5HJHA

Dps4 from nostoc punctiforme in complex with fe ions
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
177
structure length
177
Chain Sequence
TLLRNFGNVYDNPVLLDRSVTAPVTEGFNVVLASFQALYLQYQKHHFVVEGSEFYSLHEFFNESYNQVQDHIHEIGERLDGLGGVPVATFSKLAELTCFEQESEGVYSSRQMVENDLAAEQAIIGVIRRQAAQAESLGDRGTRYLYEKILLKTEERAYHLSHFLAKDSLTLGFVQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin, Dps family protein
publication title Dps4 from Nostoc punctiforme in complex with Fe ions
rcsb
source organism Nostoc punctiforme
molecule tags Metal binding protein
total genus 73
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5hjhA00
5JKLG 4R42A 1NFVA 4XKSA 2QQYA 4XKTA 3WVUA 4M33A 5GU2X 2F7NA 3QD8A 5ERJA 4Z3BA 4PGIA 3A68A 4TO9A 5FFAA 4DYYA 2JD70 2XJOA 4RC5B 4M34A 2C2FA 2Z5QA 1R03A 2V2NA 2BK6A 2Z90A 2WLUA 1TK6A 4EVBA 1LKMA 1S30A 4CMYA 2V2OA 4YKHA 3SE1A 3RE7A 4AM5A 2W0OA 4ETRA 1S2ZA 1UMNA 2ITBA 3UNOA 1JYBA 3RD0A 3FVBA 4ERUA 4CYBA 2JD80 4DI0A 3PWQA 4DASA 4RC7B 3NOZX 3GE4A 3KA6A 3OGHA 1LB3A 2CF7A 5J9VA 1YV1A 2GS4A 5FEJA 4ZL5A 3RBCA 5LG2A 1YUXA 5GU3X 1VEIA 3U90A 3WVVA 1DATA 5ERKA 4RC7A 2CN7A 3F36A 3F38A 5LG8A 2YW6A 3PW1A 2D5KA 1JIGA 5GU0X 2ZG8X 3E1PA 2CHIA 3F37A 4II4A 2XGWA 3QHCA 2XJMA 3PW8C 5LS9A 3VNXA 5LBHA 4TW3A 1JI4A 2V2SA 4LPNA 1NNQA 3A9QA 3EGMA 2CHPA 1KRQA 3IS8A 5HQOA 3R2HA 2FHAA 3E1JA 2CLBA 4LYUA 2XKQA 1QGHA 4CMYV 4CVPA 3PVYB 3RGDA 4MKUA 1UVHA 2BJYA 2IU2A 3R2RA 4LQVA 4M35A 3E6SA 4OYNA 1IESA 2FG4A 5GU1X 2C2UA 3FSEA 3KXUA 4M32A 4Z5SA 3PZAA 3EZUA 3GHQA 3ISEA 5CMQA 4MUDA 3BT5A 3PVYA 2V2MA 2FZFA 3PW8A 2V15A 3TA8A 3GVYA 2VXIA 2HTNA 4ZTTA 4RC8A 5JKMA 3ERZA 1NF6A 1Z6OM 2ZA8A 3F39A 2V2IA 4DE6A 4ZLWA 2WLAA 3T9JA 4DYXA 5D8SA 2FL0A 4CVSA 4TOAA 4MY7A 2Z6MA 3AK9A 3E1OA 3R2KA 5D8PA 4LPJA 5J8WA 1QYBA 3NP0X 2WTLA 1L8IA 2G4HA 3QHBA 5FFEA 2C2JA 4ML5A 4KVSA 4ZMCA 4KVRA 3PW1B 1JKUA 2FFXJ 3AF8X 5D8XA 3UOFA 1EUMA 1TKOA 4II4B 1RCGA 4TOBA 3WNWA 5HJFA 2ZURX 1DPSA 1GWGA 5D8QA 3E1NA 3KWOA 4ITWA 3O7RA 3OJ5A 2VZBA 1XZ1A 1IERA 1OTKA 1DVBA 4LYXA 3SIDA 3EZ0A 5JKLA 2OC5A 4P18A 5CZUA 4EVCA 4LQNA 3BVFA 4KVQA 1O9RA 3F33A 2QF9A 1ZS3A 2UX1A 3MPSA 2HR5A 3AJPA 5IX6A 4A25A 3KA8A 3UOIA 3KA4A 5GN8A 4REUA 3E2CA 4CVTA 5D8OA 1VEQA 1YUZA 5FFCA 5FFBA 3PWFA 4MJYA 1FHAA 1JREA 4ZKXA 2Z5RA 4TODA 5J93A 2FKZA 2IB0A 4IXKA 2CEIA 3AK8A 3QVDA 1JI5A 2XJNA 2Z5PA 5D8YA 4TOHA 3ISFA 2ZA7A 2CIHA 3R2MA 3PVRA 2ZG9X 3HL1A 1JTSA 3BVKA 4IWKA 3PVTB 3BVLA 5E2DA 4ZJKA 5I4JA 4RC6A 1O9IA 3F32A 1BCFA 4LQJA 3PWQC 1RYTA 3NP2X 1RCDA 4LPMA 2PYBA 3SH6A 1N1QA 1L8HA 2BKCA 5HJHA 3R2SA 1AEWA 1VELA 2VXXA 3FI6A 5JACA 3PVTA 3IS7A 3QZ3A 5K52A 1VLGA 4PGKA 4U3GA 4DYUA 3AJQA 4XGSA 3WVWA 4TOEA 4E6KA 4ISPA 4ISMA 5J8SA 4ITTA 2V2JA 4EVEA 2YJJA 2RBDA 4QUWA 3RAVA 5E1UA 1TKPA 4ZKHA 2FG8A 4IWJA 4RC5A 4XKUA 3BKNA 5GOUA 3Q4RA 1JKVA 1LKOA 2ZA6A 3BVEA 4TOGA 1TJOA 3Q4QA 2FJCA 4CYAA 2BW1A 3KA3A 2C41A 1SQ3A 2C6RA 4CY9A 1BG7A 2V2LA 