5HK0A

Crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
109
Chain Sequence
MVISRAEIYWADLGPPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF6
publication title Crystal structure of M. tuberculosis MazF-mt3 (Rv1991c) in complex with RNA
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Hydrolase/rna
total genus 20
structure length 109
sequence length 114
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hk0A00
3JSCA 1VUBA 4MZTA 5CKHA 4OF1A 5CKFA 5DLOA 3HPWA 5CCAA 5CQXA 4ELZC 2VUBA 5HK3A 1UB4A 4HKEA 3G7ZA 4VUBA 5HKCA 2C06A 2KMTA 5CKEA 4MZPA 3TCJA 5CR2A 5CKBA 5HK0A 3VUBA 2MF2A 5CK9A 5CQYA 4ME7A 4ELYC 5CKDA 4MDXA 3JRZA 3NFCA 5CO7A 1NE8A 1X75C 1M1FA 4MZMA
chains in the Genus database with same CATH superfamily
3EGXA 4XTVA 3GNGA 3OYJA 1YJWQ 2KY9A 1TU0B 1TG0A 3OMCA 3CBOA 4XTYA 4ZGJB 2K2VA 2R5AA 4M7AE 2JS0A 4C0DC 1I5LA 3M54A 4PJOB 1SKUB 4J83A 5LJ3j 4JJNK 2RQUA 1VQ4T 1WZOA 4RCBA 3EG9B 5KYXB 3EHRA 3OYBA 3EFRA 2PU9B 3CQTA 4RTVA 3ZL7C 3OSSC 1YJ9T 5HK3A 2VUBA 4AMCA 4AFQC 1LOJA 1ZUKA 4PFPA 2OTLT 3FB9A 4AFUC 4M7AF 1VQNT 2EKOA 2KGTA 5CK9A 4NOYA 2EVRA 5GAMd 1S1NA 5GAOn 2XU8A 4E7LA 4FU6A 4GLMA 1WJQA 1KC8R 1LCKA 1BYMA 2YLCA 2Y4YA 3LGLA 2RHYA 1K9AA 3KFVA 4NL3A 5FLXE 4HVUA 4JPBW 4KT0E 1X6OA 1WHJA 4M75A 3CCUQ 2KEAA 1U3OA 1UDLA 2GQIA 1GXIE 4OB0B 2F5TX 3L2ZA 2DILA 1VQLA 4PFOA 1V1CA 1VQ7Q 1NLOC 3LWIA 2OTLA 1RADB 3CMET 2L3QA 1ZBXA 2KQWA 3CPWA 1H92A 2VV5A 3DB4A 4GBQA 4OGEA 5FU6B 4HA8A 3MEUA 1W6XA 4EPCA 3C0CA 1Y96B 3L42A 2OI3A 2ZAEA 4M78D 1RAGB 4J5YA 4E7HA 1U8RA 4CRIA 4Z88A 4PNOA 5IHIA 4FT2A 2X51A 1W1FA 5GANg 2DYIA 2PVGB 4ZN3A 2HEQA 2FPDA 2LX9A 3URGA 1GCQA 3NFCA 2VYTA 1SSHA 5J26A 3CMEA 4PLIA 1YJNQ 1ZSZA 2E41A 2JMAA 4N4HA 1XOVA 4LXCA 2QQBA 1FWZA 1RAIB 2V1RA 1BI2A 1OQKA 3H0HA 3OW2S 2AK5A 1UECA 2DJQA 1KC8U 7AT1B 4KUDK 4C8QG 3QYHB 3CCUA 1C1AA 3RKYA 2SEMA 4F7UG 5D6WA 3RR6A 2ATCB 4E7JA 3E9FA 2CGHA 3HL8A 4BDYA 4M77D 1VQ7A 1SG5A 3CCMQ 3TCJA 1AEYA 5IXBA 2H3EB 1JXMA 2QEXQ 3DKMA 2WSFE 2HNIA 3CBMA 4C92A 2DLPA 2QA4T 2FL7A 4HT8A 4QKUA 2VGNA 2BZYA 4IUQA 1ZX6A 5CQXA 2KAFA 1BI3A 1UJYA 4JUVA 5GAOq 4M78E 3LH0A 1VQ5Q 4J9FA 1GCPA 1M90U 3RUXA 3FEOA 4AG1C 1IB8A 1QVFS 4QVZA 1FXXA 2L3PA 4FYYB 1R8OB 3QDFA 2DTHA 2G6FX 4M78F 3I56Q 1T0JA 1TUGB 3KBGA 1U1SA 2LJ1A 1RABB 4PJMA 4J6WA 3JCMf 1UUEA 1OPKA 1Y71A 2RHZA 1G3WA 5GAN3 3Q1JA 3BE3A 3FIFA 4PKCC 5CQYA 2K4YA 4FCYA 1RACB 2VVKA 1M5Q1 3JB9I 2PNIA 2M51A 3QXEB 2LT1A 3OYHA 2E65A 1JO8A 4JZ4A 2DVJA 3T9NA 