5HJLA

Crystal structure of class i tagatose 1,6-bisphosphate aldolase lacd from streptococcus porcinus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
322
structure length
322
Chain Sequence
SNKKAYLEKVSRDGIISALAFDQRGALKRMMASHQKEEPTTEQIVSLKRLVSEELTPYASSILLDPEYGLPAIEVKDQKAGLLLAYEKTGYDAKTSSRLPDCLEDWSVKGLKAAGADAIRFLLYYDVDGNEAVNHQKKAYIERIGSECQAEDLPFFLEILTYDEKISDNSSIAFAKVKAHKVNEAMRVFSAKRFGIDVLKVEVPLNMAYVEGFTEGPILYSKADAALAFKEQEAASHLPYIYLSAGVSAQLFQETLIFAAQSGATFNGVLCGRATWADVVSVYIKEGEAAARQWLRQEGVKNIESLNDVLAKTASPWTNKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Characterization of a new class I Tagatose-1,6-bipshosphate aldolase from Streptococcus porcinus : switch in specificity directed by an Arginine
rcsb
source organism Streptococcus porcinus str. jelinkova 176
molecule tags Lyase
molecule keywords Tagatose 1,6-diphosphate aldolase
total genus 120
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 4.1.2.40: Tagatose-bisphosphate aldolase.
pdb deposition date 2016-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5hjlA00
1IGSA 1QR7A 1OFAA 1F7BA 3LCWA 1FCBA 4U28A 5F2LA 3VE9A 1SZFA 3G1AA 2A4AA 5EA9A 5AC7A 5CPOA 2YCEA 1FX6A 1DL3A 5HUOA 1B9BA 1SO4A 2C16A 3QJAA 3M5VA 4M6PA 4WXYA 2QCEA 3DKJA 5EPDA 5DY2A 1ZALA 4RJEA 2Y7DA 2B7PA 1F6PA 1AW5A 4XUGA 2H8ZA 3QH2A 2RH9A 2YFOA 4UFJA 3S5ZA 5LNSA 3UPWA 2E5DA 4ZQOA 1G4SA 2ZA2A 1QNVA 2ZRYA 1AK5A 2A1YA 5DLCA 1UJPA 2QDHA 3FLUA 3G24A 5LNVA 3V75A 3NQ2A 2V5BA 4DELA 4JTFA 1AG1O 5SWUA 1XUZA 2QUVA 3EWZA 3RK8A 4DF1A 2PURA 1XC4A 2TMDA 1GPWA 3KX6A 1EWEA 3NQGA 1TPEA 3LXCA 3W72A 3G18A 3U6WA 3L5MA 4UIOA 2OCZA 4IQLA 3NEVA 3VE7A 1I2OA 2WSRA 3KOFA 3HJZA 3W7KA 1CI1A 2R94A 3NQFA 1W56A 3TDFA 3JS3A 1ZFJA 5DCBA 4RZ6A 4UFKA 1MXSA 3BVJA 1JR1A 1GVOA 2P0OA 3HGSA 1TPDA 1VLWA 2Q3RA 5I3JA 3DFQA 1H7NA 1VJIA 1R30A 1JULA 5L9FA 4N9EA 3HG4A 5HNRA 4FXSA 1P0KA 3W1PA 3LB0A 4R53A 4HNTA 3W75A 1SSGA 3B06A 3L21A 4K7YA 3G1FA 3W22A 1ZY9A 1NFBA 5D09A 3EWYA 3QMTA 4OV4A 2VFDA 1HUVA 3HB9A 4ML9A 3MI3A 2JKAA 3O6DA 1Y0EA 4EIVA 4NNBA 3S8HA 1KTBA 2V30A 3QQ1A 4JR5A 2EPHA 4GUFA 1QWGA 3W7QA 4CLMA 4DQWA 1WAUA 2R14A 1F05A 4GXMA 1SQ7A 4EVZA 1LBFA 2A7NA 3TXZA 3OA3A 3DFOA 1RD5A 1DJQA 3A23A 3MBDA 4MLJA 5G5IA 2ZZ4A 2J9XA 4O4WA 1B3OA 1FDZA 3BLEA 5D2WA 3QMRA 4UFHA 4BR1A 2D73A 4I7UA 3NQ7A 4KWWA 2O7SA 1G69A 3V1PA 3LLDA 4WY0A 2ZRVA 4JTGA 1ML1A 2FB3A 1OK4A 3TQKA 1A5BA 4QITA 2YGYA 3G1DA 1SFJA 2DU2A 2Q8ZA 4NQ1A 1I8JA 2DORA 1H5YA 4Y96A 4IMCA 5CGQA 1EEPA 5G4EA 3C2VA 3KVMA 4ZQCA 3UPBA 3WK3A 3MI2A 1KM5A 4N9BA 5LHFA 1IXQA 1YXCA 3IVSA 1AW2A 1TTIA 1T99A 3P8JA 1LCOA 3ABQA 4M19A 4UNLA 2AGKA 2ZA1A 5D32A 3WJZA 2GUUA 3EX4A 5LNWA 1XCFA 4LOCA 1G4TA 4UUIA 2PRHA 3FKKA 2RDWA 2ZZ1A 3LCLA 4BK9A 3MO7A 5FF3A 2X1RA 5CZSA 3M7WA 4R33A 1TPC1 1ICSA 3H53A 4NX0A 2QKFA 1JQVA 1JUBA 1YXDA 6ALDA 5G2IA 5DN1A 3OVPA 1VS1A 4QISA 1SU5A 3NAVA 4PC8A 1HG3A 4OHQA 3M5XA 2NWSA 3EWXA 4GUHA 1Z48A 3I6RA 3W1LA 5CZ0A 1HL2A 4O1BA 3VI2A 4X9SA 4XKYA 2Y89A 1OG0A 2H3BA 2BWGA 3ABSA 3STGA 1AMKA 2V81A 2PC4A 3OVRA 4CNNA 1A5CA 3M5YA 3QC3A 3TQVA 4P2VA 2OZ0A 3GKFA 5KZDA 3N2XA 4OBTA 4TIMA 2EHHA 5IBXA 3STCA 3M9YA 4OV9A 3E96A 1M6JA 2J27A 3MP5A 3IV3A 3O6YX 2NLIA 3R13A 3W7DA 2FFCA 3S1WA 3DBPA 3DFNA 4N6FA 1GYLA 3HO8A 3W7LA 2B4GA 4K37A 3ZWTA 4N02A 1LLWA 1XUUA 3F03K 3PUEA 3ZWSA 1A5AA 3KAOA 4LVDA 4UTIA 3CU2A 2QCHA 2CLHA 5DXYA 2QUTA 3CT7A 3HOJA 1O95A 1VC4A 1JJKA 3Q2DA 2I14A 3BW4A 1G4PA 2NX1A 3LHZA 1WDWA 3LHWA 5HWNA 1FQ0A 2X1SA 3LLFA 2X1UA 1H51A 1XL9A 4QJ1A 3CQ0A 3OBKA 3P8IA 3NNTA 2OT1A 1H1YA 4YL2A 1W8SA 1XKYA 2YXGA 4FIRA 1OVDA 4K7VA 3FOKA 1L9WA 1TJPA 4JTTA 1Q6QA 1VQTA 4JTEA 5EY5A 5D04C 1KLZA 4NXKA 4NUWA 4RK8A 3TQ0A 5BOOA 3I7QA 5AHLA 3RMJA 3T78A 3TFXA 2DZSA 4S2BA 4E2DA 7TIMA 3AO0A 2XFWA 4AH7A 1UCWA 2ISWA 2GJLA 1TQXA 4ORIA 5CPNA 3P80A 4XTIA 3G1SA 4JY8A 1R2SA 4DBDA 3HQ1A 5G1YA 2CLMA 3BGGA 3UWWA 4DF0A 4YCOA 4TMBA 3BO9A 1X1ZA 1OFBA 2CLIA 1WBJA 2O7QA 1DORA 3A9IA 3NOEA 1HTIA 4IMEA 1EX5A 1I2NA 4IXHA 2B7QA 1E51A 3L0NA 3MUXA 1MEHA 2ZCGA 1N55A 4N9DA 2NV2A 2Y6ZA 1ADOA 3P82A 3QYQA 5EMUA 4UTTC 1JVNA 4WOZA 1JCMP 1NVMA 4BI7A 1FDYA 1FWWA 3G0UA 1Q6LA 2C6QA 3DFTA 4N9CA 4O54A 2RDTA 3O07A 4Q32A 1FCVA 3RLVA 3JRKA 4EWND 4FX8A 1LZOA 3UWYA 3T40A 3W85A 2NWRA 4BF9A 1FWSA 4O17A 1ALDA 3LV6A 3ZS4A 5AYYA 1K8XA 2XN2A 1NF0A 1JRCA 3NQEA 1MEWA 4JY9A 1HO4A 4UCGA 5AC6A 4JX4A 4O18A 1MEIA 1SO5A 1VZWA 3LTYA 3LM7A 1OX4A 3LCXA 3W2MA 3ANYA 5E93A 1J2WA 3PVFA 4G1KA 4NT0A 4CQ9A 2H3DA 4MKNA 4RCXA 2G5WA 3GAYA 1K7EA 1OYCA 3NQAA 3L0KA 2Z1BA 1SZNA 3QSRA 4DBEA 3NPWA 4UC5A 3O6CA 3CHVA 1F73A 3W7EA 2KZHA 1PCWA 2YZRA 4K38A 2WKJA 1M5WA 3P62A 3W2JA 2B7OA 5EL1A 1O5XA 2JGYA 3GLCA 2H8XA 4JNMA 5TBOA 4ICNA 1KM2A 3L68A 2VC6A 1F6KA 5A8GA 4MIMA 3P84A 3S1UA 5FEZA 1F74A 3MW7A 1QOQA 3DHFA 5HULA 4YCPA 2HS6A 5J5DA 4HNNA 3L9CA 1PHQA 2ZRUA 1P4CA 2V2DA 3LTPA 1GG0A 2ISVA 2V2HA 2QCFA 2CWNA 3BW2A 5HWMA 2Q8LA 3BLFA 4UTWA 1OX5A 1LORA 1OFOA 3NQVA 4ONVA 5T26A 2GJNA 4NVTA 3IIOA 4ZQMA 3IVTA 1H7RA 4UTUA 1H7PA 4K6AA 1DOSA 3E9AA 4TMCA 1GT8A 3STFA 2ZRZA 1TTPA 3BK0A 3NL3A 3SFKA 1GVQA 4GE8A 1CX9A 2FPYA 3SY5A 3W9ZA 4CNOA 1KM3A 1VHCA 2WNQA 5CSRA 4I9AA 1FCQA 2C3ZA 4JGDA 2NXGA 