5HK0A

Crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
109
Chain Sequence
MVISRAEIYWADLGPPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of M. tuberculosis MazF-mt3 (Rv1991c) in complex with RNA
rcsb
molecule keywords Endoribonuclease MazF6
molecule tags Hydrolase/rna
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 20
structure length 109
sequence length 114
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hk0A00
4MZMA 4MZTA 4VUBA 2MF2A 5CKHA 5CQYA 3HPWA 5CKBA 4OF1A 3JRZA 1M1FA 2VUBA 1VUBA 5HK3A 5CQXA 5CKEA 3JSCA 5CKFA 3NFCA 5CK9A 4ELYC 2C06A 1X75C 1NE8A 5HK0A 5DLOA 3TCJA 5CO7A 4ME7A 5HKCA 5CKDA 3VUBA 5CR2A 4MDXA 3G7ZA 4ELZC 4MZPA 5CCAA 4HKEA 1UB4A 2KMTA
chains in the Genus database with same CATH superfamily
1KD1U 1FWZA 5KYYA 2K3BA 2B86A 2ZPIB 2FVUA 5LJ5f 2DERA 2B8AA 3I55T 1WLPB 2KXDA 1M90U 4J83A 4M78A 3RUXA 2ZCFB 3QDFA 1SRMA 2OX7A 4TVRA 2LNVA 2FL7A 2RH2A 1T3SA 4XTZA 1FMKA 3OSSC 2DEUA 5FRMA 1OI1A 1JU5C 3HPWA 1G3SA 3UDCA 1YJNQ 2DL3A 2COWA 4ZNXA 5GAMf 1SF9A 4C5IA 1AVZC 1U5SA 1UTIA 3OYIA 2CZ6B 4M7AD 2KR3A 1N8RU 2OTLQ 4XTUA 1PD0A 1XJWB 1YITQ 4EDUA 3IQLA 3VUBA 4NL3A 2CP0A 3TVTA 3KBGA 4Z89A 3JCMQ 2KY9A 3M5AA 2RJCA 3EFSA 1B3QA 4OB3B 4NL2A 5FU7B 1WYXA 2A0FB 2FHDA 2L3SA 1FMVA 2ZAEA 1TUDA 3HTRA 3EGXB 2HCKA 5GAN2 3H0FA 4LN2A 5LJ3h 1UHCA 2FYKA 2JTFA 1BK2A 4MMLA 4M77B 1YCSB 4FYVB 4CRIA 5KH6A 3P8HA 2VASA 1K8AR 4HCZA 1VQ7A 2QGGA 4IIOA 3E1SA 3CCMA 2QA4Q 1VQ6Q 3JCMP 2DXCA 1IHVA 2DL4A 1I81A 1HYOA 4M7DA 1D1BA 1NBEB 3FDRA 3MP6A 5FWCA 2WSCE 3JCMh 1K8AC 4BI4A 5M9OA 1VQLA 3AHUA 5GMKh 1M1FA 5HCKA 4FYWB 2CT3A 3JB9D 1VQ8T 1RAGB 2V8JA 2RI3A 1D1CA 1G3TA 2QTVA 3UPUA 2DTHA 1MMAA 2Z0WA 4RTVA 2YHTA 5GANh 1IHWA 5FW9A 2L0AA 2GFAA 1G3WA 1O9SA 4J9FA 1WHLA 4Z8AA 2HDAA 2DO3A 4M7AC 2RQUA 9ATCB 4E7SA 3ULRB 3I55Q 4XTVA 2PTKA 4FT2A 3JCMW 5KYXA 2GTOA 2RK1A 1M1GA 3EG9B 2QK0A 3RKXA 2HBWA 3CCRA 2CS7A 3RMQA 2AIRB 3OBYA 3L2UA 2R5AA 1YHQT 5KYWA 1MHNA 4E7KA 3OYCA 4E7HA 1KJWA 2J6FA 2CH4A 4JPBW 2JS2A 2DVJA 3Q1JA 4AFQC 4MZPA 5LJ3g 2JT4A 3KFVA 3SEMA 2SEMA 1E6GA 4A4FA 1UFFA 1YI2A 1BBZA 4ZN3A 3M0UA 4HXJA 2VVKA 4CC2A 1ABOA 3C95A 2DYIA 1ZQ1A 4BI3A 4C92C 3CBPA 4R56A 1W2BS 4Z02A 2VC8A 4ZTFA 4OVAA 2XIDA 3OYLA 4C92E 1Z9QA 3CC7A 3JCMg 2GQIA 4M7AF 3QUIA 2XDDA 3L2QA 2VKNA 5GAOr 1VA7A 2I0NA 2YWWA 5FROA 2K2VA 5CKFA 3SHWA 4J9BA 2X3WD 3VS4A 3EG0A 1FX7A 1MNEA 2OAWA 2F2WA 4ZGEB 2H8HA 1WHHA 2DXTA 4JDSA 5LJ5d 3NGPA 3RESA 1TUCA 2MPXC 1SKUB 2O2OA 1BCMA 3X28B 2HMAA 1G2BA 4KH1B 4HCCA 3GLXA 1SHGA 1IGQA 1QVFP 1BI0A 2DYBA 2RNAA 1PCXA 3M0RA 4WCIA 2EIFA 2DPPB 3VS5A 1VQ8Q 3L1AA 2ROLA 3QBYA 2MMPA 5A2QE 4FW2A 2BUDA 3OYDA 3CMET 3I35A 3MCAB 4ZTJA 5FU6C 3UWNA 4M78D 2GTJA 2K5IA 1ACMB 1B7TA 1G83A 3JCMX 4BACA 1JJ2P 5CQXA 2KYBA 4C92F 2M9UA 3L2RA 4NS5A 1BI3A 3VYGA 3JCMc 3L2ZA 4M77A 1R0CB 3EH1A 2KT8A 3SWNB 1YJWT 1CKBA 3VS6A 2DZCA 3J80E 4GLMA 4OMFB 1W2BA 5FRNA 4X9CA 5CQYA 4V2SA 1YHQQ 1RACB 5IHNA 4F14A 1QWFA 5CKEA 2DRMA 4BI8B 3LH0A 3OYEA 2LC4A 4J5YA 4F7UB 4FT4A 5KCHA 2W0ZA 1KHCA 4KGZB 4JLIA 4EMKA 3TEEA 3EGUA 2RA2A 3PIPA 2E70A 2K7AA 2IG0A 2X35A 2MK5A 2COZA 2MCNA 1WHKA 2YXYA 3MEWA 4M77G 3CCJA 4BE2A 3CMEA 2L5QA 1Q81C 2YRDA 1RI9A 2E3IA 1X2QA 1TH7A 2KMTA 3CCVT 2MYSA 2YRCA 3G71Q 1Y71A 1WIEA 2RQVA 2LVMA 2XKOC 2XI9A 1TXQA 4ESRA 1SPKA 3CCSQ 3UA7A 5KYYB 3VS7A 4M78C 3OS1A 3M9QA 2KNBB 5ECAA 4CC7A 3TCJA 2LDMA 3EG3A 1ARKA 4C8QA 1AHJB 3HP9A 4J9DA 3DLMA 4OMPA 1KC8R 2M0OA 3NHNA 3G6EA 2DX1A 1QLYA 1RAEB 4IUVA 2LQNA 1K76A 3OBWA 4FL6A 4C0DB 1XQHA 4PK4A 4RTWA 2KXCA 3CBOA 3LGFA 5IXFA 1KQ1A 4X34A 3V7RA 3I56T 2AT1B 1WXTA 4PL6A 4KULA 1HK9A 1KC8C 1RAHB 4ZGJB 3GF5A 3CC2T 2A37A 2CP5A 5FLXE 1PRMC 3BY7A 4PJOA 4OGCA 4OMNA 3MJXA 3NPFA 1K73R 4M7AG 1WGSA 3VRYA 5GAOq 2EQMA 5GAMj 3LGLA 2X4JA 1I07A 1FMWA 3DB3A 1E6HA 2D6FA 2D9TA 4ZN1A 1MNDA 2XU8A 1YJWQ 2LZ6B 2PUKB 4LE9A 2EJFA 1VQPQ 4PJMA 5CAIA 2XHCA 3L2VA 2PNIA 3E9GA 2CP6A 2CT4A 2QEXA 4A4EA 5HK3A 3JCMV 1WI7A 3L2WA 2D0NA 4M78F 2NYSA 1HJDA 4M7DC 1GCPA 1MV3A 1ZSGA 4RTTA 3PMTA 1Q7YR 1WJRA 3E9FA 4X1VA 2EQUA 3CC4A 2RD1A 3GBQA 4M7DE 1WXBA 2V1QA 2E10A 3A8MB 4ORZA 1KQSP 3BE3A 1KC8U 1X6OA 5KYUB 2RMOA 4PKCC 2DL5A 3QYHB 4C92G 2MWOA 3CC2A 4WF2A 3OYFA 4II1A 5AT1B 3JB9G 1H92A 4ELZC 1VQ4Q 2EKOA 1NLPC 3EG1A 2E6NA 3CCVQ 4KGXB 5DM7R 4LNPA 1WJQA 4FU6A 1YJ9A 1KD1C 1G5VA 3OYAA 3C94A 3SWNA 5LJ5h 3ASKA 5D7UA 3CPFA 1K73U 1V76A 2QQRA 3CXCP 1X6GA 1K0SA 3C0CA 4FIBA 4BD3A 1T3LA 3UT1A 3PGGA 1SSHA 3CEYA 4CI0C 2M02A 1I1JA 2NLUA 1P92A 1I0CA 1JXOA 2BZYA 4F7UA 2WACA 2LQKA 3A8GB 3PVLA 1QKWA 4A63B 4M7DF 2DBKA 1VQ6T 3I56Q 4ELYC 2DD4A 1M2OA 1WHGA 1VQKQ 2EGEA 4BY6B 2RHZA 1QVGP 3A1PA 1YJNA 4R55A 4J9GA 2F5TX 1GFDA 2XICA 1H8KA 1Q7YU 4EMGA 1N8RC 1JO8A 2A7YA 2CZ7B 4JZ3A 3V8JA 2OTLA 1YITA 2O31A 4N4GA 3CPWP 1PG5B 2EFIA 2KSSA 4D6WA 3WVEB 1VQ9T 3JB9J 5J39A 4BE0A 1W1FA 2E3HA 2KK4A 4M75D 2PVGB 1UG1A 1AT1B 2DAQA 2RK2A 1ZBXA 3V8KA 5GANe 1BKBA 2FPDA 1ZSZB 1BCOA 3A8HB 3NTIA 3CCQT 1JBMA 5I21A 4C5GA 3HHTB 2HNIA 4XTWA 2ZPHB 2YLCA 4F04B 4RTXA 1VIEA 2HL3A 2COYA 3G4ST 4HKEA 1PRLC 3TREA 1PM3A 2X3XD 4LD9K 1AZEA 2QA4A 1VQ6A 4Z88A 1GBRA 5GANj 3M4YA 3QPHA 4X9DA 2FZGB 1WHMA 1LPLA 3MO8A 2X4WA 3REBB 2QXFA 5LJ5g 2Y4XA 2QGFB 4B9XA 4DQ2A 5HK0A 3QJYA 2CP2A 3TSZA 2KRNA 2Y90A 1GCQA 5FU7C 1QVFS 5GAOm 4J6WA 3F70A 3MEAA 2JTEA 3CCLT 1OOTA 2BIVA 2EKHA 2NUZA 4C8QD 4E6RA 4J9CA 1RLPC 4K11A 1TOVA 4M78G 5C0MA 4M77C 4FCYA 1U06A 3VS2A 3M0SA 4XQ3A 5GAMg 2FRWA 1MMDA 3WXMB 2CSIA 4GLKA 5GAN7 1SG5A 4M77E 1NPPA 3QWYA 3OYKA 3I55A 2M1HA 1AWOA 1JJ2S 3RNJA 1HSQA 2ZZDA 2M51A 4J7FA 4PJOD 1UGQB 4FM4B 1UJYA 2E5KA 4HVUA 2VXEA 2E12A 3X26B 1H641 2FEIA 4M75B 5DLQE 1VYVA 3J81E 5KYUA 4FW1A 1IO6A 1RI0A 2BZXA 4EMKB 2L2PA 1Y0MA 3VJPA 2AZSA 1RUWA 2LQ8A 3V8LA 3EFOB 4QVZA 2RM4A 1ABQA 1K0XA 2MAMA 1J3TA 6AT1B 4XU2A 5D6XA 2RHIA 1VQ9Q 1R0BG 4KGVB 4LDWA 3FIFA 2K3XA 1QVFA 1N9SA 4OMOA 3EHQA 2L89A 3TQ7P 4LDXA 4M77F 3JSCA 4M7DG 5KE2A 1FXXA 3CCQQ 1EX4A 1CSKA 3ZEHA 4M7AE 1X75C 2CZ0B 2DXBA 2QQBA 2MI6A 3MEUA 3S3NA 4AT1B 2DFUA 3E19A 3G4SQ 1UB4A 4VUBA 2QI2A 4C8QB 3L42A 1Y7XA 3PTAA 1QP3A 2DE0X 2WSFE 2EWNA 3PNWC 3HRTA 2ROTA 4C0ZA 1VQMT 4RTUA 1JJ2A 4JS5A 4E7JA 2LCSA 4RG2A 2Y4YA 2EVRA 2CSQA 1SEMA 2HL5C 1VQ8A 2CYZB 5CKHA 3M57A 3CCLQ 1A0NB 4RG8A 1VQOT 4PJOB 1N5ZA 