5HK0A

Crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
109
Chain Sequence
b'MVISRAEIYWADLGPPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF6
molecule tags Hydrolase/rna
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
publication title Crystal structure of M. tuberculosis MazF-mt3 (Rv1991c) in complex with RNA
rcsb
total genus 20
structure length 109
sequence length 114
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hk0A00
5CKFA 1M1FA 5HK3A 4MZPA 4HKEA 3JRZA 4ELYC 5CKDA 2C06A 3TCJA 2MF2A 5CQXA 5CQYA 5CKEA 1X75C 2VUBA 1NE8A 5HKCA 1UB4A 5CK9A 4ELZC 5DLOA 3G7ZA 4ME7A 5CO7A 5CCAA 4MDXA 4VUBA 4MZTA 3JSCA 5CKHA 3NFCA 4MZMA 1VUBA 4OF1A 5CR2A 2KMTA 3VUBA 3HPWA 5HK0A 5CKBA
chains in the Genus database with same CATH superfamily
3M5AA 5I21A 3EG9B 5GMKl 1D1CA 1JXOA 2E5QA 5CQYA 2RJDA 2DXTA 2RQWA 1PKSA 4PL6A 1GCQC 3CC7A 5LJ5h 4AFQC 3CC4A 4BI3A 2PVDB 1VQNA 1BCOA 2COYA 1K76A 5KYUA 3OYBA 3JCMQ 1YN8A 4OGEA 2QEXA 4XU0A 1R8OB 4M7DB 2DXCA 3EAEA 2M51A 3OW2P 3CC4Q 3RKYA 1BU1A 4F7UE 3FRNA 1WX6A 4C0GA 1K9AA 2KRSA 2D1XA 4DEXA 2LQKA 2F2XA 3DKMA 1UDLA 3PT9A 2IG0A 1Q7YR 1OPKA 4J9FA 3H6ZA 2GTJA 1TUGB 3NHNA 3REBB 1XTDA 3RKWA 3MJXA 3CCJA 1IZ6A 4M77F 4X34A 1M2VA 3HHTB 4O5VA 1QVPA 4GLMA 1Q82U 4M78C 2J05A 1AT1B 4FCYA 5GAMe 2PQWA 4IURA 4M7AB 4RTUA 4FW2A 1TU0B 4RTZA 5HK3A 3P8BB 2KBTA 3EGDA 2RJFA 2O2OA 1M1KC 1UE9A 1OX8A 4DBFA 4PK4A 3X28B 1K73C 5FU7C 3QUIA 1EIFA 4ANJA 4AG1C 3AHUA 4PKCC 2DX1A 4FYXB 2EYYA 4X9CA 3GF5A 1U5SA 3OYGA 3RBBB 2KT8A 3LX7A 3JCMf 2E4HA 3F70A 2PZ1A 1VYVA 3E9GA 3JV3A 2LT1A 2VC8A 4OF1A 1XJWB 5GMKi 3M0TA 1MNEA 3HPWA 3QG1A 3UA6A 5ECAA 5HK0A 2KT1A 3V8JA 4N0AA 4BUGA 1WHGA 2BE9B 2LJ1A 1OULA 1YP5A 2C0IA 1Q95G 2A7YA 1M90R 1YIJT 4C8QG 2NUTA 1Q7YU 3ZL7C 1Q81C 4RMOA 4CC4B 1PKTA 4II1A 5FRNA 2K3XA 2DA9A 3V7CA 2R57A 3E9FA 3EHQA 3X24B 3SDZA 1QQJA 1G3YA 4PJOB 1PNJA 3C95A 3S6WA 4QT7A 3I9QA 4C8QE 2FYKA 4JJDA 5IHNA 2EW3A 4AFZC 3MP6A 1Q86R 4M77E 3H0FA 3JCMc 2OTLA 1JEGA 1KC8U 2QK0A 1S72Q 2D8HA 2HNIA 4IUQA 2O9VA 4OMLA 4JRPA 1SG5A 4M78B 1WHMA 4N4HA 4BY6B 4AMCA 4M77C 5FRMA 2YUNA 2LDMA 1JRIA 3CPWP 5GANe 5LJ3d 1VQMA 1H92A 2AT1B 3HP9A 1VOMA 2DEQA 2KYMA 1Y96B 2BZ8A 2LQWA 4L59A 5GAMh 3PVQA 3LWIA 1KFZA 4JS4A 4UC4A 1YHQQ 2QI2A 4HT9A 2PU9B 2DMOA 1JJ2P 2X35A 2J6OA 2DIGA 3J7AF 3ULRB 1YCSB 2A36A 3EFRA 3FB9A 2HSPA 5KE3A 4OMPA 2QEXQ 3CCJQ 2XU8A 3M59A 4LDWA 2A08A 4Z89A 2BE7D 1I1JA 3FLGA 4QQ6A 4C8QA 4E7ZA 2JN0A 9ATCB 1QWFA 4M78G 3TSZA 2QQRA 1MHNA 2DL8A 2QA4Q 4F17A 1YJ9A 1TUDA 4HVWA 3NMZC 2RM4A 3CBMA 3GBQA 1SSFA 2GQIA 1Q86U 2DLPA 2XKOC 1QVFS 2FZCB 4M77G 1KQSA 2QQAA 4M77A 2CH4W 1YITQ 2R5MA 1NEBA 3PMIA 1W2BS 4OB3B 1Q7YC 2CP6A 4IIMA 4HVUA 5IH2A 4DBRA 5KH6A 3OYCA 1K9MR 1V76A 5GAN4 1QVFA 2LRQA 1AWOA 3OQ5A 1WGSA 3M54A 2V8KA 5CQXA 4XAXB 4M7AG 3E19A 4ZGJB 1WHLA 4PFZA 4PJNA 1JJ2S 3QXEB 1VQ4Q 5GMKm 3U23A 4ELZC 2Y90A 3EG3A 4IUTA 2DXUA 2XDPA 2OAWA 3UPUA 2DNUA 1AEYA 2R58A 4C92C 3DB3A 3S3NA 4DOWA 2KXDA 4MMLA 3C12A 2KI7A 1PRLC 4HCCA 1K73U 1N9SA 2D9TA 5AT1B 1KHCA 1D09B 2FO0A 1NEGA 3VS2A 4ZTFA 4AFUC 4MZMA 2K5LA 3QWXX 3GLXA 1VQKQ 2AKLA 2YXYA 1M1FA 2I0NA 1QCNA 1QKXA 1W4SA 3JCMh 3OYYA 2COZA 1KK7A 3G6ET 2XICA 1VQKT 3N5BB 1HJDA 1M90C 1FYNA 4OMMA 2DRKA 3LGFA 3NFCA 5GJWB 3VUBA 2GQVA 1VQ4A 1WXBA 2KNBB 5KYWB 2K9GA 1Y0MA 1ZLMA 4LDVA 4M75F 5C0MA 3NTHA 4F16A 2OTJT 1ZSZA 2K2MA 4C8QF 1KD1R 3GPLA 2EVRA 3H0HA 1TTHB 2RQTA 1MMNA 1VQMQ 1O9SA 1MMGA 3M0QA 4MDXA 2IIMA 2DJQA 2V8JA 4MZTA 1Q81U 1VQ5T 1D3BA 1YNZA 4XTVA 3PMTA 4E47A 2HBWA 3SEMA 2COWA 5GAN6 2X51A 3CPWA 2AKKA 2E6NA 4LNPA 3CCUQ 1W70A 1Z9ZA 2EQIA 2RQVA 2O01E 2ZPBB 1WJSA 4EMKC 1UGQB 2DD4A 3FJ5A 4ZNXA 3JCMd 4FSXA 1ZUKA 3JCMJ 2CUDA 1NPRA 2HQXA 1JXMA 1UHCA 1YCYA 2LC4A 1VQ9A 1QP2A 1M3AA 2K2VA 4XQ3A 1YJWT 2DZCA 3JCMX 2O31A 1PSFA 1HYOA 3EFOB 3UWNA 2KROA 5IXFA 1D0XA 1UHFA 3OSVA 1T3LA 1IGUA 4RUGA 1IB8A 3KUFA 3PE0A 1E6HA 5GAN5 3TEEA 3OY9A 1I4K1 2JS0A 1RL2A 2ZPIB 2VV5A 2E70A 1QCOA 4C0DB 2DYBA 4E7HA 5GAOl 1E7OA 1QLYA 2EIFA 1K8AR 2DTOA 2O9SA 1YHQT 2RI2A 1YITT 4OMOA 2DZ9A 2RD1A 4ZGEB 1V29B 1EZZB 1UJ0A 2WSFE 3SWNC 3LH0A 4PJOC 2XMFA 2VXFA 2PTKA 1UGRB 5GMKe 2FZGB 2RQRA 2JTFA 2YUOA 2QQ9A 4FYVB 2ROTA 1U3OA 1G3TA 1ABOA 1QVGS 2RO0A 4Y92A 3L2WA 1SRMA 2RMOA 4D8KA 1VQ9T 5DM7R 2HQEA 1RLPC 2ZGWA 3RR6A 3R6NA 2V26A 2ZAEA 5FU6B 2DBKA 1UG1A 4J5YA 3OS1A 4A4HA 4BI8B 2OTJA 4XU1A 3UA7A 2F5KA 4YTLA 3R6OA 1M8VA 1QW1A 3VV0A 1WHJA 3LWHA 2B86A 2X4WA 1FMKA 4E7IA 2EYQA 2M9UA 1CSKA 4A4GA 2FPFA 2OJ2A 2RPNA 2PVGB 4C5HA 1K73R 4XU2A 2LCCA 4A4KA 2EGCA 4RKUE 1QVGP 2DTHA 2FZKB 1TG0A 1M4ZA 3L2QA 2YRDA 4QW2A 2BIVA 3H0IA 3BDLA 5EG2A 5CCAA 4LD6A 2ECZA 2LJ3A 3VS0A 5KCOA 1WFWA 2KRMA 4F04B 2M0OA 5LJ3f 1TOVA 3OYKA 4QQGA 3E2UA 2CZ7B 5GANd 1AZGB 1VQ7T 3L1AA 1KQSP 2EQUA 1U1SA 3CCLT 2ZPEB 2F2VA 3JB9F 3CCVA 1NE8A 2LJ0A 5HKCA 3O5ZA 1UGPB 1NPPA 4M77B 3C94A 3GOXA 1WNLA 4JZ3A 3OYMA 2E12A 2RK1A 2LTOA 1OEBA 5I2SA 1PM3A 3EGXA 1YJNT 5KYYB 1VQ6T 2QG9B 2DO3A 4FSSA 3G4ST 3DLMA 1JB0E 1QP3A 2EGAA 3EG2A 3G71Q 2FG0A 3LW5E 2RF0A 2CZ0B 3JCMW 3OW2S 4HCBA 3URGA 2NUZA 5GAOq 4BI4A 1RI0A 3CD6Q 1KC8R 4C5GA 3FIFA 2XIDA 2C06A 1P92A 2EQMA 2RJEA 1VQ8A 1ZHIA 4IUPA 5IT9E 1B3QA 3UT1A 3QIIA 1I5LA 4GLKA 4QVDA 1YWOA 4LUDA 1J3TA 1OU9A 3ME9A 4PJOF 1RAGB 5IHKA 3V8KA 4M7AE 3M0RA 1YJNQ 4JRQA 1T0HA 4BB7A 3M0SA 5I11A 2ROLA 4HA8A 1WXUA 3CCST 1PRMC 3I35A 4GBQA 3KBGA 3CQTA 4E2FB 3CCMQ 2DTIA 4OB2B 5FU6C 1VQNQ 1MMAA 2BKDN 2CT3A 1NZ9A 3M4GA 3CCLA 2CP0A 2MK5A 5AYFA 1YJWA 3UF4A 2EFIA 1AVZC 3EG1A 4FT4A 3PGGA 4ESRA 1SRLA 2X4YA 4HXJA 4PFPA 4QQDA 4ME7A 1UTIA 2QQBA 4X1VA 2YWWA 1GBQA 2SEMA 2XG8D 5FWCA 1K8AC 5GMKj 1LNXA 3X26B 1XNIA 1VQLA 5GAN2 1N8RR 4M78D 1WIEA 4OB0B 3ZEHA 1R77A 2H3EB 1TWBA 1DJ7B 1VQPT 1ZBJA 1WJRA 3CMAA 3CCSA 1WHKA 3EG0A 1GL5A 1QKWA 3CCMA 2PNIA 1QWEA 4ZN3A 2LQNA 2P4TA 1I8FA 3QZ5B 1YJNA 4J7IA 3VKIA 1O75A 4KUDK 2CP3A 2JXBA 5C6SA 2VGNA 5L8RE 1R0CB 2ED1A 4M75C 1F1BB 4JLGA 4J9CA 2DERA 3PIPA 1KQ1A 2CDTA 3OYJA 2MYSA 1PG5B 4N4GA 2BTTA 2GCXA 2MF2A 1JU5C 4CC7A 1LJOA 2A3LA 4A4EA 1OZ2A 3CEYA 1Q82R 2V8IA 7AT1B 3FDRA 4K11A 1VQ4T 1ABQA 2DEUA 1IHVA 3HSBA 1OI1A 3BY7A 2VXEA 3QJYA 4M78A 1KD1U 1SKUB 3QPHA 4M77D 2F2WA 3HFNA 2JMAA 3QSUA 3EGUA 2RHZA 2Y4YA 2L3RA 1KG1A 4DOVA 2E3IA 1AWWA 3G1JA 1VQ7A 2QQSA 2L89A 4JRIA 