5FU7B 1U5SA 3FJPA 4A4GA 2EIFA 4FSSA 4M7DB 1FMWA 2V26A 4AFZC 1NM7A 2YDLA 4AG2C 4LUEA 1D0XA 3QYGB 1H8KA 3QZ9B 3CCMA 2QQ9A 3FDRA 3ZFJA 2RQTA 4M77E 5AYFA 2L2PA 2QQRA 2O31A 2QEXA 2L89A 2QYZA 4EIKA 1W2BS 2MMPA 3CC4T 1TUDA 3LLRA 3P8HA 3CMAQ 2CZ1B 2D0NA 1KQ2A 2ECZA 4M77F 1MUZA 1T3SA 4QW2A 2DVEA 4HCKA 3OYGA 2JS2A 5LJ3h 1VQ5A 1UGPB 4PFZA 1HK9A 1LNXA 4RG2A 3L2QA 5GMKm 2RHXA 3VUZA 1ZA1B 3OS5A 2HL5C 2M16A 2LC4A 4BE0A 2RM4A 1OI1A 5HKCA 3OW2P 3I56A 1M3BA 2CZ7B 1ZSZB 2EBPA 2B8AA 4OGCA 1T0HA 1M2VA 1N9SA 2CUDA 2RQRA 1ACMB 1WGSA 1M4ZA 4PK4A 2CP6A 3PVQA 4PLLA 1M1KR 2HAXA 3GIBA 4M7AG 2DF6A 2RNAA 4A54A 5FRMA 1UGRB 4C8QD 5GANh 3EGDB 2RD1A 2A36A 2M1HA 5CKDA 2DIQA 2ENMA 4EMKC 1Q7YC 1Z9ZA 2JM8A 1IGUA 3H6ZA 4CC3A 4R56A 1BU1A 1R0BG 2NUPB 1VQPQ 2ESWA 4ESRA 1YWPA 3G4ST 3CCST 3FLGA 1XQHA 2PVOB 5CKEA 2H3JA 2AKKA 2LDMA 1RAHB 3CMAA 3VS1A 3OYMA 2J7IA 2VC8A 2Y4XA 2YRDA 2HKNA 4F04B 1PKTA 3LX7A 4AFSC 2BZXA 2LQWA 1HSQA 2FZCB 3HRSA 1WLPB 1RLQC 3A1PA 2DD4A 4A4KA 1WDXA 5J3BA 4J6YA 4R55A 4DBHA 2K57A 4M7AC 4C0GA 4IUPA 3EH2A 3GF5A 3CC7T 3A5ZB 5FWCA 3OS2A 2X3XD 1NZ9A 4JS4A 3OW2A 4QT7A 4FIBA 2KSSA 4X9CA 1ARKA 4B9XA 1B3QA 2BZ8A 1S72Q 4KGXB 2RI5A 2RK1A 2EPDA 1YHQQ 4PJOA 1G5VA 4C8QE 4M75G 2OTJQ 3EG9A 5KYXA 1NE8A 3SB2A 1MMGA 3CCLQ 2LJ0A 1M1KU 3UPUA 2RQWA 1KQ1A 5KCOA 1WQ7A 2ABLA 1QKWA 3RKWA 4BD3A 2JTFA 2HSPA 4C8QF 5FWBA 1VQPA 2AZSA 3M0UA 1QP2A 1KIKA 2XDDA 1PSEA 3L2RA 3CCRT 1KHCA 4OMNA 2RHIA 1MMAA 3OS1A 3VYHB 3CD6T 4Y91A 3QJ6A 3VKIA 1IZ6A 4ZTJA 4DEXA 2DZCA 1VYUA 4O5VA 1RI9A 4F17A 1C0MA 2DD5A 1H641 4II1A 3CCVQ 6AT1B 2YLBA 4LDYA 4M4ZA 4IIOA 2PQWA 4ELYC 2MI6A 1X27A 2KT8A 3V8LA 1H3HA 2EQMA 4OMPA 4Y92A 1WXTA 2QTVA 4PJOF 2KRNA 1X2QA 2AZVA 2FEIA 3LW5E 1PSFA 4IIMA 5IN1A 3N5BB 2GF7A 1BKBA 3E2UA 4FYWB 3JCMg 2FVUA 4KULA 4EMGA 4KGVB 4M7AD 1KD1C 1M1GA 4FW1A 1Y96A 1G3SA 3I55T 2DAQA 4J7IA 3QWYA 1S72A 4A63B 4M78G 2YWWA 2GQVA 1G83A 1YHQA 3EFOB 2V8IA 3A98A 1PD0A 2JW4A 5LJ5d 3QO3A 1OU8A 4JRIA 3ME9A 2OTJA 1ABOA 1PCXA 4LD6A 2M9UA 1VQ8Q 5A0GA 3CCLA 2F69A 1NPPA 3JB9H 5GAN8 2DNUA 2E12A 2KDSA 5KCHA 3CPFA 1DJ7B 1HJDA 3MKDA 2YUOA 2ED1A 2RB6A 2LZ6B 4C92G 1N27A 4R0KA 1VQ9T 1VQKT 3HTRA 3J81E 3UA6A 1K4US 2K5IA 1YIJT 4C5GA 1WJRA 4A4FA 2HQHA 3J80E 1EFNA 4D6WA 2DEQA 1YJ9Q 2CUBA 4IUTA 3S6WA 2OAWA 2OTLQ 4PJNA 1UTIA 1VQNQ 2A7YA 2K3BA 5GMKj 4M77G 1QVGP 4M78C 3MJXA 5LJ3e 1ZUYA 5GAOl 2CT4A 3SFMA 4JJCA 2KNBB 2X3WD 1MHNA 3QIIA 1RL2A 2X4WA 2DFUA 3VV0A 3TU4K 3JRZA 2KRMA 4EMHA 2FPEA 3E19A 4M75D 2NLUA 2GCXA 