4TU1A 4RXGA 3UNDA 1P0NA 5EKYA 3BV4A 2B0MA 3C4UA 3F4WA 2E77A 4NU7A 3DKLA 2CZDA 4IGHA 4OE7A 3R89A 1D3HA 4AXKA 3SR7A 4CQ8A 3C3NA 3LI0A 4NZFA 4LVFA 1X6UA 1S5WA 1SR9A 5U7SA 1PL9A 1SZGA 4AAJA 3PBVA 4X3ZA 3CWNA 4UTWC 4JYEA 3NL6A 2GVLA 3W83A 8TIMA 2ZZ2A 3GK0A 3W3OA 3NA8A 5FF7A 3W88A 1B4EA 1KV5A 3GZ3A 4NZJA 4JTKA 1FWRA 2ZTKA 3O16A 2R91A 4HPJA 1B4KA 3M0ZA 4ZQNA 2G95A 1AW1A 3FFSA 1D9EA 3TMLA 2QDGA 2YPIA 4H4IA 5C54A 4MJMA 4EF9A 1S5TA 3W1MA 3TROA 5HQEA 1W37A 1K03A 4QQ3A 3S6DA 2FIQA 3FA5A 1Q3NA 3N19B 1VLIA 3N3MA 1RZMA 2GVJA 2NXIA 5BNKA 2ZQ0A 2VOMA 4O13A 2NX9A 2AAMA 2A7RA 3TFCA 2DZPA 5D33A 4O16A 3TE9A 3E0IA 1UUMA 4TR9A 4IMDA 3TW6A 3W2LA 4RKAA 1RV8A 3TC6A 1L2UA 1PCKA 3NPUA 4I7WA 4UTMA 4Z1CA 1TRDA 1MO0A 1TMHA 3LX9A 4FNSA 5J5RA 2NX3A 3MJYA 3NQ6A 1RQEA 1VCFA 2Y70A 1WXJA 2E5CA 3HIJA 4ALDA 4ZVJA 4O12A 4UFMA 4WY0B 3RNDA 1F76A 1ONRA 1GTHA 4LVAA 4BI5A 1FDJA 1PE1A 1OHLA 4HKPA 3NL5A 4JXCA 1EP3A 5K9DA 1GG1A 5LHEA 3L5LA 1DJNA 1EP1A 2FQIA 2QJIA 3CEPA 2ZBTA 4KFNA 2CLEA 1SFLA 4HHPA 5K4ZA 1TPFA 1JUKA 1XBVA 1SO3A 3GVGA 4Z08A 4A2SA 3SJ3A 3UD6A 2C18A 2TYSA 3GDLA 3LI1A 4MUZA 2DZTA 1T8XA 3W7HA 1EB3A 3L0GA 3I7SA 1CW2A 3SECA 1QO2A 3U8GA 2PRMA 4JEQA 3WJWA 2WV8A 1YTEA 1K8ZA 4JIPA 2YYUA 4A29A 3TAOA 1LP6A 3BARA 4ORMA 5G2HA 5AOUA 3C8FA 2EKCA 2Y7EA 3RU6A 3C0JA 4MFDA 4OT7A 3D0CA 3NPXA 5F2GA 3E02A 2QCCA 4ADSA 3O63A 1H50A 3MP4A 3RFAA 2JKPA 4O28A 3SW6A 1KFLA 4PH6A 1M7PA 1YTDA 5HUPA 4WX2A 3TA6A 1BEUA 1VCVA 1WOAA 4ZMGA 3DFSA 2RFGA 4IMFA 4L4LA 3P5ZA 3LCGA 1DVJA 3UXDA 4MY8A 2CZFA 1K02A 4K36A 3LCIA 3W7IA 3NZ1A 2TPSA 4MY1A 4WOQA 1H7WA 4O1AA 1OYAA 5FI8A 4BWLC 5AHMA 3FYPA 5A5WA 3W7NA 2QCDA 3A21A 1EPXA 2FDSA 3BG3A 3W1XA 3IGSA 2J9ZA 3EWWA 1JCNA 2WJZA 3R12A 2C15A 1H63A 2QCNA 3VFLA 2YR1A 1EUNA 4E38A 4NX5A 3THAA 1LBMA 2I1OA 3H55A 3PSVA 4MZ1A 1EWDA 4JX6A 5D38A 3L66A 3O1NA 2EAWA 1M7OA 2DJXA 4LTSA 3FIGA 3IIVA 1KTCA 3R5EA 5K4XA 3GDKA 1FUYA 3BGJA 2WSQA 4MZ8A 3A24A 3ATZA 4O50A 5BMWA 2OMAA 4M7SA 1FWNA 2VFEA 1F5ZA 1XBYA 5IM51 3EX2A 4UTTA 1RR2A 4PEKA 5DCEA 1W3TA 2B7NA 3CTLA 1RQHA 4UTHA 4JDBA 4NJJA 5L6UA 4UFIA 3NQCA 5E1QA 3QPYA 1W54A 4BFAA 4LS2A 5DXXA 3PULA 3HPXA 3P61A 2VKZG 5DCDA 2DZUA 1QPOA 1TPUA 1I2PA 2RDUA 2YX0A 3N34A 2QJGA 3M1ZA 1ICPA 4CCDA 3EXSA 1ICQA 4J9JA 5D2VA 5C6MA 3QMSA 1G4EA 5LSMA 3PSWA 5D37A 3EB2A 3M47A 1QDSA 5GVJA 2ZA3A 3TMQA 4JTLA 4LRSA 4XQ6A 3TW7A 2FTPA 3NL2A 2DZVA 2CFFA 4IOTA 3THQA 5AHIA 5F4SA 2GQAA 3AJXA 3NM3A 4XKYB 5AC8A 3TK7A 3W7OA 2DZWA 3K30A 2FB2A 5DBUA 2QCDB 3PC0A 3O8AA 1JCLA 1JUEA 4N4QA 4Z0SA 3A22A 2FPTA 4WUIA 4M7TA 1A53A 3W71A 2JK2A 3PBWA 5EYWA 1AL7A 4YXGA 2FLIA 5KZEA 3L65A 4RX0A 4FNTA 5CZJA 3W2KA 3S9YA 2ZYFA 1W5OA 3EXTA 4Y8FA 3IGUA 3G0SA 3KHJA 5KZMA 1KLYA 3B4UA 3OHIA 1X8FA 3G1XA 3FYOA 2X16A 5K9XA 3PBUA 4MJZA 5BMXA 3SGUA 4QAIA 3W7JA 4LRTA 3GXTA 4AEOA 5FEWA 1O4UA 4GNJA 3T55A 5TQLA 1S5VA 3NO5A 3T4CA 3DFPA 4GUIA 2ZDRA 1VH7A 3NYZA 4YLWA 3T44A 5DELA 3DAQA 2DZXA 2ABAA 3G8RA 2Z6JA 1A50A 2CLLA 2YW4A 3QFEA 4JTHA 3WFAA 4AVFA 5AB3A 1TV7A 3G1HA 1WX0A 1J4EA 4JTUA 4UTKA 2YYTA 4AWUA 4JTIA 2NUWA 3HG5A 3NVTA 4WXZA 1WQ5A 4X2RA 3FJ6A 4DEFA 5LGZA 4Y6GA 5I3HA 4GBUA 5K2ZA 5AFDA 5I3KA 4O53A 2E6AA 3PBYA 4UMCA 1SZEA 4H6KA 5CG7A 3QQ0A 4IPIA 4Q33A 1QCWA 1YDOA 1KFBA 1ZNNA 5FF4A 3B0PA 2A85A 3F1QA 3IEBA 3EX3A 4LUIA 1FCUA 4YWIA 1ME8A 4LWWA 1OK6A 4CNPA 2BSLA 1VRDA 3PS7A 4XBKA 4KWVA 1DBTA 3M44A 2WPBA 3W7MA 1B57A 1KM6A 4Z1AA 5F4WA 3N73A 1R46A 3N14A 2HS8A 3UZ5A 4JTJA 2C1HA 1YTKA 3NPVA 4K8EA 1HFBA 2CZ5A 2C19A 3RLUA 1ME9A 5HINA 1LRNA 4Z0JA 1SSDA 1ZJIA 3IIPA 3GAKA 1W1ZA 2E6FA 4AHPA 4FXRA 3P5YA 3QM3A 2BXVA 4ZQPA 1QOPA 3IRDA 1W5MA 1Q6RA 3UWUA 2ABBA 2J88A 1Z44A 2X30A 3EWBX 4ADTA 1GQNA 3LBMA 3GX9A 3DGRA 1UB3A 3W84A 3O05A 3W74A 5D03A 1N8FA 3PM6A 4O1CA 3TR2A 3QPZA 3NXFA 4BI6A 3MP3A 3TUUA 3EEGA 1GZGA 3G0XA 3W2NA 4PL1A 1TO3A 1Z42A 5KMYA 4JX5A 3GXNA 1TPWA 3SI9A 4Y90A 1U5JA 4AHOA 2H6RA 4POCA 3ABRA 2A2IA 2C0AA 3GNNA 1F2JA 1R2TA 3CEUA 1XXXA 4FNQA 1KBIA 4KFOA 3W07A 3FS2A 2J9YA 3OIXA 3TSMA 1A5SA 1BWKA 1H60A 1EUAA 4E0CA 3QW4B 4IUOA 4LVBA 2BLEA 1JQXA 3HF3A 4MPQA 4NJHA 5H2ZA 3DHDA 2QF7A 3PB0A 3LXBA 1TTQA 2V82A 4FX6M 3W87A 4MVAA 2TSYA 3DU0A 2ZZ6A 1KM1A 4M6VA 1OF8A 1LTDA 3UXAA 4MLRA 2ATSA 3W7RA 4FX7A 4RZ4A 3UY7A 1K3UA 4OQVA 3B8DA 3LERA 4AMAA 4A22A 1YPFA 5D2YA 4O8RA 1DHPA 1XM3A 3RF9A 2A5HA 3MI6A 5LNRA 3WK2A 4O15A 1XDMA 3OVQA 4Z1DA 1QO5A 4A3UA 3QW3A 4GC4A 1H61A 3TKFA 5H91A 3LHYA 4CCCA 4ZZ9A 5AHNA 3UWZA 4HT3A 4LS1A 2Q3OA 3L2IA 2ZRXA 1GVSA 1KFJA 1T96A 3E49A 4O10A 3S5YA 1WOBA 4JN6A 1G7UA 4R7JA 3U2OA 3WK1A 2CLOA 3O15A 1D3GA 1YDVA 1TV5A 4O11A 1XBXA 2GVGA 4I7VA 4FHAA 2WNNA 4LS0A 1EA0A 5D2TA 3BG9A 3M43A 3USBA 1GYNA 4NNAA 4S1FA 3LOTA 4GUGA 2VENA 1PHWA 4IX0A 4XBSA 3M5ZA 3G1YA 2XN1A 2OJPA 4UFLA 4N6EA 1PVNA 3NR0A 1Z41A 3EX1A 1OFQA 1KA9F 4WQ6A 4O4VA 5F1UA 2VEIA 5FF0A 2P1FA 4NJGA 1AL8A 1EP2A 2CLKA 4HIBA 1VHNA 2PE4A 4Z1BA 3W7PA 1NEYA 4IWWA 3TC7A 2JKEA 1DKWA 4QNWA 3H54A 2OT0A 3E12A 3QRHA 2X2GA 2J24A 5K3VA 3INPA 1KV8A 1WYIA 3O06A 5EBUA 3W7GA 1DV7A 3BPWA 2C14A 1RVGA 5LGXA 3STEA 1TV8A 3DI0A 4AWSA 4XZ9A 2LLEA 2QCLA 4NNCA 4QM1A 4UXDA 4W9TA 3M16A 1LBLA 3NG3A 2HSAA 1XFBA 5F4XA 3A5FA 5CPLA 5HJLA 4FF7A 3L5AA 2VXNA 2A6NA 