1OZ2A 2W10A 1YIJT 1M2VB 3OYBA 1BIBA 2ED0A 4PJJA 5CR2A 2GF7A 3H6ZA 1UECA 3QXEB 2FB7A 3H41A 3G71T 1ZSZA 1WXUA 3CCST 1WX6A 2DJQA 4F16A 2JVVA 5GANf 2DVEA 2XDBA 2EQJA 2RQTA 3X20B 2DXUA 2VXFA 3PFSA 5IHKA 1UEBA 2WSEE 1YHQA 3EGDA 2RN8A 5IH2A 1KG1A 4A4KA 4QT7A 4E2FB 2F2XA 2GCXA 1TU0B 1OX9A 3BFMA 3M4GA 2K3YA 1U3OA 3U23A 3CCET 3ER0A 2FZKB 3A8LB 2GGRA 3X24B 2PZ1A 5I2MA 3M53A 5HKCA 1I5OB 2DBMA 4KT0E 1Y57A 3S6WA 3CCUT 4RMOA 4EMHA 1KIKA 5GAMd 1ZLMA 1KQSS 1H3HA 2JTMA 1SRLA 5L8RE 4JS4A 1RADB 1UDLA 1AWJA 3C4SA 1N27A 2ZPBB 3SWNC 4OMLA 2C0TA 4J9HA 1UHFA 3M0PA 1Y96A 3G71A 3JB9F 3A5ZB 1NJIR 4OP0A 3OY9A 1H3ZA 5GAOp 3CCSA 1HXDA 1GL5A 1VQPT 1ZUKA 4HT9A 4HVVA 1S72T 2KRMA 2D0QB 1C0MA 1OQKA 4IURA 2EGAA 1NJIC 3EAEA 3CXCS 2SRCA 4M75A 1VQMQ 5HY6A 2LP5A 2FPFA 2E1HA 3REAB 2JM9A 2D8HA 1LNXA 2NUPB 1X43A 1Q86U 3JCMb 2E65A 3KUFA 1VQNT 3EFOA 1VQ5T 2O9SA 2CP7A 2A08A 4RCCA 3FEOA 4A53A 3CD6T 1VQOQ 5CVIA 1RABB 1V1CA 1YIJQ 1QVGS 1NPRA 3S3MA 1VQ4T 2LNHB 2ED1A 4N4IA 2OJ2A 4PJNA 1WQWA 3D7SB 2JUFA 5I11A 3RBBB 3GOXA 2ZPFB 3MHXA 2ABLA 3M59A 4MMKA 2CH4W 4Y92A 4IIMA 3FJPA 4M75G 1VUBA 5IT9E 4JRIA 1KQSA 3CPWS 1YJWA 3LLRA 4JUVA 1VQPA 2MOXA 2X4XA 4C0DC 5GJWB 2DF6A 4L59A 4KUIA 4AG1C 2GQVA 2IIMA 4M78E 4F7UF 3VS0A 2V1RA 4A54A 5LJ5e 2X51A 1IZ6A 1NJIU 3OYYA 1WA7A 1DJ7B 3I5RA 5GMKm 3VU3C 4KUDK 1YCYA 1M4ZA 1XTDA 4C0FA 3CCEQ 2JXBA 5GAOl 1TS9A 1VQKT 3OA6A 4HCBA 1D1AA 3CXCA 3LW5E 3OS0A 2DILA 3LYIA 2YUNA 1NM7A 1BB9A 3CCUQ 1S1NA 3N5BB 1BU1A 1WPYA 1PWTA 2ESWA 5GAN3 1M2VA 1OPLA 4KH0B 2VV5A 1RAIB 4QVCA 3M55A 1VQ4A 4C8QG 1UE9A 2C06A 3QZ5B 5IXBA 3CCVA 4DBHA 2QQSA 1OV3A 5CIUA 1K73C 3H0IA 3E2UA 1QVGA 1RL2A 1AOJA 2HQXA 4FSSA 3THKA 4JRPA 1S72Q 1M30A 1IREB 4FSXA 3MEVA 1AZGB 3RKYA 2IVWA 2FRYA 1M27C 4PJOG 2BTTA 3CPWA 3QSUA 3I5SA 5GANd 5CCAA 3SFMA 5GAN5 4OMQA 4LUEA 2K2MA 1IGUA 2HKNA 4J9EA 2JW4A 1ZUYA 2KGTA 3OYMA 3I56A 1OYXA 3ME9A 2C0OA 3FLGA 1VQNQ 3R6NA 1ZBJA 1PKTA 2KT1A 1VQKA 1VQ5Q 1KK7A 1Q7YC 2KAFA 3CD6Q 1GXIE 2K6DA 3FB9A 5DLOA 4JRQA 3CMAT 2FPEA 1NLOC 1M3CA 2R58A 4IUTA 1VIFA 1M9SA 1E7OA 2ZPGB 4EIKA 1Z9ZA 3UA6A 2DM1A 4Y28E 2KQWA 4N4HA 2EQKA 2DK3A 2CUBA 3QZ9B 4A4HA 3EHRA 1OX8A 2NUTB 1NG2A 4C5HA 2YLBA 2HKQB 1PSEA 4XAXB 4YTLA 2L3PA 4RTZA 4JRKA 1IXDA 3QJ6A 4XU1A 3GP8A 2LCCA 4DEXA 3PE0A 3CQTA 2QASA 4BY6C 3MKDA 5L23A 1YFNA 1M5Q1 2NUPA 5LJ3e 4MDWA 2LTOA 3M0QA 1X6BA 1AWXA 5GAMh 1V29B 2OAUA 5KYNA 3QIIA 4J8OA 2E64A 2K57A 4XK8E 2E41A 2ZGWA 1UGVA 1RAFB 1TSFA 3O5ZA 2ENMA 1PHTA 2QQ9A 2VUBA 2DJZA 4WTOB 3FC3A 4J6YA 2JNGA 5LJ3j 3OS5A 1Q82R 1WNLA 1QVPA 1SSFA 1LJOA 3OYGA 3JCMe 4HVWA 4QW2A 2F69A 2RI5A 3VYHB 5GMKe 1ZSZC 4EPCA 3H0HA 4F7UG 4AFUC 2BE7D 2BZ8A 2LCLA 4GBQA 3JB9H 2AKKA 2RJFA 2VYTA 4Q5WA 2QDLA 3TSWA 2BKDN 4PJLA 1AWWA 2EJGA 3OYJA 2BE9B 2EW3A 1ZUUA 2HD0A 5GMKj 1XNIA 1GBQA 3OW2P 4E7LA 1MGQA 2H3JA 2K4YA 4E7IA 3G1JA 3EGDB 3PMIA 4PFZA 3T9NA 3FJ5A 4LDVA 3QO3A 2LQWA 1NEBA 5LL6S 1VQ7T 2RJEA 5J26A 3CCMT 1M8MA 4E7ZA 2IPOB 3X25B 3CMAQ 2KRSA 1ZA1B 5GJVB 2L8DA 2O9VA 2JJ9A 2QTXA 4LXCA 8AT1B 4XU0A 3SDZA 1VQLT 1VQ9A 2MWPA 1OEBA 3PIOA 1KSWA 3GNFB 1Y07A 1W70A 5D6WA 1PKSA 2FG0A 5CO7A 4DA4A 1M8VA 1JXMA 1M3BA 2YDLA 4BB7A 2HEQA 2F1LA 1Q82U 4RKUE 1Y96B 4PLLA 3CCQA 3LWHA 4PLIA 3OYNA 4M75C 4ZGDB 3H9NA 1NZ9A 3QHSA 2QQAA 3VS1A 4E47A 3G4SA 2RF0A 2QDYB 4EMKC 4BDZA 4M75E 1D0ZA 2ATCB 2O4XA 2LT1A 5DY9A 4KRTA 4AFZC 3O8VA 5CKBA 1D3BB 2HAXA 2P4RA 2V8KA 2PVDB 2P0QA 1YP5A 3CCRT 4L5GA 1QMCA 1QCOA 3EH2A 2DD5A 1D0YA 4C5EA 3META 3NTKA 3JCMJ 4N0AA 2M16A 2K5FA 1OZ3A 3CCLA 3A98A 2D1XA 4KBMB 2HQHA 1AD5A 5IAYA 3ZFJA 4C92D 1MMGA 3M0TA 1ZHIA 4OB1B 1GRIA 1YBYA 2A36A 2NUTA 2LRQA 4HCKA 2ECZA 4LDYA 3LWIA 1YI2T 2GBQA 4J7IA 2A28A 3QDRB 1D0XA 2CUDA 4C8QC 4BUGA 3BW1A 2VWFA 3P8BB 2YSQA 3FRNA 4IUPA 5GMKl 4C8QE 3JRZA 4M75F 3CC7T 1EIFA 4RCBA 1WQ7A 1QCFA 3V7SA 5LJ3f 3J7AF 4DBQA 1PC0A 4M7AB 1VQ7Q 2R57A 1HD3A 4PJOC 4MDXA 4XTXA 3CCMQ 4F17A 2CZ1B 3OSVA 3GPLA 4QKUA 4BDYA 1R77A 2CDTA 2EBPA 2DETA 2LJ0A 4PJOE 2O01E 2P0KA 1FYNA 2XDPA 2KEAA 1TWBA 1VQLQ 5KE3A 1QP2A 4CC4B 1T0JA 2D8JA 3JAME 1K8AU 1ZX6A 2DTIA 1QKXA 3A8OB 2J7IA 3JCMf 3GIBA 2H3EB 4JJDA 5A0GA 3NTHA 2XD0A 1OPKA 3G7ZA 1NYGA 1OU8A 2F2VA 2A3LA 3ZBDA 3KXTA 1MUZA 2XG8D 4PFOA 2QG9B 3M56A 2YRVA 1QQJA 3SD4A 4IUQA 1W4SA 3QWXX 4AG2C 1Q86R 2RPNA 4GY5A 4LD6A 4C8QF 4BE1A 4DEYA 2KVQG 3OMCA 3RERA 2EQIA 2F5KA 5I22A 2O88A 3OMGA 2DIGA 5D6YA 3R6OA 1U1TA 4C92B 4JZ4A 1I5LA 2DIQA 3AT1B 2EPDA 3HL8A 1Q86C 1VQMA 2AKLA 2EGCA 3LX7A 2J06A 3CCRQ 2DL7A 2EYYA 1YN8A 3LH5A 2VB6A 3NFCA 2RQRA 4HA8A 1YNZA 1X01A 5GANg 4PJOF 2LX9A 5FWBA 3NMZC 4QVDA 5A0LA 3DB4A 1M1KR 2EYXA 2EJ9A 1N9RA 3TU4K 1VOMA 1VQOA 2HBPA 4OB2B 4RUGA 5EG2A 1WDXA 3DKMA 2RQWA 7AT1B 4OMMA 4DOWA 1YIJA 2KDSA 5GAN4 4LUDA 3M58A 2G3RA 1M1KC 1YI2Q 1KQ2A 2YUQA 1N6AA 3RR6A 4ME7A 5GMKi 3CCJT 2JM8A 2RHYA 2RO0A 4MZTA 4PNOA 1WFWA 2FZCB 2KI7A 1K1ZA 3EGXA 1MV0B 2CREA 2G6FX 1WZOA 3S3OA 3URGA 3CC7Q 1BYMA 2XK0A 4FYXB 4J6XA 4HT8A 5FU6B 4F7UE 4P5NA 4Y91A 1UGPB 3INZA 2DKGA 2XMFA 1D3BA 4QQ6A 2K5LA 1Q95G 2RB6A 1K4US 2X9HA 3CCEA 3PVQA 2DLPA 1IRXA 2GFUA 3G6ET 4ANJA 4CC3A 2J05A 3CCUA 1QCNA 2LJ1A 4M4ZA 1Q81R 1JQQA 4LDUA 3QG1A 3VV0A 1PNJA 2MF2A 1VYUA 1D09B 1QWEA 3JV3A 1M1KU 4OB0B 2YT6A 5IHIA 2YUOA 2I2LA 3HFOA 1B34B 4O6JA 2HQEA 4QQDA 1QW1A 5I2SA 4FYYB 4D8KA 1S72A 1BIAA 2ZPEB 4DOVA 1M3AA 4RTYA 1X69A 2KBTA 4IUUA 5EC7A 1VYTA 1C6VX 2VGMA 5J3BA 2X4YA 4M7DD 4C0GA 2J6OA 1W6XA 3MPUB 4M7AA 2PVOB 2C0IA 3EG9A 2JMAA 1ZA2B 3VRZA 1K9MR 2QEXT 2DRKA 4L6V5 4AFSC 1G8XA 2LT4A 2R5MA 1C1AA 1GCQC 1WHJA 4ATOA 1U1SA 1UUEA 4D8DA 1VQNA 3OW2S 3EG2A 3RDVA 1PD1A 2HSPA 5LJ3d 1VQ5A 4M78B 3VKIA 3CD6A 5LJ5j 3CC4T 1I8FA 2RJDA 1K9MC 1OULA 5GAMe 3RMSA 1JEGA 1CKAA 2V26A 2L3RA 1KHIA 4XU3A 3OYHA 2HZYA 3H8ZA 3HRSA 5GAOn 2DEQA 2EYQA 1U8RA 5IN1A 1W2BP 3CCJQ 1RAAB 3CMEQ 2GNCA 1NYFA 3SB2A 1TG0A 4DBFA 2KROA 1LOJA 3JCMd 2P84A 2K9GA 1Q81U 2K79A 1F1BB 1MMNA 1G3YA 1YJ9T 1UGRB 2JMCA 2KYMA 4B9WA 2YUPA 4C92A 3DLLA 1YWOA 5CKDA 1X27A 3WVDB 2OTJT 4IKFA 8ATCB 3UF4A 3ZL7C 4A4GA 1T0HA 3MP1A 1PSFA 4UC4A 2DZ9A 1X2KA 3G6EQ 2O4XB 3M54A 2QAZA 3BDLA 5A0DA 2JZ2A 4N0AC 3OS2A 2PU9B 1B07A 2VGNA 1NE8A 2KE9A 3HRUA 5C6SA 2AZVA 2DNUA 4XTYA 1I4K1 3EFRA 1K9MU 1TUGB 2PQWA 4M7DB 4PFPA 3C12A 1YJNT 3OW2A 3MP8A 2E4HA 2RI2A 5KCOA 2P4TA 2J6KA 1K9AA 1UJ0A 1OU9A 4JLGA 4OGEA 1KFZA 2RHUA 3RIRA 2V8IA 3HSBA 2E5QA 4AMCA 1WJSA 3OQ5A 1KD1R 3GNGA 4O5VA 2OTLT 1YITT 3OB9A 4QQGA 2MIOA 1IB8A 2LJ3A 3UATA 2JOYA 2M0YA 1R8OB 2AK5A 2CKKA 1M90R 2PUOB 3VUZA 1AEYA 2QYZA 2L3QA 2DL8A 3QKJA 2OTJA 1JRIA 2LX7A 3P8DA 1NEGA 3HFNA 3VS3A 2QEXQ 1LVKA 1BI2A 1M90C 5KYXB 2P0PA 1O75A 4MZMA 1XOVA 4JJCA 3CC4Q 1YWPA 2EAYA 3CBMA 2LMJA 2QA4T 1N8RR 3CMAA 4NOYA 4J9IA 5KYWB 5CK9A 5GAN8 1EZZB 4R0KA 3HKSA 1SHFA 1LCKA 2EYZA 2NWMA 5GAN6 1EFNA 2HSEB 3CC2Q 2FO0A 2OI3A 2EYWA 4JJNK 2CGHA 2DMOA 4M77D 1B34A 4OF1A 1Q82C 4B6MA 4DBRA 3V7CA 1UGSB 5AYFA 2DTOA 2CP3A 2JN0A 2DA9A 4JJBA 1BI1A 2RHXA 1RLQC 1TTHB 1YJ9Q 3PT9A 2E6ZA 3I9QA 3BDUA 3RKWA 3QYGB 3JB9I 1JB0E 1GFCA 2AHJB 2JS0A 2OTJQ
