2BKCA 3EZ0A 3R2MA 2W0OA 3NP2X 5E2DA 3UOFA 3AJPA 1RCCA 1TJOA 4W4KB 4CYAA 4IWKA 4P18A 2QQYA 2WLAA 2RBDA 3RD0A 4ISPA 4EVBA 1F33A 4ITWA 4ZKWA 3UNOA 3BVIA 3JZ9A 4QUWA 3KX9A 5D8SA 4ETRA 1RYTA 4AM5A 3IS7A 4AM2A 2F7NA 3FRSA 2Z90A 1AEWA 3LKDA 3Q4QA 2YJJA 1EUMA 3F35A 1S3QA 5GOUA 3FRRA 5D8OA 3QVDA 4TOBA 3R2OA 5J8SA 3F34A 2V2IA 3HIUA 3E2CA 3AJQA 4RC6A 1HRSA 4CVPA 5LG8A 3ERZA 5K53A 3VV9A 4E6KA 2PYBA 4DYYA 2ZA8A 3KWOA 3KA3A 5D8XA 4MJYA 1RCIA 3BVLA 2CHPA 2CIHA 5JKMG 1NF6A 2G4HA 2QF9A 2FG8A 1H96A 2V2NA 2BK6A 3R2RA 4XKUA 1IERA 3BT5A 3ISEA 3FI6A 3AF9X 5FFDA 1SQ3A 2FFXJ 4R42A 4ITTA 3BVKA 3HL1A 1ZUJA 4PGIA 1VELA 5I4JA 5FFBA 2ZURX 1S2ZA 3R2SA 3RAVA 2BJYA 4DYUA 5GU3X 3D19A 1O9RA 5FFCA 4TOHA 4Y08A 5D8QA 1L8HA 4DASA 3KXUA 5J9VA 2YW7A 2MGYA 1RCEA 1N1QA 3F33A 2V15A 3E1JA 5JKLA 3WNWA 1YV1A 1LKOA 2C2UA 5HQOA 2ZA6A 4RC5B 4ZL6A 3E1QA 1R03A 4M33A 3RE7A 4DYXA 3Q4NA 1QGHA 1MFRA 1VEQA 4YXMA 2V2MA 3QZ3A 3OGHA 2Z6MA 4LQJA 1JKVA 4EVCA 4KXRB 2CEIA 4WJG4 3EZUA 3KA6A 1TK6A 1F30A 4TO9A 3PVYA 3AK9A 4KVSA 3RBCA 3UOIA 1JREA 4MXPA 5HJHA 2OH3A 1VEIA 3A68A 3PVTB 3QD8A 3PVRB 1O9IA 3PWFA 3WVWA 1BG7A 1Z6OA 4MY7A 1DATA 3KHKA 2N02A 2FJCA 2BW1A 4LYXA 2V2OA 1SOFA 4IXKA 4ZL5A 1JYBA 3ES3A 4A25A 3C21A 4X0JA 3AK8A 2CF7A 3E1LA 4TOAA 4XGSA 4Z5SA 4CY9A 1FHAA 2Z5QA 3F36A 1DVBA 3F37A 5GU1X 3SH6A 2V2PA 2V8UA 1Z6OM 3E1OA 3MPSA 1JI4A 2Y3QA 3N6OA 4IWJA 4MN9A 5CZUA 2YJKA 1ZS3A 4LQVA 3GE4A 5JKLG 4RC7B 3R2KA 2XJMA 1LKMA 3PW1B 2CN7A 3NOZX 2JD80 5ERJA 4DI0A 4LPJA 2FL0A 3F38A 4MKUA 4YXJA 2ZG8X 1LKPA 1BFRA 2IB0A 4TOCA 4M35A 3PW8C 4II4B 5FEJA 1VLGA 3V3KB 2CLUA 5D8PA 3KDQA 3GGZA 2UX1A 4YVZA 3E1MA 3DBYA 1GWGA 1S30A 3FSEA 3QB9A 2V2LA 3AJOA 1XZ1A 3PVTA 4YKHA 5HJFA 3KA8A 2XGWA 5J8WA 4XKSA 4CVTA 2OC5A 4KVRA 1KRQA 3R2LA 4TOGA 2CWLA 4LPMA 1OTKA 3C23A 5J93A 4EVEA 4ISMA 1NF4A 2IY4A 3GGYA 2C6RA 3KA4A 5D8RA 2V2JA 3KA9A 3NP0X 1XZ3A 4ML5A 1NNQA 2FG4A 3GHQA 3OJ5A 3IQ1A 4LPNA 4LYUA 3C1YA 3Q4RA 2VXIA 4ZJKA 3E6SA 3GVYA 3O7RA 2XKQA 2WTLA 2WWXB 4AM4A 