4CC2A 1K0XA 3S3MA 1W1FA 2M0YA 1ZBXA 4C92F 1TH7A 3UATA 3A8LB 4LE9A 3OS2A 4ATOA 4A4FA 4J9HA 4AT1B 2YUQA 4JUVA 3BE3A 4A63B 1H3HA 3CD6T 3JB9G 5LJ3j 4R0KA 2KYBA 2LNVA 4M75A 5LJ3g 4RCBA 1VQPA 2EYXA 2X9HA 1ZSZC 2ZPGB 3I56A 5GAOr 1WYXA 1X6BA 2Y4XA 1ARKA 2RJCA 2KE9A 5D6XA 2KY9A 1VQ8Q 5GAN7 1WI7A 4KH0B 1I81A 3HTRA 3M58A 3OSSC 5A0LA 2ZCFB 4E6RA 1KC8C 3TU4K 5FW9A 1WZOA 2ESWA 4J9BA 1CKAA 3QWYA 5KYNA 4VUBA 2BZYA 2VVKA 3V7RA 1MUZA 2GGRA 5D7UA 1PCXA 2DILA 4JDSA 3IQLA 2RA2A 3CC2A 1PD0A 2OAUA 2K79A 2OTJQ 2EKHA 1AWJA 2HMAA 4OB1B 2O4XB 3OW2A 1VYUA 4JJNK 1M8MA 2AK5A 1ZA1B 3JB9I 1EX4A 1S72T 2HKQB 3CXCP 2MAMA 3X25B 1E6GA 1WA7A 3TVTA 1IGQA 5GANh 1G8XA 1WXTA 2L0AA 1VA7A 2FB7A 2WSCE 1X6GA 3JRZA 5FWBA 5FROA 5A2QE 3A8OB 1M27C 1VQ6A 5DLOA 3CMAQ 5HCKA 1N9RA 2SRCA 3HRSA 2XD0A 2WSEE 3QDRB 5GANj 2J6FA 1YFNA 4WF2A 4C92E 2GNCA 1SSHA 3CXCS 2MWPA 3EGXB 1MMDA 3SWNA 2K57A 2YSQA 3EG9A 1VQLQ 1HXDA 2L8DA 2D0QB 1C0MA 1HSQA 4M7DE 2NUPA 2CYZB 3VS5A 4C5IA 2K5IA 1KIKA 4PFOA 2EWNA 2FRWA 1NYGA 3A1PA 2AZSA 2MMPA 5A0GA 1WDXA 5L23A 4PJMA 3H9NA 4MMKA 1BK2A 4LN2A 4MZPA 3MO8A 3HKSA 3OMGA 4XTUA 4B9WA 4L5GA 2EJ9A 4XU3A 2E1HA 2QTXA 4J9EA 2FPEA 5GJVB 2EPDA 3OYAA 3CCSQ 2YUPA 3VYHB 2RHXA 3ZBDA 2ZZDA 3A98A 2YLBA 4RTXA 1RAHB 3P8HA 2GF7A 4Y28E 2VYTA 2PUKB 5GAN8 3G6EA 1D0ZA 5IHIA 1TSFA 3MKDA 3MHXA 2XK0A 3G71T 2ENMA 3VS6A 1UFFA 4M7AD 5GAMj 4ZN1A 2W10A 3CCLQ 5KYXB 5LL6S 4C92D 3CBOA 3LGLA 4RTWA 3RIRA 1OX9A 2DXBA 2JS2A 4KULA 4JJCA 4TVRA 4JS5A 3M0PA 5HY6A 2LQ8A 1MV3A 2MI6A 1H8KA 2EGEA 1S1NA 2K4YA 3OA6A 2X4JA 2JNGA 2EAYA 4C8QB 1OQKA 1KSWA 3P8DA 4HVVA 1PSEA 2EJGA 2KVQG 3M56A 2J7IA 1OOTA 3FEOA 3JCMe 3JSCA 4M4ZA 2EJFA 1IRXA 2ZPHB 3VS1A 4FW1A 3CCRA 3Q1JA 1VIEA 3M0UA 2HKNA 3VS7A 4M7AC 2DL3A 1Y07A 5A0DA 2EQJA 3EH1A 4F7UA 4M7DA 1C6VX 1U1TA 4BDZA 4M78E 2KK4A 4F7UG 2K7AA 1WQ7A 4RG8A 1QMCA 5GAMd 2VASA 4E7LA 3G71A 2RHYA 3EH2A 1VQ5Q 2MOXA 4OMQA 5D6WA 2NUTB 3L2RA 2KMTA 2O4XA 4PLLA 2QDLA 1ZX6A 3CCVQ 5GANg 4PJOG 2DL5A 2CT4A 1MNDA 1MGQA 8ATCB 3RDVA 3QYHB 4RTTA 2QASA 1N27A 3THKA 2LP5A 4DEYA 3ER0A 2DPPB 3FC3A 3G7ZA 4PNOA 4FM4B 4EMGA 3CCQA 1K0SA 5KYYA 2PVOB 3WVEB 3OYNA 2A37A 1BI3A 1BI1A 1YHQA 1KQSS 1EFNA 4J6WA 3HRTA 1SHGA 2CP5A 4IIOA 1HK9A 4PJOA 2LMJA 1VQ8T 2E3HA 4NL3A 3UDCA 1UGSB 2E6ZA 1FWZA 2CH4A 4JRKA 4CI0C 2B8AA 1YITA 3MPUB 2RB6A 1UUEA 1KQ2A 1BBZA 3M4YA 4FYYB 3PFSA 4E7KA 2P0QA 3CC2T 1AWXA 1M30A 2EBPA 2DIQA 2HAXA 1M3CA 2CZ6B 3CCQQ 1RAEB 1TS9A 3QYGB 3RMSA 2H3JA 3D7SB 1D0YA 4EMHA 1G3WA 4EDUA 3OYFA 3CCUA 1VQOQ 1I5OB 2RI5A 1NJIC 1NLOC 5CKDA 2GFAA 2M02A 2LNHB 3CPFA 2OTLT 3MP8A 4M78F 1N8RC 3CC7T 1S72A 3PNWC 1Y57A 3I5SA 1A0NB 1YI2T 4PJLA 2X3XD 2CGHA 4KGVB 1RAIB 4O6JA 1FMVA 4FL6A 2LX9A 1WLPB 3LYIA 1PHTA 2QGFB 3KFVA 1TXQA 2J06A 4RTVA 5CVIA 2AHJB 3L42A 2RI3A 3CCRQ 3OYHA 2DJZA 3CXCA 1M3BA 3I55Q 3SWNB 2K3YA 3OBYA 1UGVA 2NLUA 4JLIA 2GTOA 2E41A 3M9QA 1N5ZA 3CC4T 2LCLA 2BUDA 2E5KA 1X27A 3JB9J 5LJ3e 1NG2A 4BDYA 3M57A 1X2KA 1Q82C 2DL7A 2DL4A 3VU3C 1IREB 4KT0E 4PJJA 2HQHA 1JO8A 2ABLA 3MEVA 1VQMT 1W2BA 4ZGDB 3TSWA 4PJOD 4J6XA 4JZ4A 3SHWA 1D1BA 5KYWA 4F7UB 3EFOA 3QO3A 2W0ZA 3RERA 1ZSZB 4JJBA 4BE0A 3NTIA 3A8HB 2BZXA 4Y91A 4BD3A 4LXCA 3VRZA 4XK8E 5I22A 4OVAA 4M75E 4FU6A 2KEAA 1U8RA 1JJ2A 1LCKA 3RESA 1X43A 2DRMA 3G4SA 1RI9A 1YBYA 2D6FA 1N8RU 2DBMA 4JPBW 5CAIA 5KE2A 2CP2A 3OYIA 4RG2A 2EYWA 3H41A 4LDYA 4M7DD 1G2BA 2NUPB 3BFMA 4HKEA 2NYSA 5LJ3h 2KAFA 2AZVA 3CCRT 1BB9A 1ZSGA 1QVFP 2L3PA 5FLXE 3A5ZB 1YJ9Q 1I0CA 3HFOA 1OU8A 1G5VA 1VUBA 3HRUA 1GRIA 2X4XA 1OYXA 4LDUA 1Q86C 3I55T 1VQ9Q 1R0BG 1YIJA 3JB9D 2JTMA 1RLQC 2DYIA 4QVCA 4BE1A 1GBRA 2DK3A 2OTLQ 2P0KA 2KDSA 2DD5A 2RN8A 4J7FA 2KR3A 3CMEQ 2JMCA 2LX7A 3G4SQ 3CCMT 3JB9H 2MWOA 5IN1A 1NM7A 1M9SA 4KH1B 5M9OA 2E65A 4BY6C 4CRIA 1YIJQ 2F69A 4IUUA 1ACMB 5J3BA 2WACA 1QVGA 2EQKA 2O88A 2X3WD 5CK9A 2JVVA 1U06A 3A8MB 5GANf 3VS4A 4LD9K 1LPLA 1W6XA 1RADB 1UEBA 3L2ZA 3RMQA 4M75G 2LZ6B 2YLCA 5LJ5f 4FYWB 1SF9A 3JCMg 2DFUA 3MCAB 3VYGA 1LVKA 1X69A 2XHCA 2JJ9A 3LLRA 4Z88A 3CC2Q 3MP1A 2DM1A 1GCPA 4C92G 2HD0A 2K6DA 4RCCA 3QDFA 2QEXT 1B34B 4C92A 4HT8A 8AT1B 1ZA2B 4C0DC 2M1HA 5LJ5g 4OP0A 2QTVA 4HCKA 1HD3A 2F1LA 4B9XA 3GNGA 2H8HA 2FL7A 2ATCB 1ZUYA 3C4SA 3OYDA 1FX7A 2EKOA 1G3SA 1M2OA 2RNAA 2FRYA 3RKXA 1NJIR 1AZEA 3SD4A 1VQ5A 4J8OA 5CKHA 4V2SA 4C8QC 3H8ZA 3MEAA 1SHFA 2E10A 3META 2QAZA 1NYFA 2XDBA 1SPKA 3WXMB 5CKBA 5GAMf 1N6AA 3QKJA 2CREA 2KGTA 4ZTJA 2JUFA 1WJQA 3QZ9B 2MCNA 5IXBA 1I07A 3FJPA 1TUCA 1D3BB 3CMET 2DETA 4AG2C 1M5Q1 2LCSA 2KRNA 4D6WA 1BIAA 2F5TX 3QBYA 1WPYA 1BI0A 2ED0A 1M1KR 1PWTA 2FPDA 1NBEB 2DVJA 3NTKA 3TREA 4N4IA 3CCVT 2L3SA 3E1SA 4XTWA 4EPCA 2MIOA 2MPXC 5EC7A 4WTOB 3G6EQ 3DLLA 4DQ2A 5KYUB 2K3BA 3KXTA 2P0PA 3M53A 1Z9QA 4RTYA 1RUWA 4N0AC 3SFMA 1VQPQ 1H641 3DB4A 1RAFB 2CS7A 1BYMA 4B6MA 4C0ZA 3VUZA 1Q81R 3T9NA 3LH5A 3PIOA 3WVDB 1RACB 4WCIA 1RAAB 4EMKA 2VKNA 4D8DA 2P84A 1M1KU 3CPWS 1OV3A 4NOYA 4E7SA 1AD5A 2C0TA 4FIBA 3CC7Q 3CMEA 3I56T 2VGMA 1K1ZA 3CCET 5LJ5j 4IUVA 5KCHA 3HL8A 4M7DG 1M2VB 1K8AU 4C8QD 3J81E 3V7SA 1BIBA 2ZPFB 3OB9A 4E7JA 3CCQT 4M75D 4F14A 3X20B 1OPLA 1UB4A 2YRVA 4M7DC 2RH2A 2G6FX 1XQHA 2JW4A 2LVMA 2CUBA 2GBQA 1T3SA 2HSEB 2V1QA 5CR2A 2DF6A 1KD1C 2J6KA 5J26A 1VQNT 2DVEA 2CZ1B 2L2PA 1OZ3A 1G83A 2VWFA 2CKKA 3CBPA 3EGDB 1WQWA 5GAN3 1PD1A 1RABB 4PJOE 1D1AA 1FXXA 2VUBA 2YRCA 2KQWA 3V8LA 2AIRB 4GY5A 1W2BP 3GNFB 1SEMA 1VQOT 3BW1A 4A54A 2JM9A 1VQ6Q 2Z0WA 2M16A 3ASKA 3L2UA 5J39A 2QXFA 4QKUA 5I2MA 2QDYB 1M1GA 2HL5C 2CP7A 1YI2Q 1WHHA 1VQKA 5CIUA 4OMNA 3VS3A 2HDAA 4CC3A 2RHUA 2XI9A 3EFSA 2FEIA 3I55A 4Q5WA 1VQLT 4R55A 2KSSA 4J6YA 3CCUT 4ORZA 5GMKh 3GIBA 4P5NA 2HBPA 5IAYA 2C0OA 1X6OA 3MEUA 4C0FA 4KRTA 4XTZA 1PC0A 1YJ9T 3CMAT 4M7DF 2GFUA 1BI2A 5DLQE 3VJPA 2EYZA 3OBWA 3I56Q 1X2QA 1IXDA 3OYEA 2JT4A 3GP8A 2PUOB 2K5FA 2I2LA 5D6YA 1GCQA 4Z8AA 2A28A 3JCMb 2XDDA 1MV0B 3OS5A 1CKBA 1JQQA 6AT1B 3L2VA 4J83A 5GAOn 1IHWA 1K9MC 4DBQA 3VRYA 1K9MU 1KJWA 2VB6A 2D0NA 4J9IA 4X9DA 1GFDA 3OMCA 4EIKA 2P4RA 5LJ5e 3OS0A 2L5QA 4KGZB 2IPOB 4KGXB 1KHIA 2RHIA 4M7AF 4J9DA 3NGPA 3BDUA 1JBMA 2CSQA 2V1RA 1VQOA 2IVWA 4XTYA 4HCZA 4KUIA 4BACA 4BE2A 3O8VA 3QHSA 3OYLA 2JTEA 1BKBA 1QCFA 4MDWA 4NL2A 1X01A 3JCMP 2QA4A 4EMKB 1Y96A 1V1CA 3PVLA 5CKFA 5DY9A 3INZA 4J9GA 1VYTA 2KXCA 3CD6A 4OGCA 4LDXA 5CKEA 1X75C 2R5AA 4M75B 3REAB 4M7AA 3J80E 4QVZA 1VIFA 3AT1B 2RK2A 3A8GB 1YWPA 1T0JA 2HCKA 5GAOm 2FHDA 4NS5A 1LOJA 2OI3A 1BCMA 1B7TA 2JOYA 2L3QA 1B34A 4C92B 1YJWQ 2HL3A 2G3RA 4LUEA 3TCJA 4FT2A 3CCJT 2QGGA 1GFCA 2HEQA 2RQUA 4OMFB 4R56A 4IKFA 1UJYA 3M55A 3TQ7P 5CO7A 3C0CA 2OX7A 1M90U 1AHJB 3NPFA 3QJ6A 4PLIA 4KBMB 1XOVA 5GAOp 3SB2A 1ZQ1A 2YT6A 1Y7XA 2DAQA 4XTXA 4DBHA 5LJ5d 4ELYC 2A0FB 3JCMV 1C1AA 2CSIA 1FMWA 4AFSC 4DA4A 3MEWA 2YHTA 2QYZA 3PTAA 4Z02A 2E64A 3CCEA 2JM8A 1NLPC 1K4US 1VQ7Q 3RUXA 2QA4T 3EHRA 2YDLA 2DE0X 1AOJA 2NWMA 3ZFJA 3JAME 2FVUA 2HZYA 1GXIE 1UECA 1B07A 1NJIU 4L6V5 1Y71A 5FU7B 2DKGA 3RNJA 3S3OA 3I5RA 1IO6A 3CCEQ 5GAMg 1ZUUA 1H3ZA 4C5EA 4F7UF 2D8JA 4A53A 2JZ2A 1YI2A 2LT4A 5KYXA