chains in the Genus database with same CATH topology
4C8QE 5CAIA 2XHCA 1S72T 1KD1U 3L2VA 1FWZA 4HT9A 3E9GA 2ZPIB 3JRZA 2FVUA 5LJ5f 4M75F 2D0QB 2B8AA 1EIFA 3I55T 3CC7T 2QEXA 4A4EA 5HK3A 4RCBA 3JCMV 4IURA 3L2WA 1WQ7A 4M78F 1NJIC 3V7SA 3EAEA 3CXCS 5LJ3f 4M75A 3J7AF 1M90U 4M7DC 5HY6A 4J83A 3PMTA 4M7AB 4M78A 2E1HA 3RUXA 2R57A 2ZCFB 1LNXA 1WJRA 3E9FA 4PJOC 4MDXA 1Q86U 2EQUA 2LNVA 2RD1A 4TVRA 4XTXA 2RH2A 2FL7A 2CZ1B 3JCMb 3CC4A 4M7DE 2E65A 3OSVA 3OSSC 4XTZA 2E10A 3GPLA 5FRMA 1OI1A 3KUFA 3A8MB 4BDYA 3HPWA 1VQNT 4PJOE 1G3SA 2O01E 2P0KA 1VQ5T 3UDCA 2XDPA 4RCCA 3FEOA 1X6OA 1KC8U 4A53A 3CD6T 5GAMf 5CVIA 4PKCC 3QYHB 4C92G 2MWOA 3CC2A 4C5IA 5KE3A 1QP2A 4WF2A 3JAME 3OYFA 1K8AU 4II1A 2DTIA 3JB9G 1NPRA 3A8OB 3JCMf 1QVGS 3GIBA 3OYIA 3S3MA 5A0GA 2CZ6B 1VQ4T 3NTHA 4M7AD 1N8RU 3G7ZA 4ELZC 2XD0A 2EKOA 4XTUA 4N4IA 4EDUA 3VUBA 1WQWA 4NL3A 2E6NA 2JUFA 3KBGA 2A3LA 3JCMQ 5DM7R 3ZBDA 2ZPFB 2KY9A 3MHXA 3GOXA 3M5AA 2RJCA 3KXTA 3M59A 4MMKA 2XG8D 3EFSA 3FJPA 1WJQA 1VUBA 3M56A 4FU6A 4M75G 2YRVA 4JRIA 4OB3B 5IT9E 1YJ9A 4NL2A 5FU7B 3SD4A 3OYAA 3C94A 4IUQA 1KD1C 2FHDA 1G5VA 1W4SA 3CPWS 3SWNA 4GY5A 4LD6A 3ASKA 5LJ5h 1YJWA 4C8QF 3CPFA 1K73U 4BE1A 2QQRA 3LLRA 4JUVA 5GAN2 1VQPA 2X4XA 2KVQG 4C0DC 3OMCA 4FIBA 4BD3A 3RERA 1KQSA 2F5KA 5LJ3h 4L59A 3OMGA 2DIGA 4KUIA 3UT1A 3PGGA 5D6YA 2FYKA 3CEYA 2JTFA 2GQVA 4CI0C 3R6OA 1U1TA 4MMLA 4M78E 4F7UF 4A54A 4C92B 4M77B 5LJ5e 1I5LA 2NLUA 4CRIA 2DIQA 5KH6A 3HL8A 1P92A 1IZ6A 1Q86C 3OYYA 3P8HA 1VQMA 1DJ7B 1NJIU 4F7UA 3VU3C 2WACA 3LX7A 4HCZA 1YCYA 2LQKA 3A8GB 5GMKm 1VQ7A 4KUDK 1M4ZA 1XTDA 3E1SA 4C0FA 4M7DF 3CCMA 1VQ6T 3NFCA 4HA8A 4ELYC 3JCMP 2DD4A 5GAOl 1VQKT 2DXCA 1X01A 5GANg 1I81A 4PJOF 4BY6B 3OA6A 2LX9A 4HCBA 4M7DA 3FDRA 4QVDA 5A0LA 2RHZA 3DB4A 3LW5E 3CXCA 2EJ9A 3MP6A 3LYIA 3OS0A 1YJNA 2WSCE 4R55A 3JCMh 1K8AC 4BI4A 1N9RA 3TU4K 2F5TX 2XICA 1VQOA 3N5BB 2HBPA 5M9OA 1WPYA 4OB2B 4EMGA 5EG2A 1Q7YU 1N8RC 1VQLA 3DKMA 3AHUA 5GMKh 5GAN3 1M1FA 2A7YA 4DOWA 1YIJA 2CZ7B 2VV5A 3JB9D 2KDSA 1VQ8T 4QVCA 5GAN4 2V8JA 2RI3A 3V8JA 1G3TA 3M55A 3M58A 3UPUA 1VQ4A 1YITA 2OTLA 2DTHA 2G3RA 1M1KC 4N4GA 4C8QG 2YHTA 1KQ2A 2C06A 3QZ5B 5GANh 1N6AA 2EFIA 2GFAA 2KSSA 4D6WA 3CCVA 3WVEB 4ME7A 1G3WA 5GMKi 3CCJT 1VQ9T 3JB9J 2QQSA 5J39A 4BE0A 5CIUA 1O9SA 1K73C 2KK4A 2RHYA 2PVGB 4M75D 1QVGA 2RO0A 1RL2A 4MZTA 2DAQA 2DO3A 2RK2A 4PNOA 1ZBXA 2HQXA 3V8KA 4JRPA 4M7AC 1IREB 4FSXA 3MEVA 5GANe 3S3OA 1BKBA 3URGA 1BYMA 3A8HB 4XTVA 2XK0A 4FT2A 3NTIA 3CCQT 3JCMW 1JBMA 5I21A 4J6XA 4HT8A 5FU6B 4C5GA 3RKYA 4F7UE 3HHTB 2IVWA 2HNIA 4P5NA 4XTWA 4Y91A 1UGPB 2ZPHB 2YLCA 4PJOG 3CPWA 3INZA 1VIEA 2RK1A 3QSUA 5GANd 1M1GA 2DKGA 3G4ST 5CCAA 1D3BA 3SFMA 4HKEA 5GAN5 4QQ6A 3TREA 2K5LA 2RB6A 3RKXA 3CCRA 2CS7A 3RMQA 4LD9K 3OBYA 3CCEA 3L2UA 2QA4A 2R5AA 1YHQT 3OYMA 3I56A 1VQ6A 1OYXA 3ME9A 1MHNA 5GANj 3M4YA 3FLGA 3QPHA 4X9DA 2GFUA 3G6ET 4E7KA 1VQKA 3OYCA 4E7HA 3MO8A 1Q7YC 2X4WA 2KAFA 2QXFA 5LJ5g 2Y4XA 1GXIE 4B9XA 4DQ2A 3CCUA 3FB9A 5HK0A 5DLOA 3QJYA 4JRQA 3CMAT 3Q1JA 2R58A 4IUTA 1VIFA 1M9SA 2Y90A 2ZPGB 4MZPA 5FU7C 5LJ3g 1QVFS 5GAOm 4J6WA 3F70A 4LDUA 3MEAA 3QG1A 3VV0A 3CCLT 2MF2A 2BIVA 4A4FA 1YI2A 4Y28E 2KQWA 4C8QD 4ZN3A 4N4HA 1M1KU 2EQKA 4OB0B 2DK3A 3C95A 3QZ9B 4A4HA 1ZQ1A 2I2LA 3HFOA 1B34B 4M78G 2HQEA 4O6JA 4QQDA 4BI3A 4M77C 4C92C 4C5HA 5C0MA 2YLBA 3CBPA 4R56A 1QW1A 1PSEA 1W2BS 4XAXB 5I2SA 4XQ3A 4YTLA 2VC8A 4Z02A 5GAMg 4OVAA 3WXMB 1BIAA 2XIDA 2ZPEB 4ZTFA 4GLKA 1S72A 4DOVA 5GAN7 3OYLA 4C92E 4IUUA 4JRKA 4M77E 3QJ6A 1NPPA 2VGMA 4XU1A 3GP8A 3OYKA 3I55A 3CC7A 3JCMg 2LCCA 4M7AF 5J3BA 3QUIA 2X4YA 2XDDA 2M1HA 3L2QA 4M7DD 4C0GA 4BY6C 1JJ2S 5GAOr 2ZZDA 4J7FA 4M7AA 2PVOB 1M5Q1 4PJOD 1UGQB 5FROA 4MDWA 5LJ3e 2K2VA 5CKFA 2LTOA 1FX7A 4ZGEB 2QEXT 4FM4B 4L6V5 2DXTA 2LT4A 2R5MA 4JDSA 3RESA 5LJ5d 5GAMh 2VXEA 1V29B 4ATOA 1U1SA 2E12A 3X26B 3X28B 2OAUA 1H641 3QIIA 4M75B 5DLQE 3OW2S 4J8OA 2E64A 2K57A 4XK8E 1VQNA 3J81E 4HCCA 5LJ3d 2E41A 1VQ5A 3GLXA 2ZGWA 4M78B 3VKIA 1BI0A 3CD6A 5LJ5j 3CC4T 1RI0A 1I8FA 4EMKB 2RJDA 2QQ9A 2EIFA 2DJZA 2VUBA 1K9MC 2DPPB 5GAMe 3RMSA 4J6YA 3FC3A 3VJPA 2JNGA 5LJ3j 3L1AA 3OS5A 2LQ8A 1WNLA 2L3RA 4QVZA 1KHIA 1QVPA 3V8LA 1SSFA 1LJOA 2RM4A 4XU3A 3OYGA 3JCMe 3OYHA 3H8ZA 2MAMA 2MMPA 3HRSA 3QBYA 5GAOn 5A2QE 2DEQA 4XU2A 2BUDA 2EYQA 1U8RA 3OYDA 4QW2A 2F69A 2RI5A 5IN1A 3CMET 3VYHB 3MCAB 2RHIA 5D6XA 5GMKe 4EPCA 4ZTJA 3SB2A 4LDWA 5FU6C 3FIFA 4F7UG 2K3XA 3UWNA 1LOJA 4M78D 2LCLA 3JCMd 1QVFA 2K5IA 1N9SA 3JB9H 2RJFA 3JCMX 2VYTA 1Q81U 4BACA 4Q5WA 5CQXA 2L89A 4LDXA 4C92F 2M9UA 2BKDN 4M77F 3JSCA 3L2RA 4NS5A 1G3YA 4M7DG 1BI3A 5KE2A 1YJ9T 1UGRB 3VYGA 1FXXA 3JCMc 2EJGA 3ZEHA 3L2ZA 3OYJA 4B9WA 1X75C 4M7AE 2CZ0B 4C92A 3DLLA 2DXBA 2QQBA 4M77A 2MI6A 5CKDA 3SWNB 1YJWT 2DZCA 3MEUA 2HD0A 3S3NA 3WVDB 1XNIA 5GMKj 2OTJT 3J80E 3E19A 1UB4A 4OMFB 4IKFA 1W2BA 5FRNA 4VUBA 4E7LA 4X9CA 1MGQA 2H3JA 5CQYA 4A4GA 2K4YA 2QI2A 4C8QB 4V2SA 3L42A 3MP1A 4E7IA 1PSFA 1Y7XA 4UC4A 3PTAA 1QP3A 2DZ9A 3PMIA 2WSFE 3T9NA 2EWNA 3PNWC 3HRTA 5CKEA 2O4XB 3M54A 4LDVA 4C0ZA 3BDLA 1VQMT 4BI8B 1JJ2A 3LH0A 3QO3A 2JZ2A 4N0AC 5A0DA 3OS2A 3OYEA 2PU9B 2LC4A 4JS5A 4E7JA 5LL6S 1VQ7T 4J5YA 2RJEA 4FT4A 4F7UB 5KCHA 2VGNA 1NE8A 4RG2A 1KHCA 3HRUA 5J26A 3CCMT 2Y4YA 3X25B 4JLIA 4EMKA 3TEEA 5C6SA 4XTYA 2RA2A 1I4K1 3EFRA 1K9MU 2PQWA 2L8DA 3PIPA 2CYZB 2E70A 5CKHA 1VQ8A 3C12A 3M57A 2IG0A 4M7DB 2X35A 1YJNT 2QTXA 3OW2A 3MP8A 2RI2A 4RG8A 5KCOA 2P4TA 4OGEA 1VQOT 4XU0A 4JLGA 4PJOB 3SDZA 2RHUA 3RIRA 1VQLT 3MEWA 4M77G 3CCJA 4BE2A 1VQ9A 1OZ2A 2MWPA 2V8IA 3CMEA 3HSBA 2E5QA 2L5QA 