2YJKA 5GN8B 2Y3QA 2CLUA 1MOJA 1ZUJA 3Q4OA 1F33A 2OH3A 3KX9A 4LQHA 1MFRA 1RCIA 5JKMG 1S3QA 1RCCA 3F35A 2CN6A 3SHXA 1HRSA 4AM4A 1XZ3A 3F34A 1BFRA 1JGCA 1NF4A 3PVRB 3E6RA 3O7SA 2IY4A 2GYDA 3HIUA 3E1LA 3E1MA 3H7GA 3AJOA 1LKPA 1Z6OA 2JD60 4RC6B 2V2PA 3KA9A 3AF9X 3R2LA 4CVRA 3ES3A 4DYZA 1J30A 4TOCA 2X170 1RCEA 3BVIA 4TOFA 4ZKWA 1SOFA 2GYQA 4ZL6A 3IQ1A 1F30A 4Y08A 5FFDA 1VJXA 3AF7X 3R2OA 2ZG7X 5C6FA 2YW7A 5D8RA 4MN9A 5K53A 3E1QA 5CMRA 1Z4AA 2V2RA 1B71A 4PG1A 4DZ0A 4EVDA 1H96A 4PG0A 4AM2A 3QB9A 5AXSA 3Q4NA
chains in the Genus database with same CATH superfamily
5JKLG 4R42A 1NFVA 4XKSA 2QQYA 4XKTA 3WVUA 4M33A 5GU2X 2F7NA 3QD8A 5ERJA 4Z3BA 4PGIA 3A68A 4TO9A 5FFAA 4DYYA 2JD70 2XJOA 4RC5B 4M34A 2C2FA 2Z5QA 1R03A 3C1ZA 2V2NA 2BK6A 2Z90A 2WLUA 1TK6A 3JZ9A 4EVBA 1LKMA 1S30A 4CMYA 2V2OA 4YKHA 3SE1A 3RE7A 4AM5A 2W0OA 4ETRA 1S2ZA 3M6JA 4W4LB 1UMNA 2ITBA 3UNOA 1JYBA 3RD0A 3FVBA 4ERUA 4CYBA 3C1YA 2JD80 4DI0A 3PWQA 4DASA 4RC7B 3NOZX 3V3KB 3GE4A 3KA6A 3OGHA 1LB3A 2CF7A 5J9VA 1YV1A 2GS4A 5FEJA 3LKDA 4ZL5A 2AR0A 3RBCA 5LG2A 1YUXA 5GU3X 1VEIA 3U90A 3WVVA 3VVAA 1DATA 5ERKA 4RC7A 2CN7A 3F36A 3F38A 5LG8A 2YW6A 3PW1A 2D5KA 1JIGA 5GU0X 2ZG8X 3E1PA 2CHIA 3F37A 4II4A 2XGWA 3QHCA 2XJMA 3C21A 3C23A 3PW8C 2OKCA 5LS9A 3VNXA 5LBHA 4TW3A 1JI4A 2V2SA 4LPNA 1NNQA 3A9QA 3EGMA 2CHPA 1KRQA 3W54A 5HU6D 3IS8A 5HQOA 3R2HA 2FHAA 3E1JA 2CLBA 4LYUA 2XKQA 3KHKA 2G38B 4WJG4 1QGHA 4CMYV 4CVPA 3PVYB 3RGDA 4MKUA 1UVHA 2BJYA 2IU2A 3R2RA 4LQVA 4M35A 3E6SA 4OYNA 1IESA 4KXRB 2FG4A 3FRSA 5GU1X 2C2UA 3FSEA 2WWXB 3KXUA 4M32A 4Z5SA 3PZAA 3EZUA 3GHQA 3ISEA 5CMQA 4MUDA 3GGYA 3BT5A 3PVYA 3UFBA 2V2MA 2FZFA 3PW8A 2V15A 3TA8A 3GVYA 2VXIA 2HTNA 4ZTTA 4YXJA 4RC8A 5JKMA 3ERZA 1NF6A 1Z6OM 2ZA8A 3F39A 2V2IA 3FRRA 4DE6A 4ZLWA 2WLAA 3T9JA 4DYXA 5D8SA 2FL0A 4CVSA 4TOAA 4MY7A 4MXPA 2Z6MA 3AK9A 3E1OA 3R2KA 2CWLA 5D8PA 4LPJA 5J8WA 1QYBA 3NP0X 2WTLA 1L8IA 2G4HA 3QHBA 5FFEA 2C2JA 4ML5A 4KVSA 4ZMCA 4KVRA 3PW1B 1JKUA 2FFXJ 3AF8X 5D8XA 3UOFA 1EUMA 1TKOA 4II4B 1RCGA 4TOBA 3WNWA 5HJFA 2ZURX 1DPSA 1GWGA 5D8QA 3E1NA 3KWOA 4ITWA 3O7RA 3OJ5A 2VZBA 1XZ1A 1IERA 1OTKA 1DVBA 4LYXA 3SIDA 3EZ0A 5JKLA 2OC5A 4P18A 5CZUA 2Y44A 4EVCA 4LQNA 3BVFA 4KVQA 1O9RA 3F33A 2QF9A 1ZS3A 2UX1A 3MPSA 2HR5A 3AJPA 5IX6A 4A25A 3KA8A 3UOIA 3KA4A 5GN8A 4REUA 3E2CA 3D19A 4CVTA 5D8OA 4YXMA 2V8UA 1VEQA 1YUZA 5FFCA 5FFBA 3PWFA 4MJYA 1FHAA 1JREA 4ZKXA 2Z5RA 4TODA 5J93A 2FKZA 2IB0A 4IXKA 3JZAB 2CEIA 3AK8A 3QVDA 1JI5A 2XJNA 2Z5PA 5D8YA 4TOHA 3ISFA 2ZA7A 2CIHA 3R2MA 3PVRA 2ZG9X 3HL1A 1JTSA 3BVKA 4IWKA 3PVTB 3BVLA 5E2DA 4ZJKA 5I4JA 4RC6A 1O9IA 3F32A 1BCFA 4LQJA 3PWQC 1RYTA 3NP2X 1RCDA 4LPMA 2PYBA 3SH6A 1N1QA 1L8HA 2BKCA 5HJHA 3R2SA 1AEWA 1VELA 2VXXA 3FI6A 5JACA 3PVTA 3IS7A 3QZ3A 5K52A 1VLGA 4PGKA 4U3GA 4DYUA 3AJQA 5JDOA 4XGSA 3WVWA 4TOEA 4E6KA 4ISPA 2MGYA 4ISMA 5J8SA 4ITTA 2V2JA 4EVEA 3N6OA 2YJJA 2RBDA 4X0JA 4QUWA 3RAVA 2N02A 5E1UA 1TKPA 4ZKHA 