chains in the Genus database with same CATH topology
2E65A 3M5AA 5I21A 1NPRA 2HQXA 4BY6C 4CRIA 5GMKl 2F69A 1YCYA 2LC4A 4OB1B 2O4XB 1VQ9A 1QP2A 2K2VA 4IUUA 4XQ3A 5J3BA 3OW2A 2E5QA 5CQYA 2WACA 2RJDA 1YJWT 2DXTA 2DZCA 4JJNK 3JCMX 1QVGA 2EQKA 4PL6A 3JB9I 1PSFA 5CK9A 1S72T 2JVVA 3A8MB 3CC7A 5LJ5h 5GANf 3UWNA 3CC4A 4LD9K 2MAMA 4BI3A 3OSVA 3X25B 2PVDB 1UEBA 3L2ZA 3RMQA 4M75G 1VQNA 2YLCA 5LJ5f 5GANh 3JCMg 3KUFA 2FB7A 3MCAB 2WSCE 5GAN5 3TEEA 3OY9A 1I4K1 1RL2A 3VYGA 2ZPIB 3OYBA 2VV5A 2E70A 3JRZA 5FROA 4C0DB 5A2QE 3A8OB 3JCMQ 4E7HA 4OGEA 2XHCA 2QEXA 3LLRA 4XU0A 5GAOl 1VQ6A 1R8OB 2EIFA 2DTOA 5DLOA 1YHQT 2RI2A 3MP1A 4C92G 1YITT 2HD0A 2DXCA 4M7DB 3EAEA 1N9RA 2DZ9A 4RCCA 2QEXT 3RKYA 1B34B 2RD1A 4C92A 4F7UE 4ZGEB 4HT8A 3FRNA 1V29B 4C0GA 4C0DC 2WSFE 2M1HA 3SWNC 3LH0A 4OP0A 5LJ5g 3HRSA 2LQKA 4PJOC 2XD0A 2WSEE 3DKMA 3QDRB 5GANj 2VXFA 4WF2A 4B9XA 3PT9A 3GNGA 1UGRB 2IG0A 4C92E 5GMKe 3H6ZA 3CXCS 2FL7A 2MWPA 2JTFA 3SWNA 2QQ9A 3C4SA 1FX7A 2K57A 3OYDA 2EKOA 1XTDA 1HXDA 3RKWA 1G3SA 3CCJA 1IZ6A 2L8DA 1G3TA 2D0QB 4M77F 4X34A 3RKXA 2RO0A 1QVGS 4M7DE 3L2WA 3HHTB 3SD4A 4O5VA 1VQ5A 1QVPA 4J8OA 2CYZB 2HQEA 5CKHA 2K5IA 4C5IA 4C8QC 3H8ZA 5DM7R 2ZGWA 4V2SA 2EWNA 1Q82U 3MEAA 5A0GA 4M78C 2MMPA 2E10A 3META 5GAMe 2PQWA 2XDBA 4IURA 5FU6B 3WXMB 4M7AB 5CKBA 5HK3A 4MMKA 1N6AA 3QKJA 5GAMf 3P8BB 4MZPA 4ZTJA 2JUFA 1WJQA 3HKSA 3MO8A 3QZ9B 3OMGA 4J5YA 4XTUA 4B9WA 3OS1A 4A4HA 4L5GA 2RJFA 4BI8B 2EJ9A 2OTJA 4XU3A 3FJPA 4XU1A 2F5KA 4YTLA 1M1KC 2E1HA 2QTXA 1D3BB 3CMET 3R6OA 1M8VA 1QW1A 1M5Q1 3OYAA 4D6WA 3X28B 1BIAA 3VV0A 3LWHA 2X4WA 4E7IA 2F5TX 2EYQA 2M9UA 2RHXA 5FU7C 3VYHB 3QBYA 3ZBDA 4A4GA 2ZZDA 3QUIA 1WPYA 1BI0A 1EIFA 2YLBA 3P8HA 2PVGB 2GF7A 4Y28E 3AHUA 2VYTA 4PKCC 2PUKB 5GAN8 3G6EA 4C5HA 3NTKA 4XU2A 3TREA 2LCCA 4A4KA 4N4IA 3CCVT 3E1SA 4X9CA 4XTWA 4EPCA 4RKUE 3GF5A 2DTHA 3OYGA 3MHXA 2XK0A 1M4ZA 3L2QA 3G71T 3DLLA 3LX7A 3JCMf 4DQ2A 4QW2A 3KXTA 2BIVA 4M7AD 5GAMj 3BDLA 5EG2A 2P0PA 3M53A 4ZN1A 5CCAA 3F70A 4N0AC 4LD6A 5LL6S 3SFMA 4C92D 3E9GA 3CBOA 3LGLA 2LT1A 3RIRA 2VC8A 4OF1A 2DXBA 5KCOA 5GMKi 4KULA 1H641 3DB4A 3HPWA 2CS7A 1BYMA 3QG1A 4TVRA 2M0OA 5LJ3f 4C0ZA 4JS5A 5HK0A 5HY6A 2LQ8A 3V8JA 4N0AA 4BUGA 3VUZA 3OYKA 2MI6A 4QQGA 2CZ7B 3T9NA 5GANd 1VQ7T 3L1AA 2EQUA 1U1SA 2K4YA 3PIOA 3WVDB 3OA6A 2X4JA 2A7YA 2JNGA 2EAYA 2ZPEB 3CCLT 1YIJT 3JB9F 4C8QB 4EMKA 3CCVA 4C8QG 1NE8A 1M1KU 3CPWS 1Q7YU 1Q81C 5HKCA 3P8DA 4RMOA 4NOYA 1UGPB 1NPPA 4M77B 1PSEA 3C94A 3GOXA 2EJGA 2KVQG 4II1A 5FRNA 3M56A 3JCMe 3FEOA 4FIBA 1WNLA 2K3XA 3JSCA 3CMEA 3OYMA 2EJFA 2ZPHB 3I56T 2VGMA 3CCRA 3CCET 3V7CA 3Q1JA 1VIEA 2R57A 2E12A 2RK1A 2LTOA 3E9FA 4IUVA 5KCHA 5LJ5j 3HL8A 5I2SA 4M7DG 4M7AC 3X24B 1Y07A 5A0DA 3SDZA 2EQJA 4F7UA 1K8AU 1G3YA 4M7DA 1YJNT 4PJOB 4C8QD 3J81E 1U1TA 3C95A 3S6WA 4M78E 2KK4A 4BDZA 1VQ6T 3V7SA 4F7UG 1BIBA 1WQ7A 2ZPFB 3OB9A 4C8QE 2FYKA 3CCQT 4RG8A 4E7JA 4M75D 3X20B 1UB4A 2DO3A 2YRVA 3G4ST 3MP6A 3DLMA 5GAMd 1JB0E 4M7DC 4M77E 2RH2A 1XQHA 1QP3A 3JCMc 3G71A 2LVMA 2RHYA 4E7LA 5CR2A 1KD1C 2OTLA 5D6WA 3L2RA 1KC8U 2KMTA 5J26A 2O4XA 3LW5E 2DVEA 2CZ1B 4PLLA 3JCMW 2CZ0B 1VQNT 3OW2S 5GANg 4HCBA 1OZ3A 2HNIA 4PJOG 3URGA 4IUQA 3CBPA 2CKKA 5GAOq 1MGQA 1RI0A 1WQWA 4BI4A 5GAN3 4C5GA 3QYHB 4PJOE 4JRPA 3FIFA 2XIDA 2C06A 1P92A 2EQMA 2RJEA 4M78B 1VQ8A 1ZHIA 1N27A 4IUPA 1FXXA 5IT9E 4N4HA 4BY6B 2VUBA 3ER0A 2DPPB 2KQWA 3QIIA 4M77C 3UT1A 3FC3A 1I5LA 4GLKA 5FRMA 3V8LA 4QVDA 3G7ZA 4GY5A 4PNOA 2LDMA 4FM4B 1JRIA 4EMGA 3CCQA 3GNFB 5GANe 2PVOB 5LJ3d 3WVEB 1VQMA 3OYNA 1VQOT 3BW1A 4A54A 1BI3A 3ME9A 4PJOF 1BI1A 1YHQA 1KQSS 3HP9A 3V8KA 2DEQA 4M7AE 2M16A 3ASKA 3L2UA 4JRQA 5J39A 2QXFA 5I2MA 4J6WA 4BB7A 1Y96B 4L59A 5GAMh 2QDYB 3HRTA 4HA8A 3LWIA 3CCST 1M1GA 4JS4A 1HK9A 4UC4A 4PJOA 3KBGA 1VQKA 5CIUA 2QI2A 1VQ8T 4HT9A 2PU9B 2DTIA 2X35A 4OB2B 5FU6C 4NL3A 2RHUA 2DIGA 2XI9A 3EFSA 3UDCA 3J7AF 2BKDN 3I55A 1NZ9A 4Q5WA 3M4GA 1VQLT 3EFRA 4R55A 3FB9A 3CCLA 5KE3A 2KSSA 4J6YA 1UGSB 3CCUT 2E6ZA 5GMKh 1FWZA 2XU8A 5AYFA 3GIBA 3M59A 4LDWA 4JRKA 4CI0C 4P5NA 2B8AA 1YITA 1YJWA 2HBPA 4QQ6A 2RB6A 3FLGA 2EFIA 4C8QA 5IAYA 2JN0A 1KQ2A 4FT4A 1X6OA 3MEUA 3PGGA 4C0FA 3M4YA 4M78G 4XTZA 2QQRA 1MHNA 2X4YA 3PFSA 4E7KA 1YJ9T 3CMAT 4QQDA 4M7DF 2GFUA 1BI2A 5DLQE 3VJPA 4ME7A 1YJ9A 2P0QA 3CC2T 3OBWA 1K8AC 2QQBA 2RM4A 2DIQA 3OYEA 2HAXA 2CZ6B 2XG8D 3GP8A 3CBMA 2PUOB 1LNXA 3QYGB 5GMKj 2K5FA 1SSFA 3RMSA 2I2LA 5D6YA 1Q86U 2H3JA 2XKOC 1XNIA 3X26B 1G3WA 4EMHA 1VQLA 1QVFS 4EDUA 5GAN2 4M77G 3JCMb 3OYFA 1KQSA 3CCUA 4M78D 2XDDA 3OS5A 2RI5A 2QQAA 1NJIC 4M77A 4OB0B 5CKDA 2R5MA 3PMIA 3ZEHA 3L2VA 2GFAA 4J83A 3CPFA 5GAOn 2OTLT 1K9MC 3MP8A 4M78F 1W2BS 1N8RC 4OB3B 1K9MU 3CC7T 1S72A 1Q7YC 3PNWC 1DJ7B 4X9DA 1VQPT 3OMCA 1WJRA 5KH6A 3CMAA 1YI2T 5LJ5e 3CCSA 3OS0A 3OYCA 2CGHA 2L5QA 5GAN4 1QVFA 2LRQA 3OQ5A 1WGSA 3M54A 4O6JA 2V8KA 3CCMA 1KHIA 4FL6A 2RHIA 2LX9A 5CQXA 4XAXB 3LYIA 3E19A 4ZGJB 4M7AG 4ZN3A 4M7AF 2P4TA 3BDUA 1JBMA 1I8FA 3QZ5B 1VQOA 2IVWA 4XTYA 1YJNA 1JJ2S 4J7IA 3QXEB 4HCZA 5CVIA 2AHJB 3L42A 3VKIA 5GMKm 1O75A 4KUIA 4BACA 4BE2A 4ELZC 5C6SA 4KUDK 3O8VA 2RI3A 2VGNA 3OYHA 2DJZA 2Y90A 3QHSA 4IUTA 3OYLA 3CXCA 2DXUA 2XDPA 5L8RE 3SWNB 2K3YA 3OBYA 3UPUA 4M75C 2NLUA 1BKBA 4JLIA 2R58A 4JLGA 3M9QA 2E41A 4MDWA 1X01A 4NL2A 3CC4T 2LCLA 2BUDA 3JCMP 4C92C 2QA4A 3DB3A 4EMKB 1Y96A 3PIPA 1KQ1A 3JB9J 5CKFA 4DOWA 5LJ3e 3OYJA 5DY9A 4BDYA 3M57A 3S3NA 1Q82C 3INZA 4MMLA 4N4GA 2GCXA 2MF2A 3C12A 3CD6A 4HCCA 4OGCA 3VU3C 1K73U 4LDXA 1IREB 1N9SA 1X75C 2R5AA 4M75B 1LJOA 2D9TA 5CKEA 4M7AA 2A3LA 4KT0E 3MEVA 