3PIOA 1YIJT 3GNFB 1Y07A 1WJSA 3OQ5A 1Q81C 3OYBA 1BIBA 3GNGA 1VQPT 5D6WA 4O5VA 5CO7A 4DA4A 2OTLT 1YITT 3OB9A 4QQGA 5CR2A 1M8VA 2GF7A 3H6ZA 1TH7A 4BB7A 1Q82U 2JOYA 3QXEB 2FB7A 2KMTA 4RKUE 1R8OB 3G71T 3CCVT 1Y96B 2CKKA 1Y71A 4PLLA 2LVMA 2XKOC 3CCST 2XI9A 3CCQA 2PUOB 3VUZA 3LWHA 4PLIA 2JVVA 5GANf 3OYNA 2DVEA 4M75C 4ZGDB 1NZ9A 3QHSA 2QQAA 4E47A 3QKJA 4M78C 3G4SA 2OTJA 3OS1A 2QDYB 2EQJA 2XDBA 1JRIA 3P8DA 3M9QA 3X20B 2DXUA 3HFNA 2VXFA 3TCJA 2LDMA 4EMKC 4BDZA 1BI2A 3PFSA 4C8QA 1AHJB 4M75E 1UEBA 2WSEE 1M90C 3HP9A 1YHQA 3DLMA 2M0OA 1KG1A 2P0PA 1O75A 4MZMA 3G6EA 2O4XA 2LT1A 4A4KA 1XOVA 5DY9A 4IUVA 3O8VA 3OBWA 4FL6A 2GCXA 1D3BB 5CKBA 4C0DB 2HAXA 2V8KA 1XQHA 2PVDB 2P0QA 3BFMA 3CCRT 2EAYA 4L5GA 3CBMA 3CBOA 3M4GA 2K3YA 3LGFA 3CCET 2DD5A 1KQ1A 4X34A 2QA4T 3V7RA 3I56T 3CMAA 3ER0A 4NOYA 4PL6A 4C5EA 4KULA 3META 5CK9A 5GAN8 3NTKA 3A8LB 1HK9A 3JCMJ 1KC8C 3X24B 2M16A 3HKSA 4N0AA 5I2MA 3M53A 2K5FA 1OZ3A 4ZGJB 5GAN6 5HKCA 3CCLA 3GF5A 4KBMB 3CC2T 5FLXE 4KT0E 3S6WA 3CCUT 3BY7A 4EMHA 4RMOA 4PJOA 5GAMd 4OGCA 4JJNK 1KQSS 5IAYA 2JTMA 3ZFJA 4C92D 2CGHA 4M77D 5L8RE 4JS4A 4M7AG 1B34A 1WGSA 1ZHIA 4OB1B 1YBYA 4OF1A 5GMKl 5GAOq 3C4SA 1Q82C 1N27A 2LRQA 2ZPBB 3SWNC 3V7CA 1UGSB 5AYFA 2DTOA 2EQMA 4LDYA 5GAMj 3LWIA 2JN0A 3LGLA 1YI2T 4J7IA 2X4JA 1BI1A 3QDRB 2RHXA 4C8QC 3JB9F 1Y96A 3G71A 3DB3A 3PT9A 2D6FA 2D9TA 3A5ZB 2E6ZA 4OP0A 3BDUA 4BUGA 4ZN1A 3OY9A 3BW1A 2XU8A 5GAOp 1H3ZA 3RKWA 3P8BB 3QYGB 3CCSA 1HXDA 3JB9I 1JB0E 2PUKB 3FRNA 2AHJB 4IUPA 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZM A;  4MZT A;  4VUB A;  2MF2 A;  5CKH A;  5CQY A;  3HPW A;  5CKB A;  4OF1 A;  3JRZ A;  1M1F A;  2VUB A;  1VUB A;  5HK3 A;  5CQX A;  5CKE A;  3JSC A;  5CKF A;  3NFC A;  5CK9 A;  4ELY C;  2C06 A;  1X75 C;  1NE8 A;  5HK0 A;  5DLO A;  3TCJ A;  5CO7 A;  4ME7 A;  5HKC A;  5CKD A;  3VUB A;  5CR2 A;  4MDX A;  3G7Z A;  4ELZ C;  4MZP A;  5CCA A;  4HKE A;  1UB4 A;  2KMT A; 
#chains in the Genus database with same CATH topology
 1KD1 U;  1FWZ A;  5KYY A;  2K3B A;  2B86 A;  2ZPI B;  2FVU A;  5LJ5 f;  2DER A;  2B8A A;  3I55 T;  1WLP B;  2KXD A;  1M90 U;  4J83 A;  4M78 A;  3RUX A;  2ZCF B;  3QDF A;  1SRM A;  2OX7 A;  4TVR A;  2LNV A;  2FL7 A;  2RH2 A;  1T3S A;  4XTZ A;  1FMK A;  3OSS C;  2DEU A;  5FRM A;  1OI1 A;  1JU5 C;  3HPW A;  1G3S A;  3UDC A;  1YJN Q;  2DL3 A;  2COW A;  4ZNX A;  5GAM f;  1SF9 A;  4C5I A;  1AVZ C;  1U5S A;  1UTI A;  3OYI A;  2CZ6 B;  4M7A D;  2KR3 A;  1N8R U;  2OTL Q;  4XTU A;  1PD0 A;  1XJW B;  1YIT Q;  4EDU A;  3IQL A;  3VUB A;  4NL3 A;  2CP0 A;  3TVT A;  3KBG A;  4Z89 A;  3JCM Q;  2KY9 A;  3M5A A;  2RJC A;  3EFS A;  1B3Q A;  4OB3 B;  4NL2 A;  5FU7 B;  1WYX A;  2A0F B;  2FHD A;  2L3S A;  1FMV A;  2ZAE A;  1TUD A;  3HTR A;  3EGX B;  2HCK A;  5GAN 2;  3H0F A;  4LN2 A;  5LJ3 h;  1UHC A;  2FYK A;  2JTF A;  1BK2 A;  4MML A;  4M77 B;  1YCS B;  4FYV B;  4CRI A;  5KH6 A;  3P8H A;  2VAS A;  1K8A R;  4HCZ A;  1VQ7 A;  2QGG A;  4IIO A;  3E1S A;  3CCM A;  2QA4 Q;  1VQ6 Q;  3JCM P;  2DXC A;  1IHV A;  2DL4 A;  1I81 A;  1HYO A;  4M7D A;  1D1B A;  1NBE B;  3FDR A;  3MP6 A;  5FWC A;  2WSC E;  3JCM h;  1K8A C;  4BI4 A;  5M9O A;  1VQL A;  3AHU A;  5GMK h;  1M1F A;  5HCK A;  4FYW B;  2CT3 A;  3JB9 D;  1VQ8 T;  1RAG B;  2V8J A;  2RI3 A;  1D1C A;  1G3T A;  2QTV A;  3UPU A;  2DTH A;  1MMA A;  2Z0W A;  4RTV A;  2YHT A;  5GAN h;  1IHW A;  5FW9 A;  2L0A A;  2GFA A;  1G3W A;  1O9S A;  4J9F A;  1WHL A;  4Z8A A;  2HDA A;  2DO3 A;  4M7A C;  2RQU A;  9ATC B;  4E7S A;  3ULR B;  3I55 Q;  4XTV A;  2PTK A;  4FT2 A;  3JCM W;  5KYX A;  2GTO A;  2RK1 A;  1M1G A;  3EG9 B;  2QK0 A;  3RKX A;  2HBW A;  3CCR A;  2CS7 A;  3RMQ A;  2AIR B;  3OBY A;  3L2U A;  2R5A A;  1YHQ T;  5KYW A;  1MHN A;  4E7K A;  3OYC A;  4E7H A;  1KJW A;  2J6F A;  2CH4 A;  4JPB W;  2JS2 A;  2DVJ A;  3Q1J A;  4AFQ C;  4MZP A;  5LJ3 g;  2JT4 A;  3KFV A;  3SEM A;  2SEM A;  1E6G A;  4A4F A;  1UFF A;  1YI2 A;  1BBZ A;  4ZN3 A;  3M0U A;  4HXJ A;  2VVK A;  4CC2 A;  1ABO A;  3C95 A;  2DYI A;  1ZQ1 A;  4BI3 A;  4C92 C;  3CBP A;  4R56 A;  1W2B S;  4Z02 A;  2VC8 A;  4ZTF A;  4OVA A;  2XID A;  3OYL A;  4C92 E;  1Z9Q A;  3CC7 A;  3JCM g;  2GQI A;  4M7A F;  3QUI A;  2XDD A;  3L2Q A;  2VKN A;  5GAO r;  1VA7 A;  2I0N A;  2YWW A;  5FRO A;  2K2V A;  5CKF A;  3SHW A;  4J9B A;  2X3W D;  3VS4 A;  3EG0 A;  1FX7 A;  1MNE A;  2OAW A;  2F2W A;  4ZGE B;  2H8H A;  1WHH A;  2DXT A;  4JDS A;  5LJ5 d;  3NGP A;  3RES A;  1TUC A;  2MPX C;  1SKU B;  2O2O A;  1BCM A;  3X28 B;  2HMA A;  1G2B A;  4KH1 B;  4HCC A;  3GLX A;  1SHG A;  1IGQ A;  1QVF P;  1BI0 A;  2DYB A;  2RNA A;  1PCX A;  3M0R A;  4WCI A;  2EIF A;  2DPP B;  3VS5 A;  1VQ8 Q;  3L1A A;  2ROL A;  3QBY A;  2MMP A;  5A2Q E;  4FW2 A;  2BUD A;  3OYD A;  3CME T;  3I35 A;  3MCA B;  4ZTJ A;  5FU6 C;  3UWN A;  4M78 D;  2GTJ A;  2K5I A;  1ACM B;  1B7T A;  1G83 A;  3JCM X;  4BAC A;  1JJ2 P;  5CQX A;  2KYB A;  4C92 F;  2M9U A;  3L2R A;  4NS5 A;  1BI3 A;  3VYG A;  3JCM c;  3L2Z A;  4M77 A;  1R0C B;  3EH1 A;  2KT8 A;  3SWN B;  1YJW T;  1CKB A;  3VS6 A;  2DZC A;  3J80 E;  4GLM A;  4OMF B;  1W2B A;  5FRN A;  4X9C A;  5CQY A;  4V2S A;  1YHQ Q;  1RAC B;  5IHN A;  4F14 A;  1QWF A;  5CKE A;  2DRM A;  4BI8 B;  3LH0 A;  3OYE A;  2LC4 A;  4J5Y A;  4F7U B;  4FT4 A;  5KCH A;  2W0Z A;  1KHC A;  4KGZ B;  4JLI A;  4EMK A;  3TEE A;  3EGU A;  2RA2 A;  3PIP A;  2E70 A;  2K7A A;  2IG0 A;  2X35 A;  2MK5 A;  2COZ A;  2MCN A;  1WHK A;  2YXY A;  3MEW A;  4M77 G;  3CCJ A;  4BE2 A;  3CME A;  2L5Q A;  1Q81 C;  2YRD A;  1RI9 A;  2E3I A;  1X2Q A;  1TH7 A;  2KMT A;  3CCV T;  2MYS A;  2YRC A;  3G71 Q;  1Y71 A;  1WIE A;  2RQV A;  2LVM A;  2XKO C;  2XI9 A;  1TXQ A;  4ESR A;  1SPK A;  3CCS Q;  3UA7 A;  5KYY B;  3VS7 A;  4M78 C;  3OS1 A;  3M9Q A;  2KNB B;  5ECA A;  4CC7 A;  3TCJ A;  2LDM A;  3EG3 A;  1ARK A;  4C8Q A;  1AHJ B;  3HP9 A;  4J9D A;  3DLM A;  4OMP A;  1KC8 R;  2M0O A;  3NHN A;  3G6E A;  2DX1 A;  1QLY A;  1RAE B;  4IUV A;  2LQN A;  1K76 A;  3OBW A;  4FL6 A;  4C0D B;  1XQH A;  4PK4 A;  4RTW A;  2KXC A;  3CBO A;  3LGF A;  5IXF A;  1KQ1 A;  4X34 A;  3V7R A;  3I56 T;  2AT1 B;  1WXT A;  4PL6 A;  4KUL A;  1HK9 