3PZAA 5FFAA 5JACA 2VXXA 5K52A 3AF7X 1DPSA 3WVUA 2Z5RA 3EGMA 4RC7A 1LB3A 4TODA 3ISFA 1RCGA 3O7SA 3JZAB 2Y44A 3PW1A 5ERKA 2XJNA 2JD60 3BVEA 2ITBA 5D8YA 3M6JA 4M34A 2C41A 3BKNA 3FVBA 4ERUA 5LBHA 4CMYA 4TOFA 3A9QA 1JTSA 4LQNA 2ZG7X 3PWQC 5GU2X 1BCFA 5HU6D 1JGCA 2AR0A 4ZTTA 3F39A 3W54A 2G38B 4DYZA 3C1ZA 4REUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BVF A;  2JD7 0;  5E1U A;  3PW8 A;  4EVD A;  2IU2 A;  3RGD A;  3QHC A;  5C6F A;  1UVH A;  3E6R A;  2GYD A;  5AXS A;  3T9J A;  4ZKX A;  1B71 A;  1RCD A;  4CVS A;  3H7G A;  3F32 A;  3QHB A;  3E1P A;  2V2S A;  3R2H A;  1YUX A;  4CYB A;  3TA8 A;  4RC5 A;  5GN8 B;  2ZG9 X;  2ZA7 A;  1NFV A;  1J30 A;  2CN6 A;  3Q4O A;  2VZB A;  4TOE A;  2CHI A;  1L8I A;  2C2F A;  2FZF A;  3AF8 X;  4DZ0 A;  3SHX A;  4ZMC A;  2D5K A;  4PG0 A;  1IES A;  3SID A;  5CMR A;  5IX6 A;  2FHA A;  3WVV A;  3U90 A;  2HR5 A;  2C2J A;  1Z4A A;  1JI5 A;  1JIG A;  3PVY B;  4KVQ A;  2HTN A;  2V2R A;  4CMY V;  2GS4 A;  2X17 0;  4Z3B A;  4DE6 A;  3PVR A;  2GYQ A;  4MUD A;  5GU0 X;  4RC8 A;  1UMN A;  4ZKH A;  2FKZ A;  4OYN A;  4LQH A;  1MOJ A;  4TW3 A;  3E1N A;  5LG2 A;  1TKO A;  4M32 A;  2XJO A;  1TKP A;  5CMQ A;  3PWQ A;  3IS8 A;  4PG1 A;  1QYB A;  1YUZ A;  4RC6 B;  4XKT A;  3VNX A;  5FFE A;  5JKM A;  5GN8 A;  2WLU A;  4U3G A;  2Z5P A;  5LS9 A;  2CLB A;  1JKU A;  3SE1 A;  4ZLW A;  4PGK A;  1VJX A;  4II4 A;  4CVR A;  2YW6 A;  2BKC A;  3EZ0 A;  3R2M A;  2W0O A;  3NP2 X;  5E2D A;  3UOF A;  3AJP A;  1RCC A;  1TJO A;  4CYA A;  4IWK A;  4P18 A;  2QQY A;  2WLA A;  2RBD A;  3RD0 A;  4ISP A;  4EVB A;  1F33 A;  4ITW A;  4ZKW A;  3UNO A;  3BVI A;  4QUW A;  3KX9 A;  5D8S A;  4ETR A;  1RYT A;  4AM5 A;  3IS7 A;  4AM2 A;  2F7N A;  2Z90 A;  1AEW A;  3Q4Q A;  2YJJ A;  1EUM A;  3F35 A;  1S3Q A;  5GOU A;  5D8O A;  5J8S A;  3QVD A;  4TOB A;  3R2O A;  3F34 A;  2V2I A;  3HIU A;  3E2C A;  3AJQ A;  4RC6 A;  1HRS A;  4CVP A;  5LG8 A;  3ERZ A;  5K53 A;  4E6K A;  2PYB A;  4DYY