1TIMA 3MMTA 3S0CA 2H90A 4LV9A 3KXQA 3TSDA 1OX6A 3HPSA 1ZCOA 3C56A 3KVJA 2G97A 3LV5A 3EX6A 4FNUA 5KSWA 3C6CA 4LC8A 4LW7A 2ZZ3A 3GDRA 5I3GA 3P7YA 3IGXA 4QIUA 1GOXA 4IJBA 3IIXA 4DO4A 2QCMA 1C8VA 5G1TA 4HSNA 3IVUA 3KVLA 5FEXA 4JS3A 2TRSA 3GR8A 4LY8A 2ZZ5A 3PB2A 1RQBA 3LDVA 4HN4A 4PL2A 4D2JA 1TPVA 3GNDA 1I2RA 3LBCA 3PG9A 3LXAA 2F7FA 4P61A 5DY3A 2UV8G 3VCRA 3S5OA 1O5KA 1KFEA 1OFRA 2ALDA 4CQAA 1IF2A 1JCJA 2ISSA 1NF7A 5KINA 2W6RA 4L4MA 4Y9AA 2V2CA 3CIWA 3TJXA 2G96A 3UQNA 3WJYA 3C2OA 3MBFA 1U83A 4NJIA 3HGJA 4WD0A 4AWTA 3DH7A 2CU0A 2A0NA 1H62A 2CZEA 1X7FA 1ZAIA 1TREA 1WBHA 3MWAA 1SW0A 4QSHA 5TIMA 1L6SA 4PFMA 1NSJA 3TX9A 3I65A 2Y62A 3A5VA 4MOZA 3GB6A 1N7KA 3M41A 2YW3A 1YYAA 2QUUA 3DXIA 3R8RA 1LOQA 1GVRA 2ZRWA 4OGZA 3S5NA 3W2UA 1FBAA 2VFIA 3CLMA 4Q4KA 3CC1A 3GDTA 5BRBA 3C2FA 5FEPA 2DJLA 3T7VA 1VYPX 1I45A 2XN0A 3F4NA 4IPJA 2FJKA 3UYCA 5C2XA 4O0ZA 2WSYA 3B04A 3W70A 2Z0IA 1SW3A 1LM1A 4O52A 4GWEA 5IBXC 2ZFAA 4JDYA 4IXXA 1FXPA 2GOUA 1RPXA 2Y7GA 4JYFA 1ZHAA 2Z6IA 4O14A 3HG3A 3PUDA 2R8WA 4TO8A 2Y7FA 2YSWA 5HR6A 4FEZA 4RLIA 4OWGA 3LCHA 5MHBA 3LRLA 4O19A 5C5YA 2IQTA 4RV8A 3C61A 1MZHA 4PCFA 4M5PA 3TU9A 1HO1A 1PIIA 3GXPA 4DO6A 5CZTA 3EXRA 1FY6A 1BWLA 3ABOA 1NAL1 1IIHA 1XDLA 3BG5A 3YPIA 1W3IA 5K7JA 3SSJA 4ADUA 3GYEA 4GUJA 4UR8A 3C2EA 4PTNA 3NQ8A 3VNDA 5BW6A 4C1LA 3PY2A 1OYBA 4JD4A 2QCGA 1SO6A 1LYXA 4N4PA 5DBTA 1TCDA 1SPQA 4DXVA 2BTMA 3TAKA 2WNZA 1KFKA 2BX7A 3CWOX 1UASA 1PS9A 4LT9A 3UWQA 4DF2A 1TYGA 1KW1A 4MY9A 3VKJA 2V9DA 1LLZA 1OFEA 4O0KA 1THFD 2VEKA 3GIYA 3KVKA 1V7YA 3G1VA 1TTJA 4C1KA 4RXFA 4YMZA 3TIMA 3QZEA 3EKZA 3ATYA 1GWJA 3BLIA 4AB4A 1TPB1 5KTLA 3OG3A 3FJLA 4PA8A 4OU1A 4HNVA 3ELFA 3MHGA 3W1QA 3G3DA 4LNYA 1K7FA 2VEPA 4GRSA 4X22A 2BZNA 2V5LA 1I4NA 1O60A 5E0KA 1YPIA 5D02A 5I3IA 1EIXA 2YDAA 5AHFA 2QEZA 1T0OA 3S1VA 1JCYA 4XWUA 3B0UX 3LRMA 3W73A 1IXOA 2J6XA 3FKRA 1JCXA 1YADA 3PUOA 3I68A 4LV4A 1KFCA 3CB8A 5AHEA 1W31A 2HTMA 2E5BA 2I9EA 3PG8A 4O1DA 3LRKA 3TSBA 3TNOA 2F84A 3SGZA 4IMGA 3QSTA 1G6CA 4K39A 2WOQA 1LRTA 4GJ1A 3W86A 3ZFHA 4ZL1A 3NQDA 1OX4B 4N2YA 3P67A 3G8EA 4RR4A 3PF3A 3MHUA 2NUXA 3NDOA 3LHTA 4WY0F 3SIZA 2AQWA 1R47A 3WJSA 2ATMA 1C29A 2E09A 2EF9A 3HG2A 1TB3A 2E6DA 3LTSA 1ME7A 1TRIA 1TSIA 3LGEA 4U4MA 1XBZA 4WJEA 1OABA 3TH6A 3PAJA 3P81A 1LRQA 3OEXA 4AF0A 5FF2A 2EGZA 1W5PA 4UTLA 5HWJA 1VR6A 5D30A 1G67A 2Y85A 2QAPA 1PV8A 3G22A 1ZENA 3MHFA 1OFPA 3C52A 3W7CA 4EF8A 3W76A 4DO5A 3KRZA 3EWUA 2PRLA 3JR2A 1I2QA 3GDMA 4FNRA 3P74A 3QF0A 3TV8A 1SW7A 4UTJA 3KFTA 1QPQA 3GR7A 3LHUA 1ZAHA 4A21A 3S42A 2QAFA 4M6QA 2HMCA 3W23A 3CM4A 4LC6A 4LVGA 1W5QA 4QNEA 4FB7A 1IIGA 3EKLA 3Q37A 3DZ1A 4ZQRA 1JRBA 4DPQA 3G3MA 1TPH1 3DI1A 1R2RA 1FWTA 1BKSA 4B5NA 5D2XA 5I3FA 3KRUA 2X1TA 2ZZ7A 2C13A 2CW6A 2Y88A 2WO5A 4CCEA 1QPRA 4MZYA 1DQWA 5ABTA 6TIMA 4UR7A 1V5XA 1UBSA 3IIZA 5F2MA 2E68A 4FIQA 3W1AA 5C55A 3HMJG 4HNUA 2PCQA 3N9RA 4DPPA 2GQ8A 3HBLA 4HSOA 5F1VA 1QPNA 4RZ5A 1P1XA 3HGRA 3R2GA 4FO4A 1H7OA 1KTNA 1L6WA 2DP3A 5AYXA 4UNKA 3TXVA 3PWAA 2Y63A 3MYOA 1VCGA 4MYXA 1XI3A 3SZ8A 4JICA 2E6YA 2QJHA 2RKXA 3P60A 4FNPA 3C2RA 1GEQA 1QFEA 4PODA 1X1OA 2NUYA 1LROA 2QR6A 1IXNA 3N9SA 5F2IA 4UMBA 1K8YA 2VFGA 3TCEA 1LOLA 4HPXA 1W3NA 5FESA 2GPTA 3PR2A 3W1TA 5CSSA 1O94A 5G2WA 3ZR4A 4XTDA 3HPZA 3B05A 5LZLA 1YLVA 2E1DA 4R34A 3W6YA 3B03A 1C9DA 4GFSA 1IXPA 1P5BA 3UZJA 3GKAA 4LUJA 2NV1A 4UMAA 2VELA 1GJPA 1J5TA 5AN7A 4A2RA 4AF0B 2P10A 2OX1A 2A7PA 5K9CA 3L67A 1TJRA 3HGOA 1VGAA 1G7VA 1GTEA 1L6YA 4BWLA 1LDCA 2YFNA 5AYZA 4S2CA 2JBMA 5CKSA 3UWVA 1WV2A 3Q94A 5HMSA 3DENA 4K8HA 1S3HA 2VFFA 3LCFA 3W1UA 1K7XA 3TJLA 3BW3A 1H7XA 2Z2UA 4MFEA 2A6LA 4IX2A 3WJXA 3S1XA 5LNUA 4H3DA 1QAPA 4LU0A 3FEMA 1KBJA 2Y61A 1H1ZA 3NZRA 4NJKA 4TX9A 1QMLA 5LKYA 2ZTJA 4AHQA 3W1NA 3LHVA 1LOSA 1KM0A 2JGQA 1TQJA 4NXSA 1OFDA 1Q45A 1VYRA 1VYSX 3I7RA 2NZLA 1SUXA 3CIXA 3KRSA 3NQMA 5G4WA 2GQ9A 3MYPA 3NGJA 2VEMA 1WA3A 4JYDA 1OJXA 1UUOA 1ZAJA 3QEZA 1OF6A 5CPMA 1MSSA 3UY8A 1Q6OA 2A21A 1KM4A 5HR7A 1GVFA 3W1RA 2NXHA 2RHGA 1W5NA 2W79A 4KFPA 3WK0A 3B0VC 1W0MA 3N2MA 2WQPA 5KITA 4O57A 1BTMA 2V8ZA 4WZHA 1DQXA 2V0TA 1YXYA 5U4NA 2FPVA 4MYAA 5D05A 1VPXA 3CPRA 4E2BA 1YDNA 3Q58A 4JIQA 4JTSA 4EOUA 2W0UA 3NM1A 2CLFA 3M6YA 4KKXA 1FXQA 2VFHA
chains in the Genus database with same CATH superfamily
4GFIA 1Y65A 3BV7A 3VE9A 1VRXA 2A4AA 3MKCA 5EA9A 5AC7A 2QUMA 3E2QA 2E9BA 4B3ZA 1KGXA 1V7AA 3M5VA 3QJAA 2BY3A 3WFLA 3AAMA 3ANVA 5H8UA 5CZKA 2Y7DA 4LB4A 2B7PA 4ZXOA 1NP0A 1UOKA 5HANA 3QH2A 3W28A 3E6EA 1ADDA 3MC5A 2DVXA 1QNVA 1BRLB 4LXFA 2A1YA 3P6LA 1AZ2A 1UJPA 3V75A 3LG3A 2V5BA 4P7QA 5CLWA 2VI0A 1NY1A 4KRUA 1V03A 3NSNA 3WH5A 4DF1A 5BXSA 3KOZA 1XC4A 5HPOA 1UR8A 3UBPC 3OLIA 5KETA 1YNQA 3NEVA 4I9MA 3VE7A 2BY2A 2WSRA 3NQFA 1W56A 4MDPA 1OCBA 1CCWB 2G3IA 4RZ6A 4JQ4A 4IFRA 3BVJA 2BXYA 1V0MA 4I8YA 1GVOA 1CXFA 1VLWA 4AIUA 5I3JA 3DFQA 1H7NA 1TZ7A 2WLYA 3HV8A 3HG4A 3LNMA 1UA7A 4OOZA 4AG0A 3UT0A 3W1PA 2DY3A 4R27A 5BZAA 3W22A 3OQ8A 3P0WA 3EWYA 1YX1A 2B81A 1W1IE 2VFDA 1HUVA 4YTRA 3MI3A 2EJAA 4WDUA 2JKAA 4IL2A 4J3ZA 1CB2A 4NNBA 3FGCB 3QQ1A 1DWJM 1GGOA 1QWGA 4ZTXA 2PBGA 4Q7IA 1SJDA 5JXQA 1LBFA 1GJUA 2A7NA 4J27A 3DFOA 3MDUA 1DJQA 2VWSA 2B31A 2ZZ4A 3UGRA 5FKYA 4D6FA 