A;  1KC8 C;  1RAH B;  4ZGJ B;  3GF5 A;  3CC2 T;  2A37 A;  2CP5 A;  5FLX E;  1PRM C;  3BY7 A;  4PJO A;  4OGC A;  4OMN A;  3MJX A;  3NPF A;  1K73 R;  4M7A G;  1WGS A;  3VRY A;  5GAO q;  2EQM A;  5GAM j;  3LGL A;  2X4J A;  1I07 A;  1FMW A;  3DB3 A;  1E6H A;  2D6F A;  2D9T A;  4ZN1 A;  1MND A;  2XU8 A;  1YJW Q;  2LZ6 B;  2PUK B;  4LE9 A;  2EJF A;  1VQP Q;  4PJM A;  5CAI A;  2XHC A;  3L2V A;  2PNI A;  3E9G A;  2CP6 A;  2CT4 A;  2QEX A;  4A4E A;  5HK3 A;  3JCM V;  1WI7 A;  3L2W A;  2D0N A;  4M78 F;  2NYS A;  1HJD A;  4M7D C;  1GCP A;  1MV3 A;  1ZSG A;  4RTT A;  3PMT A;  1Q7Y R;  1WJR A;  3E9F A;  4X1V A;  2EQU A;  3CC4 A;  2RD1 A;  3GBQ A;  4M7D E;  1WXB A;  2V1Q A;  2E10 A;  3A8M B;  4ORZ A;  1KQS P;  3BE3 A;  1KC8 U;  1X6O A;  5KYU B;  2RMO A;  4PKC C;  2DL5 A;  3QYH B;  4C92 G;  2MWO A;  3CC2 A;  4WF2 A;  3OYF A;  4II1 A;  5AT1 B;  3JB9 G;  1H92 A;  4ELZ C;  1VQ4 Q;  2EKO A;  1NLP C;  3EG1 A;  2E6N A;  3CCV Q;  4KGX B;  5DM7 R;  4LNP A;  1WJQ A;  4FU6 A;  1YJ9 A;  1KD1 C;  1G5V A;  3OYA A;  3C94 A;  3SWN A;  5LJ5 h;  3ASK A;  5D7U A;  3CPF A;  1K73 U;  1V76 A;  2QQR A;  3CXC P;  1X6G A;  1K0S A;  3C0C A;  4FIB A;  4BD3 A;  1T3L A;  3UT1 A;  3PGG A;  1SSH A;  3CEY A;  4CI0 C;  2M02 A;  1I1J A;  2NLU A;  1P92 A;  1I0C A;  1JXO A;  2BZY A;  4F7U A;  2WAC A;  2LQK A;  3A8G B;  3PVL A;  1QKW A;  4A63 B;  4M7D F;  2DBK A;  1VQ6 T;  3I56 Q;  4ELY C;  2DD4 A;  1M2O A;  1WHG A;  1VQK Q;  2EGE A;  4BY6 B;  2RHZ A;  1QVG P;  3A1P A;  1YJN A;  4R55 A;  4J9G A;  2F5T X;  1GFD A;  2XIC A;  1H8K A;  1Q7Y U;  4EMG A;  1N8R C;  1JO8 A;  2A7Y A;  2CZ7 B;  4JZ3 A;  3V8J A;  2OTL A;  1YIT A;  2O31 A;  4N4G A;  3CPW P;  1PG5 B;  2EFI A;  2KSS A;  4D6W A;  3WVE B;  1VQ9 T;  3JB9 J;  5J39 A;  4BE0 A;  1W1F A;  2E3H A;  2KK4 A;  4M75 D;  2PVG B;  1UG1 A;  1AT1 B;  2DAQ A;  2RK2 A;  1ZBX A;  3V8K A;  5GAN e;  1BKB A;  2FPD A;  1ZSZ B;  1BCO A;  3A8H B;  3NTI A;  3CCQ T;  1JBM A;  5I21 A;  4C5G A;  3HHT B;  2HNI A;  4XTW A;  2ZPH B;  2YLC A;  4F04 B;  4RTX A;  1VIE A;  2HL3 A;  2COY A;  3G4S T;  4HKE A;  1PRL C;  3TRE A;  1PM3 A;  2X3X D;  4LD9 K;  1AZE A;  2QA4 A;  1VQ6 A;  4Z88 A;  1GBR A;  5GAN j;  3M4Y A;  3QPH A;  4X9D A;  2FZG B;  1WHM A;  1LPL A;  3MO8 A;  2X4W A;  3REB B;  2QXF A;  5LJ5 g;  2Y4X A;  2QGF B;  4B9X A;  4DQ2 A;  5HK0 A;  3QJY A;  2CP2 A;  3TSZ A;  2KRN A;  2Y90 A;  1GCQ A;  5FU7 C;  1QVF S;  5GAO m;  4J6W A;  3F70 A;  3MEA A;  2JTE A;  3CCL T;  1OOT A;  2BIV A;  2EKH A;  2NUZ A;  4C8Q D;  4E6R A;  4J9C A;  1RLP C;  4K11 A;  1TOV A;  4M78 G;  5C0M A;  4M77 C;  4FCY A;  1U06 A;  3VS2 A;  3M0S A;  4XQ3 A;  5GAM g;  2FRW A;  1MMD A;  3WXM B;  2CSI A;  4GLK A;  5GAN 7;  1SG5 A;  4M77 E;  1NPP A;  3QWY A;  3OYK A;  3I55 A;  2M1H A;  1AWO A;  1JJ2 S;  3RNJ A;  1HSQ A;  2ZZD A;  2M51 A;  4J7F A;  4PJO D;  1UGQ B;  4FM4 B;  1UJY A;  2E5K A;  4HVU A;  2VXE A;  2E12 A;  3X26 B;  1H64 1;  2FEI A;  4M75 B;  5DLQ E;  1VYV A;  3J81 E;  5KYU A;  4FW1 A;  1IO6 A;  1RI0 A;  2BZX A;  4EMK B;  2L2P A;  1Y0M A;  3VJP A;  2AZS A;  1RUW A;  2LQ8 A;  3V8L A;  3EFO B;  4QVZ A;  2RM4 A;  1ABQ A;  1K0X A;  2MAM A;  1J3T A;  6AT1 B;  4XU2 A;  5D6X A;  2RHI A;  1VQ9 Q;  1R0B G;  4KGV B;  4LDW A;  3FIF A;  2K3X A;  1QVF A;  1N9S A;  4OMO A;  3EHQ A;  2L89 A;  3TQ7 P;  4LDX A;  4M77 F;  3JSC A;  4M7D G;  5KE2 A;  1FXX A;  3CCQ Q;  1EX4 A;  1CSK A;  3ZEH A;  4M7A E;  1X75 C;  2CZ0 B;  2DXB A;  2QQB A;  2MI6 A;  3MEU A;  3S3N A;  4AT1 B;  2DFU A;  3E19 A;  3G4S Q;  1UB4 A;  4VUB A;  2QI2 A;  4C8Q B;  3L42 A;  1Y7X A;  3PTA A;  1QP3 A;  2DE0 X;  2WSF E;  2EWN A;  3PNW C;  3HRT A;  2ROT A;  4C0Z A;  1VQM T;  4RTU A;  1JJ2 A;  4JS5 A;  4E7J A;  2LCS A;  4RG2 A;  2Y4Y A;  2EVR A;  2CSQ A;  1SEM A;  2HL5 C;  1VQ8 A;  2CYZ B;  5CKH A;  3M57 A;  3CCL Q;  1A0N B;  4RG8 A;  1VQO T;  4PJO B;  1N5Z A;  1OZ2 A;  2W10 A;  1YIJ T;  1M2V B;  3OYB A;  1BIB A;  2ED0 A;  4PJJ A;  5CR2 A;  2GF7 A;  3H6Z A;  1UEC A;  3QXE B;  2FB7 A;  3H41 A;  3G71 T;  1ZSZ A;  1WXU A;  3CCS T;  1WX6 A;  2DJQ A;  4F16 A;  2JVV A;  5GAN f;  2DVE A;  2XDB A;  2EQJ A;  2RQT A;  3X20 B;  2DXU A;  2VXF A;  3PFS A;  5IHK A;  1UEB A;  2WSE E;  1YHQ A;  3EGD A;  2RN8 A;  5IH2 A;  1KG1 A;  4A4K A;  4QT7 A;  4E2F B;  2F2X A;  2GCX A;  1TU0 B;  1OX9 A;  3BFM A;  3M4G A;  2K3Y A;  1U3O A;  3U23 A;  3CCE T;  3ER0 A;  2FZK B;  3A8L B;  2GGR A;  3X24 B;  2PZ1 A;  5I2M A;  3M53 A;  5HKC A;  1I5O B;  2DBM A;  4KT0 E;  1Y57 A;  3S6W A;  3CCU T;  4RMO A;  4EMH A;  1KIK A;  5GAM d;  1ZLM A;  1KQS S;  1H3H A;  2JTM A;  1SRL A;  5L8R E;  4JS4 A;  1RAD B;  1UDL A;  1AWJ A;  3C4S A;  1N27 A;  2ZPB B;  3SWN C;  4OML A;  2C0T A;  4J9H A;  1UHF A;  3M0P A;  1Y96 A;  3G71 A;  3JB9 F;  3A5Z B;  1NJI R;  4OP0 A;  3OY9 A;  1H3Z A;  5GAO p;  3CCS A;  1HXD A;  1GL5 A;  1VQP T;  1ZUK A;  4HT9 A;  4HVV A;  1S72 T;  2KRM A;  2D0Q B;  1C0M A;  1OQK A;  4IUR A;  2EGA A;  1NJI C;  3EAE A;  3CXC S;  2SRC A;  4M75 A;  1VQM Q;  5HY6 A;  2LP5 A;  2FPF A;  2E1H A;  3REA B;  2JM9 A;  2D8H A;  1LNX A;  2NUP B;  1X43 A;  1Q86 U;  3JCM b;  2E65 A;  3KUF A;  1VQN T;  3EFO A;  1VQ5 T;  2O9S A;  2CP7 A;  2A08 A;  4RCC A;  3FEO A;  4A53 A;  3CD6 T;  1VQO Q;  5CVI A;  1RAB B;  1V1C A;  1YIJ Q;  1QVG S;  1NPR A;  3S3M A;  1VQ4 T;  2LNH B;  2ED1 A;  4N4I A;  2OJ2 A;  4PJN A;  1WQW A;  3D7S B;  2JUF A;  5I11 A;  3RBB B;  3GOX A;  2ZPF B;  3MHX A;  2ABL A;  3M59 A;  4MMK A;  2CH4 W;  4Y92 A;  4IIM A;  3FJP A;  4M75 G;  1VUB A;  5IT9 E;  4JRI A;  1KQS A;  3CPW S;  1YJW A;  3LLR A;  4JUV A;  1VQP A;  2MOX A;  2X4X A;  4C0D C;  5GJW B;  2DF6 A;  4L59 A;  4KUI A;  4AG1 C;  2GQV A;  2IIM A;  4M78 E;  4F7U F;  3VS0 A;  2V1R A;  4A54 A;  5LJ5 e;  2X51 A;  1IZ6 A;  1NJI U;  3OYY A;  1WA7 A;  1DJ7 B;  3I5R A;  5GMK m;  3VU3 C;  4KUD K;  1YCY A;  1M4Z A;  1XTD A;  4C0F A;  3CCE Q;  2JXB A;  5GAO l;  1TS9 A;  1VQK T;  3OA6 A;  4HCB A;  1D1A A;  3CXC A;  3LW5 E;  3OS0 A;  2DIL A;  3LYI A;  2YUN A;  1NM7 A;  1BB9 A;  3CCU Q;  1S1N A;  3N5B B;  1BU1 A;  1WPY A;  1PWT A;  2ESW A;  5GAN 3;  1M2V A;  1OPL A;  4KH0 B;  2VV5 