2FG8A 4IWJA 4RC5A 4XKUA 3BKNA 5GOUA 3Q4RA 1JKVA 1LKOA 2ZA6A 3BVEA 4TOGA 1TJOA 3Q4QA 2FJCA 4CYAA 2BW1A 3KA3A 2C41A 1SQ3A 2C6RA 4CY9A 1BG7A 2V2LA 2YJKA 5GN8B 2Y3QA 2CLUA 1MOJA 1ZUJA 3Q4OA 3VV9A 4W4KB 1F33A 2OH3A 3KX9A 4LQHA 1MFRA 1RCIA 5JKMG 1S3QA 1RCCA 3F35A 2CN6A 3SHXA 1HRSA 4AM4A 1XZ3A 3F34A 1BFRA 1JGCA 3GGZA 1NF4A 3PVRB 3E6RA 3O7SA 2IY4A 2GYDA 3HIUA 3E1LA 3E1MA 3H7GA 3AJOA 1LKPA 1Z6OA 2JD60 4RC6B 2V2PA 3KA9A 3AF9X 3R2LA 4CVRA 3ES3A 2V8TA 4YVZA 4DYZA 1J30A 4TOCA 2X170 1RCEA 3BVIA 4TOFA 4ZKWA 1SOFA 2GYQA 4ZL6A 4E40A 3IQ1A 1F30A 4Y08A 5FFDA 3DBYA 1VJXA 3AF7X 3R2OA 2ZG7X 5C6FA 2YW7A 5D8RA 4MN9A 5K53A 3E1QA 3L0MA 5CMRA 1Z4AA 2V2RA 1B71A 5JDOB 4PG1A 4DZ0A 4EVDA 1H96A 4PG0A 3KDQA 4AM2A 3QB9A 5AXSA 3Q4NA
chains in the Genus database with same CATH topology
5JKLG 4R42A 1NFVA 4XKSA 2QQYA 4XKTA 3WVUA 4M33A 5GU2X 2F7NA 3QD8A 5ERJA 4Z3BA 4PGIA 3A68A 4TO9A 5FFAA 4DYYA 2JD70 2XJOA 4RC5B 4M34A 2C2FA 2Z5QA 1R03A 3C1ZA 2V2NA 2BK6A 2Z90A 2WLUA 1TK6A 3JZ9A 4EVBA 1LKMA 1S30A 4CMYA 2V2OA 4YKHA 3SE1A 3RE7A 4AM5A 2W0OA 4ETRA 1S2ZA 3M6JA 4W4LB 1UMNA 2ITBA 3UNOA 1JYBA 3RD0A 3FVBA 4ERUA 4CYBA 3C1YA 2JD80 4DI0A 3PWQA 4DASA 4RC7B 3NOZX 3V3KB 3GE4A 3KA6A 3OGHA 1LB3A 2CF7A 5J9VA 1YV1A 2GS4A 5FEJA 3LKDA 4ZL5A 2AR0A 3RBCA 5LG2A 1YUXA 5GU3X 1VEIA 3U90A 3WVVA 3VVAA 1DATA 5ERKA 4RC7A 2CN7A 3F36A 3F38A 5LG8A 2YW6A 3PW1A 2D5KA 1JIGA 5GU0X 2ZG8X 3E1PA 2CHIA 3F37A 4II4A 2XGWA 3QHCA 2XJMA 3C21A 3C23A 3PW8C 2OKCA 5LS9A 3VNXA 5LBHA 4TW3A 1JI4A 2V2SA 4LPNA 1NNQA 3A9QA 3EGMA 2CHPA 1KRQA 3W54A 5HU6D 3IS8A 5HQOA 3R2HA 2FHAA 3E1JA 2CLBA 4LYUA 2XKQA 3KHKA 2G38B 4WJG4 1QGHA 4CMYV 4CVPA 3PVYB 3RGDA 4MKUA 1UVHA 2BJYA 2IU2A 3R2RA 4LQVA 4M35A 3E6SA 4OYNA 1IESA 4KXRB 2FG4A 3FRSA 5GU1X 2C2UA 3FSEA 2WWXB 3KXUA 4M32A 4Z5SA 3PZAA 3EZUA 3GHQA 3ISEA 5CMQA 4MUDA 3GGYA 3BT5A 3PVYA 3UFBA 2V2MA 2FZFA 3PW8A 2V15A 3TA8A 3GVYA 2VXIA 2HTNA 4ZTTA 4YXJA 4RC8A 5JKMA 3ERZA 1NF6A 1Z6OM 2ZA8A 3F39A 2V2IA 3FRRA 4DE6A 4ZLWA 2WLAA 3T9JA 4DYXA 5D8SA 2FL0A 4CVSA 4TOAA 4MY7A 4MXPA 2Z6MA 3AK9A 3E1OA 3R2KA 2CWLA 5D8PA 4LPJA 5J8WA 1QYBA 3NP0X 2WTLA 1L8IA 2G4HA 3QHBA 5FFEA 2C2JA 4ML5A 4KVSA 4ZMCA 4KVRA 3PW1B 1JKUA 2FFXJ 3AF8X 5D8XA 3UOFA 1EUMA 1TKOA 4II4B 1RCGA 4TOBA 3WNWA 5HJFA 2ZURX 1DPSA 1GWGA 5D8QA 3E1NA 3KWOA 4ITWA 3O7RA 3OJ5A 2VZBA 1XZ1A 1IERA 1OTKA 1DVBA 4LYXA 3SIDA 3EZ0A 5JKLA 2OC5A 4P18A 5CZUA 2Y44A 4EVCA 4LQNA 3BVFA 4KVQA 1O9RA 3F33A 2QF9A 1ZS3A 2UX1A 3MPSA 2HR5A 3AJPA 5IX6A 4A25A 3KA8A 3UOIA 3KA4A 5GN8A 4REUA 3E2CA 3D19A 4CVTA 5D8OA 4YXMA 2V8UA 1VEQA 1YUZA 5FFCA 5FFBA 3PWFA 4MJYA 1FHAA 1JREA 4ZKXA 2Z5RA 4TODA 5J93A 2FKZA 2IB0A 4IXKA 3JZAB 2CEIA 3AK8A 3QVDA 1JI5A 2XJNA 2Z5PA 5D8YA 4TOHA 3ISFA 2ZA7A 2CIHA 3R2MA 3PVRA 2ZG9X 3HL1A 1JTSA 3BVKA 4IWKA 3PVTB 3BVLA 5E2DA 4ZJKA 5I4JA 4RC6A 1O9IA 3F32A 1BCFA 4LQJA 3PWQC 1RYTA 3NP2X 1RCDA 4LPMA 2PYBA 3SH6A 1N1QA 1L8HA 2BKCA 5HJHA 3R2SA 1AEWA 1VELA 