5KYYA 1J3TA 2QGFB 1NJIC 3UATA 1K0XA 4J8OA 1W70A 3RMQA 2JUFA 3L2VA 1VQ8A 1OEBA 2K6DA 5EC7A 1WHKA 5GAMg 1OZ3A 2CZ6B 3CMEQ 3G71T 2P0PA 2RJFA 4J7FA 3VRZA 4HCBA 2YHTA 3A8GB 3H8ZA 1D3BB 4YTLA 1KD1R 2XMFA 1AZEA 3BW1A 3CXCS 4BY6C 1QWEA 2ZPBB 4XU3A 3EAEA 3M55A 1XJWB 3RBBB 1YJWT 3SWNC 5GANj 2GTJA 4M77C 1UGSB 2ROLA 2QAZA 1VQ4A 1SSFA 3A8HB 3LYIA 2ZPHB 4M7DA 3TSWA 1YJ9A 2XG8D 2COYA 3V7RA 2C0TA 1M27C 4OMFB 1YI2T 2L5QA 1VQNA 2QTXA 2VKNA 4E7IA 2C0IA 2O9SA 2ZPFB 5LJ3d 5GAOr 5IHKA 5D6YA 1M90R 3GPLA 3JCMW 2LMJA 4BB7A 2EKHA 1Q82C 1QVGA 1IREB 1ZSGA 3I35A 3QBYA 4MZMA 2R57A 4RTTA 4JJBA 3E1SA 4OB3B 3VYGA 2KXDA 4EMKB 3I9QA 1G3YA 1KSWA 4M75E 3OA6A 3MO8A 1NEBA 2RJEA 1WPYA 2GBQA 2DERA 2K5FA 2QGGA 2LJ3A 3M53A 3VRYA 4BDZA 5I21A 4C5EA 4OVAA 4M75F 1AWOA 2XK0A 1JXOA 2IG0A 4C92D 2RMOA 3JCMh 4VUBA 2LRQA 1U1TA 2CDTA 4E7ZA 3QPHA 3OMGA 2M0YA 1UHCA 4ORZA 1IHWA 3H0IA 3L2WA 2EGEA 2K3XA 2HCKA 2E1HA 1TWBA 3S3OA 2CSQA 5FW9A 2HZYA 2F2XA 3BDUA 3PIPA 3X25B 2QDLA 4CC2A 1KD1U 1WA7A 2KK4A 1TS9A 3TEEA 3OYAA 3EGDA 1MNDA 3S3NA 3NGPA 4J6XA 2EYZA 4QVCA 2D8JA 2HBPA 5HY6A 1X43A 2YXYA 2B86A 1YWOA 2AKLA 3R6OA 3WVDB 3NTIA 3EFSA 1LVKA 2NUPA 2YUPA 4K11A 2L3RA 1QVPA 3X28B 2JNGA 1OX8A 3PNWC 3V7SA 5KYYB 5DLQE 1EX4A 3OYFA 1UHFA 1MV0B 4N0AC 4J9BA 4X9DA 1N5ZA 4PJOG 2CP5A 1YJNT 2F5KA 4OMQA 1I81A 1BI0A 5D6XA 3CCET 2XDBA 3VU3C 2MWPA 2DL5A 2GTOA 3QZ5B 1AD5A 3X24B 5J39A 2EQUA 3GBQA 1JRIA 4C8QC 1JBMA 4HCZA 2D1XA 3PVLA 4RTWA 2DRMA 2KVQG 2A3LA 3CC4Q 4C92E 1JU5C 5ECAA 5GAN7 1JB0E 3RKXA 4HVWA 2QA4A 1Q81C 1M3CA 1Y07A 1B7TA 3P8DA 4DOWA 5DY9A 5LJ5f 5GAN6 3C95A 4DQ2A 2NUTA 2CP3A 1CKBA 1V29B 4C92F 2EJ9A 2JJ9A 4ZTFA 1SEMA 4MMLA 4LN2A 1VIEA 4BI8B 5DM7R 5GAMh 4B9WA 3O8VA 4PJJA 3MPUB 4RTXA 3MP1A 2ROTA 5GMKi 5CKFA 5GMKh 1JQQA 2MWOA 4ZNXA 4HVVA 1B07A 2DA9A 2GFUA 1QQJA 5KH6A 1X2KA 2D9TA 2LQNA 1N8RC 2DL3A 1RLPC 4J9HA 1FYNA 1Q86C 2I2LA 2RJCA 1Z9QA 2MOXA 3M0QA 4RTUA 3JAME 3OYDA 1Q95G 4JRKA 1K8AC 3ULRB 1RAFB 1K73C 3V7CA 1IHVA 2DXUA 5AT1B 2FZKB 2P0QA 4LUDA 5KE3A 4J9DA 4HXJA 4C0FA 2J6OA 1UFFA 2E10A 2M0OA 5GJWB 4Z02A 4LD9K 4FYXB 4MDWA 4E7KA 3QKJA 2CT3A 3G4SQ 1QCNA 1TSFA 1D1CA 3CCSQ 2K7AA 2XD0A 2DJZA 2QI2A 3MP6A 2P84A 3DB3A 4IUUA 3CC4A 3HPWA 1TUCA 3HFNA 1PKSA 4JRPA 2P0KA 2KMTA 2JT4A 1WHGA 1MMNA 2V8KA 1JJ2S 2ZZDA 2EAYA 3EFOA 4A53A 3ZEHA 3CCJT 1QCOA 3G6ET 5GAMf 1VQMT 2JMCA 2RA2A 3OYKA 4RKUE 4OMOA 4HCCA 3GLXA 4JLIA 3VS4A 2O4XA 3CC7Q 4A4EA 3OY9A 1QVFP 1HD3A 1RUWA 2RI3A 3JCMP 1KHIA 1R77A 2LP5A 3OB9A 2D8HA 