A;  1RAI B;  4QVC A;  3M55 A;  1VQ4 A;  4C8Q G;  1UE9 A;  2C06 A;  3QZ5 B;  5IXB A;  3CCV A;  4DBH A;  2QQS A;  1OV3 A;  5CIU A;  1K73 C;  3H0I A;  3E2U A;  1QVG A;  1RL2 A;  1AOJ A;  2HQX A;  4FSS A;  3THK A;  4JRP A;  1S72 Q;  1M30 A;  1IRE B;  4FSX A;  3MEV A;  1AZG B;  3RKY A;  2IVW A;  2FRY A;  1M27 C;  4PJO G;  2BTT A;  3CPW A;  3QSU A;  3I5S A;  5GAN d;  5CCA A;  3SFM A;  5GAN 5;  4OMQ A;  4LUE A;  2K2M A;  1IGU A;  2HKN A;  4J9E A;  2JW4 A;  1ZUY A;  2KGT A;  3OYM A;  3I56 A;  1OYX A;  3ME9 A;  2C0O A;  3FLG A;  1VQN Q;  3R6N A;  1ZBJ A;  1PKT A;  2KT1 A;  1VQK A;  1VQ5 Q;  1KK7 A;  1Q7Y C;  2KAF A;  3CD6 Q;  1GXI E;  2K6D A;  3FB9 A;  5DLO A;  4JRQ A;  3CMA T;  2FPE A;  1NLO C;  1M3C A;  2R58 A;  4IUT A;  1VIF A;  1M9S A;  1E7O A;  2ZPG B;  4EIK A;  1Z9Z A;  3UA6 A;  2DM1 A;  4Y28 E;  2KQW A;  4N4H A;  2EQK A;  2DK3 A;  2CUB A;  3QZ9 B;  4A4H A;  3EHR A;  1OX8 A;  2NUT B;  1NG2 A;  4C5H A;  2YLB A;  2HKQ B;  1PSE A;  4XAX B;  4YTL A;  2L3P A;  4RTZ A;  4JRK A;  1IXD A;  3QJ6 A;  4XU1 A;  3GP8 A;  2LCC A;  4DEX A;  3PE0 A;  3CQT A;  2QAS A;  4BY6 C;  3MKD A;  5L23 A;  1YFN A;  1M5Q 1;  2NUP A;  5LJ3 e;  4MDW A;  2LTO A;  3M0Q A;  1X6B A;  1AWX A;  5GAM h;  1V29 B;  2OAU A;  5KYN A;  3QII A;  4J8O A;  2E64 A;  2K57 A;  4XK8 E;  2E41 A;  2ZGW A;  1UGV A;  1RAF B;  1TSF A;  3O5Z A;  2ENM A;  1PHT A;  2QQ9 A;  2VUB A;  2DJZ A;  4WTO B;  3FC3 A;  4J6Y A;  2JNG A;  5LJ3 j;  3OS5 A;  1Q82 R;  1WNL A;  1QVP A;  1SSF A;  1LJO A;  3OYG A;  3JCM e;  4HVW A;  4QW2 A;  2F69 A;  2RI5 A;  3VYH B;  5GMK e;  1ZSZ C;  4EPC A;  3H0H A;  4F7U G;  4AFU C;  2BE7 D;  2BZ8 A;  2LCL A;  4GBQ A;  3JB9 H;  2AKK A;  2RJF A;  2VYT A;  4Q5W A;  2QDL A;  3TSW A;  2BKD N;  4PJL A;  1AWW A;  2EJG A;  3OYJ A;  2BE9 B;  2EW3 A;  1ZUU A;  2HD0 A;  5GMK j;  1XNI A;  1GBQ A;  3OW2 P;  4E7L A;  1MGQ A;  2H3J A;  2K4Y A;  4E7I A;  3G1J A;  3EGD B;  3PMI A;  4PFZ A;  3T9N A;  3FJ5 A;  4LDV A;  3QO3 A;  2LQW A;  1NEB A;  5LL6 S;  1VQ7 T;  2RJE A;  5J26 A;  3CCM T;  1M8M A;  4E7Z A;  2IPO B;  3X25 B;  3CMA Q;  2KRS A;  1ZA1 B;  5GJV B;  2L8D A;  2O9V A;  2JJ9 A;  2QTX A;  4LXC A;  8AT1 B;  4XU0 A;  3SDZ A;  1VQL T;  1VQ9 A;  2MWP A;  1OEB A;  3PIO A;  1KSW A;  3GNF B;  1Y07 A;  1W70 A;  5D6W A;  1PKS A;  2FG0 A;  5CO7 A;  4DA4 A;  1M8V A;  1JXM A;  1M3B A;  2YDL A;  4BB7 A;  2HEQ A;  2F1L A;  1Q82 U;  4RKU E;  1Y96 B;  4PLL A;  3CCQ A;  3LWH A;  4PLI A;  3OYN A;  4M75 C;  4ZGD B;  3H9N A;  1NZ9 A;  3QHS A;  2QQA A;  3VS1 A;  4E47 A;  3G4S A;  2RF0 A;  2QDY B;  4EMK C;  4BDZ A;  4M75 E;  1D0Z A;  2ATC B;  2O4X A;  2LT1 A;  5DY9 A;  4KRT A;  4AFZ C;  3O8V A;  5CKB A;  1D3B B;  2HAX A;  2P4R A;  2V8K A;  2PVD B;  2P0Q A;  1YP5 A;  3CCR T;  4L5G A;  1QMC A;  1QCO A;  3EH2 A;  2DD5 A;  1D0Y A;  4C5E A;  3MET A;  3NTK A;  3JCM J;  4N0A A;  2M16 A;  2K5F A;  1OZ3 A;  3CCL A;  3A98 A;  2D1X A;  4KBM B;  2HQH A;  1AD5 A;  5IAY A;  3ZFJ A;  4C92 D;  1MMG A;  3M0T A;  1ZHI A;  4OB1 B;  1GRI A;  1YBY A;  2A36 A;  2NUT A;  2LRQ A;  4HCK A;  2ECZ A;  4LDY A;  3LWI A;  1YI2 T;  2GBQ A;  4J7I A;  2A28 A;  3QDR B;  1D0X A;  2CUD A;  4C8Q C;  4BUG A;  3BW1 A;  2VWF A;  3P8B B;  2YSQ A;  3FRN A;  4IUP A;  5GMK l;  4C8Q E;  3JRZ A;  4M75 F;  3CC7 T;  1EIF A;  4RCB A;  1WQ7 A;  1QCF A;  3V7S A;  5LJ3 f;  3J7A F;  4DBQ A;  1PC0 A;  4M7A B;  1VQ7 Q;  2R57 A;  1HD3 A;  4PJO C;  4MDX A;  4XTX A;  3CCM Q;  4F17 A;  2CZ1 B;  3OSV A;  3GPL A;  4QKU A;  4BDY A;  1R77 A;  2CDT A;  2EBP A;  2DET A;  2LJ0 A;  4PJO E;  2O01 E;  2P0K A;  1FYN A;  2XDP A;  2KEA A;  1TWB A;  1VQL Q;  5KE3 A;  1QP2 A;  4CC4 B;  1T0J A;  2D8J A;  3JAM E;  1K8A U;  1ZX6 A;  2DTI A;  1QKX A;  3A8O B;  2J7I A;  3JCM f;  3GIB A;  2H3E B;  4JJD A;  5A0G A;  3NTH A;  2XD0 A;  1OPK A;  3G7Z A;  1NYG A;  1OU8 A;  2F2V A;  2A3L A;  3ZBD A;  3KXT A;  1MUZ A;  2XG8 D;  4PFO A;  2QG9 B;  3M56 A;  2YRV A;  1QQJ A;  3SD4 A;  4IUQ A;  1W4S A;  3QWX X;  4AG2 C;  1Q86 R;  2RPN A;  4GY5 A;  4LD6 A;  4C8Q F;  4BE1 A;  4DEY A;  2KVQ G;  3OMC A;  3RER A;  2EQI A;  2F5K A;  5I22 A;  2O88 A;  3OMG A;  2DIG A;  5D6Y A;  3R6O A;  1U1T A;  4C92 B;  4JZ4 A;  1I5L A;  2DIQ A;  3AT1 B;  2EPD A;  3HL8 A;  1Q86 C;  1VQM A;  2AKL A;  2EGC A;  3LX7 A;  2J06 A;  3CCR Q;  2DL7 A;  2EYY A;  1YN8 A;  3LH5 A;  2VB6 A;  3NFC A;  2RQR A;  4HA8 A;  1YNZ A;  1X01 A;  5GAN g;  4PJO F;  2LX9 A;  5FWB A;  3NMZ C;  4QVD A;  5A0L A;  3DB4 A;  1M1K R;  2EYX A;  2EJ9 A;  1N9R A;  3TU4 K;  1VOM A;  1VQO A;  2HBP A;  4OB2 B;  4RUG A;  5EG2 A;  1WDX A;  3DKM A;  2RQW A;  7AT1 B;  4OMM A;  4DOW A;  1YIJ A;  2KDS A;  5GAN 4;  4LUD A;  3M58 A;  2G3R A;  1M1K C;  1YI2 Q;  1KQ2 A;  2YUQ A;  1N6A A;  3RR6 A;  4ME7 A;  5GMK i;  3CCJ T;  2JM8 A;  2RHY A;  2RO0 A;  4MZT A;  4PNO A;  1WFW A;  2FZC B;  2KI7 A;  1K1Z A;  3EGX A;  1MV0 B;  2CRE A;  2G6F X;  1WZO A;  3S3O A;  3URG A;  3CC7 Q;  1BYM A;  2XK0 A;  4FYX B;  4J6X A;  4HT8 A;  5FU6 B;  4F7U E;  4P5N A;  4Y91 A;  1UGP B;  3INZ A;  2DKG A;  2XMF A;  1D3B A;  4QQ6 A;  2K5L A;  1Q95 G;  2RB6 A;  1K4U S;  2X9H A;  3CCE A;  3PVQ A;  2DLP A;  1IRX A;  2GFU A;  3G6E T;  4ANJ A;  4CC3 A;  2J05 A;  3CCU A;  1QCN A;  2LJ1 A;  4M4Z A;  1Q81 R;  1JQQ A;  4LDU A;  3QG1 A;  3VV0 A;  1PNJ A;  2MF2 A;  1VYU A;  1D09 B;  1QWE A;  3JV3 A;  1M1K U;  4OB0 B;  2YT6 A;  5IHI A;  2YUO A;  2I2L A;  3HFO A;  1B34 B;  4O6J A;  2HQE A;  4QQD A;  1QW1 A;  5I2S A;  4FYY B;  4D8K A;  1S72 A;  1BIA A;  2ZPE B;  4DOV A;  1M3A A;  4RTY A;  1X69 A;  2KBT A;  4IUU A;  5EC7 A;  1VYT A;  1C6V X;  2VGM A;  5J3B A;  2X4Y A;  4M7D D;  4C0G A;  2J6O A;  1W6X A;  3MPU B;  4M7A A;  2PVO B;  2C0I A;  3EG9 A;  2JMA A;  1ZA2 B;  3VRZ A;  1K9M R;  2QEX T;  2DRK A;  4L6V 5;  4AFS C;  1G8X A;  2LT4 A;  2R5M A;  1C1A A;  1GCQ C;  1WHJ A;  4ATO A;  1U1S A;  1UUE A;  4D8D A;  1VQN A;  3OW2 S;  3EG2 A;  3RDV A;  1PD1 A;  2HSP A;  5LJ3 d;  1VQ5 A;  4M78 B;  3VKI A;  3CD6 A;  5LJ5 j;  3CC4 T;  1I8F A;  2RJD A;  1K9M C;  1OUL A;  5GAM e;  3RMS A;  1JEG A;  1CKA A;  2V26 A;  2L3R A;  1KHI A;  4XU3 A;  3OYH A;  2HZY A;  3H8Z