4ZODA 5GNXA 4DB7A 3NQ7A 3V1PA 1OB0A 4WY0A 1NELA 2WVVB 3E5BA 1ML1A 1B9ZA 1X38A 1OK4A 1CPUA 4QITA 1A5UA 4PMZA 1I8JA 4Q8NA 2DORA 2KX9A 2E3ZA 1MXDA 4IMCA 1EEPA 3C2VA 1E6XM 1JFHA 4LCSA 3WK3A 1C90A 1RCQA 2W91A 1KD0A 4PMRA 3ABQA 4M19A 3UA3A 1KGUA 3GXIA 2ZA1A 3FJ4A 5LNWA 2JF6A 2V3EA 2D3LA 4GK8A 2E8ZA 1FHUA 5LIUX 2CZVA 3WD1A 3H22A 1J0HA 3WH9A 1E73M 1JQVA 1JUBA 1S1PA 4QLKA 3KBSA 5DN1A 1SJCA 1VS1A 3KEHA 1UMLA 3TCSA 1KRAC 1PTGA 4PC8A 1HG3A 3M5XA 3WQOA 1P6BA 1Z48A 3SEPA 4XB3A 3I6RA 3AXKA 2V63A 3GIQA 4X9SA 1EO7A 1RP9A 1UWIA 4DYEA 2WK2A 2BY0A 2PC4A 1XFCA 2PB1A 2ZE0A 2CWXA 3N2XA 4TIMA 3R8GA 1QK2A 1WB0A 3LY0A 2DSWA 1M6JA 2J27A 3O6YX 4PE8A 7A3HA 3WQ6A 3GDBA 2FFCA 2AQVA 3S1WA 3AU2A 5TD4A 1H1NA 3NYDA 4N6FA 1GYLA 3W7LA 1ADSA 1XUUA 3F03K 2PDYA 4WF7A 4RDWA 4HA4A 5DXYA 2QUTA 4MHBA 4DWSD 5FOOA 3RYSA 1EIBA 1W2PA 3CGTA 3Q2DA 2VUYA 3CXOA 1LQ2A 1FQ0A 4AYGA 5HWNA 1EBHA 4QJ1A 1GYMA 2OWWA 2HK1A 2YIHA 1TA3A 2XGIA 3FY1A 3DN5A 3P8IA 4PCTA 2X42A 2OWCA 3AWNA 4U33A 3AUOA 2FHBA 4K7VA 4GYJA 2WSPA 4JTTA 1VJSA 3AXXA 1G9HA 4V27A 5D04C 5DX7A 1KLZA 3I7QA 4AW7A 4DWSB 1HZYA 1XGDA 3AO0A 4PCNA 1R38A 3U48A 4ORIA 3PZNA 1BF2A 4BZYA 2J8FA 4DF0A 4YCOA 3BO9A 1OFBA 4PGLA 1WBJA 1DORA 4IMEA 1B2YA 4IXHA 4H2HA 3MUXA 1W8GA 1ZJAA 2NV2A 1ADOA 3P82A 1F9CA 1JVNA 2HNHA 1U2YA 1XYZA 1FWWA 3G0UA 5A2AA 1Q6LA 2Y5SA 3DFTA 3M7SA 1ZJHA 2J66A 3M4HA 4GJJA 3O07A 4Q32A 2XIMA 1MDLA 4CU8A 3VGHA 4L5ZA 5G1MA 1IYXA 3BLPX 3MU7A 5BOFA 4D6DA 4XIAA 3H23A 3B3DA 3T40A 2TAAA 2NWRA 2VNCA 3LMYA 3ZS4A 4RV3A 5AYYA 3KHDA 3U4FA 2V69A 3ARXA 2OO6A 2UY4A 1R3QA 1SFSA 4TTUA 1VZWA 3WEZA 4CN1A 3U2CA 5LIKX 3GXFA 4O1FA 3ANYA 1JGIA 3VKBA 4DJFA 3PVFA 4NT0A 4CQ9A 2BXZA 4L61A 4C6MA 1T6MA 2G5WA 1E4LA 1K7EA 3NQAA 3L0KA 3B9DA 5AECA 1SZNA 4KPLA 1AUSL 1NQ6A 3O6CA 3CHVA 1YW1A 3BSMA 1F73A 4GY7A 1FWBC 2KZHA 4JKLA 2YZRA 2WKJA 2YA1A 2GUYA 4FLQA 2ESCA 4JNMA 2XU2A 5I77A 3HN3A 1L6FA 5EMKA 1F6KA 2FGBA 5I79A 2IQDA 1BWVA 4JKKA 1ITXA 3MW7A 4ZGYA 3KP0A 2V6AA 3PTDA 3H2FA 1UPPA 2ZC1A 2FGZA 3W6LA 4HNNA 4MPKA 5DQPA 6TAAA 2ZRUA 1R3SA 3LTPA 3GTFA 1XS2A 2Y8KA 2QCFA 4H8VA 1D7KA 2ZX5A 2Y0FA 3BW2A 4NF7A 3BLFA 2QQ6A 2I17A 5CGMA 4RNJA 4ONVA 5T26A 3GZAA 4NVTA 3IVTA 1H7RA 1OADA 4UNIA 3A3WA 3BK0A 1E4NA 4JEJA 4MB3A 2DT0A 1Q6CA 3NL3A 2R24A 4ECLA 3JU2A 3W9ZA 4CNOA 2RDXA 1VHCA 3IJIA 4AIOA 4QGCA 2OSXA 5C0QA 3WL0A 4TU1A 2GVYA 4GHRA 2V5KA 1QK0A 2B0MA 3F4WA 4HZ8A 3I3DA 1OIMA 3DKLA 2CZDA 4NAEB 2ZKMX 4MSSA 3R89A 4LYPA 3GBEA 2GGEA 3SUUA 3ALGA 1X6UA 3H26A 1SR9A 5U7SA 1T5AA 2XM2A 1SZGA 4AAJA 3PBVA 4X3ZA 3COTA 2WJEA 3T0AA 5FJTA 3VIJA 4CD4A 1H0GA 3S47A 3W3OA 4GKLA 1KV5A 1XIHA 2XFYA 4JTKA 1EFZA 4NZ1A 3WF4A 3O16A 2G95A 3U4AA 1H3GA 2QDGA 1JZ2A 4ZO9A 4YN5A 5C54A 4DZHA 1KRCC 1TV3A 1CXKA 3TROA 4AY1A 3S6DA 3SSZA 1TUFA 3FA5A 1UH2A 2WYSA 7ODCA 1R7OA 2OEJA 5HMEA 1KR0A 4O13A 2AAMA 3S83A 3TJIA 3EOOA 3TQPA 4FLOA 4W87A 2UZ9A 1ZBVA 4Q8WA 3NXLA 3E0IA 2GFTA 1UUMA 4TR9A 1FHVA 3CAKA 1JDAA 1DJHA 3WLPA 4DUXA 2OO0A 4E5TA 4UTMA 4Z1CA 1TRDA 1UC5A 1C3FA 5I2UA 1C9WA 3VDHA 2DUXA 1VCFA 3CZKA 2GSEA 1WXJA 1FFRA 2ZE3A 2WVVA 5CSYA 4ALDA 1KQZA 3SN1A 2WMJA 3F5LA 4IP5A 4WY0B 1F76A 4W88A 4LVAA 3TJ4A 1OHLA 1H2JA 4JOMA 1UROA 1EP3A 1VBRA 1EP1A 2QJIA 1OWQA 2ZBTA 5M2FX 5K4ZA 3WBYA 3RHGA 4XAYA 4WLCA 1NWRA 5D9MA 7XIMA 4JIHA 1X39A 1XF0A 2FHFA 3LQGA 2FZNA 4A2SA 2C18A 2TYSA 4I9TA 1MQRA 4MUZA 4G1NA 2DZTA 3R10A 4MNKA 1EB3A 3L0GA 1W1B1 1E3XA 4FR1A 2PRMA 4V33A 1CBGA 1YTEA 1C8XA 2WZTA 2YYUA 2YXXA 3IUIA 4L6OA 5FSDC 4R3UA 4ORMA 5AOUA 1S2WA 2Y7EA 3C0JA 4MFDA 4ZTYA 2X0HA 3RO6A 5F2GA 3H7UA 1M41A 3RFAA 5A2BA 1WDQA 2XSXA 1XSJA 5C9ZA 4NY2A 1QTWA 1XWYA 4MMWA 1YTDA 3R7MA 3VX0A 1BEUA 2Q71A 4P5UA 4AVOA 2AOSA 2DIEA 2D69A 1VBHA 3BAXA 2CZFA 3II1A 5DEZA 3W7IA 4MY1A 4WOQA 1H7WA 4HMEA 4BWLC 1W32A 4H6RA 3W25A 3G6LA 5M3WA 2FDSA 4DUOA 5JIPA 3IGHX 5JQ9A 3VFLA 1B31A 4NX5A 4MB4A 3MQTA 1EF2A 2XZ7A 1UA3A 3WLTA 4CKQA 5D38A 4QHRA 2DJXA 5J04A 3KZSA 4KETA 4AMCA 5C9WA 3R5EA 3CS2A 3BGJA 4P7RA 4WSHA 4PUEA 3A24A 5EMLA 3KOWA 4L6DA 4M7SA 1XBYA 2EJ1A 1Y5XA 2NQHA 1E9YB 3TYBA 1RR2A 1W1YA 2VTFA 3GG0A 4JPGA 3KE0A 2X0SA 1GORA 5L6UA 3NQCA 3RJYA 4LS2A 3PZVA 1RBAA 4ZOCA 3QR0A 2YX0A 4S3DA 2WVTA 1J0KA 2QJGA 1AQ0A 4CCDA 2ACRA 3QOKA 3QMSA 3EPOA 5LSMA 3EB2A 4F4RA 1QDSA 3QBUA 4QG8A 2W5FA 3VILA 3D3AA 3FDGA 3TMQA 2PD9A 4LRSA 1RCXB 4XG1A 4CQDA 2CFFA 2VMFA 5AHIA 3MUIA 4IL0A 3AJXA 4XKYB 4I8DA 3V16A 3WLOA 5DBUA 4KRZA 2VP8A 1JUEA 3A22A 2CBVA 4M7TA 1EJTC 5EYWA 1S5NA 5KZEA 3L65A 1LUCB 3E38A 5CZJA 2VCAA 4QDMA 2ZYFA 2ISDA 3TTYA 4E4PA 1W5OA 4S3KA 3UZXA 4Y8FA 3KHJA 3IANA 3CWHA 5B7YA 3UF9A 4JKMA 3PBUA 4C1NA 5BMXA 3FAXA 3ITVA 2E8YA 3VCCA 1QHOA 4GY0A 3B8TA 5FEWA 4GNJA 4F3HA 2BS9A 4QP0A 4UQBA 1PEZA 4U31A 1A0DA 4IG2A 3T44A 2DZXA 3DESA 3N25A 3PBMA 4A3QA 4GI6A 1DXEA 4DRSA 1IHIA 2CLLA 4AVFA 4JTHA 1WDDA 1JAKA 4JFUA 2Z7GA 4JTUA 4UTKA 4WHBA 1E6PA 4AZBA 1CLVA 3RLHA 3GM8A 3NVTA 1UBPC 4WXZA 5AYBA 1WQ5A 1J6OA 4Y6GA 4HHLA 3QGAC 1EXPA 1RY8A 3CT2A 5AFDA 4O53A 2E6AA 4XSMA 4BEUA 1SZEA 5CG7A 3OGVA 4IPIA 3FXYA 5GNZA 5A8OA 1YDOA 3E3HA 2TODA 5FF4A 1R7AA 3DYMA 1XIMA 4ML4A 4LUIA 4YWIA 1YBQA 4KWVA 1QNOA 1DBTA 3M44A 2WPBA 3O7UA 4V1XA 1B57A 3W7MA 4LF2A 5F4WA 6A3HA 3VOIA 1NDYA 2OG9A 4JTJA 