4C0DB 2RF0A 1IO6A 3JCMQ 1VQ6T 2J06A 5KYWB 2YUNA 4Z89A 1TTHB 1M1FA 4PJOD 2HSEB 3HP9A 3EG0A 2MIOA 1ZBJA 3DLMA 1OX9A 1UB4A 1V76A 2FRYA 3CBPA 4WF2A 2FZGB 4NL2A 4BI4A 1MMDA 2V8JA 1ZA2B 3G6EA 5LL6S 1LJOA 3CCQT 1X01A 4BY6B 2DBMA 2A28A 5A0DA 1ZLMA 2EFIA 2LT4A 2D0QB 3G4SA 1N8RR 1NLPC 2LX7A 5EG2A 3CCSA 3EH1A 1GRIA 3SWNB 3CCRQ 4M77B 1YNZA 3CD6Q 1WJSA 2CSIA 3NMZC 2D6FA 2NUTB 1WXBA 2EQJA 1KJWA 1SRLA 2WSCE 3MEWA 1W2BP 1KFZA 1NBEB 4CC7A 2KT1A 2KI7A 1D1BA 2E3HA 3EG2A 2DL8A 4M7DG 3NPFA 1YITT 1WYXA 1TXQA 1NPRA 4HKEA 1O75A 1FMKA 1IGQA 1GFDA 3VS0A 3IQLA 3CC7A 1NEGA 3JB9F 1M3AA 1AWJA 2O2OA 2A37A 2RHUA 2HKQB 2F2WA 3HHTB 1D3BA 1QVFA 2IVWA 1VYVA 1PRLC 2XDPA 1BIAA 2QXFA 3I55Q 5LJ5j 5HCKA 2Y90A 4FM4B 2EYXA 2L3SA 4PJOE 3M58A 1Q7YR 3CC2T 2EQKA 1Q81U 4C0ZA 3JCMc 4F16A 2FO0A 4IURA 3P8BB 5L8RE 3VS2A 1VQOT 3O5ZA 1YCYA 1JJ2P 4M75C 4EDUA 2P4RA 3MP8A 3L2UA 1I4K1 1G3TA 5FU7C 3EGUA 3CCRA 2DZ9A 4L6V5 1TOVA 4WTOB 3CEYA 3CD6A 4XTZA 1VQ9Q 1VQKQ 4JRQA 1X75C 3TVTA 2J6FA 1YIJQ 1WHHA 1N8RU 3BDLA 1SF9A 5LJ5g 3ZBDA 4NS5A 4EMKA 2AT1B 3M0RA 4JDSA 3NTHA 1KC8C 2EYYA 3VS5A 4RTYA 2O4XB 1W2BA 4BE1A 1K73U 5FRNA 4L5GA 5IHNA 1MV3A 2ZGWA 1AWXA 4DBRA 5KYUB 4BI3A 1BK2A 2XKOC 4OMMA 1QMCA 2DEUA 4XU2A 4C5HA 3GOXA 2R58A 4LDWA 5CCAA 1RAAB 1GCQC 2JOYA 2JN0A 1A0NB 3I55A 4XU1A 5GMKe 1G8XA 1VQ4Q 1KG1A 2FYKA 1T3LA 1I5OB 1RI0A 3GNFB 4KGZB 2DRKA 3WXMB 1ZSZC 4E2FB 1U06A 2P4TA 3BFMA 5GAMj 4QQDA 5GMKl 1VA7A 4OF1A 3KXTA 1P92A 5DLOA 2YRCA 4C8QB 2VXFA 2HQXA 4X1VA 4XAXB 4F7UB 5IAYA 3G7ZA 3G71Q 1Q7YU 9ATCB 2DETA 1PD1A 3EG3A 1I8FA 4RTZA 2LQ8A 3FRNA 3I5RA 4XTXA 5I22A 2CS7A 1JJ2A 1N6AA 4L59A 1VQ9A 1D0YA 1SRMA 1VQKA 2PUKB 1CKAA 4IKFA 2K5LA 2A0FB 1YIJA 2HQEA 2X9HA 3L1AA 1QCFA 3ASKA 5C0MA 4M7DD 1YBYA 1JEGA 2LNVA 3HKSA 4C92C 3JV3A 2W0ZA 1PHTA 2CP0A 2X4JA 3C4SA 4MMKA 4BE2A 1PM3A 4O6JA 1YI2Q 3PFSA 3BY7A 1NG2A 1D09B 4FSXA 1ZHIA 5GANe 3SDZA 2ZPEB 1Y7XA 5CIUA 1VQLT 1VIFA 2XHCA 3PE0A 4LDXA 3OBWA 2X35A 2KBTA 2K2MA 3PMTA 3S3MA 2YRVA 1AZGB 1BBZA 2JXBA 4JS5A 3SD4A 3HFOA 1QW1A 1GL5A 3UDCA 1MGQA 4FW2A 1EIFA 2CP7A 2RH2A 2O9VA 3TREA 3M59A 1D1AA 1AVZC 3R6NA 4P5NA 2O01E 4GY5A 5CVIA 2ED0A 2QQSA 4ZGEB 2DMOA 3AHUA 3VUBA 2LQKA 3QG1A 1PRMC 4J9GA 5LJ3g 2JVVA 3G71A 1QWFA 3PIOA 2JTEA 1GFCA 2M02A 4RCCA 1Y57A 1WHLA 5KE2A 1VUBA 4QVDA 3C12A 2XI9A 1MNEA 2OAUA 3U23A 4UC4A 2EYWA 2CZ0B 4DA4A 1K76A 1YJWA 3NTKA 1QKXA 2A08A 2COZA 2YT6A 2FHDA 3TSZA 4M7DE 1OYXA 2E4HA 1F1BB 2C0OA 4XTUA 2NWMA 4D8DA 1YI2A 3CCUT 2NUZA 4DBQA 1ZQ1A 4XU0A 