A;  2ZA8 A;  3KWO A;  3KA3 A;  5D8X A;  4MJY A;  1RCI A;  3BVL A;  2CHP A;  2CIH A;  5JKM G;  1NF6 A;  2G4H A;  2QF9 A;  2FG8 A;  1H96 A;  2V2N A;  2BK6 A;  3R2R A;  4XKU A;  1IER A;  3BT5 A;  3ISE A;  3FI6 A;  3AF9 X;  5FFD A;  1SQ3 A;  2FFX J;  4R42 A;  4ITT A;  3BVK A;  3HL1 A;  1ZUJ A;  4PGI A;  1VEL A;  5I4J A;  5FFB A;  2ZUR X;  1S2Z A;  3R2S A;  3RAV A;  2BJY A;  4DYU A;  5GU3 X;  1O9R A;  5FFC A;  4TOH A;  4Y08 A;  5D8Q A;  1L8H A;  4DAS A;  3KXU A;  5J9V A;  2YW7 A;  1RCE A;  1N1Q A;  3F33 A;  2V15 A;  3E1J A;  5JKL A;  3WNW A;  1YV1 A;  1LKO A;  2C2U A;  5HQO A;  2ZA6 A;  4RC5 B;  4ZL6 A;  3E1Q A;  1R03 A;  4M33 A;  3RE7 A;  4DYX A;  3Q4N A;  1QGH A;  1MFR A;  1VEQ A;  2V2M A;  3QZ3 A;  3OGH A;  2Z6M A;  4LQJ A;  1JKV A;  4EVC A;  2CEI A;  3EZU A;  3KA6 A;  1TK6 A;  1F30 A;  4TO9 A;  3PVY A;  3AK9 A;  4KVS A;  3RBC A;  3UOI A;  1JRE A;  5HJH A;  2OH3 A;  1VEI A;  3A68 A;  3PVT B;  3QD8 A;  3PVR B;  1O9I A;  3PWF A;  3WVW A;  1BG7 A;  1Z6O A;  4MY7 A;  1DAT A;  2FJC A;  2BW1 A;  4LYX A;  2V2O A;  1SOF A;  4IXK A;  4ZL5 A;  1JYB A;  3ES3 A;  4A25 A;  3AK8 A;  2CF7 A;  3E1L A;  4TOA A;  4XGS A;  4Z5S A;  4CY9 A;  1FHA A;  2Z5Q A;  3F36 A;  1DVB A;  3F37 A;  5GU1 X;  3SH6 A;  2V2P A;  1Z6O M;  3E1O A;  3MPS A;  1JI4 A;  2Y3Q A;  4IWJ A;  4MN9 A;  5CZU A;  2YJK A;  1ZS3 A;  4LQV A;  3GE4 A;  5JKL G;  4RC7 B;  3R2K A;  2XJM A;  1LKM A;  3PW1 B;  2CN7 A;  3NOZ X;  2JD8 0;  5ERJ A;  4DI0 A;  4LPJ A;  2FL0 A;  3F38 A;  4MKU A;  2ZG8 X;  1LKP A;  1BFR A;  2IB0 A;  4TOC A;  4M35 A;  3PW8 C;  4II4 B;  5FEJ A;  1VLG A;  2CLU A;  5D8P A;  2UX1 A;  3E1M A;  1GWG A;  1S30 A;  3FSE A;  3QB9 A;  2V2L A;  3AJO A;  1XZ1 A;  3PVT A;  4YKH A;  5HJF A;  3KA8 A;  2XGW A;  5J8W A;  4XKS A;  4CVT A;  2OC5 A;  4KVR A;  1KRQ A;  3R2L A;  4TOG A;  4LPM A;  1OTK A;  5J93 A;  4EVE A;  4ISM A;  1NF4 A;  2IY4 A;  2C6R A;  3KA4 A;  5D8R A;  2V2J A;  3KA9 A;  3NP0 X;  1XZ3 A;  