3H2AA 3V3WA 1J12A 4JHOA 1XSIA 1LRNA 1ZJIA 3CL7A 3GAKA 3EMZA 4FXRA 3QM3A 2BXVA 1W5MA 3PTKA 2ZUUA 4CGTA 1IE7C 1BPLB 1OGGA 3OZOA 3WEMA 3BANA 5I00A 1HX0A 1RA5A 3T2OA 3W74A 1N8FA 2HJPA 4DY1A 4WVXA 1PX3A 2XVGA 3TUUA 3EEGA 1V6XA 2QPUA 5KMYA 4FSAA 1XIFA 4EANA 5CC6A 3SI9A 4DJDA 5HJYA 1UP0A 3IJDA 4AHOA 4POCA 2C0AA 1E9LA 3GNNA 1GHSA 1JF5A 1E6QM 4A05A 2QT3A 2YDRA 2PGEA 1K6WA 4DBSA 1EUAA 4E0CA 3HF3A 1BG9A 3VIGA 4RW5A 2QF7A 1ZBKA 2IS7A 1DE6A 3R0UA 3N12A 1UD6A 4M6VA 2VDIA 4B2DD 4H41A 3PPCA 2NLYA 3N2BA 4OQVA 3LERA 1B3WA 5BXTA 1XIDA 3O0KA 2XUCA 2JEQA 4IFKA 5T9CE 5LNRA 4LAZA 2XFRA 3PWIA 4HSHA 4R85A 3WIJA 4YTSA 3QW3A 2MANA 2HBXA 5AHNA 4HT3A 1AMYA 5A6BD 1GVSA 1W3JA 3VUSA 1K6AA 4JN6A 4ERGA 4AC7C 1V4YA 4NILA 1YMYA 2Z2AA 4O11A 1QI3A 2WNNA 4LS0A 1EA0A 1HKIA 4HPHA 2BG5A 2VENA 3BJFA 3ZO9A 4IX0A 4Y9OA 2XN1A 4IQDA 4B2DA 5C9XA 1Z41A 4D71A 2EBNA 4PTVA 5CAKA 3NUKA 1LQAA 5CC7A 3SURA 1KQYA 2P1FA 3OLDA 2IQ0A 3WNLA 4MTVA 2ZUNA 1G1YA 1W9VA 3TC7A 1T41A 3H54A 4LX4A 2OT0A 2J24A 5K3VA 3DHPA 3ONBA 2BY1A 5EBUA 1BQCA 3BPWA 2C14A 1RVGA 3STEA 1OEPA 2OKOA 1AZ1A 2VGBA 4MNLA 3L4TA 4XZ9A 4QM1A 4G2DA 4W9TA 3WDRA 5F4XA 1NWSA 4L1XA 1S2AA 1TIMA 4NHVA 1VKFA 1AJ0A 1CXLA 1ZCOA 1C8QA 5KSWA 4LC8A 3ZR6A 3UFYA 2ZZ3A 4ACZA 5I3GA 1ISYA 4DO4A 2YOCA 1B1YA 4HSNA 3SRFA 2OODA 1MNSA 4JS3A 2TRSA 3QY7A 4RNHA 1ISZA 2IW0A 1RQBA 3LDVA 4D2JA 3PG9A 4P61A 2VRQA 3HZ3A 3UPMA 1XIBA 3LZ3A 4G56A 1ZP4A 3VCRA 4GZIA 1OFRA 2ZWZA 2ALDA 1J2BA 1IF2A 3DECA 4PBGA 4Z2IA 4GOAA 2V2CA 3QC0A 3WJYA 5DMYA 1U83A 3SY8A 4Z2GA 1H62A 2CZEA 4R88A 2D22A 1X7FA 1WBHA 3PANA 3VNIA 4PFMA 4BEQA 4U3AA 4Y8EA 1O12A 3I65A 2Y62A 3KL3A 4MOZA 4PB5A 3A3XA 3M41A 2QUUA 3MB9A 1LOQA 2ZRWA 2XVKA 1S2VA 2VFIA 1B54A 5BRBA 2ZUTA 2Z1WA 5FEPA 1Q5MA 4IGNA 2FJKA 3UYCA 1SZRA 2AL2B 1J0IA 2WSYA 3CJPA 4GQQA 4O52A 4DBWA 1PB0A 1RPXA 4L9YA 4HK7A 4ROPA 3KDOA 4JYFA 2O56A 2X40A 4G9PA 4IUGA 4TO8A 4YU1A 5HR6A 2PDCA 3DX5A 3KWXA 4FEZA 3RR1A 2XSBA 3LCHA 2OYLA 1TWZA 4H9YA 3UP8A 4M5PA 4IIBA 5CZTA 2WC3A 3AS2A 5E6YA 5JBFA 1NAL1 1W3IA 3SSJA 4QAWA 3GYEA 3UW6A 3DFHA 4UR8A 3BH4A 3BMVA 1EGZA 4EE9A 5AY7A 1HJVA 1KKRA 4OOUA 4CEUC 2RJHA 3CMFA 1TCDA 3QLDA 4DXVA 3C8NA 4DJEA 3LUTA 1KFKA 1F3WA 3TTOA 1UJQA 4DF2A 1A4MA 3ITYA 3SBFA 1QNSA 3VKJA 1OFEA 3MJMA 4J3VA 4LAKA 4DM2A 1TTJA 2VGGA 1DEDA 3SUSA 3NSXA 4YMZA 3C3UA 3EOLA 1TR1A 3EKZA 2OYKA 4AB4A 1TPB1 3IK2A 5KTLA 3OG3A 4GYPA 3ELFA 2UBPC 3W1QA 2I7GA 4ZCWA 1QVBA 4AZIA 4GRSA 4J2PA 3BSHA 3OO2A 1YPIA 4C5ZA 4Y9NA 5EU9A 2YDAA 4RDZA 3M64A 3L2MA 4XUYA 1V08A 2PDHA 3B0UX 3LRMA 4FP1A 3JVAA 4TX8A 4JZ5A 1YRRA 1IXOA 2DW6A 2V3DA 2QF8A 3MMUA 4NYUA 1ELSA 3VD4A 3PUOA 4LV4A 2PSNA 3V5CA 5AZ1A 5AHEA 3UR2A 1C91A 1J18A 3ABZA 3QFWA 5I6SA 1MW0A 1NQKA 1LLOA 1US2A 4CCZA 2EO7A 3EOEA 1FWCC 3NQDA 1OX4B 3VGFA 3EKGA 4RR4A 3PF3A 3MHUA 3SUTA 1EDTA 3LHTA 4WY0F 2WBGA 5I7GA 1R47A 3T1GA 2E09A 4R9XA 3BAKA 4C6OA 2GSHA 4AZCB 4PTWA 3ID7A 1XBZA 1UH4A 1W1VA 3PAJA 1AODA 3P81A 1CXIA 2J75A 5FF2A 3T81A 1Q4NX 2Y85A 4OUIA 4PUNA 4ZOEA 4XISA 4J28A 4QQUA 3KUMA 3W76A 4DO5A 3BC9A 1I2QA 3GDMA 4B90A 2Y4SA 1EX1A 3QV8A 4IGSA 1J8VA 3LHUA 4KCWA 1ZAHA 4A21A 3S42A 1V3LA 4CD8A 2HMCA 3LN3A 3CQJA 4LC6A 3A4XA 4LVGA 3ABXA 2Q6ZA 1QW9A 3Q37A 3DZ1A 4GACA 1JRBA 3QY8A 9XIAA 1IQ8A 2POZA 3G3MA 3DI1A 1R2RA 1Q7MA 1V0KA 4B5NA 5D2XA 1O1ZA 1VFUA 3RG6A 4BQ4A 5CGTA 3S2LA 1V3HA 3FCPA 2Y88A 4LBSA 4CCEA 4E8CA 1YE6A 3ITLA 3V35A 5ABTA 4UR7A 3IIZA 1VIWA 3T8LA 3W1AA 1PXGA 1V3MA 5C55A 1JYVA 3HMJG 2Z29A 5F1VA 1QPNA 3CV1A 3QV6A 3URQA 3R2GA 1OD0A 1EGMA 3OBAA 3LMZA 3MUCA 3W27A 2VJXA 4MYXA 3B8IA 2XIJA 4B9ZA 2E6YA 2QJHA 3P60A 1UIOA 4HNOA 1GEQA 4GCXA 1X1OA 4IMAA 4HA0A 1D3CA 1LROA 2YCIX 2OPJA 1K8YA 2P50A 3WQ4A 5BOEA 1QI5A 4W86A 4J3SA 2QV5A 2OGYA 2GPTA 5BRQA 3PR2A 2WZHA 1O94A 3HA1A 5G2WA 4TVUA 3A12A 3TYDA 3FEQA 2E1DA 4R34A 3B8SA 3B03A 4D8LA 3H70A 4BF5A 1VEOA 4GFSA 2X7VA 3UZJA 4LUJA 5DMMA 1BLIA 2P53A 3ZT5A 4QJ4B 4B4HA 3R0DA 2X41A 2YL5A 4HK6A 3VD3A 2P10A 1TV2A 5K9CA 1VGAA 1GTEA 5AYZA 2Z24A 2C79A 2D20A 3DENA 3VIFA 2D0FA 2PDXA 1PUDA 2Z2UA 4IX2A 3WJXA 1FWEC 5LNUA 4U5IA 3GSMA 2OTDA 3NZRA 1EJRC 4XZMX 3NO1A 1X6LA 4AHQA 1MVYA 3LHVA 1C92A 1HQTA 1CECA 4LH8A 3IARA 2VQUA 1EBGA 2YB4A 2NZLA 3VGDA 1ONWA 3QOMA 3NQMA 2GQ9A 1WA3A 3UJFA 3VVGA 1OJXA 1UUOA 3F4CA 2WBKA 1MSSA 3WENA 1CLXA 4C91A 5DF0A 3UY8A 1WKEA 2A21A 2DH2A 5FACA 2WMHA 3W1RA 2NXHA 1N2VA 3CV6A 5KZ6A 1L8NA 3AS1A 1XQLA 2V8ZA 2ZADA 2XH2A 4MYAA 1IZJA 2HK0A 2YCJA 1M53A 3BDKA 4Q8MA 1MRQA 3NM1A 2CLFA 2FVMA 3H7RA 2R9RA 3LCWA 5LA1A 4U28A 4WDXA 3G1AA 3H4XA 3M0VA 1DL3A 2BB0A 4MWAD 3SJNA 1B9BA 1SO4A 3TVAA 2PU1A 1JD7A 2HPMA 3PNUA 4R5EA 3O2LA 4A8RA 1YE4A 4A8IA 3DC0A 2WC4A 2RH9A 2DT1A 2YFOA 3UPWA 1Q6EA 3VMPA 4A3HA 1G4SA 3S5SA 1AK5A 5DLCA 2C1IA 3G24A 1XRTA 2EG6A 3GH7A 1XW8A 1VFOA 3RAOA 2GZXA 3RK8A 2PURA 3ARYA 4CQBA 2TMDA 1GPWA 3RGTA 3UR5A 3W72A 3URBA 3L5MA 4W8BA 4YYCA 2OCZA 1JYWA 2R94A 1UZHA 4GD0A 3TDFA 4QTGA 1MXSA 3AZSA 3WH7A 2F6XA 4MM1A 1F07A 2P0OA 3HGSA 1E4MM 2CNCA 4P8XA 1ZU8A 3CZGA 4E3VA 2PDPA 2PPGA 5AKQA 4LYRA 4GIAA 2HE8A 4CNUA 4OKDA 1XIGA 2JFEX 5HNRA 4OJYA 1P0KA 2IKGA 9RUBA 3LB0A 4R53A 3W75A 4ZE4A 2PDWA 3IJLA 3VDAA 1BRLA 1HP4A 4TX6A 3TA9A 4UOQA 4ZR8A 3NIYA 5IFTA 3URNA 3A9BA 