1VQMT 3J80E 4A4EA 1VIFA 4QVZA 1KHCA 1OZ2A 3CEYA 1W2BA 4ZGDB 2RK2A 2V8IA 3A8GB 4PJOD 4J6XA 3FDRA 5GAOm 2FHDA 4F7UB 4NS5A 4ZTFA 3QO3A 1VQ4T 1LOJA 4MZMA 3RERA 3HSBA 2K5LA 1OI1A 3GLXA 4BE0A 3BY7A 3NTIA 2JOYA 2VXEA 3A8HB 3QJYA 1M1FA 4M78A 1B34A 4C92B 1KD1U 4Y91A 4BD3A 3QPHA 2G3RA 4M77D 3HFNA 4XK8E 3QSUA 3TCJA 4FT2A 4OVAA 3CCJT 2RHZA 4OMFB 4R56A 1W4SA 2Y4YA 4IKFA 2L3RA 4M75E 1KG1A 4FU6A 3M55A 3JCMh 4DOVA 1U8RA 1JJ2A 3OYYA 3G6ET 5CO7A 3RESA 2XICA 1VQ7A 2QQSA 2L89A 1M90U 1VQKT 1AHJB 3N5BB 4JRIA 3G4SA 1M90C 1YBYA 2D6FA 3QJ6A 1N8RU 5KE2A 3LGFA 5CAIA 3NFCA 4PLIA 3S3MA 4KBMB 3VUBA 1ZBXA 3OYIA 1XOVA 2GQVA 4RG2A 5GAOp 4C92F 1VQ4A 1TH7A 4LDYA 3SB2A 1VQ9T 1ZQ1A 3A8LB 3OS2A 4M7DD 4ATOA 4A4FA 1Y7XA 2DAQA 3BFMA 4LDVA 4M75F 4XTXA 5LJ5d 4HKEA 5C0MA 3NTHA 2OTJT 4ELYC 4JUVA 3JCMV 5LJ3h 2KAFA 4C8QF 3CCRT 4DA4A 3MEWA 3CD6T 2YHTA 5LJ3j 3JB9G 3GPLA 3PTAA 2LNVA 2E64A 4Z02A 4M75A 5LJ3g 4RCBA 1VQPA 1O9SA 4MDXA 2V8JA 3CCEA 5FLXE 2ZPGB 3I56A 5GAOr 4MZTA 3A5ZB 3RUXA 2QA4T 2Y4XA 3HFOA 1Q81U 1G5VA 1VUBA 1D3BA 3HRUA 1VQ5T 4XTVA 3PMTA 2X4XA 4E47A 1OYXA 2RJCA 4LDUA 1Q86C 3ZFJA 5D6XA 3JAME 3I55T 2KY9A 2FVUA 5GAN6 3CPWA 5GAN7 1GXIE 2E6NA 1YIJA 3JB9D 1I81A 2JTMA 1NJIU 3M58A 4L6V5 3OSSC 5A0LA 1Y71A 5FU7B 2DKGA 2ZCFB 4QVCA 4BE1A 2DK3A 2O01E 2ZPBB 2P0KA 3S3OA 2KDSA 1KC8C 1WJSA 2DD5A 3TU4K 4EMKC 4J7FA 1UGQB 5GAMg 4VUBA 2DD4A 3CCMT 3V7RA 3JB9H 3JCMd 4FSXA 4JDSA 1H3ZA 4C5EA 2MWOA 2RA2A 4F7UF 4A53A 3JCMJ 3CC2A 2JZ2A 5IN1A 1YI2A 2LT4A 1M9SA 1K73C 2OAUA 5M9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKF A;  1M1F A;  5HK3 A;  4MZP A;  4HKE A;  3JRZ A;  4ELY C;  5CKD A;  2C06 A;  3TCJ A;  2MF2 A;  5CQX A;  5CQY A;  5CKE A;  1X75 C;  2VUB A;  1NE8 A;  5HKC A;  1UB4 A;  5CK9 A;  4ELZ C;  5DLO A;  3G7Z A;  4ME7 A;  5CO7 A;  5CCA A;  4MDX A;  4VUB A;  4MZT A;  3JSC A;  5CKH A;  3NFC A;  4MZM A;  1VUB A;  4OF1 A;  5CR2 A;  2KMT A;  3VUB A;  3HPW A;  5HK0 A;  5CKB A; 
#chains in the Genus database with same CATH topology
 3M5A A;  5I21 A;  3EG9 B;  5GMK l;  1D1C A;  1JXO A;  2E5Q A;  5CQY A;  2RJD A;  2DXT A;  2RQW A;  1PKS A;  4PL6 A;  1GCQ C;  3CC7 A;  5LJ5 h;  4AFQ C;  3CC4 A;  4BI3 A;  2PVD B;  1VQN A;  1BCO A;  2COY A;  1K76 A;  5KYU A;  3OYB A;  3JCM Q;  1YN8 A;  4OGE A;  2QEX A;  4XU0 A;  1R8O B;  4M7D B;  2DXC A;  3EAE A;  2M51 A;  3OW2 P;  3CC4 Q;  3RKY A;  1BU1 A;  4F7U E;  3FRN A;  1WX6 A;  4C0G A;  1K9A A;  2KRS A;  2D1X A;  4DEX A;  2LQK A;  2F2X A;  3DKM A;  1UDL A;  3PT9 A;  2IG0 A;  1Q7Y R;  1OPK A;  4J9F A;  3H6Z A;  2GTJ A;  1TUG B;  3NHN A;  3REB B;  1XTD A;  3RKW A;  3MJX A;  3CCJ A;  1IZ6 A;  4M77 F;  4X34 A;  1M2V A;  3HHT B;  4O5V A;  1QVP A;  4GLM A;  1Q82 U;  4M78 C;  2J05 A;  1AT1 B;  4FCY A;  5GAM e;  2PQW A;  4IUR A;  4M7A B;  4RTU A;  4FW2 A;  1TU0 B;  4RTZ A;  5HK3 A;  3P8B B;  2KBT A;  3EGD A;  2RJF A;  2O2O A;  1M1K C;  1UE9 A;  1OX8 A;  4DBF A;  4PK4 A;  3X28 B;  1K73 C;  5FU7 C;  3QUI A;  1EIF A;  4ANJ A;  4AG1 C;  3AHU A;  4PKC C;  2DX1 A;  4FYX B;  2EYY A;  4X9C A;  3GF5 A;  1U5S A;  3OYG A;  3RBB B;  2KT8 A;  3LX7 A;  3JCM f;  2E4H A;  3F70 A;  2PZ1 A;  1VYV A;  3E9G A;  3JV3 A;  2LT1 A;  2VC8 A;  4OF1 A;  1XJW B;  5GMK i;  3M0T A;  1MNE A;  3HPW A;  3QG1 A;  3UA6 A;  5ECA A;  5HK0 A;  2KT1 A;  3V8J A;  4N0A A;  4BUG A;  1WHG A;  2BE9 B;  2LJ1 A;  1OUL A;  1YP5 A;  2C0I A;  1Q95 G;  2A7Y A;  1M90 R;  1YIJ T;  4C8Q G;  2NUT A;  1Q7Y U;  3ZL7 C;  1Q81 C;  4RMO A;  4CC4 B;  1PKT A;  4II1 A;  5FRN A;  2K3X A;  2DA9 A;  3V7C A;  2R57 A;  3E9F A;  3EHQ A;  3X24 B;  3SDZ A;  1QQJ A;  1G3Y A;  4PJO B;  1PNJ A;  3C95 A;  3S6W A;  4QT7 A;  3I9Q A;  4C8Q E;  2FYK A;  4JJD A;  5IHN A;  2EW3 A;  4AFZ C;  3MP6 A;  1Q86 R;  4M77 E;  3H0F A;  3JCM c;  2OTL A;  1JEG A;  1KC8 U;  2QK0 A;  1S72 Q;  2D8H A;  2HNI A;  4IUQ A;  2O9V A;  4OML A;  4JRP A;  1SG5 A;  4M78 B;  1WHM A;  4N4H A;  4BY6 B;  4AMC A;  4M77 C;  5FRM A;  2YUN A;  2LDM A;  1JRI A;  3CPW P;  5GAN e;  5LJ3 d;  1VQM A;  1H92 A;  2AT1 B;  3HP9 A;  1VOM A;  2DEQ A;  2KYM A;  1Y96 B;  2BZ8 A;  2LQW A;  4L59 A;  5GAM h;  3PVQ A;  3LWI A;  1KFZ A;  4JS4 A;  4UC4 A;  1YHQ Q;  2QI2 A;  4HT9 A;  2PU9 B;  2DMO A;  1JJ2 P;  2X35 A;  2J6O A;  2DIG A;  3J7A F;  3ULR B;  1YCS B;  2A36 A;  3EFR A;  3FB9 A;  2HSP A;  5KE3 A;  4OMP A;  2QEX Q;  3CCJ Q;  2XU8 A;  3M59 A;  4LDW A;  2A08 A;  4Z89 A;  2BE7 D;  1I1J A;  3FLG A;  4QQ6 A;  4C8Q A;  4E7Z A;  2JN0 A;  9ATC B;  1QWF A;  4M78 G;  3TSZ A;  2QQR A;  1MHN A;  2DL8 A;  2QA4 Q;  4F17 A;  1YJ9 A;  1TUD A;  4HVW A;  3NMZ C;  2RM4 A;  3CBM A;  3GBQ A;  1SSF A;  2GQI A;  1Q86 U;  2DLP A;  2XKO C;  1QVF S;  2FZC B;  4M77 G;  1KQS A;  2QQA A;  4M77 A;  2CH4 W;  1YIT Q;  2R5M A;  1NEB A;  3PMI A;  1W2B S;  4OB3 B;  1Q7Y C;  2CP6 A;  4IIM A;  4HVU A;  5IH2 A;  4DBR A;  5KH6 A;  3OYC A;  1K9M R;  1V76 A;  5GAN 4;  1QVF A;  2LRQ A;  1AWO A;  3OQ5 A;  1WGS A;  3M54 A;  2V8K A;  5CQX A;  4XAX B;  4M7A G;  3E19 A;  4ZGJ B;  1WHL A;  4PFZ A;  4PJN A;  1JJ2 S;  3QXE B;  1VQ4 Q;  5GMK m;  3U23 A;  4ELZ C;  2Y90 A;  3EG3 A;  4IUT A;  2DXU A;  2XDP A;  2OAW A;  3UPU A;  2DNU A;  1AEY A;  2R58 A;  4C92 C;  3DB3 A;  3S3N A;  4DOW A;  2KXD A;  4MML A;  3C12 A;  2KI7 A;  1PRL C;  4HCC A;  1K73 U;  1N9S A;  2D9T A;  5AT1 B;  1KHC A;  1D09 B;  2FO0 A;  1NEG A;  3VS2 A;  4ZTF A;  4AFU C;  4MZM A;  2K5L A;  3QWX X;  3GLX A;  1VQK Q;  2AKL A;  2YXY A;  1M1F A;  2I0N A;  1QCN A;  1QKX A;  1W4S A;  3JCM h;  3OYY A;  2COZ A;  1KK7 A;  3G6E T;  2XIC A;  1VQK T;  3N5B B;  1HJD A;  1M90 C;  1FYN A;  4OMM A;  2DRK A;  3LGF A;  3NFC A;  5GJW B;  3VUB A;  2GQV A;  1VQ4 A;  1WXB A;  2KNB B;  5KYW B;  2K9G A;  1Y0M A;  1ZLM A;  4LDV A;  4M75 F;  5C0M A;  3NTH A;  4F16 A;  2OTJ T;  1ZSZ A;  2K2M A;  4C8Q F;  1KD1 R;  3GPL A;  2EVR A;  3H0H A;  1TTH B;  2RQT A;  1MMN A;  1VQM Q;  1O9S A;  1MMG A;  3M0Q A;  4MDX A;  2IIM A;  2DJQ A;  2V8J A;  4MZT A;  1Q81 U;  1VQ5 T;  1D3B A;  1YNZ A;  4XTV A;  3PMT A;  4E47 A;  2HBW A;  3SEM A;  2COW A;  5GAN 6;  2X51 A;  3CPW A;  2AKK A;  2E6N A;  4LNP A;  3CCU Q;  1W70 A;  1Z9Z A;  2EQI A;  2RQV A;  2O01 E;  2ZPB B;  