2VXXA 3FI6A 5JACA 3PVTA 3IS7A 3QZ3A 5K52A 1VLGA 4PGKA 4U3GA 4DYUA 3AJQA 5JDOA 4XGSA 3WVWA 4TOEA 4E6KA 4ISPA 2MGYA 4ISMA 5J8SA 4ITTA 2V2JA 4EVEA 3N6OA 2YJJA 2RBDA 4X0JA 4QUWA 3RAVA 2N02A 5E1UA 1TKPA 4ZKHA 2FG8A 4IWJA 4RC5A 4XKUA 3BKNA 5GOUA 3Q4RA 1JKVA 1LKOA 2ZA6A 3BVEA 4TOGA 1TJOA 3Q4QA 2FJCA 4CYAA 2BW1A 3KA3A 2C41A 1SQ3A 2C6RA 4CY9A 1BG7A 2V2LA 2YJKA 5GN8B 2Y3QA 2CLUA 1MOJA 1ZUJA 3Q4OA 3VV9A 4W4KB 1F33A 2OH3A 3KX9A 4LQHA 1MFRA 1RCIA 5JKMG 1S3QA 1RCCA 3F35A 2CN6A 3SHXA 1HRSA 4AM4A 1XZ3A 3F34A 1BFRA 1JGCA 3GGZA 1NF4A 3PVRB 3E6RA 3O7SA 2IY4A 2GYDA 3HIUA 3E1LA 3E1MA 3H7GA 3AJOA 1LKPA 1Z6OA 2JD60 4RC6B 2V2PA 3KA9A 3AF9X 3R2LA 4CVRA 3ES3A 2V8TA 4YVZA 4DYZA 1J30A 4TOCA 2X170 1RCEA 3BVIA 4TOFA 4ZKWA 1SOFA 2GYQA 4ZL6A 4E40A 3IQ1A 1F30A 4Y08A 5FFDA 3DBYA 1VJXA 3AF7X 3R2OA 2ZG7X 5C6FA 2YW7A 5D8RA 4MN9A 5K53A 3E1QA 3L0MA 5CMRA 1Z4AA 2V2RA 1B71A 5JDOB 4PG1A 4DZ0A 4EVDA 1H96A 4PG0A 3KDQA 4AM2A 3QB9A 5AXSA 3Q4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JKL G;  4R42 A;  1NFV A;  4XKS A;  2QQY A;  4XKT A;  3WVU A;  4M33 A;  5GU2 X;  2F7N A;  3QD8 A;  5ERJ A;  4Z3B A;  4PGI A;  3A68 A;  4TO9 A;  5FFA A;  4DYY A;  2JD7 0;  2XJO A;  4RC5 B;  4M34 A;  2C2F A;  2Z5Q A;  1R03 A;  2V2N A;  2BK6 A;  2Z90 A;  2WLU A;  1TK6 A;  4EVB A;  1LKM A;  1S30 A;  4CMY A;  2V2O A;  4YKH A;  3SE1 A;  3RE7 A;  4AM5 A;  2W0O A;  4ETR A;  1S2Z A;  1UMN A;  2ITB A;  3UNO A;  1JYB A;  3RD0 A;  3FVB A;  4ERU A;  4CYB A;  2JD8 0;  4DI0 A;  3PWQ A;  4DAS A;  4RC7 B;  3NOZ X;  3GE4 A;  3KA6 A;  3OGH A;  1LB3 A;  2CF7 A;  5J9V A;  1YV1 A;  2GS4 A;  5FEJ A;  4ZL5 A;  3RBC A;  5LG2 A;  1YUX A;  5GU3 X;  1VEI A;  3U90 A;  3WVV A;  1DAT A;  5ERK A;  4RC7 A;  2CN7 A;  3F36 A;  3F38 A;  5LG8 A;  2YW6 A;  3PW1 A;  2D5K A;  1JIG A;  5GU0 X;  2ZG8 X;  3E1P A;  2CHI A;  3F37 A;  4II4 A;  2XGW A;  3QHC A;  2XJM A;  3PW8 C;  5LS9 A;  3VNX A;  5LBH A;  4TW3 A;  1JI4 A;  2V2S A;  4LPN A;  1NNQ A;  3A9Q A;  3EGM A;  2CHP A;  1KRQ A;  3IS8 A;  5HQO A;  3R2H A;  2FHA A;  3E1J A;  2CLB A;  4LYU A;  2XKQ A;  1QGH A;  4CMY V;  4CVP A;  3PVY B;  3RGD A;  4MKU A;  1UVH A;  2BJY A;  2IU2 A;  3R2R A;  4LQV A;  4M35 A;  3E6S A;  4OYN A;  1IES A;  2FG4 A;  5GU1 X;  2C2U A;  3FSE A;  3KXU A;  4M32 A;  4Z5S A;  3PZA A;  3EZU A;  3GHQ A;  3ISE A;  5CMQ A;  4MUD A;  3BT5 A;  3PVY A;  2V2M A;  2FZF A;  3PW8 A;  2V15 A;  3TA8 A;  3GVY A;  2VXI A;  2HTN A;  4ZTT A;  4RC8 A;  5JKM A;  3ERZ A;  1NF6 A;  1Z6O M;  2ZA8 A;  3F39 A;  2V2I A;  4DE6 A;  4ZLW A;  2WLA A;  3T9J A;  4DYX A;  5D8S A;  2FL0 A;  4CVS A;  4TOA A;  4MY7 A;  2Z6M A;  3AK9 A;  3E1O A;  3R2K A;  5D8P A;  4LPJ A;  5J8W A;  1QYB A;  3NP0 X;  2WTL A;  1L8I A;  2G4H A;  3QHB A;  5FFE A;  2C2J A;  4ML5 A;  4KVS A;  4ZMC A;  4KVR A;  3PW1 B;  1JKU A;  2FFX J;  3AF8 X;  5D8X A;  3UOF A;  1EUM A;  1TKO A;  4II4 B;  1RCG A;  4TOB A;  3WNW A;  5HJF A;  2ZUR X;  1DPS A;  1GWG A;  5D8Q A;  3E1N A;  3KWO A;  4ITW A;  3O7R A;  3OJ5 A;  2VZB A;  1XZ1 A;  1IER A;  1OTK A;  1DVB A;  4LYX A;  3SID A;  3EZ0 A;  5JKL A;  2OC5 A;  4P18 A;  5CZU A;  4EVC A;  4LQN A;  3BVF A;  4KVQ A;  1O9R A;  3F33 A;  2QF9 A;  1ZS3 A;  2UX1 A;  3MPS A;  2HR5 A;  3AJP A;  5IX6 A;  4A25 A;  3KA8 A;  3UOI A;  3KA4 A;  5GN8 A;  4REU A;  3E2C A;  4CVT A;  5D8O A;  1VEQ A;  1YUZ A;  5FFC A;  5FFB A;  3PWF A;  4MJY A;  1FHA A;  1JRE A;  4ZKX A;  2Z5R A;  4TOD A;  5J93 A;  2FKZ A;  2IB0 A;  4IXK A;  2CEI A;  3AK8 A;  3QVD A;  1JI5 A;  2XJN A;  2Z5P A;  5D8Y A;  4TOH A;  3ISF A;  2ZA7 A;  2CIH A;  3R2M A;  3PVR A;  2ZG9 X;  3HL1 A;  1JTS A;  3BVK A;  4IWK A;  3PVT B;  3BVL A;  5E2D A;  4ZJK A;  5I4J A;  4RC6 A;  1O9I A;  3F32 A;  1BCF A;  4LQJ A;  3PWQ C;  1RYT A;  3NP2 X;  1RCD A;  4LPM A;  2PYB A;  3SH6 A;  1N1Q A;  1L8H A;  2BKC A;  5HJH A;  3R2S A;  1AEW A;  1VEL A;  2VXX A;  3FI6 A;  5JAC A;  3PVT A;  3IS7 A;  3QZ3 A;  5K52 A;  1VLG A;  4PGK A;  4U3G A;  4DYU A;  3AJQ A;  4XGS A;  3WVW A;  4TOE A;  4E6K A;  4ISP A;  4ISM A;  5J8S A;  4ITT A;  2V2J A;  4EVE A;  2YJJ A;  2RBD A;  4QUW A;  3RAV A;  5E1U A;  1TKP A;  4ZKH A;  2FG8 A;  4IWJ A;  4RC5 A;  4XKU A;  3BKN A;  5GOU A;  3Q4R A;  1JKV A;  1LKO A;  2ZA6 A;  3BVE A;  4TOG A;  1TJO A;  3Q4Q A;  2FJC A;  4CYA A;  2BW1 A;  3KA3 A;  2C41 A;  1SQ3 A;  2C6R A;  4CY9 A;  1BG7 A;  2V2L A;  2YJK A;  5GN8 B;  2Y3Q A;  2CLU A;  1MOJ A;  1ZUJ A;  3Q4O A;  1F33 A;  2OH3 A;  3KX9 A;  4LQH A;  1MFR A;  1RCI A;  5JKM G;  1S3Q A;  1RCC A;  3F35 A;  2CN6 A;  3SHX A;  1HRS A;  4AM4 A;  1XZ3 A;  3F34 A;  1BFR A;  1JGC A;  1NF4 A;  3PVR B;  3E6R A;  3O7S A;  2IY4 A;  2GYD A;  3HIU A;  3E1L A;  3E1M A;  3H7G A;  3AJO A;  1LKP A;  1Z6O A;  2JD6 0;  4RC6 B;  2V2P A;  3KA9 A;  3AF9 X;  3R2L A;  4CVR A;  3ES3 A;  4DYZ A;  1J30 A;  4TOC A;  2X17 0;  1RCE A;  3BVI A;  4TOF A;  4ZKW A;  1SOF A;  2GYQ A;  4ZL6 A;  3IQ1 A;  1F30 A;  4Y08 A;  5FFD A;  1VJX A;  3AF7 X;  3R2O A;  2ZG7 X;  5C6F A;  2YW7 A;  5D8R A;  4MN9 A;  5K53 A;  3E1Q A;  5CMR A;  1Z4A A;  2V2R A;  1B71 A;  4PG1 A;  4DZ0 A;  4EVD A;  1H96 A;  4PG0 A;  4AM2 A;  3QB9 A;  5AXS A;  3Q4N A; 
#chains in the Genus database with same CATH topology
 5JKL G;  4R42 A;  1NFV A;  4XKS A;  2QQY A;  4XKT A;  3WVU A;  4M33 A;  5GU2 X;  2F7N A;  3QD8 A;  5ERJ A;  4Z3B A;  4PGI A;  3A68 A;  4TO9 A;  5FFA A;  4DYY A;  2JD7 0;  2XJO A;  4RC5 B;  4M34 A;  2C2F A;  2Z5Q A;  1R03 A;  3C1Z A;  2V2N A;  2BK6 A;  2Z90 A;  2WLU A;  1TK6 A;  3JZ9 A;  4EVB A;  1LKM A;  1S30 A;  4CMY A;  2V2O A;  4YKH A;  3SE1 A;  3RE7 A;  4AM5 A;  2W0O A;  4ETR A;  1S2Z A;  3M6J A;  4W4L B;  1UMN A;  2ITB A;  3UNO A;  1JYB A;  3RD0 A;  3FVB A;  4ERU A;  4CYB A;  3C1Y A;  2JD8 0;  4DI0 A;  3PWQ A;  4DAS A;  4RC7 B;  3NOZ X;  3V3K