A;  3HRS A;  5GAO n;  2DEQ A;  2EYQ A;  1U8R A;  5IN1 A;  1W2B P;  3CCJ Q;  1RAA B;  3CME Q;  2GNC A;  1NYF A;  3SB2 A;  1TG0 A;  4DBF A;  2KRO A;  1LOJ A;  3JCM d;  2P84 A;  2K9G A;  1Q81 U;  2K79 A;  1F1B B;  1MMN A;  1G3Y A;  1YJ9 T;  1UGR B;  2JMC A;  2KYM A;  4B9W A;  2YUP A;  4C92 A;  3DLL A;  1YWO A;  5CKD A;  1X27 A;  3WVD B;  2OTJ T;  4IKF A;  8ATC B;  3UF4 A;  3ZL7 C;  4A4G A;  1T0H A;  3MP1 A;  1PSF A;  4UC4 A;  2DZ9 A;  1X2K A;  3G6E Q;  2O4X B;  3M54 A;  2QAZ A;  3BDL A;  5A0D A;  2JZ2 A;  4N0A C;  3OS2 A;  2PU9 B;  1B07 A;  2VGN A;  1NE8 A;  2KE9 A;  3HRU A;  5C6S A;  2AZV A;  2DNU A;  4XTY A;  1I4K 1;  3EFR A;  1K9M U;  1TUG B;  2PQW A;  4M7D B;  4PFP A;  3C12 A;  1YJN T;  3OW2 A;  3MP8 A;  2E4H A;  2RI2 A;  5KCO A;  2P4T A;  2J6K A;  1K9A A;  1UJ0 A;  1OU9 A;  4JLG A;  4OGE A;  1KFZ A;  2RHU A;  3RIR A;  2V8I A;  3HSB A;  2E5Q A;  4AMC A;  1WJS A;  3OQ5 A;  1KD1 R;  3GNG A;  4O5V A;  2OTL T;  1YIT T;  3OB9 A;  4QQG A;  2MIO A;  1IB8 A;  2LJ3 A;  3UAT A;  2JOY A;  2M0Y A;  1R8O B;  2AK5 A;  2CKK A;  1M90 R;  2PUO B;  3VUZ A;  1AEY A;  2QYZ A;  2L3Q A;  2DL8 A;  3QKJ A;  2OTJ A;  1JRI A;  2LX7 A;  3P8D A;  1NEG A;  3HFN A;  3VS3 A;  2QEX Q;  1LVK A;  1BI2 A;  1M90 C;  5KYX B;  2P0P A;  1O75 A;  4MZM A;  1XOV A;  4JJC A;  3CC4 Q;  1YWP A;  2EAY A;  3CBM A;  2LMJ A;  2QA4 T;  1N8R R;  3CMA A;  4NOY A;  4J9I A;  5KYW B;  5CK9 A;  5GAN 8;  1EZZ B;  4R0K A;  3HKS A;  1SHF A;  1LCK A;  2EYZ A;  2NWM A;  5GAN 6;  1EFN A;  2HSE B;  3CC2 Q;  2FO0 A;  2OI3 A;  2EYW A;  4JJN K;  2CGH A;  2DMO A;  4M77 D;  1B34 A;  4OF1 A;  1Q82 C;  4B6M A;  4DBR A;  3V7C A;  1UGS B;  5AYF A;  2DTO A;  2CP3 A;  2JN0 A;  2DA9 A;  4JJB A;  1BI1 A;  2RHX A;  1RLQ C;  1TTH B;  1YJ9 Q;  3PT9 A;  2E6Z A;  3I9Q A;  3BDU A;  3RKW A;  3QYG B;  3JB9 I;  1JB0 E;  1GFC A;  2AHJ B;  2JS0 A;  2OTJ Q; 
#chains in the Genus database with same CATH homology
 4C8Q E;  5CAI A;  2XHC A;  1S72 T;  1KD1 U;  3L2V A;  1FWZ A;  4HT9 A;  3E9G A;  2ZPI B;  3JRZ A;  2FVU A;  5LJ5 f;  4M75 F;  2D0Q B;  2B8A A;  1EIF A;  3I55 T;  3CC7 T;  2QEX A;  4A4E A;  5HK3 A;  4RCB A;  3JCM V;  4IUR A;  3L2W A;  1WQ7 A;  4M78 F;  1NJI C;  3V7S A;  3EAE A;  3CXC S;  5LJ3 f;  4M75 A;  3J7A F;  1M90 U;  4M7D C;  5HY6 A;  4J83 A;  3PMT A;  4M7A B;  4M78 A;  2E1H A;  3RUX A;  2R57 A;  2ZCF B;  1LNX A;  1WJR A;  3E9F A;  4PJO C;  4MDX A;  1Q86 U;  2EQU A;  2LNV A;  2RD1 A;  4TVR A;  4XTX A;  2RH2 A;  2FL7 A;  2CZ1 B;  3JCM b;  3CC4 A;  4M7D E;  2E65 A;  3OSV A;  3OSS C;  4XTZ A;  2E10 A;  3GPL A;  5FRM A;  1OI1 A;  3KUF A;  3A8M B;  4BDY A;  3HPW A;  1VQN T;  4PJO E;  1G3S A;  2O01 E;  2P0K A;  1VQ5 T;  3UDC A;  2XDP A;  4RCC A;  3FEO A;  1X6O A;  1KC8 U;  4A53 A;  3CD6 T;  5GAM f;  5CVI A;  4PKC C;  3QYH B;  4C92 G;  2MWO A;  3CC2 A;  4C5I A;  5KE3 A;  1QP2 A;  4WF2 A;  3JAM E;  3OYF A;  1K8A U;  4II1 A;  2DTI A;  3JB9 G;  1NPR A;  3A8O B;  3JCM f;  1QVG S;  3GIB A;  3OYI A;  3S3M A;  5A0G A;  2CZ6 B;  1VQ4 T;  3NTH A;  4M7A D;  1N8R U;  3G7Z A;  4ELZ C;  2XD0 A;  2EKO A;  4XTU A;  4N4I A;  4EDU A;  3VUB A;  1WQW A;  4NL3 A;  2E6N A;  2JUF A;  3KBG A;  2A3L A;  3JCM Q;  5DM7 R;  3ZBD A;  2ZPF B;  2KY9 A;  3MHX A;  3GOX A;  3M5A A;  2RJC A;  3KXT A;  3M59 A;  4MMK A;  2XG8 D;  3EFS A;  3FJP A;  1WJQ A;  1VUB A;  3M56 A;  4FU6 A;  4M75 G;  2YRV A;  4JRI A;  4OB3 B;  5IT9 E;  1YJ9 A;  4NL2 A;  5FU7 B;  3SD4 A;  3OYA A;  3C94 A;  4IUQ A;  1KD1 C;  2FHD A;  1G5V A;  1W4S A;  3CPW S;  3SWN A;  4GY5 A;  4LD6 A;  3ASK A;  5LJ5 h;  1YJW A;  4C8Q F;  3CPF A;  1K73 U;  4BE1 A;  2QQR A;  3LLR A;  4JUV A;  5GAN 2;  1VQP A;  2X4X A;  2KVQ G;  4C0D C;  3OMC A;  4FIB A;  4BD3 A;  3RER A;  1KQS A;  2F5K A;  5LJ3 h;  4L59 A;  3OMG A;  2DIG A;  4KUI A;  3UT1 A;  3PGG A;  5D6Y A;  2FYK A;  3CEY A;  2JTF A;  2GQV A;  4CI0 C;  3R6O A;  1U1T A;  4MML A;  4M78 E;  4F7U F;  4A54 A;  4C92 B;  4M77 B;  5LJ5 e;  1I5L A;  2NLU A;  4CRI A;  2DIQ A;  5KH6 A;  3HL8 A;  1P92 A;  1IZ6 A;  1Q86 C;  3OYY A;  3P8H A;  1VQM A;  1DJ7 B;  1NJI U;  4F7U A;  3VU3 C;  2WAC A;  3LX7 A;  4HCZ A;  1YCY A;  2LQK A;  3A8G B;  5GMK m;  1VQ7 A;  4KUD K;  1M4Z A;  1XTD A;  3E1S A;  4C0F A;  4M7D F;  3CCM A;  1VQ6 T;  3NFC A;  4HA8 A;  4ELY C;  3JCM P;  2DD4 A;  5GAO l;  1VQK T;  2DXC A;  1X01 A;  5GAN g;  1I81 A;  4PJO F;  4BY6 B;  3OA6 A;  2LX9 A;  4HCB A;  4M7D A;  3FDR A;  4QVD A;  5A0L A;  2RHZ A;  3DB4 A;  3LW5 E;  3CXC A;  2EJ9 A;  3MP6 A;  3LYI A;  3OS0 A;  1YJN A;  2WSC E;  4R55 A;  3JCM h;  1K8A C;  4BI4 A;  1N9R A;  3TU4 K;  2F5T X;  2XIC A;  1VQO A;  3N5B B;  2HBP A;  5M9O A;  1WPY A;  4OB2 B;  4EMG A;  5EG2 A;  1Q7Y U;  1N8R C;  1VQL A;  3DKM A;  3AHU A;  5GMK h;  5GAN 3;  1M1F A;  2A7Y A;  4DOW A;  1YIJ A;  2CZ7 B;  2VV5 A;  3JB9 D;  2KDS A;  1VQ8 T;  4QVC A;  5GAN 4;  2V8J A;  2RI3 A;  3V8J A;  1G3T A;  3M55 A;  3M58 A;  3UPU A;  1VQ4 A;  1YIT A;  2OTL A;  2DTH A;  2G3R A;  1M1K C;  4N4G A;  4C8Q G;  2YHT A;  1KQ2 A;  2C06 A;  3QZ5 B;  5GAN h;  1N6A A;  2EFI A;  2GFA A;  2KSS A;  4D6W A;  3CCV A;  3WVE B;  4ME7 A;  1G3W A;  5GMK i;  3CCJ T;  1VQ9 T;  3JB9 J;  2QQS A;  5J39 A;  4BE0 A;  5CIU A;  1O9S A;  1K73 C;  2KK4 A;  2RHY A;  2PVG B;  4M75 D;  1QVG A;  2RO0 A;  1RL2 A;  4MZT A;  2DAQ A;  2DO3 A;  2RK2 A;  4PNO A;  1ZBX A;  2HQX A;  3V8K A;  4JRP A;  4M7A C;  1IRE B;  4FSX A;  3MEV A;  5GAN e;  3S3O A;  1BKB A;  3URG A;  1BYM A;  3A8H B;  4XTV A;  2XK0 A;  4FT2 A;  3NTI A;  3CCQ T;  3JCM W;  1JBM A;  5I21 A;  4J6X A;  4HT8 A;  5FU6 B;  4C5G A;  3RKY A;  4F7U E;  3HHT B;  2IVW A;  2HNI A;  4P5N A;  4XTW A;  4Y91 A;  1UGP B;  2ZPH B;  2YLC A;  4PJO G;  3CPW A;  3INZ A;  1VIE A;  2RK1 A;  3QSU A;  5GAN d;  1M1G A;  2DKG A;  3G4S T;  5CCA A;  1D3B A;  3SFM A;  4HKE A;  5GAN 5;  4QQ6 A;  3TRE A;  2K5L A;  2RB6 A;  3RKX A;  3CCR A;  2CS7 A;  3RMQ A;  4LD9 K;  3OBY A;  3CCE A;  3L2U A;  2QA4 A;  2R5A A;  1YHQ T;  3OYM A;  3I56 A;  1VQ6 A;  1OYX A;  3ME9 A;  1MHN A;  5GAN j;  3M4Y A;  3FLG A;  3QPH A;  4X9D A;  2GFU A;  3G6E T;  4E7K A;  1VQK A;  3OYC A;  4E7H A;  3MO8 A;  1Q7Y C;  