4EIVA 3AS3A 2OOFA 3ARRA 1KTBA 2V30A 2EPHA 3M0HA 1JIBA 1S46A 1CYGA 1EJ7L 4B5XA 3QR1A 4K2SA 3VM5A 1WAUA 2R14A 4MB1A 3FAWA 2V3GA 3K4AA 5HATA 1W9PA 3HFTA 3A23A 4MLJA 3I6TA 1FDZA 3AYRA 5D2WA 4MWAE 2W27A 4UFHA 4BR1A 4NL1A 5DFAA 1DIDA 2D73A 4I7UA 1NOUA 1XISA 4PTDA 1G69A 3PJUA 3TLQA 3DFYA 4G7EA 1ZPTA 3HQOA 4PSPA 4F0SA 2WZMA 1AVAA 1V3JA 1GEHA 1A5BA 2YGYA 2D2JA 1Q4WA 1ODUA 4DYKA 1Z69A 3MSDA 4O8AA 3UZYA 2QVHA 3KVMA 4ZQCA 4BJHA 3RJXA 3MI2A 1NOWA 1KM5A 2YL9A 4E4UA 1U22A 1TTIA 2P8CA 3CMGA 1T99A 3AYTA 1ISWA 3ME3A 4B91A 1V02A 2CBUA 4K68A 3WJZA 3EX4A 1XCFA 1G4TA 4UUIA 2PRHA 1GOKA 3M7WA 4HBKA 4R33A 1TPC1 2CCRA 2QKFA 4EWJA 1YXDA 3TYUA 3WO8A 6ALDA 1E6RA 5GJMA 3WEOA 3OVPA 3QHMA 5A6TC 1SU5A 4DJEC 3S46A 2J8TA 4OHQA 4M29A 3WLSA 1VBGA 5ABFA 4C6DA 1HL2A 1NWTA 1G0CA 4XKYA 1RXOB 1OG0A 2PTZA 3SRDA 3UCCA 2BWGA 3AMCA 2V81A 1UKSA 5DMNA 1JXJA 3LGGA 3QKZA 1HL8A 4MUPA 2QPXA 5IBXA 1FH7A 3U5YA 4FXFA 1QHZA 3MP5A 2NLIA 2ACSA 3CIVA 4LPCA 1T8QA 3DBPA 5IHSA 1LT8A 3BAJA 4K37A 3SCQA 3ZWTA 1EPVA 4N02A 3PUEA 3ZWSA 3D5HA 1E0TA 3EA3A 2NVCA 4JHZA 2QCHA 2CLHA 2Y8UA 3BAYA 5H1WA 4H9UA 1XLHA 1WO2A 1ZLPA 1O95A 1VC4A 1A80A 1JJKA 3R11A 3BW4A 3AZTA 1OC5A 3LHZA 3MV11 2R1KA 1NOFA 3FNDA 1EA9C 2BVYA 5FJJA 1GW9A 1QWKA 3H2CA 3OBKA 1H1YA 4Q6XA 4YL2A 2BVTA 1UZ4A 4AD1A 5EGRA 2NVAA 2I16A 1OVDA 3VDGA 2E9MA 4DJFD 3FOKA 3FSTA 2PD5A 2PDGA 5FD0A 1L9WA 1A5KC 1REQA 1TE1A 2BHZA 1VQTA 3TWBA 5EY5A 3W01A 4RK8A 3TQ0A 3CUHA 1DIKA 3BZJA 3TFXA 2DZSA 4E2DA 4LGXA 2OX4A 4YTUA 2CERA 1UCWA 3WMLA 2YZ5A 1TQXA 3ZM8A 5CPNA 3PN8A 3P80A 5C70A 4JY8A 1R2SA 4DBDA 5G1YA 2CLMA 1JPDX 3BGGA 3LSCA 4JBRA 3AI0A 5IOBA 1X1ZA 2CLIA 3E0FA 1IZKA 1HTIA 1I2NA 5H8MA 4L1GA 1XPGA 3IAQA 1E51A 3L0NA 1A3HA 1MEHA 3LPOA 4F48A 1N55A 4MJ4A 3WF1A 3B0YA 4DJDD 5EMUA 4Q8PA 3WLKX 3I4EA 1WXYA 1JCMP 4FPSA 4JAWA 1M03A 1DWGM 1FDYA 1MI3A 3F5KA 2FKPA 4GGBA 2C6QA 4AIBA 1C8YA 3VOHA 1TX2A 5FA5A 3RLVA 5I07A 4FX8A 3FA3A 1FWSA 2GOKA 4JQ3A 1OC7A 4O17A 1FP9A 1OQFA 1K8XA 1XLDA 1NF0A 1JRCA 2P5NA 2WSKA 1NJJA 4JY9A 2DFAA 3GS6A 2YBVA 3BSGA 3NGFA 1MEIA 3PJXA 2YCLA 3S2CA 2Z2BA 5IXEA 3KBWA 3VD7A 2PDUA 1K1DA 5HQMA 3P0XA 1V8EA 4G1KA 3XINA 1RALA 1V0LA 1FHLA 1BSLA 5RUBA 4RCXA 4YS1A 3AMKA 3N2TA 3REQA 2A3EA 4S3EA 3I3EA 1B5TA 4HTYA 1CGUA 4CN6A 4K1WA 1EZ2A 2PDMA 2IXVA 1E5JA 4GXPA 3W7EA 5CBJA 2ONEA 2EPLX 4K38A 1M5WA 3P62A 4QDWA 3W2JA 4QR6A 3WQ5A 1O5XA 2JGYA 3GLCA 4M82A 4F40A 5ECVA 2DH3A 1VF8A 1KM2A 2A3HA 2VC6A 4MIMA 2Z1VA 2O0TA 4L80A 1F74A 4JL2A 1UOZA 1HN1A 1QOQA 4TV5A 3A4AA 3Q4DA 4MWAB 4NG3A 5LA2A 1X7IA 5J5DA 3SB0A 3L9CA 1P4CA 2ISVA 1O68A 2ZXBA 4D72A 2CWNA 4C6JA 1C93A 4L56A 4UTWA 2POTA 3VIMA 3OJGA 4P8WA 4I5XA 7REQB 3QZ6A 2WHMA 1H7PA 1DOSA 1GT8A 2GDQA 1KCKA 2FZDA 3DUGA 5HAOA 2C7FA 2IKHA 3SFKA 4C6PA 1GVQA 1GKPA 3HQPA 2Q02A 1MXGA 5A1AA 2BHYA 5CSRA 4I9AA 2PDFA 3RCMA 3KRBA 3C5QA 3UNDA 5A94A 1P0NA 5EKYA 1EJXC 2WCAA 2GDUA 3AC0A 1WCGA 4HZ7A 4CVWA 3SR7A 2E40A 1OC6A 4CQ8A 3GIPA 2CKSA 1S5WA 3UG8A 1QNQA 3CWNA 4UTWC 1RK6A 2GVLA 1E72M 1UHVA 4UOJA 3NA8A 5FF7A 3W88A 4I5UA 3S2JA 4XK2A 2ICSA 3GHUA 1J9YA 1BKHA 4GIEA 4E8DA 5D9OA 3DCPA 3N9KA 4KS0A 3GVQA 3HJEA 3ALFA 1JDCA 2YPIA 4MJMA 4WCJA 1Q8JA 4CU7A 1W37A 2J8GA 4RPPA 1HGWA 5CCZA 2FIQA 1FA2A 1VLIA 2DEPA 1R5YA 2GVJA 2Q8XA 2ZQ0A 2VOMA 3UA4A 2E28A 1Q6GA 2A7RA 1ESWA 4Z2KA 5D33A 3ZT6A 1UKTA 3RPMA 1XLKA 3SRHA 4MADA 4RW3A 4WIWA 2QDDA 3AHVA 3TW6A 4RKAA 4GLEA 2FVLA 5GQBA 2ZIDA 1L2UA 2HEJA 1DP0A 4GIYA 1MO0A 3LZ5A 1EYEA 3DOPA 3ARTA 1EQCA 1Q85A 3MJYA 2Y70A 3ARZA 3HIJA 3SUVA 4ZVJA 4O12A 4UFMA 3RNDA 4BI5A 1FDJA 1PE1A 3NVDA 1BXBA 2JEPA 4D1JA 2VCCA 5LHEA 2FQIA 4KFNA 2CLEA 3TW9A 4HHPA 4WK9A 3KM8A 2DGAA 5FAGA 1XKJA 1Q7QA 1TWWA 3SJ3A 4H8HA 5D9PA 4EPBC 1DE5A 3GDLA 3GR4A 3LI1A 1T8XA 3W7HA 3SECA 5AC4A 3U8GA 4JEQA 4CD5A 2WV8A 3TAOA 2AKZA 1LP6A 1GVEA 3IK4A 5G2HA 3C8FA 2EKCA 3ZT7A 1LL4A 4DXKA 1X8CA 4ENLA 4OT7A 3D0CA 1NP2A 3H12A 4ADSA 1GONA 2OLSA 2V5DA 3MP4A 4GABA 3NJ3A 1WE5A 2BGQA 3SW6A 2QUNA 1KFLA 2OELA 1M7PA 1F4AA 1SR0A 3F2CA 1WOAA 3BOLA 4DZ5A 4ZMGA 3DFSA 1AJZA 4IF2A 2FH8A 1V6VA 3AJ7A 4GZ7A 4L4LA 2PTWA 2VGFA 5AC5A 1TJ1A 1BHGA 4HZ6A 2TPSA 3I6EA 3B4YA 1KNWA 4O1AA 4X63A 3BE7A 1OYAA 4DYJA 5HPCA 5FI8A 2WQDA 1VBUA 2QCDA 3W1XA 1L6GA 5I24A 3EB4A 1V51A 4HMNA 2PUZA 4KT2A 1H63A 4DZAA 3THAA 4KIRA 4TOQA 1EWDA 2G41A 2Y5JA 4DX3A 4DWDA 8XIMA 3CUIA 3IRSA 3O1NA 1M7OA 4S3CA 3IIVA 2UY3A 4AD3A 4EXBA 1ZBWA 3Q65A 4HYWA 3ATZA 3E0VA 2XIIA 1FWNA 2EPOA 5IM51 1Q2RA 4UTTA 4GCAA 1W3TA 2B7NA 4YNGA 4NJJA 1GOQA 2AQOA 2VDHA 5DXXA 3HPXA 3P61A 2VKZG 5C71A 1QPOA 1TPUA 4GVGA 2PWGA 3VGGA 1ICPA 3WFZA 1ICQA 3VKKA 2HISA 1G4EA 3PSWA 4JQ2A 4PSRA 4H19A 5GVJA 1CGTA 3WH8A 2FTPA 3TYEA 3UNTA 2VD8A 3THQA 1U1HA 2A3BA 2FZ8A 1J6PA 1W17A 3F2DA 4L4PA 4MWAA 3K30A 2FB2A 3BWWA 2QCDB 1UR0A 5GJNA 3KP1A 3O8AA 4Z0SA 3AHYA 3CLWA 4WUIA 3C86A 4NIRA 2GL5A 4RX0A 3MV01 4J4KA 3EXTA 3VYLA 1X8FA 3G1XA 5K9XA 4KEVA 1GQKA 3W7JA 3QHOA 1TVPA 2WPGA 5ABEA 5TQLA 1S5VA 1XLCA 4GUIA 2VVNA 2ZDRA 3GXMA 3NYZA 3ISIX 4H8NA 4YLWA 5DELA 3V18A 5AZ0A 3TR9A 5XIAA 3KDNA 3N1AA 3QFEA 5DANA 1GK8A 1CGWA 1WX0A 3TONA 1NDVA 2XH0A 1GQLA 4JTIA 3HG5A 4DEFA 1WKYA 4G7EB 3WQWA 3LS9A 4GBUA 2AMXA 5I3KA 3UEQA 4AVNA 3R94A 3RXZA 4J3UA 4H6KA 3WBAA 