B;  3GE4 A;  3KA6 A;  3OGH A;  1LB3 A;  2CF7 A;  5J9V A;  1YV1 A;  2GS4 A;  5FEJ A;  3LKD A;  4ZL5 A;  2AR0 A;  3RBC A;  5LG2 A;  1YUX A;  5GU3 X;  1VEI A;  3U90 A;  3WVV A;  3VVA A;  1DAT A;  5ERK A;  4RC7 A;  2CN7 A;  3F36 A;  3F38 A;  5LG8 A;  2YW6 A;  3PW1 A;  2D5K A;  1JIG A;  5GU0 X;  2ZG8 X;  3E1P A;  2CHI A;  3F37 A;  4II4 A;  2XGW A;  3QHC A;  2XJM A;  3C21 A;  3C23 A;  3PW8 C;  2OKC A;  5LS9 A;  3VNX A;  5LBH A;  4TW3 A;  1JI4 A;  2V2S A;  4LPN A;  1NNQ A;  3A9Q A;  3EGM A;  2CHP A;  1KRQ A;  3W54 A;  5HU6 D;  3IS8 A;  5HQO A;  3R2H A;  2FHA A;  3E1J A;  2CLB A;  4LYU A;  2XKQ A;  3KHK A;  2G38 B;  4WJG 4;  1QGH A;  4CMY V;  4CVP A;  3PVY B;  3RGD A;  4MKU A;  1UVH A;  2BJY A;  2IU2 A;  3R2R A;  4LQV A;  4M35 A;  3E6S A;  4OYN A;  1IES A;  4KXR B;  2FG4 A;  3FRS A;  5GU1 X;  2C2U A;  3FSE A;  2WWX B;  3KXU A;  4M32 A;  4Z5S A;  3PZA A;  3EZU A;  3GHQ A;  3ISE A;  5CMQ A;  4MUD A;  3GGY A;  3BT5 A;  3PVY A;  3UFB A;  2V2M A;  2FZF A;  3PW8 A;  2V15 A;  3TA8 A;  3GVY A;  2VXI A;  2HTN A;  4ZTT A;  4YXJ A;  4RC8 A;  5JKM A;  3ERZ A;  1NF6 A;  1Z6O M;  2ZA8 A;  3F39 A;  2V2I A;  3FRR A;  4DE6 A;  4ZLW A;  2WLA A;  3T9J A;  4DYX A;  5D8S A;  2FL0 A;  4CVS A;  4TOA A;  4MY7 A;  4MXP A;  2Z6M A;  3AK9 A;  3E1O A;  3R2K A;  2CWL A;  5D8P A;  4LPJ A;  5J8W A;  1QYB A;  3NP0 X;  2WTL A;  1L8I A;  2G4H A;  3QHB A;  5FFE A;  2C2J A;  4ML5 A;  4KVS A;  4ZMC A;  4KVR A;  3PW1 B;  1JKU A;  2FFX J;  3AF8 X;  5D8X A;  3UOF A;  1EUM A;  1TKO A;  4II4 B;  1RCG A;  4TOB A;  3WNW A;  5HJF A;  2ZUR X;  1DPS A;  1GWG A;  5D8Q A;  3E1N A;  3KWO A;  4ITW A;  3O7R A;  3OJ5 A;  2VZB A;  1XZ1 A;  1IER A;  1OTK A;  1DVB A;  4LYX A;  3SID A;  3EZ0 A;  5JKL A;  2OC5 A;  4P18 A;  5CZU A;  2Y44 A;  4EVC A;  4LQN A;  3BVF A;  4KVQ A;  1O9R A;  3F33 A;  2QF9 A;  1ZS3 A;  2UX1 A;  3MPS A;  2HR5 A;  3AJP A;  5IX6 A;  4A25 A;  3KA8 A;  3UOI A;  3KA4 A;  5GN8 A;  4REU A;  3E2C A;  3D19 A;  4CVT A;  5D8O A;  4YXM A;  2V8U A;  1VEQ A;  1YUZ A;  5FFC A;  5FFB A;  3PWF A;  4MJY A;  1FHA A;  1JRE A;  4ZKX A;  2Z5R A;  4TOD A;  5J93 A;  2FKZ A;  2IB0 A;  4IXK A;  3JZA B;  2CEI A;  3AK8 A;  3QVD A;  1JI5 A;  2XJN A;  2Z5P A;  5D8Y A;  4TOH A;  3ISF A;  2ZA7 A;  2CIH A;  3R2M A;  3PVR A;  2ZG9 X;  3HL1 A;  1JTS A;  3BVK A;  4IWK A;  3PVT B;  3BVL A;  5E2D A;  4ZJK A;  5I4J A;  4RC6 A;  1O9I A;  3F32 A;  1BCF A;  4LQJ A;  3PWQ C;  1RYT A;  3NP2 X;  1RCD A;  4LPM A;  2PYB A;  3SH6 A;  1N1Q A;  1L8H A;  2BKC A;  5HJH A;  3R2S A;  1AEW A;  1VEL A;  2VXX A;  3FI6 A;  5JAC A;  3PVT A;  3IS7 A;  3QZ3 A;  5K52 A;  1VLG A;  4PGK A;  4U3G A;  4DYU A;  3AJQ A;  5JDO A;  4XGS A;  3WVW A;  4TOE A;  4E6K A;  4ISP A;  2MGY A;  4ISM A;  5J8S A;  4ITT A;  2V2J A;  4EVE A;  3N6O A;  2YJJ A;  2RBD A;  4X0J A;  4QUW A;  3RAV A;  2N02 A;  5E1U A;  1TKP A;  4ZKH A;  2FG8 A;  