1WJS A;  4EMK C;  1UGQ B;  2DD4 A;  3FJ5 A;  4ZNX A;  3JCM d;  4FSX A;  1ZUK A;  3JCM J;  2CUD A;  1NPR A;  2HQX A;  1JXM A;  1UHC A;  1YCY A;  2LC4 A;  1VQ9 A;  1QP2 A;  1M3A A;  2K2V A;  4XQ3 A;  1YJW T;  2DZC A;  3JCM X;  2O31 A;  1PSF A;  1HYO A;  3EFO B;  3UWN A;  2KRO A;  5IXF A;  1D0X A;  1UHF A;  3OSV A;  1T3L A;  1IGU A;  4RUG A;  1IB8 A;  3KUF A;  3PE0 A;  1E6H A;  5GAN 5;  3TEE A;  3OY9 A;  1I4K 1;  2JS0 A;  1RL2 A;  2ZPI B;  2VV5 A;  2E70 A;  1QCO A;  4C0D B;  2DYB A;  4E7H A;  5GAO l;  1E7O A;  1QLY A;  2EIF A;  1K8A R;  2DTO A;  2O9S A;  1YHQ T;  2RI2 A;  1YIT T;  4OMO A;  2DZ9 A;  2RD1 A;  4ZGE B;  1V29 B;  1EZZ B;  1UJ0 A;  2WSF E;  3SWN C;  3LH0 A;  4PJO C;  2XMF A;  2VXF A;  2PTK A;  1UGR B;  5GMK e;  2FZG B;  2RQR A;  2JTF A;  2YUO A;  2QQ9 A;  4FYV B;  2ROT A;  1U3O A;  1G3T A;  1ABO A;  1QVG S;  2RO0 A;  4Y92 A;  3L2W A;  1SRM A;  2RMO A;  4D8K A;  1VQ9 T;  5DM7 R;  2HQE A;  1RLP C;  2ZGW A;  3RR6 A;  3R6N A;  2V26 A;  2ZAE A;  5FU6 B;  2DBK A;  1UG1 A;  4J5Y A;  3OS1 A;  4A4H A;  4BI8 B;  2OTJ A;  4XU1 A;  3UA7 A;  2F5K A;  4YTL A;  3R6O A;  1M8V A;  1QW1 A;  3VV0 A;  1WHJ A;  3LWH A;  2B86 A;  2X4W A;  1FMK A;  4E7I A;  2EYQ A;  2M9U A;  1CSK A;  4A4G A;  2FPF A;  2OJ2 A;  2RPN A;  2PVG B;  4C5H A;  1K73 R;  4XU2 A;  2LCC A;  4A4K A;  2EGC A;  4RKU E;  1QVG P;  2DTH A;  2FZK B;  1TG0 A;  1M4Z A;  3L2Q A;  2YRD A;  4QW2 A;  2BIV A;  3H0I A;  3BDL A;  5EG2 A;  5CCA A;  4LD6 A;  2ECZ A;  2LJ3 A;  3VS0 A;  5KCO A;  1WFW A;  2KRM A;  4F04 B;  2M0O A;  5LJ3 f;  1TOV A;  3OYK A;  4QQG A;  3E2U A;  2CZ7 B;  5GAN d;  1AZG B;  1VQ7 T;  3L1A A;  1KQS P;  2EQU A;  1U1S A;  3CCL T;  2ZPE B;  2F2V A;  3JB9 F;  3CCV A;  1NE8 A;  2LJ0 A;  5HKC A;  3O5Z A;  1UGP B;  1NPP A;  4M77 B;  3C94 A;  3GOX A;  1WNL A;  4JZ3 A;  3OYM A;  2E12 A;  2RK1 A;  2LTO A;  1OEB A;  5I2S A;  1PM3 A;  3EGX A;  1YJN T;  5KYY B;  1VQ6 T;  2QG9 B;  2DO3 A;  4FSS A;  3G4S T;  3DLM A;  1JB0 E;  1QP3 A;  2EGA A;  3EG2 A;  3G71 Q;  2FG0 A;  3LW5 E;  2RF0 A;  2CZ0 B;  3JCM W;  3OW2 S;  4HCB A;  3URG A;  2NUZ A;  5GAO q;  4BI4 A;  1RI0 A;  3CD6 Q;  1KC8 R;  4C5G A;  3FIF A;  2XID A;  2C06 A;  1P92 A;  2EQM A;  2RJE A;  1VQ8 A;  1ZHI A;  4IUP A;  5IT9 E;  1B3Q A;  3UT1 A;  3QII A;  1I5L A;  4GLK A;  4QVD A;  1YWO A;  4LUD A;  1J3T A;  1OU9 A;  3ME9 A;  4PJO F;  1RAG B;  5IHK A;  3V8K A;  4M7A E;  3M0R A;  1YJN Q;  4JRQ A;  1T0H A;  4BB7 A;  3M0S A;  5I11 A;  2ROL A;  4HA8 A;  1WXU A;  3CCS T;  1PRM C;  3I35 A;  4GBQ A;  3KBG A;  3CQT A;  4E2F B;  3CCM Q;  2DTI A;  4OB2 B;  5FU6 C;  1VQN Q;  1MMA A;  2BKD N;  2CT3 A;  1NZ9 A;  3M4G A;  3CCL A;  2CP0 A;  2MK5 A;  5AYF A;  1YJW A;  3UF4 A;  2EFI A;  1AVZ C;  3EG1 A;  4FT4 A;  3PGG A;  4ESR A;  1SRL A;  2X4Y A;  4HXJ A;  4PFP A;  4QQD A;  4ME7 A;  1UTI A;  2QQB A;  4X1V A;  2YWW A;  1GBQ A;  2SEM A;  2XG8 D;  5FWC A;  1K8A C;  5GMK j;  1LNX A;  3X26 B;  1XNI A;  1VQL A;  5GAN 2;  1N8R R;  4M78 D;  1WIE A;  4OB0 B;  3ZEH A;  1R77 A;  2H3E B;  1TWB A;  1DJ7 B;  1VQP T;  1ZBJ A;  1WJR A;  3CMA A;  3CCS A;  1WHK A;  3EG0 A;  1GL5 A;  1QKW A;  3CCM A;  2PNI A;  1QWE A;  4ZN3 A;  2LQN A;  2P4T A;  1I8F A;  3QZ5 B;  1YJN A;  4J7I A;  3VKI A;  1O75 A;  4KUD K;  2CP3 A;  2JXB A;  5C6S A;  2VGN A;  5L8R E;  1R0C B;  2ED1 A;  4M75 C;  1F1B B;  4JLG A;  4J9C A;  2DER A;  3PIP A;  1KQ1 A;  2CDT A;  3OYJ A;  2MYS A;  1PG5 B;  4N4G A;  2BTT A;  2GCX A;  2MF2 A;  1JU5 C;  4CC7 A;  1LJO A;  2A3L A;  4A4E A;  1OZ2 A;  3CEY A;  1Q82 R;  2V8I A;  7AT1 B;  3FDR A;  4K11 A;  1VQ4 T;  1ABQ A;  2DEU A;  1IHV A;  3HSB A;  1OI1 A;  3BY7 A;  2VXE A;  3QJY A;  4M78 A;  1KD1 U;  1SKU B;  3QPH A;  4M77 D;  2F2W A;  3HFN A;  2JMA A;  3QSU A;  3EGU A;  2RHZ A;  2Y4Y A;  2L3R A;  1KG1 A;  4DOV A;  2E3I A;  1AWW A;  3G1J A;  1VQ7 A;  2QQS A;  2L89 A;  4JRI A;  4CC2 A;  1K0X A;  3S3M A;  1W1F A;  2M0Y A;  1ZBX A;  4C92 F;  1TH7 A;  3UAT A;  3A8L B;  4LE9 A;  3OS2 A;  4ATO A;  4A4F A;  4J9H A;  4AT1 B;  2YUQ A;  4JUV A;  3BE3 A;  4A63 B;  1H3H A;  3CD6 T;  3JB9 G;  5LJ3 j;  4R0K A;  2KYB A;  2LNV A;  4M75 A;  5LJ3 g;  4RCB A;  1VQP A;  2EYX A;  2X9H A;  1ZSZ C;  2ZPG B;  3I56 A;  5GAO r;  1WYX A;  1X6B A;  2Y4X A;  1ARK A;  2RJC A;  2KE9 A;  5D6X A;  2KY9 A;  1VQ8 Q;  5GAN 7;  1WI7 A;  4KH0 B;  1I81 A;  3HTR A;  3M58 A;  3OSS C;  5A0L A;  2ZCF B;  4E6R A;  1KC8 C;  3TU4 K;  5FW9 A;  1WZO A;  2ESW A;  4J9B A;  1CKA A;  3QWY A;  5KYN A;  4VUB A;  2BZY A;  2VVK A;  3V7R A;  1MUZ A;  2GGR A;  5D7U A;  1PCX A;  2DIL A;  4JDS A;  3IQL A;  2RA2 A;  3CC2 A;  1PD0 A;  2OAU A;  2K79 A;  2OTJ Q;  2EKH A;  1AWJ A;  2HMA A;  4OB1 B;  2O4X B;  3OW2 A;  1VYU A;  4JJN K;  1M8M A;  2AK5 A;  1ZA1 B;  3JB9 I;  1EX4 A;  1S72 T;  2HKQ B;  3CXC P;  2MAM A;  3X25 B;  1E6G A;  1WA7 A;  3TVT A;  1IGQ A;  5GAN h;  1G8X A;  1WXT A;  2L0A A;  1VA7 A;  2FB7 A;  2WSC E;  1X6G A;  3JRZ A;  5FWB A;  5FRO A;  5A2Q E;  3A8O B;  1M27 C;  1VQ6 A;  5DLO A;  3CMA Q;  5HCK A;  1N9R A;  2SRC A;  3HRS A;  2XD0 A;  2WSE E;  3QDR B;  5GAN j;  2J6F A;  1YFN A;  4WF2 A;  4C92 E;  2GNC A;  1SSH A;  3CXC S;  2MWP A;  3EGX B;  1MMD A;  3SWN A;  2K57 A;  2YSQ A;  3EG9 A;  1VQL Q;  1HXD A;  2L8D A;  2D0Q B;  1C0M A;  1HSQ A;  4M7D E;  2NUP A;  2CYZ B;  3VS5 A;  4C5I A;  2K5I A;  1KIK A;  4PFO A;  2EWN A;  2FRW A;  1NYG A;  3A1P A;  2AZS A;  2MMP A;  5A0G A;  1WDX A;  5L23 A;  4PJM A;  3H9N A;  4MMK A;  1BK2 A;  4LN2 A;  4MZP A;  3MO8 A;  3HKS A;  3OMG A;  4XTU A;  4B9W A;  4L5G A;  2EJ9 A;  4XU3 A;  2E1H A;  2QTX A;  4J9E A;  2FPE A;  5GJV B;  2EPD A;  3OYA A;  3CCS Q;  2YUP A;  3VYH B;  2RHX A;  3ZBD A;  2ZZD A;  3A98 A;  2YLB A;  4RTX A;  1RAH B;  3P8H A;  2GF7 A;  4Y28 E;  2VYT A;  2PUK B;  5GAN 8;  3G6E A;  1D0Z A;  5IHI A;  1TSF A;  3MKD A;  3MHX A;  2XK0 A;  3G71 T;  2ENM A;  3VS6 A;  1UFF A;  4M7A D;  5GAM j;  4ZN1 A;  2W10 A;  3CCL Q;  5KYX B;  5LL6 S;  4C92 D;  3CBO A;  3LGL A;  4RTW A;  3RIR A;  1OX9 A;  2DXB A;  2JS2 A;  4KUL A;  4JJC A;  4TVR A;  4JS5 A;  3M0P A;  5HY6 A;  2LQ8 A;  1MV3 A;  2MI6 A;  1H8K A;  2EGE A;  1S1N A;  2K4Y