4ML5 A;  1NNQ A;  2FG4 A;  3GHQ A;  3OJ5 A;  3IQ1 A;  4LPN A;  4LYU A;  3Q4R A;  2VXI A;  4ZJK A;  3E6S A;  3GVY A;  3O7R A;  2XKQ A;  2WTL A;  4AM4 A;  3PZA A;  5FFA A;  5JAC A;  2VXX A;  5K52 A;  3AF7 X;  1DPS A;  3WVU A;  2Z5R A;  3EGM A;  4RC7 A;  1LB3 A;  4TOD A;  3ISF A;  1RCG A;  3O7S A;  3PW1 A;  5ERK A;  2XJN A;  2JD6 0;  3BVE A;  2ITB A;  5D8Y A;  4M34 A;  2C41 A;  3BKN A;  3FVB A;  4ERU A;  5LBH A;  4CMY A;  4TOF A;  3A9Q A;  1JTS A;  4LQN A;  2ZG7 X;  3PWQ C;  5GU2 X;  1BCF A;  1JGC A;  4ZTT A;  3F39 A;  4DYZ A;  4REU A; 
#chains in the Genus database with same CATH topology
 3BVF A;  2JD7 0;  5E1U A;  3PW8 A;  4EVD A;  2IU2 A;  3RGD A;  3QHC A;  5C6F A;  1UVH A;  3L0M A;  3E6R A;  2GYD A;  5AXS A;  3T9J A;  4ZKX A;  1B71 A;  1RCD A;  4CVS A;  2V8T A;  3H7G A;  3F32 A;  3QHB A;  3E1P A;  2V2S A;  3R2H A;  1YUX A;  4CYB A;  3TA8 A;  5JDO B;  4RC5 A;  5GN8 B;  2ZG9 X;  2ZA7 A;  1NFV A;  1J30 A;  2CN6 A;  3Q4O A;  2VZB A;  4TOE A;  2CHI A;  3VVA A;  1L8I A;  2C2F A;  2OKC A;  2FZF A;  3AF8 X;  4DZ0 A;  3SHX A;  4ZMC A;  2D5K A;  4PG0 A;  1IES A;  3SID A;  5CMR A;  5IX6 A;  2FHA A;  3WVV A;  3U90 A;  2HR5 A;  2C2J A;  1Z4A A;  1JI5 A;  1JIG A;  3PVY B;  4KVQ A;  2HTN A;  2V2R A;  4CMY V;  2GS4 A;  2X17 0;  4Z3B A;  4DE6 A;  3PVR A;  2GYQ A;  4MUD A;  5GU0 X;  4RC8 A;  1UMN A;  4ZKH A;  2FKZ A;  3UFB A;  4OYN A;  4LQH A;  1MOJ A;  4TW3 A;  4E40 A;  3E1N A;  5LG2 A;  1TKO A;  2XJO A;  4M32 A;  1TKP A;  5CMQ A;  3PWQ A;  3IS8 A;  4PG1 A;  1QYB A;  1YUZ A;  4RC6 B;  4XKT A;  3VNX A;  4W4L B;  5FFE A;  5JDO A;  5JKM A;  5GN8 A;  2WLU A;  4U3G A;  2Z5P A;  5LS9 A;  2CLB A;  1JKU A;  3SE1 A;  4ZLW A;  4PGK A;  1VJX A;  4II4 A;  4CVR A;  2YW6 A;  2BKC A;  3EZ0 A;  3R2M A;  2W0O A;  3NP2 X;  5E2D A;  3UOF A;  3AJP A;  1RCC A;  1TJO A;  4W4K B;  4CYA A;  4IWK A;  4P18 A;  2QQY A;  2WLA A;  2RBD A;  3RD0 A;  4ISP A;  4EVB A;  1F33 A;  4ITW A;  4ZKW A;  3UNO A;  