4IWJ A;  4RC5 A;  4XKU A;  3BKN A;  5GOU A;  3Q4R A;  1JKV A;  1LKO A;  2ZA6 A;  3BVE A;  4TOG A;  1TJO A;  3Q4Q A;  2FJC A;  4CYA A;  2BW1 A;  3KA3 A;  2C41 A;  1SQ3 A;  2C6R A;  4CY9 A;  1BG7 A;  2V2L A;  2YJK A;  5GN8 B;  2Y3Q A;  2CLU A;  1MOJ A;  1ZUJ A;  3Q4O A;  3VV9 A;  4W4K B;  1F33 A;  2OH3 A;  3KX9 A;  4LQH A;  1MFR A;  1RCI A;  5JKM G;  1S3Q A;  1RCC A;  3F35 A;  2CN6 A;  3SHX A;  1HRS A;  4AM4 A;  1XZ3 A;  3F34 A;  1BFR A;  1JGC A;  3GGZ A;  1NF4 A;  3PVR B;  3E6R A;  3O7S A;  2IY4 A;  2GYD A;  3HIU A;  3E1L A;  3E1M A;  3H7G A;  3AJO A;  1LKP A;  1Z6O A;  2JD6 0;  4RC6 B;  2V2P A;  3KA9 A;  3AF9 X;  3R2L A;  4CVR A;  3ES3 A;  2V8T A;  4YVZ A;  4DYZ A;  1J30 A;  4TOC A;  2X17 0;  1RCE A;  3BVI A;  4TOF A;  4ZKW A;  1SOF A;  2GYQ A;  4ZL6 A;  4E40 A;  3IQ1 A;  1F30 A;  4Y08 A;  5FFD A;  3DBY A;  1VJX A;  3AF7 X;  3R2O A;  2ZG7 X;  5C6F A;  2YW7 A;  5D8R A;  4MN9 A;  5K53 A;  3E1Q A;  3L0M A;  5CMR A;  1Z4A A;  2V2R A;  1B71 A;  5JDO B;  4PG1 A;  4DZ0 A;  4EVD A;  1H96 A;  4PG0 A;  3KDQ A;  4AM2 A;  3QB9 A;  5AXS A;  3Q4N A; 
#chains in the Genus database with same CATH homology
 5JKL G;  4R42 A;  1NFV A;  4XKS A;  2QQY A;  4XKT A;  3WVU A;  4M33 A;  5GU2 X;  2F7N A;  3QD8 A;  5ERJ A;  4Z3B A;  4PGI A;  3A68 A;  4TO9 A;  5FFA A;  4DYY A;  2JD7 0;  2XJO A;  4RC5 B;  4M34 A;  2C2F A;  2Z5Q A;  1R03 A;  3C1Z A;  2V2N A;  2BK6 A;  2Z90 A;  2WLU A;  1TK6 A;  3JZ9 A;  4EVB A;  1LKM A;  1S30 A;  4CMY A;  2V2O A;  4YKH A;  3SE1 A;  3RE7 A;  4AM5 A;  2W0O A;  4ETR A;  1S2Z A;  3M6J A;  4W4L B;  1UMN A;  2ITB A;  3UNO A;  1JYB A;  3RD0 A;  3FVB A;  4ERU A;  4CYB A;  3C1Y A;  2JD8 0;  4DI0 A;  3PWQ A;  4DAS A;  4RC7 B;  3NOZ X;  3V3K B;  3GE4 A;  3KA6 A;  3OGH A;  1LB3 A;  2CF7 A;  5J9V A;  1YV1 A;  2GS4 A;  5FEJ A;  3LKD A;  4ZL5 A;  2AR0 A;  3RBC A;  5LG2 A;  1YUX A;  5GU3 X;  1VEI A;  3U90 A;  3WVV A;  3VVA A;  1DAT A;  5ERK A;  4RC7 A;  2CN7 A;  3F36 A;  3F38 A;  5LG8 A;  2YW6 A;  3PW1 A;  2D5K A;  1JIG A;  5GU0 X;  2ZG8 X;  3E1P A;  2CHI A;  3F37 A;  4II4 A;  2XGW A;  3QHC A;  2XJM A;  3C21 A;  3C23 A;  3PW8 C;  2OKC A;  5LS9 A;  3VNX A;  5LBH A;  4TW3 A;  1JI4 A;  2V2S A;  4LPN A;  1NNQ A;  3A9Q A;  3EGM A;  2CHP A;  1KRQ A;  3W54 A;  5HU6 D;  3IS8 A;  5HQO A;  3R2H A;  2FHA A;  3E1J A;  2CLB A;  4LYU A;  2XKQ A;  3KHK A;  2G38 B;  4WJG 4;  1QGH A;  4CMY V;  4CVP A;  3PVY B;  3RGD A;  4MKU A;  1UVH A;  2BJY A;  2IU2 A;  3R2R A;  4LQV A;  4M35 A;  3E6S A;  4OYN A;  1IES A;  4KXR B;  2FG4 A;  3FRS A;  5GU1 X;  2C2U A;  3FSE A;  2WWX B;  3KXU A;  4M32 A;  4Z5S A;  3PZA A;  3EZU A;  3GHQ A;  3ISE A;  5CMQ A;  4MUD A;  3GGY A;  3BT5 A;  3PVY A;  3UFB A;  2V2M A;  2FZF A;  3PW8 A;  2V15 A;  3TA8 A;  3GVY A;  2VXI A;  2HTN A;  4ZTT A;  4YXJ A;  4RC8 A;  5JKM A;  3ERZ A;  1NF6 A;  1Z6O M;  2ZA8 A;  3F39 A;  2V2I A;  