A;  3OA6 A;  2X4J A;  2JNG A;  2EAY A;  4C8Q B;  1OQK A;  1KSW A;  3P8D A;  4HVV A;  1PSE A;  2EJG A;  2KVQ G;  3M56 A;  2J7I A;  1OOT A;  3FEO A;  3JCM e;  3JSC A;  4M4Z A;  2EJF A;  1IRX A;  2ZPH B;  3VS1 A;  4FW1 A;  3CCR A;  3Q1J A;  1VIE A;  3M0U A;  2HKN A;  3VS7 A;  4M7A C;  2DL3 A;  1Y07 A;  5A0D A;  2EQJ A;  3EH1 A;  4F7U A;  4M7D A;  1C6V X;  1U1T A;  4BDZ A;  4M78 E;  2KK4 A;  4F7U G;  2K7A A;  1WQ7 A;  4RG8 A;  1QMC A;  5GAM d;  2VAS A;  4E7L A;  3G71 A;  2RHY A;  3EH2 A;  1VQ5 Q;  2MOX A;  4OMQ A;  5D6W A;  2NUT B;  3L2R A;  2KMT A;  2O4X A;  4PLL A;  2QDL A;  1ZX6 A;  3CCV Q;  5GAN g;  4PJO G;  2DL5 A;  2CT4 A;  1MND A;  1MGQ A;  8ATC B;  3RDV A;  3QYH B;  4RTT A;  2QAS A;  1N27 A;  3THK A;  2LP5 A;  4DEY A;  3ER0 A;  2DPP B;  3FC3 A;  3G7Z A;  4PNO A;  4FM4 B;  4EMG A;  3CCQ A;  1K0S A;  5KYY A;  2PVO B;  3WVE B;  3OYN A;  2A37 A;  1BI3 A;  1BI1 A;  1YHQ A;  1KQS S;  1EFN A;  4J6W A;  3HRT A;  1SHG A;  2CP5 A;  4IIO A;  1HK9 A;  4PJO A;  2LMJ A;  1VQ8 T;  2E3H A;  4NL3 A;  3UDC A;  1UGS B;  2E6Z A;  1FWZ A;  2CH4 A;  4JRK A;  4CI0 C;  2B8A A;  1YIT A;  3MPU B;  2RB6 A;  1UUE A;  1KQ2 A;  1BBZ A;  3M4Y A;  4FYY B;  3PFS A;  4E7K A;  2P0Q A;  3CC2 T;  1AWX A;  1M30 A;  2EBP A;  2DIQ A;  2HAX A;  1M3C A;  2CZ6 B;  3CCQ Q;  1RAE B;  1TS9 A;  3QYG B;  3RMS A;  2H3J A;  3D7S B;  1D0Y A;  4EMH A;  1G3W A;  4EDU A;  3OYF A;  3CCU A;  1VQO Q;  1I5O B;  2RI5 A;  1NJI C;  1NLO C;  5CKD A;  2GFA A;  2M02 A;  2LNH B;  3CPF A;  2OTL T;  3MP8 A;  4M78 F;  1N8R C;  3CC7 T;  1S72 A;  3PNW C;  1Y57 A;  3I5S A;  1A0N B;  1YI2 T;  4PJL A;  2X3X D;  2CGH A;  4KGV B;  1RAI B;  4O6J A;  1FMV A;  4FL6 A;  2LX9 A;  1WLP B;  3LYI A;  1PHT A;  2QGF B;  3KFV A;  1TXQ A;  2J06 A;  4RTV A;  5CVI A;  2AHJ B;  3L42 A;  2RI3 A;  3CCR Q;  3OYH A;  2DJZ A;  3CXC A;  1M3B A;  3I55 Q;  3SWN B;  2K3Y A;  3OBY A;  1UGV A;  2NLU A;  4JLI A;  2GTO A;  2E41 A;  3M9Q A;  1N5Z A;  3CC4 T;  2LCL A;  2BUD A;  2E5K A;  1X27 A;  3JB9 J;  5LJ3 e;  1NG2 A;  4BDY A;  3M57 A;  1X2K A;  1Q82 C;  2DL7 A;  2DL4 A;  3VU3 C;  1IRE B;  4KT0 E;  4PJJ A;  2HQH A;  1JO8 A;  2ABL A;  3MEV A;  1VQM T;  1W2B A;  4ZGD B;  3TSW A;  4PJO D;  4J6X A;  4JZ4 A;  3SHW A;  1D1B A;  5KYW A;  4F7U B;  3EFO A;  3QO3 A;  2W0Z A;  3RER A;  1ZSZ B;  4JJB A;  4BE0 A;  3NTI A;  3A8H B;  2BZX A;  4Y91 A;  4BD3 A;  4LXC A;  3VRZ A;  4XK8 E;  5I22 A;  4OVA A;  4M75 E;  4FU6 A;  2KEA A;  1U8R A;  1JJ2 A;  1LCK A;  3RES A;  1X43 A;  2DRM A;  3G4S A;  1RI9 A;  1YBY A;  2D6F A;  1N8R U;  2DBM A;  4JPB W;  5CAI A;  5KE2 A;  2CP2 A;  3OYI A;  4RG2 A;  2EYW A;  3H41 A;  4LDY A;  4M7D D;  1G2B A;  2NUP B;  3BFM A;  4HKE A;  2NYS A;  5LJ3 h;  2KAF A;  2AZV A;  3CCR T;  1BB9 A;  1ZSG A;  1QVF P;  2L3P A;  5FLX E;  3A5Z B;  1YJ9 Q;  1I0C A;  3HFO A;  1OU8 A;  1G5V A;  1VUB A;  3HRU A;  1GRI A;  2X4X A;  1OYX A;  4LDU A;  1Q86 C;  3I55 T;  1VQ9 Q;  1R0B G;  1YIJ A;  3JB9 D;  2JTM A;  1RLQ C;  2DYI A;  4QVC A;  4BE1 A;  1GBR A;  2DK3 A;  2OTL Q;  2P0K A;  2KDS A;  2DD5 A;  2RN8 A;  4J7F A;  2KR3 A;  3CME Q;  2JMC A;  2LX7 A;  3G4S Q;  3CCM T;  3JB9 H;  2MWO A;  5IN1 A;  1NM7 A;  1M9S A;  4KH1 B;  5M9O A;  2E65 A;  4BY6 C;  4CRI A;  1YIJ Q;  2F69 A;  4IUU A;  1ACM B;  5J3B A;  2WAC A;  1QVG A;  2EQK A;  2O88 A;  2X3W D;  5CK9 A;  2JVV A;  1U06 A;  3A8M B;  5GAN f;  3VS4 A;  4LD9 K;  1LPL A;  1W6X A;  1RAD B;  1UEB A;  3L2Z A;  3RMQ A;  4M75 G;  2LZ6 B;  2YLC A;  5LJ5 f;  4FYW B;  1SF9 A;  3JCM g;  2DFU A;  3MCA B;  3VYG A;  1LVK A;  1X69 A;  2XHC A;  2JJ9 A;  3LLR A;  4Z88 A;  3CC2 Q;  3MP1 A;  2DM1 A;  1GCP A;  4C92 G;  2HD0 A;  2K6D A;  4RCC A;  3QDF A;  2QEX T;  1B34 B;  4C92 A;  4HT8 A;  8AT1 B;  1ZA2 B;  4C0D C;  2M1H A;  5LJ5 g;  4OP0 A;  2QTV A;  4HCK A;  1HD3 A;  2F1L A;  4B9X A;  3GNG A;  2H8H A;  2FL7 A;  2ATC B;  1ZUY A;  3C4S A;  3OYD A;  1FX7 A;  2EKO A;  1G3S A;  1M2O A;  2RNA A;  2FRY A;  3RKX A;  1NJI R;  1AZE A;  3SD4 A;  1VQ5 A;  4J8O A;  5CKH A;  4V2S A;  4C8Q C;  3H8Z A;  3MEA A;  1SHF A;  2E10 A;  3MET A;  2QAZ A;  1NYF A;  2XDB A;  1SPK A;  3WXM B;  5CKB A;  5GAM f;  1N6A A;  3QKJ A;  2CRE A;  2KGT A;  4ZTJ A;  2JUF A;  1WJQ A;  3QZ9 B;  2MCN A;  5IXB A;  1I07 A;  3FJP A;  1TUC A;  1D3B B;  3CME T;  2DET A;  4AG2 C;  1M5Q 1;  2LCS A;  2KRN A;  4D6W A;  1BIA A;  2F5T X;  3QBY A;  1WPY A;  1BI0 A;  2ED0 A;  1M1K R;  1PWT A;  2FPD A;  1NBE B;  2DVJ A;  3NTK A;  3TRE A;  4N4I A;  3CCV T;  2L3S A;  3E1S A;  4XTW A;  4EPC A;  2MIO A;  2MPX C;  5EC7 A;  4WTO B;  3G6E Q;  3DLL A;  4DQ2 A;  5KYU B;  2K3B A;  3KXT A;  2P0P A;  3M53 A;  1Z9Q A;  4RTY A;  1RUW A;  4N0A C;  3SFM A;  1VQP Q;  1H64 1;  3DB4 A;  1RAF B;  2CS7 A;  1BYM A;  4B6M A;  4C0Z A;  3VUZ A;  1Q81 R;  3T9N A;  3LH5 A;  3PIO A;  3WVD B;  1RAC B;  4WCI A;  1RAA B;  4EMK A;  2VKN A;  4D8D A;  2P84 A;  1M1K U;  3CPW S;  1OV3 A;  4NOY A;  4E7S A;  1AD5 A;  2C0T A;  4FIB A;  3CC7 Q;  3CME A;  3I56 T;  2VGM A;  1K1Z A;  3CCE T;  5LJ5 j;  4IUV A;  5KCH A;  3HL8 A;  4M7D G;  1M2V B;  1K8A U;  4C8Q D;  3J81 E;  3V7S A;  1BIB A;  2ZPF B;  3OB9 A;  4E7J A;  3CCQ T;  4M75 D;  4F14 A;  3X20 B;  1OPL A;  1UB4 A;  2YRV A;  4M7D C;  2RH2 A;  2G6F X;  1XQH A;  2JW4 A;  2LVM A;  2CUB A;  2GBQ A;  1T3S A;  2HSE B;  2V1Q A;  5CR2 A;  2DF6 A;  1KD1 C;  2J6K A;  5J26 A;  1VQN T;  2DVE A;  2CZ1 B;  2L2P A;  1OZ3 A;  1G83 A;  2VWF A;  2CKK A;  3CBP A;  3EGD B;  1WQW A;  5GAN 3;  1PD1 A;  1RAB B;  4PJO E;  1D1A A;  1FXX A;  2VUB A;  2YRC A;  2KQW A;  3V8L A;  2AIR B;  4GY5 A;  1W2B P;  3GNF B;  1SEM A;  1VQO T;  3BW1 A;  4A54 A;  2JM9 A;  1VQ6 Q;  2Z0W A;  2M16 A;  3ASK A;  3L2U A;  5J39 A;  2QXF A;  4QKU A;  5I2M A;  2QDY B;  1M1G A;  2HL5 C;  2CP7 A;  1YI2 Q;  1WHH A;  1VQK A;  5CIU A;  4OMN A;  3VS3 A;  2HDA A;  4CC3 A;  2RHU A;  2XI9 A;  3EFS A;  2FEI A;  3I55 A;  4Q5W A;  1VQL T;  4R55 A;  2KSS A;  4J6Y A;  3CCU T;  4ORZ A;  5GMK h;  3GIB A;  4P5N A;  2HBP A;  5IAY A;  2C0O A;  1X6O A;  3MEU A;  4C0F A;  4KRT A;  4XTZ A;  1PC0 A;  1YJ9 T;  3CMA T;  4M7D F;  2GFU A;  1BI2 A;  5DLQ E;  3VJP A;  2EYZ A;  3OBW A;  3I56 Q;  1X2Q A;  1IXD A;  3OYE A;  2JT4 A;  3GP8 A;  2PUO B;  2K5F A;  2I2L A;  5D6Y A;  1GCQ A;  4Z8A A;  2A28 A;  3JCM b;  2XDD A;  1MV0 B;  3OS5 A;  1CKB A;  1JQQ A;  6AT1 B;  3L2V A;  4J83 A;  5GAO n;  1IHW A;  1K9M C;  4DBQ A;  3VRY A;  1K9M U;  1KJW A;  2VB6 A;  2D0N A;  4J9I A;  4X9D A;  1GFD A;  3OMC A;  4EIK A;  2P4R A;  5LJ5 e;  3OS0 A;  2L5Q A;  4KGZ B;  2IPO B;  4KGX B;  1KHI A;  2RHI A;  4M7A F;  4J9D A;  3NGP A;  3BDU A;  1JBM A;  2CSQ A;  2V1R A;  1VQO A;  2IVW A;  4XTY A;  4HCZ A;  4KUI A;  4BAC A;  4BE2 A;  3O8V A;  3QHS A;  3OYL A;  2JTE A;  1BKB A;  1QCF A;  4MDW A;  4NL2 A;  1X01 A;  3JCM P;  2QA4 A;  4EMK B;  1Y96 A;  1V1C A;  3PVL A;  5CKF A;  5DY9 A;  3INZ A;  4J9G A;  1VYT A;  2KXC A;  3CD6 A;  4OGC A;  4LDX A;  5CKE A;  1X75 C;  2R5A A;  4M75 B;  3REA B;  4M7A A;  3J80 E;  4QVZ A;  1VIF A;  3AT1 B;  2RK2 A;  3A8G B;  1YWP A;  1T0J A;  2HCK A;  5GAO m;  2FHD A;  4NS5 A;  1LOJ A;  2OI3 A;  1BCM A;  1B7T A;  2JOY A;  2L3Q A;  1B34 A;  4C92 B;  1YJW Q;  2HL3 A;  2G3R A;  4LUE A;  3TCJ A;  4FT2 A;  3CCJ T;  2QGG A;  1GFC A;  2HEQ A;  2RQU A;  4OMF B;  4R56 A;  4IKF A;  1UJY A;  3M55 A;  3TQ7 P;  5CO7 A;  3C0C A;  2OX7 A;  1M90 U;  1AHJ B;  3NPF A;  3QJ6 A;  4PLI A;  4KBM B;  1XOV A;  5GAO p;  3SB2 A;  1ZQ1 A;  2YT6 A;  1Y7X A;  2DAQ A;  4XTX A;  4DBH A;  5LJ5 d;  4ELY C;  2A0F B;  3JCM V;  1C1A A;  2CSI A;  1FMW A;  4AFS C;  4DA4 A;  3MEW A;  2YHT A;  2QYZ A;  3PTA A;  4Z02 A;  2E64 A;  3CCE A;  2JM8 A;  1NLP C;  1K4U S;  1VQ7 Q;  3RUX A;  2QA4 T;  3EHR A;  2YDL A;  2DE0 X;  1AOJ A;  2NWM A;  3ZFJ A;  3JAM E;  2FVU A;  2HZY A;  1GXI E;  1UEC A;  1B07 A;  1NJI U;  4L6V 5;  1Y71 A;  5FU7 B;  2DKG A;  3RNJ A;  3S3O A;  3I5R A;  1IO6 A;  3CCE Q;  5GAM g;  1ZUU A;  1H3Z A;  4C5E A;  4F7U F;  2D8J A;  4A53 A;  2JZ2 A;  1YI2 A;  2LT4 A;  5KYX A; 
#chains in the Genus database with same CATH homology
 2E65 A;  3M5A A;  5I21 A;  1NPR A;  2HQX A;  4BY6 C;  4CRI A;  5GMK l;  2F69 A;  1YCY A;  2LC4 A;  4OB1 B;  2O4X B;  1VQ9 A;  1QP2 A;  2K2V A;  4IUU A;  4XQ3 A;  5J3B A;  3OW2 A;  2E5Q A;  5CQY A;  2WAC A;  2RJD A;  1YJW T;  2DXT A;  2DZC A;  4JJN K;  3JCM X;  1QVG A;  2EQK A;  4PL6 A;  3JB9 I;  1PSF A;  5CK9 A;  1S72 T;  2JVV A;  3A8M B;  3CC7 A;  5LJ5 h;  5GAN f;  3UWN A;  3CC4 A;  4LD9 K;  2MAM A;  4BI3 A;  3OSV A;  3X25 B;  2PVD B;  1UEB A;  3L2Z A;  3RMQ A;  4M75 G;  1VQN A;  2YLC A;  5LJ5 f;  5GAN h;  3JCM g;  3KUF A;  2FB7 A;  3MCA B;  2WSC E;  5GAN 5;  3TEE A;  3OY9 A;  1I4K 1;  1RL2 A;  3VYG A;  2ZPI B;  3OYB A;  2VV5 A;  2E70 A;  3JRZ A;  5FRO A;  4C0D B;  5A2Q E;  3A8O B;  3JCM Q;  4E7H A;  4OGE A;  2XHC A;  2QEX A;  3LLR A;  4XU0 A;  5GAO l;  1VQ6 A;  1R8O B;  2EIF A;  2DTO A;  5DLO A;  1YHQ T;  2RI2 A;  3MP1 A;  4C92 G;  1YIT T;  2HD0 A;  2DXC A;  4M7D B;  3EAE A;  1N9R A;  2DZ9 A;  4RCC A;  2QEX T;  3RKY A;  1B34 B;  2RD1 A;  4C92 A;  4F7U E;  4ZGE B;  4HT8 A;  3FRN A;  1V29 B;  4C0G A;  4C0D C;  2WSF E;  2M1H A;  3SWN C;  3LH0 A;  4OP0 A;  5LJ5 g;  3HRS A;  2LQK A;  4PJO C;  2XD0 A;  2WSE E;  3DKM A;  3QDR B;  5GAN j;  2VXF A;  4WF2 A;  4B9X A;  3PT9 A;  3GNG A;  1UGR B;  2IG0 A;  4C92 E;  5GMK e;  3H6Z A;  3CXC S;  2FL7 A;  2MWP A;  2JTF A;  3SWN A;  2QQ9 A;  3C4S A;  1FX7 A;  2K57 A;  3OYD A;  2EKO A;  1XTD A;  1HXD A;  3RKW A;  1G3S A;  3CCJ A;  1IZ6 A;  2L8D A;  1G3T A;  2D0Q B;  4M77 F;  4X34 A;  3RKX A;  2RO0 A;  1QVG S;  4M7D E;  3L2W A;  3HHT B;  3SD4 A;  4O5V A;  1VQ5 A;  1QVP A;  4J8O A;  2CYZ B;  2HQE A;  5CKH A;  2K5I A;  4C5I A;  4C8Q C;  3H8Z A;  5DM7 R;  2ZGW A;  4V2S A;  2EWN A;  1Q82 U;  3MEA A;  5A0G A;  4M78 C;  2MMP A;  2E10 A;  3MET A;  5GAM e;  2PQW A;  2XDB A;  4IUR A;  5FU6 B;  3WXM B;  4M7A B;  5CKB A;  5HK3 A;  4MMK A;  1N6A A;  3QKJ A;  5GAM f;  3P8B B;  4MZP A;  4ZTJ A;  2JUF A;  1WJQ A;  3HKS A;  3MO8 A;  3QZ9 B;  3OMG A;  4J5Y A;  4XTU A;  4B9W A;  3OS1 A;  4A4H A;  4L5G A;  2RJF A;  4BI8 B;  2EJ9 A;  2OTJ A;  4XU3 A;  3FJP A;  4XU1 A;  2F5K A;  4YTL A;  1M1K C;  2E1H A;  2QTX A;  1D3B B;  3CME T;  3R6O A;  1M8V A;  1QW1 A;  1M5Q 1;  3OYA A;  4D6W A;  3X28 B;  1BIA A;  3VV0 A;  3LWH A;  2X4W A;  4E7I A;  2F5T X;  2EYQ A;  2M9U A;  2RHX A;  5FU7 C;  3VYH B;  3QBY A;  3ZBD A;  4A4G A;  2ZZD A;  3QUI A;  1WPY A;  1BI0 A;  1EIF A;  2YLB A;  3P8H A;  2PVG B;  2GF7 A;  4Y28 E;  3AHU A;  2VYT A;  4PKC C;  2PUK B;  5GAN 8;  3G6E A;  4C5H A;  3NTK A;  4XU2 A;  3TRE A;  2LCC A;  4A4K A;  4N4I A;  3CCV T;  3E1S A;  4X9C A;  4XTW A;  4EPC A;  4RKU E;  3GF5 A;  2DTH A;  3OYG A;  3MHX A;  2XK0 A;  1M4Z A;  3L2Q A;  3G71 T;  3DLL A;  3LX7 A;  3JCM f;  4DQ2 A;  4QW2 A;  3KXT A;  2BIV A;  4M7A D;  5GAM j;  3BDL A;  5EG2 A;  2P0P A;  3M53 A;  4ZN1 A;  5CCA A;  3F70 A;  4N0A C;  4LD6 A;  5LL6 S;  3SFM A;  4C92 D;  3E9G A;  3CBO A;  3LGL A;  2LT1 A;  3RIR A;  2VC8 A;  4OF1 A;  2DXB A;  5KCO A;  5GMK i;  4KUL A;  1H64 1;  3DB4 A;  3HPW A;  2CS7 A;  1BYM A;  3QG1 A;  4TVR A;  2M0O A;  5LJ3 f;  4C0Z A;  4JS5 A;  5HK0 A;  5HY6 A;  2LQ8 A;  3V8J A;  4N0A A;  4BUG A;  3VUZ A;  3OYK A;  2MI6 A;  4QQG A;  2CZ7 B;  3T9N A;  5GAN d;  1VQ7 T;  3L1A A;  2EQU A;  1U1S A;  2K4Y A;  3PIO A;  3WVD B;  3OA6 A;  2X4J A;  2A7Y A;  2JNG A;  2EAY A;  2ZPE B;  3CCL T;  1YIJ T;  3JB9 F;  4C8Q B;  4EMK A;  3CCV A;  4C8Q G;  1NE8 A;  1M1K U;  3CPW S;  1Q7Y U;  1Q81 C;  5HKC A;  3P8D A;  4RMO A;  4NOY A;  1UGP B;  1NPP A;  4M77 B;  1PSE A;  3C94 A;  3GOX A;  2EJG A;  2KVQ G;  4II1 A;  5FRN A;  3M56 A;  3JCM e;  3FEO A;  4FIB A;  1WNL A;  2K3X A;  3JSC A;  3CME A;  3OYM A;  2EJF A;  2ZPH B;  3I56 T;  2VGM A;  3CCR A;  3CCE T;  3V7C A;  3Q1J A;  1VIE A;  2R57 A;  2E12 A;  2RK1 A;  2LTO A;  3E9F A;  4IUV A;  5KCH A;  5LJ5 j;  3HL8 A;  5I2S A;  4M7D G;  4M7A C;  3X24 B;  1Y07 A;  5A0D A;  3SDZ A;  2EQJ A;  4F7U A;  1K8A U;  1G3Y A;  4M7D A;  1YJN T;  4PJO B;  4C8Q D;  3J81 E;  1U1T A;  3C95 A;  3S6W A;  4M78 E;  2KK4 A;  4BDZ A;  1VQ6 T;  3V7S A;  4F7U G;  1BIB A;  1WQ7 A;  2ZPF B;  3OB9 A;  4C8Q E;  2FYK A;  3CCQ T;  4RG8 A;  4E7J A;  4M75 D;  3X20 B;  1UB4 A;  