3BVI A;  3JZ9 A;  4QUW A;  3KX9 A;  5D8S A;  4ETR A;  1RYT A;  4AM5 A;  3IS7 A;  4AM2 A;  2F7N A;  3FRS A;  2Z90 A;  1AEW A;  3LKD A;  3Q4Q A;  2YJJ A;  1EUM A;  3F35 A;  1S3Q A;  5GOU A;  3FRR A;  5D8O A;  3QVD A;  4TOB A;  3R2O A;  5J8S A;  3F34 A;  2V2I A;  3HIU A;  3E2C A;  3AJQ A;  4RC6 A;  1HRS A;  4CVP A;  5LG8 A;  3ERZ A;  5K53 A;  3VV9 A;  4E6K A;  2PYB A;  4DYY A;  2ZA8 A;  3KWO A;  3KA3 A;  5D8X A;  4MJY A;  1RCI A;  3BVL A;  2CHP A;  2CIH A;  5JKM G;  1NF6 A;  2G4H A;  2QF9 A;  2FG8 A;  1H96 A;  2V2N A;  2BK6 A;  3R2R A;  4XKU A;  1IER A;  3BT5 A;  3ISE A;  3FI6 A;  3AF9 X;  5FFD A;  1SQ3 A;  2FFX J;  4R42 A;  4ITT A;  3BVK A;  3HL1 A;  1ZUJ A;  4PGI A;  1VEL A;  5I4J A;  5FFB A;  2ZUR X;  1S2Z A;  3R2S A;  3RAV A;  2BJY A;  4DYU A;  5GU3 X;  3D19 A;  1O9R A;  5FFC A;  4TOH A;  4Y08 A;  5D8Q A;  1L8H A;  4DAS A;  3KXU A;  5J9V A;  2YW7 A;  2MGY A;  1RCE A;  1N1Q A;  3F33 A;  2V15 A;  3E1J A;  5JKL A;  3WNW A;  1YV1 A;  1LKO A;  2C2U A;  5HQO A;  2ZA6 A;  4RC5 B;  4ZL6 A;  3E1Q A;  1R03 A;  4M33 A;  3RE7 A;  4DYX A;  3Q4N A;  1QGH A;  1MFR A;  1VEQ A;  4YXM A;  2V2M A;  3QZ3 A;  3OGH A;  2Z6M A;  4LQJ A;  1JKV A;  4EVC A;  4KXR B;  2CEI A;  4WJG 4;  3EZU A;  3KA6 A;  1TK6 A;  1F30 A;  4TO9 A;  3PVY A;  3AK9 A;  4KVS A;  3RBC A;  3UOI A;  1JRE A;  4MXP A;  5HJH A;  2OH3 A;  1VEI A;  3A68 A;  3PVT B;  3QD8 A;  3PVR B;  1O9I A;  3PWF A;  3WVW A;  1BG7 A;  1Z6O A;  4MY7 A;  1DAT A;  3KHK A;  2N02 A;  2FJC A;  2BW1 A;  4LYX A;  2V2O A;  1SOF A;  4IXK A;  4ZL5 A;  1JYB A;  3ES3 A;  4A25 A;  3C21 A;  4X0J A;  3AK8 A;  2CF7 A;  3E1L A;  4TOA A;  4XGS A;  4Z5S A;  4CY9 A;  1FHA A;  2Z5Q A;  3F36 A;  1DVB A;  3F37 A;  5GU1 X;  3SH6 A;  2V2P A;  2V8U A;  1Z6O M;  3E1O A;  3MPS A;  1JI4 A;  2Y3Q A;  3N6O A;  4IWJ A;  4MN9 A;  5CZU A;  2YJK A;  1ZS3 A;  4LQV A;  3GE4 A;  5JKL G;  4RC7 B;  3R2K A;  2XJM A;  1LKM A;  3PW1 B;  2CN7 A;  3NOZ X;  2JD8 0;  5ERJ A;  