4F14A 3GP8A 5GANd 2GNCA 2KR3A 2CYZB 1AOJA 2C06A 4OP0A 1VYTA 3PMIA 3JCMX 4M7DF 1B34B 1VQ7T 2EQIA 3DLLA 3H41A 2QA4Q 3M0PA 4KH0B 8AT1B 3FC3A 3REAB 3FJ5A 3MHXA 1I1JA 2LCSA 1NJIR 3LH5A 2PVDB 2XICA 3UWNA 5LJ5h 4DEYA 2CH4W 3M4GA 3RIRA 3RERA 2W10A 3H0FA 3F70A 4M7AB 3JB9G 4J9EA 2DL7A 1OV3A 1K0SA 3CCEQ 2RI2A 2ZCFB 4QQ6A 4M78A 1UEBA 2AHJB 5I2MA 3RDVA 2DTIA 1NYGA 3HSBA 1R0CB 1D0ZA 2BIVA 3EGXB 4GLKA 1WX6A 4XTWA 2L8DA 2EGAA 2EGCA 2COWA 5IH2A 5KYWA 3A8LB 4RG8A 3SEMA 2DXBA 3KUFA 2KXCA 2ZPGB 3M57A 1WI7A 3PGGA 3CXCP 1PNJA 1WNLA 1YFNA 3UF4A 1FMVA 2LTOA 1M1KC 2HDAA 2DKGA 2EWNA 3OBYA 2K3YA 3META 2JTMA 4MZPA 1Q82R 2MF2A 4LNPA 2R5MA 3X20B 1GBRA 1OOTA 1K9MC 3VS6A 3VS3A 1E6GA 3CCMT 3A8MB 3SWNA 4M77A 2QEXT 1KK7A 3A8OB 2VXEA 2PZ1A 2PTKA 2GGRA 2KROA 2E6NA 1YJNA 2HBWA 3G1JA 1H3ZA 2YSQA 2L0AA 5A2QE 3CCEA 2RN8A 2VWFA 1X69A 1VQ5T 3QHSA 1NJIU 4M75B 2DO3A 2WSEE 4Z8AA 4PJOC 1WHMA 4ATOA 4AT1B 2X4YA 2FRWA 1OPLA 1BCOA 2F2VA 4E6RA 3I56T 3MCAB 4FT4A 2LVMA 3J7AF 4FYVB 1AWWA 2QDYB 4D8KA 5L23A 2ZPIB 3JSCA 1W4SA 1PWTA 4N4IA 1XNIA 2KE9A 3X26B 1QLYA 1N9RA 4J9IA 3CCJQ 3EG1A 3G6EQ 2YUQA 5M9OA 1VQMQ 3CXCA 1WQWA 5CR2A 3D7SB 3AT1B 4KBMB 1AT1B 2LCCA 1KQSS 2VB6A 3NHNA 2DE0X 1GBQA 4DOVA 1UJ0A 5GAN5 3RESA 2HMAA 4LDVA 4FL6A 3OYEA 5D7UA 1SPKA 4LE9A 2CREA 2DK3A 5IT9E 1VQ6Q 3M56A 2X4XA 3C94A 1XTDA 3JCMV 4BUGA 2DYBA 1SHFA 2J05A 1I0CA 1CSKA 3M0TA 5GAOm 4B6MA 4OMLA 1Q82U 2E64A 3RMSA 2F1LA 2FPFA 3JB9D 5FROA 3OYLA 3CMAT 5C6SA 3OYNA 4M78B 5FU6C 3I5SA 4MZTA 3OYIA 2FB7A 2LCLA 1I07A 4QQGA 1NYFA 3VJPA 2RO0A 3CCQQ 1IXDA 4KRTA 1K9MR 5KYUA 3JB9J 2QQAA 3OYCA 3VS7A 3M5AA 1Q81R 1BB9A 1UE9A 4PL6A 3MEAA 4N0AA 1AHJB 2K9GA 3MEVA 5A0LA 4Q5WA 4N4GA 4JZ3A 4C92B 4XQ3A 1E6HA 2WACA 1QP3A 1WXUA 1OZ2A 4E7SA 2HL3A 2JM9A 1ZUUA 1YCSB 4V2SA 3OS0A 1YITQ 1M9SA 3CCJA 2DX1A 1VQMA 5LJ3f 3QDRB 2EJFA 2J6KA 4ZN1A 5I2SA 3OYYA 4C8QA 4CC4B 2QASA 3M9QA 4F7UA 1OU9A 5IXFA 2RJDA 2DL4A 1Q86R 2MK5A 1K1ZA 1PG5B 2E6ZA 3WVEB 1UGVA 4C5IA 1VQ6A 1C6VX 1K8AR 1VQPT 1M8VA 3OSVA 4E47A 1K73R 4A4HA 3JCMe 2IPOB 2MYSA 4JLGA 4RMOA 5CKHA 3UA7A 2NYSA 5I11A 3QJYA 3CC2Q 3CPWS 3JCMJ 1IRXA 1OULA 5GANf 1VQOQ 5GAN4 2OJ2A 3RNJA 1QVGS 4ZGDB 5LJ5e 2G3RA 3HRTA 3CCQA 2FG0A 1VOMA 3V8KA 4MDXA 2CKKA 4F7UE 2SRCA 2E70A 2HD0A 3V8JA 1KQSP 1O9SA 2QG9B 2PUOB 1BI1A 1LPLA 1K9MU 2BE9B 1X6BA 4F7UF 5KYNA 4ME7A 3ER0A 4Y28E 8ATCB 1S72T 3REBB 4HT9A 2MPXC 1X6GA 5CAIA 2JZ2A 1YHQT 4TVRA 1YITA 3QUIA 2MCNA 3QSUA 2OTJT 4X34A 2DM1A 1Y0MA 1M30A 3CCLT 4KUIA 4J9CA 