2DO3 A;  2YRV A;  3G4S T;  3MP6 A;  3DLM A;  5GAM d;  1JB0 E;  4M7D C;  4M77 E;  2RH2 A;  1XQH A;  1QP3 A;  3JCM c;  3G71 A;  2LVM A;  2RHY A;  4E7L A;  5CR2 A;  1KD1 C;  2OTL A;  5D6W A;  3L2R A;  1KC8 U;  2KMT A;  5J26 A;  2O4X A;  3LW5 E;  2DVE A;  2CZ1 B;  4PLL A;  3JCM W;  2CZ0 B;  1VQN T;  3OW2 S;  5GAN g;  4HCB A;  1OZ3 A;  2HNI A;  4PJO G;  3URG A;  4IUQ A;  3CBP A;  2CKK A;  5GAO q;  1MGQ A;  1RI0 A;  1WQW A;  4BI4 A;  5GAN 3;  4C5G A;  3QYH B;  4PJO E;  4JRP A;  3FIF A;  2XID A;  2C06 A;  1P92 A;  2EQM A;  2RJE A;  4M78 B;  1VQ8 A;  1ZHI A;  1N27 A;  4IUP A;  1FXX A;  5IT9 E;  4N4H A;  4BY6 B;  2VUB A;  3ER0 A;  2DPP B;  2KQW A;  3QII A;  4M77 C;  3UT1 A;  3FC3 A;  1I5L A;  4GLK A;  5FRM A;  3V8L A;  4QVD A;  3G7Z A;  4GY5 A;  4PNO A;  2LDM A;  4FM4 B;  1JRI A;  4EMG A;  3CCQ A;  3GNF B;  5GAN e;  2PVO B;  5LJ3 d;  3WVE B;  1VQM A;  3OYN A;  1VQO T;  3BW1 A;  4A54 A;  1BI3 A;  3ME9 A;  4PJO F;  1BI1 A;  1YHQ A;  1KQS S;  3HP9 A;  3V8K A;  2DEQ A;  4M7A E;  2M16 A;  3ASK A;  3L2U A;  4JRQ A;  5J39 A;  2QXF A;  5I2M A;  4J6W A;  4BB7 A;  1Y96 B;  4L59 A;  5GAM h;  2QDY B;  3HRT A;  4HA8 A;  3LWI A;  3CCS T;  1M1G A;  4JS4 A;  1HK9 A;  4UC4 A;  4PJO A;  3KBG A;  1VQK A;  5CIU A;  2QI2 A;  1VQ8 T;  4HT9 A;  2PU9 B;  2DTI A;  2X35 A;  4OB2 B;  5FU6 C;  4NL3 A;  2RHU A;  2DIG A;  2XI9 A;  3EFS A;  3UDC A;  3J7A F;  2BKD N;  3I55 A;  1NZ9 A;  4Q5W A;  3M4G A;  1VQL T;  3EFR A;  4R55 A;  3FB9 A;  3CCL A;  5KE3 A;  2KSS A;  4J6Y A;  1UGS B;  3CCU T;  2E6Z A;  5GMK h;  1FWZ A;  2XU8 A;  5AYF A;  3GIB A;  3M59 A;  4LDW A;  4JRK A;  4CI0 C;  4P5N A;  2B8A A;  1YIT A;  1YJW A;  2HBP A;  4QQ6 A;  2RB6 A;  3FLG A;  2EFI A;  4C8Q A;  5IAY A;  2JN0 A;  1KQ2 A;  4FT4 A;  1X6O A;  3MEU A;  3PGG A;  4C0F A;  3M4Y A;  4M78 G;  4XTZ A;  2QQR A;  1MHN A;  2X4Y A;  3PFS A;  4E7K A;  1YJ9 T;  3CMA T;  4QQD A;  4M7D F;  2GFU A;  1BI2 A;  5DLQ E;  3VJP A;  4ME7 A;  1YJ9 A;  2P0Q A;  3CC2 T;  3OBW A;  1K8A C;  2QQB A;  2RM4 A;  2DIQ A;  3OYE A;  2HAX A;  2CZ6 B;  2XG8 D;  3GP8 A;  3CBM A;  2PUO B;  1LNX A;  3QYG B;  5GMK j;  2K5F A;  1SSF A;  3RMS A;  2I2L A;  5D6Y A;  1Q86 U;  2H3J A;  2XKO C;  1XNI A;  3X26 B;  1G3W A;  4EMH A;  1VQL A;  1QVF S;  4EDU A;  5GAN 2;  4M77 G;  3JCM b;  3OYF A;  1KQS A;  3CCU A;  4M78 D;  2XDD A;  3OS5 A;  2RI5 A;  2QQA A;  1NJI C;  4M77 A;  4OB0 B;  5CKD A;  2R5M A;  3PMI A;  3ZEH A;  3L2V A;  2GFA A;  4J83 A;  3CPF A;  5GAO n;  2OTL T;  1K9M C;  3MP8 A;  4M78 F;  1W2B S;  1N8R C;  4OB3 B;  1K9M U;  3CC7 T;  1S72 A;  1Q7Y C;  3PNW C;  1DJ7 B;  4X9D A;  1VQP T;  3OMC A;  1WJR A;  5KH6 A;  3CMA A;  1YI2 T;  5LJ5 e;  3CCS A;  3OS0 A;  3OYC A;  2CGH A;  2L5Q A;  5GAN 4;  1QVF A;  2LRQ A;  3OQ5 A;  1WGS A;  3M54 A;  4O6J A;  2V8K A;  3CCM A;  1KHI A;  4FL6 A;  2RHI A;  2LX9 A;  5CQX A;  4XAX B;  3LYI A;  3E19 A;  4ZGJ B;  4M7A G;  4ZN3 A;  4M7A F;  2P4T A;  3BDU A;  1JBM A;  1I8F A;  3QZ5 B;  1VQO A;  2IVW A;  4XTY A;  1YJN A;  1JJ2 S;  4J7I A;  3QXE B;  4HCZ A;  5CVI A;  2AHJ B;  3L42 A;  3VKI A;  5GMK m;  1O75 A;  4KUI A;  4BAC A;  4BE2 A;  4ELZ C;  5C6S A;  4KUD K;  3O8V A;  2RI3 A;  2VGN A;  3OYH A;  2DJZ A;  2Y90 A;  3QHS A;  4IUT A;  3OYL A;  3CXC A;  2DXU A;  2XDP A;  5L8R E;  3SWN B;  2K3Y A;  3OBY A;  3UPU A;  4M75 C;  2NLU A;  1BKB A;  4JLI A;  2R58 A;  4JLG A;  3M9Q A;  2E41 A;  4MDW A;  1X01 A;  4NL2 A;  3CC4 T;  2LCL A;  2BUD A;  3JCM P;  4C92 C;  2QA4 A;  3DB3 A;  4EMK B;  1Y96 A;  3PIP A;  1KQ1 A;  3JB9 J;  5CKF A;  4DOW A;  5LJ3 e;  3OYJ A;  5DY9 A;  4BDY A;  3M57 A;  3S3N A;  1Q82 C;  3INZ A;  4MML A;  4N4G A;  2GCX A;  2MF2 A;  3C12 A;  3CD6 A;  4HCC A;  4OGC A;  3VU3 C;  1K73 U;  4LDX A;  1IRE B;  1N9S A;  1X75 C;  2R5A A;  4M75 B;  1LJO A;  2D9T A;  5CKE A;  4M7A A;  2A3L A;  4KT0 E;  3MEV A;  1VQM T;  3J80 E;  4A4E A;  1VIF A;  4QVZ A;  1KHC A;  1OZ2 A;  3CEY A;  1W2B A;  4ZGD B;  2RK2 A;  2V8I A;  3A8G B;  4PJO D;  4J6X A;  3FDR A;  5GAO m;  2FHD A;  4F7U B;  4NS5 A;  4ZTF A;  3QO3 A;  1VQ4 T;  1LOJ A;  4MZM A;  3RER A;  3HSB A;  2K5L A;  1OI1 A;  3GLX A;  4BE0 A;  3BY7 A;  3NTI A;  2JOY A;  2VXE A;  3A8H B;  3QJY A;  1M1F A;  4M78 A;  1B34 A;  4C92 B;  1KD1 U;  4Y91 A;  4BD3 A;  3QPH A;  2G3R A;  4M77 D;  3HFN A;  4XK8 E;  3QSU A;  3TCJ A;  4FT2 A;  4OVA A;  3CCJ T;  2RHZ A;  4OMF B;  4R56 A;  1W4S A;  2Y4Y A;  4IKF A;  2L3R A;  4M75 E;  1KG1 A;  4FU6 A;  3M55 A;  3JCM h;  4DOV A;  1U8R A;  1JJ2 A;  3OYY A;  3G6E T;  5CO7 A;  3RES A;  2XIC A;  1VQ7 A;  2QQS A;  2L89 A;  1M90 U;  1VQK T;  1AHJ B;  3N5B B;  4JRI A;  3G4S A;  1M90 C;  1YBY A;  2D6F A;  3QJ6 A;  1N8R U;  5KE2 A;  3LGF A;  5CAI A;  3NFC A;  4PLI A;  3S3M A;  4KBM B;  3VUB A;  1ZBX A;  3OYI A;  1XOV A;  2GQV A;  4RG2 A;  5GAO p;  4C92 F;  1VQ4 A;  1TH7 A;  4LDY A;  3SB2 A;  1VQ9 T;  1ZQ1 A;  3A8L B;  3OS2 A;  4M7D D;  4ATO A;  4A4F A;  1Y7X A;  2DAQ A;  3BFM A;  4LDV A;  4M75 F;  4XTX A;  5LJ5 d;  4HKE A;  5C0M A;  3NTH A;  2OTJ T;  4ELY C;  4JUV A;  3JCM V;  5LJ3 h;  2KAF A;  4C8Q F;  3CCR T;  4DA4 A;  3MEW A;  3CD6 T;  2YHT A;  5LJ3 j;  3JB9 G;  3GPL A;  3PTA A;  2LNV A;  2E64 A;  4Z02 A;  4M75 A;  5LJ3 g;  4RCB A;  1VQP A;  1O9S A;  4MDX A;  2V8J A;  3CCE A;  5FLX E;  2ZPG B;  3I56 A;  5GAO r;  4MZT A;  3A5Z B;  3RUX A;  2QA4 T;  2Y4X A;  3HFO A;  1Q81 U;  1G5V A;  1VUB A;  1D3B A;  3HRU A;  1VQ5 T;  4XTV A;  3PMT A;  2X4X A;  4E47 A;  1OYX A;  2RJC A;  4LDU A;  1Q86 C;  3ZFJ A;  5D6X A;  3JAM E;  3I55 T;  2KY9 A;  2FVU A;  5GAN 6;  3CPW A;  5GAN 7;  1GXI E;  2E6N A;  1YIJ A;  3JB9 D;  1I81 A;  2JTM A;  1NJI U;  3M58 A;  4L6V 5;  3OSS C;  5A0L A;  1Y71 A;  5FU7 B;  2DKG A;  2ZCF B;  4QVC A;  4BE1 A;  2DK3 A;  2O01 E;  2ZPB B;  2P0K A;  3S3O A;  2KDS A;  1KC8 C;  1WJS A;  2DD5 A;  3TU4 K;  4EMK C;  4J7F A;  1UGQ B;  5GAM g;  4VUB A;  2DD4 A;  3CCM T;  3V7R A;  3JB9 H;  3JCM d;  4FSX A;  4JDS A;  1H3Z A;  4C5E A;  2MWO A;  2RA2 A;  4F7U F;  4A53 A;  3JCM J;  3CC2 A;  2JZ2 A;  5IN1 A;  1YI2 A;  2LT4 A;  1M9S A;  1K73 C;  2OAU A;  5M9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...