4DI0 A;  4LPJ A;  2FL0 A;  3F38 A;  4MKU A;  4YXJ A;  2ZG8 X;  1LKP A;  1BFR A;  2IB0 A;  4TOC A;  4M35 A;  3PW8 C;  4II4 B;  5FEJ A;  1VLG A;  3V3K B;  2CLU A;  5D8P A;  3KDQ A;  3GGZ A;  2UX1 A;  4YVZ A;  3E1M A;  3DBY A;  1GWG A;  1S30 A;  3FSE A;  3QB9 A;  2V2L A;  3AJO A;  1XZ1 A;  3PVT A;  4YKH A;  5HJF A;  3KA8 A;  2XGW A;  5J8W A;  4XKS A;  4CVT A;  2OC5 A;  4KVR A;  1KRQ A;  3R2L A;  4TOG A;  2CWL A;  4LPM A;  1OTK A;  3C23 A;  5J93 A;  4EVE A;  4ISM A;  1NF4 A;  2IY4 A;  3GGY A;  2C6R A;  3KA4 A;  5D8R A;  2V2J A;  3KA9 A;  3NP0 X;  1XZ3 A;  4ML5 A;  1NNQ A;  2FG4 A;  3GHQ A;  3OJ5 A;  3IQ1 A;  4LPN A;  4LYU A;  3C1Y A;  3Q4R A;  2VXI A;  4ZJK A;  3E6S A;  3GVY A;  3O7R A;  2XKQ A;  2WTL A;  2WWX B;  4AM4 A;  3PZA A;  5FFA A;  5JAC A;  2VXX A;  5K52 A;  3AF7 X;  1DPS A;  3WVU A;  2Z5R A;  3EGM A;  4RC7 A;  1LB3 A;  4TOD A;  3ISF A;  1RCG A;  3O7S A;  3JZA B;  2Y44 A;  3PW1 A;  5ERK A;  2XJN A;  2JD6 0;  3BVE A;  2ITB A;  5D8Y A;  3M6J A;  4M34 A;  2C41 A;  3BKN A;  3FVB A;  4ERU A;  5LBH A;  4CMY A;  4TOF A;  3A9Q A;  1JTS A;  4LQN A;  2ZG7 X;  3PWQ C;  5GU2 X;  1BCF A;  5HU6 D;  1JGC A;  2AR0 A;  4ZTT A;  3F39 A;  3W54 A;  2G38 B;  4DYZ A;  3C1Z A;  4REU A; 
#chains in the Genus database with same CATH homology
 3BVF A;  2JD7 0;  5E1U A;  3PW8 A;  4EVD A;  2IU2 A;  3RGD A;  3QHC A;  5C6F A;  1UVH A;  3L0M A;  3E6R A;  2GYD A;  5AXS A;  3T9J A;  4ZKX A;  1B71 A;  1RCD A;  4CVS A;  2V8T A;  3H7G A;  3F32 A;  3QHB A;  3E1P A;  2V2S A;  3R2H A;  1YUX A;  4CYB A;  3TA8 A;  5JDO B;  4RC5 A;  5GN8 B;  2ZG9 X;  2ZA7 A;  1NFV A;  1J30 A;  2CN6 A;  3Q4O A;  2VZB A;  4TOE A;  2CHI A;  3VVA A;  1L8I A;  2C2F A;  2OKC A;  2FZF A;  3AF8 X;  4DZ0 A;  3SHX A;  4ZMC A;  2D5K A;  4PG0 A;  1IES A;  3SID A;  5CMR A;  5IX6 A;  2FHA A;  3WVV A;  3U90 A;  2HR5 A;  2C2J A;  1Z4A A;  1JI5 A;  1JIG A;  3PVY B;  4KVQ A;  2HTN A;  2V2R A;  4CMY V;  2GS4 A;  2X17 0;  4Z3B A;  