2VZVA 3QQ0A 3B0PA 2A85A 1XLEA 3EX3A 1FCUA 1OK6A 4CNPA 2BSLA 2HQAA 3ITOA 1KM6A 4Z1AA 1GKQA 5B7ZA 3N73A 4MB5A 4UQ9A 1R46A 4OIFA 1R9ZA 3NPVA 3WUGA 2CZ5A 2C19A 3RLUA 1ME9A 1O1HA 4AZHA 5LYRA 1SSDA 1A5LC 4GNVA 4XO7A 1A3WA 3K1GA 7ENLA 3TEVA 2E6FA 3HFYA 3B8VA 3AIUA 3SUWA 1XCXA 5IDIA 5I06A 2J88A 4H9XA 2X30A 3EWBX 4ADTA 1UB3A 1TA3B 3O05A 2CIPA 4PN2A 4GG9A 5D03A 3K1DA 2Q09A 1EJUC 3OVGA 4Y9PA 3DC8A 3GTNA 3M0KA 3PM6A 4O1CA 3TR2A 4Q7NA 3QPZA 3ZVHA 3MP3A 2J7GA 3QY6A 1BGAA 1TO3A 2J7BA 1TPWA 4Y90A 2ALRA 4HYRA 1Q6FA 1MQQA 3GNPA 1XXXA 1KBIA 3OLGA 1Z6KA 2ZVIA 2BV9A 4IUOA 4LVBA 1JQXA 3DHDA 1GZJA 3PWGA 4YIWA 1TVLA 3LXBA 4ZXLA 3DU0A 2ZZ6A 4D6IA 1O66A 1OF8A 1LTDA 3EDEA 3UXAA 4MLRA 2ATSA 3W7RA 4KEUA 2YL6A 1L0PA 1KC7A 4RZ4A 3HV9A 1K3UA 3B8DA 4A22A 5D2YA 4O8RA 3V36A 1DHPA 1OSEA 3UR7A 2A5HA 3MI6A 4L65A 3WK2A 1XDMA 1HJUA 4C6CA 3A6OA 2HZGA 1J01A 1GCYA 3HPFA 4GC4A 1H61A 4A4AA 4ZZ9A 3GQYA 2ZRXA 3S5YA 1WOBA 4R7JA 1Z7AA 3WK1A 1QOXA 3GHTA 3H4WA 1OCQA 3QPEA 1D3GA 1TV5A 2PLMA 4I7VA 4FHAA 3UVIA 4GISA 5D2TA 3BG9A 3M43A 1MUCA 3USBA 3EAUA 4NNAA 4XBSA 1MRAA 2OZ3A 2PWVA 4DWSA 1LG1A 1PVNA 3NR0A 1XX1A 3IV8A 1OFQA 2WCGA 2G3FA 4J35A 5FF0A 2F6UA 2DT2A 3B9EA 1LF1A 2CLKA 1VHNA 2OLAA 1UR1A 3P93A 2RUSA 3WG6A 4XKMA 1RBOB 4YHGA 3E12A 3QRHA 3OBEA 4LF1A 1PTAA 3O06A 2OEMA 2D0HA 5LGXA 2HXTA 8RUCA 1TV8A 3EPMA 4AY7A 1ZP3A 2LLEA 1DJWA 4UXDA 3M16A 1IEXA 1LBLA 4L6HA 4KCVA 2NQJA 5HJLA 3R1ZA 3U57A 2VXNA 1J93A 3S0CA 1J79A 2P3EA 2WW5A 2H90A 1YBQB 3WQVA 2HROA 3RM8A 1VEMA 1P6WA 3HPSA 2G97A 2YLAA 4IH3A 4H04A 1WKDA 3P7YA 4IJBA 4C7DA 3IIXA 4QJ5B 1TR9A 5G1TA 2NSXA 1A5MC 3GG1A 1P0EA 3KS5A 2A79A 3UERA 1RD6A 4HN4A 2HV5A 1TPVA 1I2RA 1B3YA 3LXAA 5DY3A 1HKKA 3QXBA 3WX7A 3MY9A 3EPNA 2ISSA 2XISA 2VRJA 1TG7A 5KINA 2W6RA 3CQIA 1TWSA 2IPWA 4L4MA 3MBFA 2VZTA 3HGJA 4AWTA 1LWJA 3DH7A 5TAOA 4IJRA 2CU0A 3XIMA 2FHCA 1DXIA 1TIWA 3L4VA 4BQ3A 1SW0A 4H9ZA 3KCLA 2X0YA 1JEZA 5TIMA 2CYGA 4PUJA 4AD4A 1NSJA 4F0LA 4XV0A 1UYQA 3VK5A 3TOYA 3CASA 3NDYA 3N4AA 3DXIA 3R8RA 1CGXA 3W2UA 4NZ5A 4Q4KA 2OR2A 1JNEA 3CC1A 3GDTA 3T7VA 1VYPX 1I45A 1M68A 3W38A 1RY0A 1FWHC 1NTHA 1W9XA 4O0ZA 1ITQA 3WUEA 2J77A 3S9ZA 2ZFAA 3ECQA 4PEEA 4GQBA 3KOYA 3NURA 1ZHAA 4D8ZA 1J0YA 2Y7FA 3WLRA 4KEMA 5DO8A 2GGJA 4OWGA 4S3JA 3VKAA 2VYOA 3VTRA 4RV8A 2YLLA 3C61A 1HO1A 3T6CA 1PIIA 4DO6A 4XD5A 3M0IA 4PBEA 4ADUA 3SY1A 4WEVX 3BOXA 1RH9A 3PY2A 2WNWA 4TQTA 4HJFA 1Z8AA 2QULA 4N4PA 4W8AA 5DBTA 1SPQA 1P0DA 2BTMA 1PX4A 4HZMA 4F2BA 2WNZA 1CB7B 3PZOA 3KLKA 1PS9A 3UWQA 2G8ZA 1KW1A 3N2OA 4G8TA 4S23A 1SJBA 3E0LA 4X0VA 3WQGA 2QNEA 1EC7A 4O0KA 2XINA 2Z25A 4M6UA 1GWJA 3EDFA 1F3EA 4HNVA 3JW7A 4OBSA 3CAWA 1K7FA 1EOKA 1EEXA 2BZNA 4HOZA 5I0DA 2V5LA 1BVNP 3L2LA 3WD3A 5D02A 1EIXA 3EB3A 3LEPA 1ZZMA 1DWIM 4GJIA 4ZO8A 2QEZA 5IHRA 4B4FA 3S1VA 1JCYA 4XWUA 3W0KA 4ERAA 1FP8A 1FWFC 3GU2A 3FKRA 4F79A 2QIWA 1IZCA 1LL6A 5I23A 1KFCA 4LANA 3CB8A 4JFSA 5EFFA 4GVHA 4DHGA 4H9MA 2HTMA 4O1DA 3TSBA 4Q22A 3O0FA 2VZUA 1IEVA 2Y24A 1XINA 4OBRA 1G6CA 4HCLA 4ICCX 3E1F1 4ZL1A 2NV9A 1MDRA 1A3XA 3BJSA 3SIZA 4GO9A 2AQWA 1PIFA 1J10A 2FZBA 2QXWA 3ZYZA 1C29A 4AZ7A 2E6DA 2QHAA 3G6MA 1PYFA 3JUGA 3LTSA 1ME7A 4U4MA 1QJWA 3K46A 1OABA 3ZXWA 3QV7A 1QHPA 4EX4A 1KWKA 1O7AA 2D2HA 4NZCA 2CHNA 1KXVA 1VR6A 3AHZA 4AEEA 1G67A 3NZPA 1PV8A 4ROQA 4GC3A 4EF8A 3KRZA 1IR1A 3OA5A 1E0UA 7TAAA 1AH4A 1EKOA 1MFUA 3L4ZA 4FNRA 1LWHA 3MCNA 2H9AB 3P74A 3QF0A 1QPQA 2QAFA 2FMNA 3S2NA 4PMDA 2HBVA 2NQ9A 3BAIA 1W9UA 1VENA 3D47A 6XIAA 9CGTA 3EKLA 1JPKA 5LIXX 2PLCA 1DWHM 3NQBA 3W81A 1PZ1A 2ODOA 1S2CA 1BKSA 4DJED 5A8QA 4RZBA 2HPIA 4LY4A 4P7LA 3CZLA 3F7JA 6TIMA 1V5XA 1RJRA 2BMBA 1UBSA 1A49A 2E68A 4FIQA 3GNOA 4HNUA 4Q4QA 1Z89A 4N7QA 4H6EA 4W84A 2AL2A 3AUJA 3WLHA 1N82A 1DJZA 1OINA 3A47A 3KWSA 1KTNA 1L6WA 2DP3A 4UNKA 3TXVA 2Y63A 3CMJA 3MZNA 5HOSA 3CAVA 4DZIA 1E4IA 2CXGA 1A0CA 4FNPA 1R0MA 5HDRA 2NUYA 3VMNA 1XGEA 4LUSB 3DG7A 3AMLA 1IXNA 3N9SA 5F2IA 4B16A 6REQA 2HCVA 4MKVA 2W3ZA 2YA0A 1HIZA 4QG9A 3RMEA 4YTTA 1IT8A 5CSSA 4CD6A 3UXIA 1G94A 5DRCA 3HPZA 3B05A 2OQHA 5LZLA 1YLVA 2WHJA 4P7OA 3K4WA 3SQSA 3W6YA 3LU2A 3BLDA 3B8UA 1XYBA 2ASHA 1POJA 2OVLA 2QLYA 4JCMA 2PP3A 1P5BA 3RX2A 5EMJA 3GKAA 1UWUA 3E0WA 2IKIA 2I5QA 2V3FA 2VELA 1GJPA 3VAVA 3T4WA 2GGHA 1H0IA 3ZJ8A 5AN7A 4PMYA 2ZDSA 4KWUA 2WAGA 6REQB 1G7VA 1IV8A 1L6YA 1PTDA 4BWLA 4YVVA 4C1NB 1M3UA 5XINA 5CKSA 3T08A 1H41A 1WV2A 3H7VA 1QNPA 1S3HA 3W1UA 9XIMA 3TJLA 3BW3A 4ZSUA 2QS8A 4X9YA 5FJRA 2A6LA 4J7RA 3S1XA 3JZEA 4H3DA 2Y61A 3GFYA 4B5UA 1H1ZA 2VGIA 7REQA 3KTCA 5LKYA 4FR6A 2ZTJA 3W1NA 2I5IA 2VT0A 2O4QA 1OFDA 3D46A 3I7RA 5G4WA 2YB1A 1UKQA 4JYDA 4OECA 3M0YA 3BXWA 1XRFA 1R3YA 3WQDA 1Q6OA 2MUCA 5E9XA 5HR7A 1W6TA 3WDHA 2ADAA 2W79A 3WK0A 3B0VC 3RCNA 2WQPA 4L9ZA 3ZMRA 1BTMA 5HK4A 3AOFA 1DQXA 3BJTA 4JFWA 2XIOA 5U4NA 5D05A 3E2RA 3LBOA 1JZ8A 1YDNA 2P3ZA 1HVXA 3R43A 4FXJA 5JBDA 3NDZA 3KOXA 4KKXA 3BL3A 4ACZB 1Q7ZA 1E70M 2VFHA 1J11A 1QR7A 1OFAA 3R25A 5F2LA 4QSFA 1NFPA 1SZFA 3APGA 3OLEA 1E3ZA 5CPOA 2O9PA 3ARWA 1FX6A 3EBVA 1QRQA 1DTUA 4M6PA 3A64A 4PUKA 5DY2A 1ZALA 2Z27A 4RJEA 2OXNA 2HXUA 1HKVA 5T8GA 1F6PA 2H8ZA 2W63A 4OVXA 2NSOA 1XG4A 4BA0A 1EZWA 3QYSA 4UFJA 3CHFA 3GVVA 2E5DA 4ZQOA 2HNEA 5AYIA 2F61A 