4PJLA 5GAN2 2KYBA 5CKBA 2IIMA 1UG1A 4M7DC 2DXCA 2VASA 2H8HA 4CI0C 1YN8A 2DTOA 2QK0A 1M2VB 2E3IA 2I0NA 3TQ7P 2DIGA 3UT1A 2E5KA 4XK8E 1BCMA 2BTTA 3JCMd 3EHQA 2KYMA 1BIBA 4BACA 1Q86U 5GAOp 4LDUA 2EW3A 4WCIA 4ANJA 2CH4A 4KH1B 2EJGA 1WIEA 3CC2A 2Z0WA 1K8AU 1G2BA 3PT9A 2RPNA 1M8MA 1WFWA 2BE7D 3INZA 2K79A 1PC0A 3H9NA 3CCVT 5CO7A 1VQOA 3HRUA 2AIRB 1HXDA 4RUGA 2E5QA 2OX7A 2LNHB 3M4YA 1RAEB 2MAMA 3SHWA 2EYQA 3LGFA 1B34A 5GAMe 4IUVA 2XIDA 3PTAA 3JCMb 3M0SA 1EZZB 2CP2A 1YP5A 4DBFA 2BUDA 1KQSA 4JJDA 1SHGA 5GJVB 1M90C 4OB2B 1ABQA 4M7AA 2O88A 1E7OA 1TH7A 2DXTA 2RK2A 3E9GA 4ELZC 1UGQB 1HYOA 2VGMA 2V1QA 1FX7A 3QWXX 3OQ5A 5HK0A 2RQVA 2DBKA 1M2OA 3CCVA 1VQ8T 3CPWP 1VQLQ 4OB1B 3LWHA 2BKDN 2KRSA 2GFAA 3THKA 2DPPB
chains in the Genus database with same CATH topology
2DXUA 1KQ1A 2PVDB 4XTVA 2XICA 2P0QA 3UWNA 5KCOA 1WQ7A 3GNGA 5LJ5h 3OYJA 5KE3A 3M4GA 3RIRA 3RERA 2KY9A 3F70A 4M7AB 3JB9G 4C0FA 3RKWA 4BD3A 2JTFA 2E10A 4C8QF 3OMCA 1VQPA 3CBOA 2M0OA 4XTYA 1QP2A 4Z02A 2RI2A 4LD9K 2XDDA 2ZCFB 1PSEA 4MDWA 4ZGJB 3L2RA 2K2VA 1KHCA 4QQ6A 4M78A 3QKJA 3CCRT 4E7KA 2RHIA 3OS1A 1UEBA 2R5AA 4M7AE 3VYHB 2AHJB 4C0DC 1I5LA 3M54A 3GIBA 3CD6T 4PJOB 5I2MA 4Y91A 3QJ6A 4J83A 3VKIA 5LJ3j 4JJNK 1IZ6A 2DTIA 4ZTJA 2XD0A 2DJZA 1VQ4T 2QI2A 4RCBA 3MP6A 3HSBA 2DZCA 3DB3A 4IUUA 3EFRA 3OYBA 4O5VA 3CC4A 3HPWA 2PU9B 2DD5A 3HFNA 2BIVA 4GLKA 3OSSC 4JRPA 5HK3A 1H641 2VUBA 4II1A 2L8DA 4XTWA 1YJ9T 1LOJA 2OTLT 3FB9A 2YLBA 4M7AF 2P0KA 2KMTA 1VQNT 4LDYA 2EKOA 3A8LB 5CK9A 2V8KA 4NOYA 1JJ2S 2PQWA 2ZZDA 2EAYA 4RG8A 4ELYC 2MI6A 5GAMd 2DXBA 3KUFA 2ZPGB 3M57A 4A53A 3V8LA 5GAOn 3PGGA 2XU8A 3ZEHA 2EQMA 4FU6A 4E7LA 3CCJT 1WNLA 3G6ET 1VQMT 5GAMf 1WJQA 2RA2A 4PJOF 3LW5E 3OYKA 4RKUE 1PSFA 4HCCA 3GLXA 4JLIA 1BYMA 5IN1A 2LTOA 2O4XA 3N5BB 2GF7A 1BKBA 4A4EA 3JCMg 2YLCA 3OY9A 1M1KC 2DKGA 2RI3A 2FVUA 2Y4YA 1KHIA 4KULA 3LGLA 3JCMP 2RHYA 4EMGA 2EWNA 3OBYA 3OB9A 4M7AD 2K3YA 3META 1KD1C 1M1GA 2JTMA 4MZPA 4C0DB 4NL3A 1Y96A 1G3SA 5FLXE 2MF2A 3I55T 2DAQA 4J7IA 2R5MA 4KT0E 3JCMQ 1S72A 1VQ6T 1X6OA 4M75A 4M78G 3X20B 2GQVA 1K9MC 1GXIE 1YHQA 1M1FA 3CCMT 4OB0B 4PJOD 2F5TX 3A8MB 2V8IA 3L2ZA 5LJ5d 3SWNA 1VQLA 3QO3A 3HP9A 4JRIA 3ME9A 4M77A 2QEXT 2OTJA 3A8OB 2VXEA 3LWIA 4LD6A 2M9UA 2OTLA 5A0GA 3CCLA 3DLMA 3CMET 2F69A 1ZBXA 1UB4A 2KQWA 3CBPA 1NPPA 3CPWA 4WF2A 3JB9H 2E6NA 5GAN8 2VV5A 3DB4A 4NL2A 1YJNA 4OGEA 4BI4A 5FU6B 4HA8A 3MEUA 2E12A 2KDSA 2V8JA 4EPCA 1H3ZA 5KCHA 3G6EA 1Y96B 5LL6S 5A2QE 1LJOA 3L42A 3CPFA 1X01A 