4DE6 A;  3PVR A;  2GYQ A;  4MUD A;  5GU0 X;  4RC8 A;  1UMN A;  4ZKH A;  2FKZ A;  3UFB A;  4OYN A;  4LQH A;  1MOJ A;  4TW3 A;  4E40 A;  3E1N A;  5LG2 A;  1TKO A;  2XJO A;  4M32 A;  1TKP A;  5CMQ A;  3PWQ A;  3IS8 A;  4PG1 A;  1QYB A;  1YUZ A;  4RC6 B;  4XKT A;  3VNX A;  4W4L B;  5FFE A;  5JDO A;  5JKM A;  5GN8 A;  2WLU A;  4U3G A;  2Z5P A;  5LS9 A;  2CLB A;  1JKU A;  3SE1 A;  4ZLW A;  4PGK A;  1VJX A;  4II4 A;  4CVR A;  2YW6 A;  2BKC A;  3EZ0 A;  3R2M A;  2W0O A;  3NP2 X;  5E2D A;  3UOF A;  3AJP A;  1RCC A;  1TJO A;  4W4K B;  4CYA A;  4IWK A;  4P18 A;  2QQY A;  2WLA A;  2RBD A;  3RD0 A;  4ISP A;  4EVB A;  1F33 A;  4ITW A;  4ZKW A;  3UNO A;  3BVI A;  3JZ9 A;  4QUW A;  3KX9 A;  5D8S A;  4ETR A;  1RYT A;  4AM5 A;  3IS7 A;  4AM2 A;  2F7N A;  3FRS A;  2Z90 A;  1AEW A;  3LKD A;  3Q4Q A;  2YJJ A;  1EUM A;  3F35 A;  1S3Q A;  5GOU A;  3FRR A;  5D8O A;  3QVD A;  4TOB A;  3R2O A;  5J8S A;  3F34 A;  2V2I A;  3HIU A;  3E2C A;  3AJQ A;  4RC6 A;  1HRS A;  4CVP A;  5LG8 A;  3ERZ A;  5K53 A;  3VV9 A;  4E6K A;  2PYB A;  4DYY A;  2ZA8 A;  3KWO A;  3KA3 A;  5D8X A;  4MJY A;  1RCI A;  3BVL A;  2CHP A;  2CIH A;  5JKM G;  1NF6 A;  2G4H A;  2QF9 A;  2FG8 A;  1H96 A;  2V2N A;  2BK6 A;  3R2R A;  4XKU A;  1IER A;  3BT5 A;  3ISE A;  3FI6 A;  3AF9 X;  5FFD A;  1SQ3 A;  2FFX J;  4R42 A;  4ITT A;  3BVK A;  3HL1 A;  1ZUJ A;  4PGI A;  1VEL A;  5I4J A;  5FFB A;  2ZUR X;  1S2Z A;  3R2S A;  3RAV A;  2BJY A;  4DYU A;  5GU3 X;  3D19 A;  1O9R A;  5FFC A;  4TOH A;  4Y08 A;  5D8Q A;  1L8H A;  4DAS A;  3KXU A;  5J9V A;  2YW7 A;  2MGY A;  1RCE A;  1N1Q A;  3F33 A;  2V15 A;  3E1J A;  5JKL A;  3WNW A;  1YV1 A;  1LKO A;  2C2U A;  5HQO A;  2ZA6 A;  4RC5 B;  4ZL6 A;  3E1Q A;  1R03 A;  4M33 A;  3RE7 A;  4DYX A;  3Q4N A;  1QGH A;  1MFR A;  1VEQ A;  4YXM A;  2V2M A;  3QZ3 A;  3OGH A;  2Z6M A;  4LQJ A;  1JKV A;  4EVC A;  4KXR B;  2CEI A;  4WJG 4;  3EZU A;  3KA6 A;  1TK6 A;  1F30 A;  4TO9 A;  3PVY A;  3AK9 