3FRR A;  4DE6 A;  4ZLW A;  2WLA A;  3T9J A;  4DYX A;  5D8S A;  2FL0 A;  4CVS A;  4TOA A;  4MY7 A;  4MXP A;  2Z6M A;  3AK9 A;  3E1O A;  3R2K A;  2CWL A;  5D8P A;  4LPJ A;  5J8W A;  1QYB A;  3NP0 X;  2WTL A;  1L8I A;  2G4H A;  3QHB A;  5FFE A;  2C2J A;  4ML5 A;  4KVS A;  4ZMC A;  4KVR A;  3PW1 B;  1JKU A;  2FFX J;  3AF8 X;  5D8X A;  3UOF A;  1EUM A;  1TKO A;  4II4 B;  1RCG A;  4TOB A;  3WNW A;  5HJF A;  2ZUR X;  1DPS A;  1GWG A;  5D8Q A;  3E1N A;  3KWO A;  4ITW A;  3O7R A;  3OJ5 A;  2VZB A;  1XZ1 A;  1IER A;  1OTK A;  1DVB A;  4LYX A;  3SID A;  3EZ0 A;  5JKL A;  2OC5 A;  4P18 A;  5CZU A;  2Y44 A;  4EVC A;  4LQN A;  3BVF A;  4KVQ A;  1O9R A;  3F33 A;  2QF9 A;  1ZS3 A;  2UX1 A;  3MPS A;  2HR5 A;  3AJP A;  5IX6 A;  4A25 A;  3KA8 A;  3UOI A;  3KA4 A;  5GN8 A;  4REU A;  3E2C A;  3D19 A;  4CVT A;  5D8O A;  4YXM A;  2V8U A;  1VEQ A;  1YUZ A;  5FFC A;  5FFB A;  3PWF A;  4MJY A;  1FHA A;  1JRE A;  4ZKX A;  2Z5R A;  4TOD A;  5J93 A;  2FKZ A;  2IB0 A;  4IXK A;  3JZA B;  2CEI A;  3AK8 A;  3QVD A;  1JI5 A;  2XJN A;  2Z5P A;  5D8Y A;  4TOH A;  3ISF A;  2ZA7 A;  2CIH A;  3R2M A;  3PVR A;  2ZG9 X;  3HL1 A;  1JTS A;  3BVK A;  4IWK A;  3PVT B;  3BVL A;  5E2D A;  4ZJK A;  5I4J A;  4RC6 A;  1O9I A;  3F32 A;  1BCF A;  4LQJ A;  3PWQ C;  1RYT A;  3NP2 X;  1RCD A;  4LPM A;  2PYB A;  3SH6 A;  1N1Q A;  1L8H A;  2BKC A;  5HJH A;  3R2S A;  1AEW A;  1VEL A;  2VXX A;  3FI6 A;  5JAC A;  3PVT A;  3IS7 A;  3QZ3 A;  5K52 A;  1VLG A;  4PGK A;  4U3G A;  4DYU A;  3AJQ A;  5JDO A;  4XGS A;  3WVW A;  4TOE A;  4E6K A;  4ISP A;  2MGY A;  4ISM A;  5J8S A;  4ITT A;  2V2J A;  4EVE A;  3N6O A;  2YJJ A;  2RBD A;  4X0J A;  4QUW A;  3RAV A;  2N02 A;  5E1U A;  1TKP A;  4ZKH A;  2FG8 A;  4IWJ A;  4RC5 A;  4XKU A;  3BKN A;  5GOU A;  3Q4R A;  1JKV A;  1LKO A;  2ZA6 A;  3BVE A;  4TOG A;  1TJO A;  3Q4Q A;  2FJC A;  4CYA A;  2BW1 A;  3KA3 A;  2C41 A;  1SQ3 A;  2C6R A;  4CY9 A;  1BG7 A;  2V2L A;  2YJK A;  5GN8 B;  2Y3Q A;  2CLU A;  1MOJ A;  1ZUJ A;  3Q4O A;  3VV9 A;  4W4K B;  1F33 A;  2OH3 A;  3KX9 A;  4LQH A;  1MFR A;  1RCI A;  5JKM G;  1S3Q A;  1RCC A;  3F35 A;  2CN6 A;  3SHX A;  1HRS A;  4AM4 A;  1XZ3 A;  3F34 A;  1BFR A;  1JGC A;  3GGZ A;  1NF4 A;  3PVR B;  3E6R A;  3O7S A;  2IY4 A;  2GYD A;  3HIU A;  3E1L A;  3E1M A;  3H7G A;  3AJO A;  1LKP A;  1Z6O A;  2JD6 0;  4RC6 B;  2V2P A;  3KA9 A;  3AF9 X;  3R2L A;  4CVR A;  3ES3 A;  2V8T A;  4YVZ A;  4DYZ A;  1J30 A;  4TOC A;  2X17 0;  1RCE A;  3BVI A;  4TOF A;  4ZKW A;  1SOF A;  2GYQ A;  4ZL6 A;  4E40 A;  3IQ1 A;  1F30 A;  4Y08 A;  5FFD A;  3DBY A;  1VJX A;  3AF7 X;  3R2O A;  2ZG7 X;  5C6F A;  2YW7 A;  5D8R A;  4MN9 A;  5K53 A;  3E1Q A;  3L0M A;  5CMR A;  1Z4A A;  2V2R A;  1B71 A;  5JDO B;  4PG1 A;  4DZ0 A;  4EVD A;  1H96 A;  4PG0 A;  3KDQ A;  4AM2 A;  3QB9 A;  5AXS A;  3Q4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...