3CCEA 4BY6B 1DJ7B 3CCQT 1VQ5T 3QHSA 1NJIU 5A0DA 4M75B 2RB6A 4M78D 4C92G 2EFIA 2LT4A 2D0QB 1N27A 4J5YA 3G4SA 4E7HA 2DO3A 1U8RA 2WSEE 5EG2A 4CRIA 3CCSA 4PNOA 1VQ9T 1VQKT 4PJOC 3SWNB 4FT2A 4ATOA 4M77B 3J81E 2X4YA 2K5IA 5GANg 1YIJT 1WJSA 4C5GA 1WJRA 2PVGB 2D6FA 4A4FA 3I56T 3MCAB 4FT4A 2EQJA 4ZN3A 2LVMA 3J80E 2LX9A 3J7AF 2WSCE 3MEWA 4D6WA 3URGA 2DEQA 3NFCA 2QDYB 2VYTA 4IUTA 3S6WA 4M7AG 2ZPIB 3JSCA 1W4SA 5J26A 4N4IA 3CMEA 4M7DG 1XNIA 2A7YA 4PLIA 3X26B 5GMKj 3FC3A 4M77G 1YITT 4M78C 5LJ3e 2E41A 4N4HA 5GAOl 1XOVA 1NPRA 4HKEA 2QQBA 1N9RA 1O75A 3SFMA 5M9OA 1FWZA 3CXCA 1WQWA 5CR2A 3CC7A 1MHNA 3QIIA 4KBMB 1RL2A 1BI2A 2LCCA 1KQSS 3JB9F 2X4WA 3VV0A 3TU4K 2RHUA 4DOVA 3JRZA 3OW2S 3HHTB 1D3BA 5GAN5 3RESA 1QVFA 4LDVA 4FL6A 2IVWA 4EMHA 3OYEA 1KC8U 4KUDK 4C8QG 2XDPA 3E19A 4M75D 1BIAA 2GCXA 2NLUA 3QYHB 3RKYA 3CCUA 2DK3A 2QXFA 4F7UG 5D6WA 5IT9E 5LJ5j 4E7JA 3M56A 3E9FA 2X4XA 2Y90A 4FM4B 3C94A 1XTDA 1NJIC 3JCMV 2CGHA 4BUGA 4J8OA 3RMQA 3HL8A 2JUFA 4BDYA 4PJOE 3M58A 4M77D 1VQ7A 5GAOm 3L2VA 3TCJA 1Q82U 2E64A 3RMSA 1VQ8A 3CC2T 2EQKA 3JB9D 1Q81U 5FROA 4C0ZA 3JCMc 3OYLA 5GAMg 3DKMA 4IURA 3CMAT 1OZ3A 2CZ6B 3G71T 2P0PA 2RJFA 4J7FA 4HCBA 2YHTA 3P8BB 2WSFE 5L8RE 5C6SA 3OYNA 4M78B 5FU6C 2HNIA 3CBMA 4MZTA 1VQOT 4C92A 3OYIA 3A8GB 3H8ZA 2QA4T 1D3BB 2FB7A 2FL7A 2LCLA 4HT8A 4YTLA 1YCYA 2VGNA 3BW1A 3CXCS 1QVGA 4QQGA 4BY6C 3VJPA 4IUQA 5CQXA 2KAFA 1BI3A 2RO0A 2ZPBB 3EAEA 3M55A 4M75C 4XU3A 4JUVA 4EDUA 3L2UA 3MP8A 5GAOq 1I4K1 4M78E 1G3TA 3LH0A 5FU7C 3CCRA 2DZ9A 1YJWT 3RUXA 3SWNC 3JB9J 4L6V5 3FEOA 5GANj 2QQAA 1M90U 3OYCA 1QVFS 4QVZA 4M77C 3CEYA 3M5AA 1UGSB 4XTZA 3CD6A 1FXXA 4PL6A 4JRQA 3MEAA 1VQ4A 1X75C 1SSFA 1R8OB 4N0AA 3A8HB 3LYIA 1AHJB 3MEVA 2DTHA 2ZPHB 3BDLA 1N8RU 5LJ5g 5A0LA 4M7DA 4M78F 4Q5WA 4N4GA 3ZBDA 1YJ9A 4NS5A 3KBGA 4C92B 4EMKA 2XG8D 3V7RA 1U1SA 4XQ3A 4JDSA 3NTHA 1KC8C 4OMFB 1YI2T 2L5QA 1VQNA 2QTXA 4J6WA 2WACA 3JCMf 1Y71A 2O4XB 1QP3A 2RHZA 4BE1A 4E7IA 1W2BA 1K73U 1G3WA 5FRNA 5GAN3 2ZPFB 1OZ2A 4L5GA 3Q1JA 3FIFA 5LJ3d 4PKCC 5GAOr 5CQYA 2ZGWA 5D6YA 2K4YA 4V2SA 3OS0A 3GPLA 3JCMW 1M9SA 3CCJA 1VQMA 1M5Q1 4BB7A 4BI3A 3JB9I 1Q82C 2XKOC 1IREB 3QDRB 3QXEB 2EJFA 3QBYA 2LT1A 5LJ3f 4MZMA 4ZN1A 3OYHA 5I2SA 2R57A 2E65A 3OYYA 4C8QA 4XU2A 4C5HA 3GOXA 3E1SA 3T9NA 3M9QA 4F7UA 5FU7B 2R58A 4LDWA 4OB3B 5CCAA 3VYGA 3FJPA 4A4GA 2EIFA 4M7DB 2RJDA 2JOYA 4EMKB 2JN0A 2E6ZA 3WVEB 1G3YA 4M75E 3I55A 4C5IA 1VQ6A 4XU1A 5GMKe 1VQPT 1M8VA 3OSVA 4E47A 3OA6A 1KG1A 3MO8A 4A4HA 