3N4EA 3SCNA 2QDHA 4DELA 4JTFA 4WJ8A 5H8PA 4LBRA 3EWZA 5DMLA 3H8AA 3LXCA 1EWEA 4M56A 3CH0A 3VNYA 4UIOA 1GQJA 1FH8A 3W7KA 1CI1A 4GH1A 3IACA 1ZFJA 1PWMA 1UWQA 2WMIA 2XZ9A 2XH7A 1JR1A 2VL4A 1EYWA 1VFSA 3KZPA 4YVPA 1W9BM 2XVLA 3MSYA 1RJQA 1BSIA 1FWAC 1R30A 2EKGA 4N9EA 3VOGA 1MUWA 2Z1KA 3BURA 1OZMA 1SSGA 3G1FA 2D2GA 1CGVA 4JTQA 3QMTA 3SN0A 3HB9A 4ML9A 1UD3A 3PZ9A 2ZUWA 3LQLA 4JHMA 4JR5A 4GUFA 4C6KA 5E0FA 1Q63A 5C2GA 4CLMA 4IJCA 2FDMA 1R87A 3OA3A 5G5IA 3D6NA 2J9XA 4O4WA 4UZSA 3BLEA 3QMRA 3WSUA 1IWBA 4KWWA 2O7SA 3SIMA 2ZRVA 4Q8QA 2PLKA 4JTGA 2FB3A 2UY5A 2GGGA 3TQKA 2C1GA 3M46A 1SFJA 2Q8ZA 2W67A 1UWTA 2QJNA 1PSCA 4XO6A 3OZPA 5CGQA 5G4EA 2CLPA 2G4JA 4US5D 4N9BA 2PI6A 3RITA 4MJ2A 3IVSA 1AW2A 1CZ1A 2XWDA 3GYCA 2GSJA 3VINA 1LCOA 1SGJA 6XIMA 4NI8A 3HU7A 1KBKA 3V0SA 2GUUA 2YBTA 1HT6A 4W7VA 4LOCA 3B9OA 2XGBA 5XIMA 2RDWA 2ZZ1A 3LCLA 3ITGA 3K13A 1NARA 1RLCL 2XGZA 4AYSA 1LUCA 3T09A 1TMQA 2FYMA 2FTWA 1W3HA 3GHRA 4QISA 5CG0A 3NAVA 2PODA 5E5CA 2XFFA 1FTXA 3B9NA 1UZ1A 1GOWA 5CZ0A 4O1BA 1J96A 1A4LA 4U3CA 2Y89A 1MQPA 2H3BA 3ABSA 3STGA 3OVRA 4CNNA 4PUDA 3AYVA 3QC3A 5EBAA 3TQVA 4P2VA 3GKFA 4K1GA 5KZDA 2F8QA 4OBTA 5HNTA 2PMQA 4RE3A 4CUCA 3STCA 3VKDA 4OV9A 3LPGA 4PCSA 3R13A 4HVXA 3W7DA 3RUBL 3SCSA 1KRBC 2V68A 4D6CA 3DFNA 1E6SM 2B4GA 3WQCA 4ILSA 1A5AA 1VFHA 1H4PA 4LVDA 4ZOAA 3CU2A 4JIEA 3N29A 1DXFA 3CT7A 3A4WA 2CC0A 1V93A 1UUQA 1G4PA 1ZL1A 3DHUA 1WDWA 4CNSA 2X1SA 3LLFA 4QE1A 4UWMA 1XL9A 3VC6A 3HURA 2RJGA 3PPGA 1K9FA 1TUXA 3NNTA 3GH4A 4LYKA 1W8SA 3BUVA 1XKYA 2FZMA 3WL1A 4PB4A 3MVIA 2G3JA 1EJSC 1Q6QA 4JTEA 2BVDA 4NXKA 2CETA 1NH6A 3RMJA 1NWUA 4S2BA 4DBUA 3BAWA 2ISWA 3K8LA 4PMQA 1WP6A 5C7HA 3HQ1A 3LPPA 1PX8A 1XIEA 4HU0A 3HPAA 4DO7A 3UWWA 4TMBA 2O7QA 4LUTA 2BOGX 4LALA 7PTDA 1EX5A 1HP5A 2B7QA 1U1UA 2ZCGA 4DLMA 1G5AA 1N8WA 3M0XA 2PWFA 3RM4A 4WDTA 1TWDA 4KESA 4WOZA 3UZZA 1GVIA 1KGWA 4BI7A 3DG6A 4N9CA 4O54A 3AICA 2RDTA 2BHUA 2QMJA 1U1JA 1FCVA 3GVWA 3AU6A 3CHEA 3JRKA 4EWND 2YCKX 3FA4A 3A3HA 2P76A 3W85A 4BF9A 3GD6A 2X05A 4D6GA 1AH3A 4MKSA 3RILA 3ZOAA 3NQEA 1BVZA 2PWHA 3T2QA 4UCGA 5AC6A 4O18A 1QI0A 1FWIC 1TKKA 3P2VA 3LM7A 3K2GA 1OX4A 4UQCA 1EC8A 3RPTA 3LCXA 3W2MA 2IUZA 3CYJA 3MTWA 4PB3A 5E93A 1J2WA 1WDRA 2H3DA 1XIIA 3FW6A 3ZSSA 3CO8A 1Q2SA 2Z1BA 2R82A 4DBEA 4IHCA 4TVDA 3NPWA 5I78A 4F9DA 2AGTA 3WLQA 4BKNA 3IJQA 3U0HA 1Y5VA 3VDBA 2H8XA 2PFHA 3TNBA 4ICNA 2PZ0A 3L68A 1H5VA 5I03A 1VBJA 4HJWA 3K8MA 3VZZA 3P84A 3S1UA 2X1IA 1MW2A 1M1BA 4GX8A 3GUWA 3DHFA 3PNZA 4YCPA 1QW7A 3POCA 3H2OA 1PHQA 2BFGA 2V2DA 2OZTA 1GG0A 2V2HA 2G4FA 5HWMA 4AZGA 3T0BA 4ZE5A 3REQB 1OX5A 1LORA 3NQVA 1XD1A 1JPHA 3MT1A 2P0IA 1UZDA 2QV4A 3ES8A 3EWDA 3O9NA 3IIOA 4ZQMA 2BGSA 4UTUA 4K6AA 3E9AA 4TMCA 3MKKA 2ZRZA 3CL8A 3GHSA 4GE8A 1CX9A 2FPYA 3TN4A 3OP2A 1GOOA 4REQB 2XM1A 3K8KA 1KM3A 4NZ3A 4IPLA 2WNQA 1R3WA 2ZX9A 4QLLA 4BQ5A 1FCQA 4AD0A 4JGDA 2NXGA 3EDDA 4RXGA 3WD4A 4Z2HA 2ZOXA 3BV4A 1UWAA 3C4UA 2J47A 4NU7A 2PGRA 3BLKA 4HHHA 1D3HA 4AXKA 1KCXA 3C3NA 3AROA 1I6NA 4DUWA 1PL9A 4I5RA 3OGSA 1C7TA 1CENA 4QCFA 2G3MA 3RDKA 4XAZA 1RCOB 1XRVA 8TIMA 3TC3A 3GK0A 3FV9A 3GZ3A 1E6NA 4NZJA 3T8QA 1FWRA 1EH9A 2R91A 4HPJA 1B4KA 5TF0A 2DT3A 1D9EA 4LB3A 3TMLA 3EEZA 3BICA 3M0JA 4HQVA 3GFXA 1HKJA 3W1MA 3DEQA 5HQEA 4CN4A 2ISFA 3ZVHB 4QQ3A 4H7VA 3ICJA 3N3MA 3IJ9A 1IEIA 2BBFA 4QLJA 2NXIA 2D24A 1A5NC 3NO3A 2DZPA 4QDPA 3WDJA 5CPQA 4IMDA 4BS0A 3OZYA 4JL1A 3TC6A 3RR4A 1PCKA 3MS8A 3NPUA 4IFOA 1TMHA 4FNSA 4PCPA 3VU2A 2NX3A 2F6KA 1RQEA 4I6VA 1HW6A 3WBXA 1R6WA 2ON3A 3WLMA 3VNLA 4AX6A 4GGHA 5CH9A 1AFSA 2I56A 3F4VA 4H2CA 1HKWA 5AVNA 4AD2A 1SFTA 4JXCA 2DUAA 1GG1A 3VUPA 1YHTA 3V5OA 1SFLA 4U2ZA 2Y8VA 1JUKA 4Z2LA 1SO3A 4OTKA 1OY0A 2P8BA 4PRRA 5T9BG 1R85A 2VRKA 1E1CB 4AZ5A 1NIUA 4AD5A 3I7SA 5LIWX 4EP8C 3E2SA 1QO2A 4XZIA 4GVFA 2VOTA 5BWAA 5FSEC 4K3ZA 3SAZA 2C91A 4GZJA 3BARA 3UZWA 4A35A 1QBBA 3RU6A 4KWOA 1VJZA 3O63A 1H50A 1XR2A 4O28A 3TWAA 3P3BA 3R8HA 5IFPA 3IUHA 4ZB2A 1UG6A 1P0BA 5HUPA 1ISXA 3TA6A 1XLAA 5CPSA 4IIDA 3FSUA 3KLLA 2V38A 4IMFA 1XP3A 1PZ3A 2DUZA 4H8UA 3GY1A 3UR8A 3P5ZA 3UXDA 4MY8A 1PWLA 3GTIA 1K02A 2QJJA 4K36A 3LCIA 1UMYA 1IWPA 4GX9A 1DJIA 4RE0A 5D8ZA 3FYPA 2V5CA 5A5WA 3W7NA 3A21A 3ZVIA 4LEFA 3IGSA 3GU9A 2WANA 3S4TA 4DWSC 1JCNA 2WJZA 4NAFA 3QR3A 1OCNA 1X97A 2QJMA 4E38A 2I1OA 3H55A 3PSVA 3DDMA 5FJIA 4WKFA 3L66A 2OU4A 3VFCA 5A8MA 4C6EA 4LTSA 1POKA 5PTDA 2R6OA 5I02A 3GDKA 1FUYA 3CZEA 4H83A 2WXDM 4MDOA 3WNOA 4O50A 3LNPA 2VFEA 4JN8A 1F5ZA 2SFPA 3OHMB 3B9AA 4QXIA 1K9EA 1WPCA 1ZB5A 3EX2A 1DJYA 3BMXA 1OZQA 3ZQ9A 2VCBA 4PEKA 4C6NA 1WXZA 5DCEA 4HOXA 3STPA 2AMGA 2F2KA 3PUGA 3PZTA 3CTLA 3AWOA 4UTHA 1W1TA 3AMDA 4GNKB 4UFIA 1SJAA 5E1QA 3QPYA 3GW3A 4BFAA 4TTGA 3PULA 4UR9A 3ZR5A 4W5ZA 5DCDA 1E6ZA 3BQ5A 3CUGA 3TOPA 3N34A 1UQZA 3M1ZA 4B9YA 3EXSA 5D2VA 4J9JA 5A6MA 5D37A 1VB9A 1D2KA 1UD5A 2XH4A 4CD7A 3WD2A 4JTLA 4RDYA 5A2CA 1CIUA 3NL2A 3LSBA 3IWPA 5F4SA 3UXLA 3V0UA 1WUEA 3RRAA 3WBEA 3TP4A 3AIWA 3MA8A 4G6CA 4QE4A 3GNXA 2DZWA 4NYYA 3ZLGA 3PC0A 4IIEA 8A3HA 1XHGA 3EA1A 3VNZA 4V28A 1WZAA 4GA8A 5ABHA 3CPGA 3H4GA 1A53A 3W71A 5BU6A 2JK2A 1AL7A 1U33A 3AQUA 2FLIA 4YXGA 1RUSA 5HJXA 2VDGA 1XRSA 4GXWA 5A6LA 3KW3A 1F4HA 3G0SA 3IGUA 5KZMA 1KLYA <