2X4W A;  2KAF A;  2QXF A;  5LJ5 g;  2Y4X A;  1GXI E;  4B9X A;  4DQ2 A;  3CCU A;  3FB9 A;  5HK0 A;  5DLO A;  3QJY A;  4JRQ A;  3CMA T;  3Q1J A;  2R58 A;  4IUT A;  1VIF A;  1M9S A;  2Y90 A;  2ZPG B;  4MZP A;  5FU7 C;  5LJ3 g;  1QVF S;  5GAO m;  4J6W A;  3F70 A;  4LDU A;  3MEA A;  3QG1 A;  3VV0 A;  3CCL T;  2MF2 A;  2BIV A;  4A4F A;  1YI2 A;  4Y28 E;  2KQW A;  4C8Q D;  4ZN3 A;  4N4H A;  1M1K U;  2EQK A;  4OB0 B;  2DK3 A;  3C95 A;  3QZ9 B;  4A4H A;  1ZQ1 A;  2I2L A;  3HFO A;  1B34 B;  4M78 G;  2HQE A;  4O6J A;  4QQD A;  4BI3 A;  4M77 C;  4C92 C;  4C5H A;  5C0M A;  2YLB A;  3CBP A;  4R56 A;  1QW1 A;  1PSE A;  1W2B S;  4XAX B;  5I2S A;  4XQ3 A;  4YTL A;  2VC8 A;  4Z02 A;  5GAM g;  4OVA A;  3WXM B;  1BIA A;  2XID A;  2ZPE B;  4ZTF A;  4GLK A;  1S72 A;  4DOV A;  5GAN 7;  3OYL A;  4C92 E;  4IUU A;  4JRK A;  4M77 E;  3QJ6 A;  1NPP A;  2VGM A;  4XU1 A;  3GP8 A;  3OYK A;  3I55 A;  3CC7 A;  3JCM g;  2LCC A;  4M7A F;  5J3B A;  3QUI A;  2X4Y A;  2XDD A;  2M1H A;  3L2Q A;  4M7D D;  4C0G A;  4BY6 C;  1JJ2 S;  5GAO r;  2ZZD A;  4J7F A;  4M7A A;  2PVO B;  1M5Q 1;  4PJO D;  1UGQ B;  5FRO A;  4MDW A;  5LJ3 e;  2K2V A;  5CKF A;  2LTO A;  1FX7 A;  4ZGE B;  2QEX T;  4FM4 B;  4L6V 5;  2DXT A;  2LT4 A;  2R5M A;  4JDS A;  3RES A;  5LJ5 d;  5GAM h;  2VXE A;  1V29 B;  4ATO A;  1U1S A;  2E12 A;  3X26 B;  3X28 B;  2OAU A;  1H64 1;  3QII A;  4M75 B;  5DLQ E;  3OW2 S;  4J8O A;  2E64 A;  2K57 A;  4XK8 E;  1VQN A;  3J81 E;  4HCC A;  5LJ3 d;  2E41 A;  1VQ5 A;  3GLX A;  2ZGW A;  4M78 B;  3VKI A;  1BI0 A;  3CD6 A;  5LJ5 j;  3CC4 T;  1RI0 A;  1I8F A;  4EMK B;  2RJD A;  2QQ9 A;  2EIF A;  2DJZ A;  2VUB A;  1K9M C;  2DPP B;  5GAM e;  3RMS A;  4J6Y A;  3FC3 A;  3VJP A;  2JNG A;  5LJ3 j;  3L1A A;  3OS5 A;  2LQ8 A;  1WNL A;  2L3R A;  4QVZ A;  1KHI A;  1QVP A;  3V8L A;  1SSF A;  1LJO A;  2RM4 A;  4XU3 A;  3OYG A;  3JCM e;  3OYH A;  3H8Z A;  2MAM A;  2MMP A;  3HRS A;  3QBY A;  5GAO n;  5A2Q E;  2DEQ A;  4XU2 A;  2BUD A;  2EYQ A;  1U8R A;  3OYD A;  4QW2 A;  2F69 A;  2RI5 A;  5IN1 A;  3CME T;  3VYH B;  3MCA B;  2RHI A;  5D6X A;  5GMK e;  4EPC A;  4ZTJ A;  3SB2 A;  4LDW A;  5FU6 C;  3FIF A;  4F7U G;  2K3X A;  3UWN A;  1LOJ A;  4M78 D;  2LCL A;  3JCM d;  1QVF A;  2K5I A;  1N9S A;  3JB9 H;  2RJF A;  3JCM X;  2VYT A;  1Q81 U;  4BAC A;  4Q5W A;  5CQX A;  2L89 A;  4LDX A;  4C92 F;  2M9U A;  2BKD N;  4M77 F;  3JSC A;  3L2R A;  4NS5 A;  1G3Y A;  4M7D G;  1BI3 A;  5KE2 A;  1YJ9 T;  1UGR B;  3VYG A;  1FXX A;  3JCM c;  2EJG A;  3ZEH A;  3L2Z A;  3OYJ A;  4B9W A;  1X75 C;  4M7A E;  2CZ0 B;  4C92 A;  3DLL A;  2DXB A;  2QQB A;  4M77 A;  2MI6 A;  5CKD A;  3SWN B;  1YJW T;  2DZC A;  3MEU A;  2HD0 A;  3S3N A;  3WVD B;  1XNI A;  5GMK j;  2OTJ T;  3J80 E;  3E19 A;  1UB4 A;  4OMF B;  4IKF A;  1W2B A;  5FRN A;  4VUB A;  4E7L A;  4X9C A;  1MGQ A;  2H3J A;  5CQY A;  4A4G A;  2K4Y A;  2QI2 A;  4C8Q B;  4V2S A;  3L42 A;  3MP1 A;  4E7I A;  1PSF A;  1Y7X A;  4UC4 A;  3PTA A;  1QP3 A;  2DZ9 A;  3PMI A;  2WSF E;  3T9N A;  2EWN A;  3PNW C;  3HRT A;  5CKE A;  2O4X B;  3M54 A;  4LDV A;  4C0Z A;  3BDL A;  1VQM T;  4BI8 B;  1JJ2 A;  3LH0 A;  3QO3 A;  2JZ2 A;  4N0A C;  5A0D A;  3OS2 A;  3OYE A;  2PU9 B;  2LC4 A;  4JS5 A;  4E7J A;  5LL6 S;  1VQ7 T;  4J5Y A;  2RJE A;  4FT4 A;  4F7U B;  5KCH A;  2VGN A;  1NE8 A;  4RG2 A;  1KHC A;  3HRU A;  5J26 A;  3CCM T;  2Y4Y A;  3X25 B;  4JLI A;  4EMK A;  3TEE A;  5C6S A;  4XTY A;  2RA2 A;  1I4K 1;  3EFR A;  1K9M U;  2PQW A;  2L8D A;  3PIP A;  2CYZ B;  2E70 A;  5CKH A;  1VQ8 A;  3C12 A;  3M57 A;  2IG0 A;  4M7D B;  2X35 A;  1YJN T;  2QTX A;  3OW2 A;  3MP8 A;  2RI2 A;  4RG8 A;  5KCO A;  2P4T A;  4OGE A;  1VQO T;  4XU0 A;  4JLG A;  4PJO B;  3SDZ A;  2RHU A;  3RIR A;  1VQL T;  3MEW A;  4M77 G;  3CCJ A;  4BE2 A;  1VQ9 A;  1OZ2 A;  2MWP A;  2V8I A;  3CME A;  3HSB A;  2E5Q A;  2L5Q A;  3PIO A;  1YIJ T;  3GNF B;  1Y07 A;  1WJS A;  3OQ5 A;  1Q81 C;  3OYB A;  1BIB A;  3GNG A;  1VQP T;  5D6W A;  4O5V A;  5CO7 A;  4DA4 A;  2OTL T;  1YIT T;  3OB9 A;  4QQG A;  5CR2 A;  1M8V A;  2GF7 A;  3H6Z A;  1TH7 A;  4BB7 A;  1Q82 U;  2JOY A;  3QXE B;  2FB7 A;  2KMT A;  4RKU E;  1R8O B;  3G71 T;  3CCV T;  1Y96 B;  2CKK A;  1Y71 A;  4PLL A;  2LVM A;  2XKO C;  3CCS T;  2XI9 A;  3CCQ A;  2PUO B;  3VUZ A;  3LWH A;  4PLI A;  2JVV A;  5GAN f;  3OYN A;  2DVE A;  4M75 C;  4ZGD B;  1NZ9 A;  3QHS A;  2QQA A;  4E47 A;  3QKJ A;  4M78 C;  3G4S A;  2OTJ A;  3OS1 A;  2QDY B;  2EQJ A;  2XDB A;  1JRI A;  3P8D A;  3M9Q A;  3X20 B;  2DXU A;  3HFN A;  2VXF A;  3TCJ A;  2LDM A;  4EMK C;  4BDZ A;  1BI2 A;  3PFS A;  4C8Q A;  1AHJ B;  4M75 E;  1UEB A;  2WSE E;  1M90 C;  3HP9 A;  1YHQ A;  3DLM A;  2M0O A;  1KG1 A;  2P0P A;  1O75 A;  4MZM A;  3G6E A;  2O4X A;  2LT1 A;  4A4K A;  1XOV A;  5DY9 A;  4IUV A;  3O8V A;  3OBW A;  4FL6 A;  2GCX A;  1D3B B;  5CKB A;  4C0D B;  2HAX A;  2V8K A;  1XQH A;  2PVD B;  2P0Q A;  3BFM A;  3CCR T;  2EAY A;  4L5G A;  3CBM A;  3CBO A;  3M4G A;  2K3Y A;  3LGF A;  3CCE T;  2DD5 A;  1KQ1 A;  4X34 A;  2QA4 T;  3V7R A;  3I56 T;  3CMA A;  3ER0 A;  4NOY A;  4PL6 A;  4C5E A;  4KUL A;  3MET A;  5CK9 A;  5GAN 8;  3NTK A;  3A8L B;  1HK9 A;  3JCM J;  1KC8 C;  3X24 B;  2M16 A;  3HKS A;  4N0A A;  5I2M A;  3M53 A;  2K5F A;  1OZ3 A;  4ZGJ B;  5GAN 6;  5HKC A;  3CCL A;  3GF5 A;  4KBM B;  3CC2 T;  5FLX E;  4KT0 E;  3S6W A;  3CCU T;  3BY7 A;  4EMH A;  4RMO A;  4PJO A;  5GAM d;  4OGC A;  4JJN K;  1KQS S;  5IAY A;  2JTM A;  3ZFJ A;  4C92 D;  2CGH A;  4M77 D;  5L8R E;  4JS4 A;  4M7A G;  1B34 A;  1WGS A;  1ZHI A;  4OB1 B;  1YBY A;  4OF1 A;  5GMK l;  5GAO q;  3C4S A;  1Q82 C;  1N27 A;  2LRQ A;  2ZPB B;  3SWN C;  3V7C A;  1UGS B;  5AYF A;  2DTO A;  2EQM A;  4LDY A;  5GAM j;  3LWI A;  2JN0 A;  3LGL A;  1YI2 T;  4J7I A;  2X4J A;  1BI1 A;  3QDR B;  2RHX A;  4C8Q C;  3JB9 F;  1Y96 A;  3G71 A;  3DB3 A;  3PT9 A;  2D6F A;  2D9T A;  3A5Z B;  2E6Z A;  4OP0 A;  3BDU A;  4BUG A;  4ZN1 A;  3OY9 A;  3BW1 A;  2XU8 A;  5GAO p;  1H3Z A;  3RKW A;  3P8B B;  3QYG B;  3CCS A;  1HXD A;  3JB9 I;  1JB0 E;  2PUK B;  3FRN A;  2AHJ B;  4IUP A;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...