A;  4KVS A;  3RBC A;  3UOI A;  1JRE A;  4MXP A;  5HJH A;  2OH3 A;  1VEI A;  3A68 A;  3PVT B;  3QD8 A;  3PVR B;  1O9I A;  3PWF A;  3WVW A;  1BG7 A;  1Z6O A;  4MY7 A;  1DAT A;  3KHK A;  2N02 A;  2FJC A;  2BW1 A;  4LYX A;  2V2O A;  1SOF A;  4IXK A;  4ZL5 A;  1JYB A;  3ES3 A;  4A25 A;  3C21 A;  4X0J A;  3AK8 A;  2CF7 A;  3E1L A;  4TOA A;  4XGS A;  4Z5S A;  4CY9 A;  1FHA A;  2Z5Q A;  3F36 A;  1DVB A;  3F37 A;  5GU1 X;  3SH6 A;  2V2P A;  2V8U A;  1Z6O M;  3E1O A;  3MPS A;  1JI4 A;  2Y3Q A;  3N6O A;  4IWJ A;  4MN9 A;  5CZU A;  2YJK A;  1ZS3 A;  4LQV A;  3GE4 A;  5JKL G;  4RC7 B;  3R2K A;  2XJM A;  1LKM A;  3PW1 B;  2CN7 A;  3NOZ X;  2JD8 0;  5ERJ A;  4DI0 A;  4LPJ A;  2FL0 A;  3F38 A;  4MKU A;  4YXJ A;  2ZG8 X;  1LKP A;  1BFR A;  2IB0 A;  4TOC A;  4M35 A;  3PW8 C;  4II4 B;  5FEJ A;  1VLG A;  3V3K B;  2CLU A;  5D8P A;  3KDQ A;  3GGZ A;  2UX1 A;  4YVZ A;  3E1M A;  3DBY A;  1GWG A;  1S30 A;  3FSE A;  3QB9 A;  2V2L A;  3AJO A;  1XZ1 A;  3PVT A;  4YKH A;  5HJF A;  3KA8 A;  2XGW A;  5J8W A;  4XKS A;  4CVT A;  2OC5 A;  4KVR A;  1KRQ A;  3R2L A;  4TOG A;  2CWL A;  4LPM A;  1OTK A;  3C23 A;  5J93 A;  4EVE A;  4ISM A;  1NF4 A;  2IY4 A;  3GGY A;  2C6R A;  3KA4 A;  5D8R A;  2V2J A;  3KA9 A;  3NP0 X;  1XZ3 A;  4ML5 A;  1NNQ A;  2FG4 A;  3GHQ A;  3OJ5 A;  3IQ1 A;  4LPN A;  4LYU A;  3C1Y A;  3Q4R A;  2VXI A;  4ZJK A;  3E6S A;  3GVY A;  3O7R A;  2XKQ A;  2WTL A;  2WWX B;  4AM4 A;  3PZA A;  5FFA A;  5JAC A;  2VXX A;  5K52 A;  3AF7 X;  1DPS A;  3WVU A;  2Z5R A;  3EGM A;  4RC7 A;  1LB3 A;  4TOD A;  3ISF A;  1RCG A;  3O7S A;  3JZA B;  2Y44 A;  3PW1 A;  5ERK A;  2XJN A;  2JD6 0;  3BVE A;  2ITB A;  5D8Y A;  3M6J A;  4M34 A;  2C41 A;  3BKN A;  3FVB A;  4ERU A;  5LBH A;  4CMY A;  4TOF A;  3A9Q A;  1JTS A;  4LQN A;  2ZG7 X;  3PWQ C;  5GU2 X;  1BCF A;  5HU6 D;  1JGC A;  2AR0 A;  4ZTT A;  3F39 A;  3W54 A;  2G38 B;  4DYZ A;  3C1Z A;  4REU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...