2FYKA 3QYGB 2RJEA 3QZ9B 1WPYA 1RI0A 3GNFB 2K5FA 3CCMA 2QQ9A 3FDRA 3WXMB 3ZFJA 3M53A 4M77E 2P4TA 5AYFA 3BFMA 3JCMe 4BDZA 2QQRA 4QQDA 5GMKl 5GAMj 5I21A 2QEXA 4JLGA 4RMOA 5CKHA 4OF1A 3KXTA 2L89A 4C5EA 1P92A 5DLOA 3QJYA 1W2BS 4OVAA 3CPWS 2MMPA 4M75F 4C8QB 3CC4T 2VXFA 2XK0A 3LLRA 2HQXA 3P8HA 2IG0A 3JCMJ 4C92D 4XAXB 3JCMh 4F7UB 4VUBA 3G7ZA 5IAYA 2LRQA 1U1TA 1Q7YU 2CZ1B 3QPHA 1KQ2A 3OMGA 5GANf 4M77F 5GAN4 1QVGS 1I8FA 4ZGDB 2LQ8A 3FRNA 5LJ5e 3L2WA 2G3RA 3HRTA 4QW2A 2K3XA 2DVEA 3CCQA 2E1HA 4XTXA 3V8KA 3S3OA 3OYGA 4MDXA 1VQ5A 5LJ3h 2CS7A 1UGPB 2CKKA 4F7UE 1HK9A 1JJ2A 1LNXA 3BDUA 3PIPA 2E70A 4RG2A 3L2QA 1N6AA 3X25B 2HD0A 4L59A 3V8JA 1VQ9A 1VQKA 5GMKm 2RHXA 3VUZA 1KD1U 2KK4A 3OS5A 2PUKB 2M16A 2LC4A 4IKFA 2K5LA 3TEEA 1O9SA 3OYAA 1YIJA 4BE0A 2RM4A 2PUOB 2HQEA 1OI1A 1BI1A 3L1AA 3S3NA 3ASKA 5C0MA 4J6XA 4QVCA 5HKCA 1K9MU 4M7DD 1YBYA 3I56A 2LNVA 2CZ7B 3HKSA 4F7UF 4C92C 2B8AA 4OGCA 2HBPA 5HY6A 4ME7A 2X4JA 3C4SA 3ER0A 4MMKA 1N9SA 4Y28E 3R6OA 4BE2A 1S72T 3WVDB 1WGSA 1M4ZA 4O6JA 3NTIA 3PFSA 3BY7A 3EFSA 4HT9A 4FSXA 4PLLA 1ZHIA 5GANe 2JZ2A 5CAIA 4TVRA 1YHQT 2L3RA 2HAXA 3SDZA 1QVPA 2ZPEB 1Y7XA 3X28B 5CIUA 3QUIA 2JNGA 4A54A 1YITA 3QSUA 1VQLT 1VIFA 2XHCA 3PNWC 2OTJT 4X34A 5FRMA 1UGRB 3V7SA 4C8QD 4LDXA 5DLQE 3OYFA 3OBWA 2X35A 3CCLT 4KUIA 3PMTA 3S3MA 2YRVA 5GANh 4N0AC 5GAN2 2RD1A 5CKBA 4JS5A 4X9DA 3SD4A 1YJNT 2M1HA 4PJOG 5CKDA 2DXCA 4M7DC 2F5KA 2DIQA 3HFOA 4CI0C 4EMKC 1Q7YC 2DTOA 1QW1A 3UDCA 1MGQA 1I81A 3H6ZA 1BI0A 1EIFA 5D6XA 3CCET 2XDBA 4R56A 2RH2A 3VU3C 2DIGA 2MWPA 3UT1A 3TREA 3M59A 4XK8E 3G4ST 4P5NA 3JCMd 2O01E 3QZ5B 3CCST 3X24B 1BIBA 3FLGA 1XQHA 2EQUA 4GY5A 5CVIA 4LDUA 5J39A 2PVOB 5GAOp 4BACA 2QQSA 2EJGA 3CC2A 5CKEA 2H3JA 4ZGEB 1K8AU 1JRIA 3PT9A 3AHUA 4C8QC 3VUBA 2LQKA 2LDMA 1JBMA 3INZA 3QG1A 4HCZA 5LJ3g 3CMAA 2JVVA 3G71A 2KVQG 3OYMA 2A3LA 4C92E 2VC8A 2Y4XA 3PIOA 5CO7A 3CCVT 3LX7A 5GAN7 1VQOA 1JB0E 4RCCA 3RKXA 3HRUA 2QA4A 5KE2A 1HXDA 1Q81C 1VUBA 1Y07A 3HRSA 2E5QA 4QVDA 3M4YA 3C12A 2XI9A 2MAMA 3P8DA 4DOWA 2OAUA 5DY9A 5LJ5f 5GAN6 4UC4A 3C95A 2DD4A 4DQ2A 2EYQA 3LGFA 1B34A 2CZ0B 5GAMe 4A4KA 1V29B 4IUVA 4DA4A 5J3BA 1Q86U 4J6YA 4C92F 4R55A 1YJWA 2XIDA 2EJ9A 3NTKA 3PTAA 3JCMb 2K57A 4ZTFA 4M7AC 4C0GA 4IUPA 4MMLA 3GF5A 3CC7T 1VIEA 4BI8B 3A5ZB 3OS2A 2FHDA 5DM7R 5GAMh 3V7CA 4B9WA 4M7DE 2BUDA 3O8VA 1NZ9A 1OYXA 1KQSA 1M90C 4JS4A 4XTUA 3MP1A 4OB2B 5GMKi 5CKFA 5GMKh 4FIBA 3OW2A 4M7AA 2MWOA 1TH7A 2KSSA 4X9CA 1YI2A 2GFUA 2DXTA 3CCUT 2RK2A 3E9GA 5KH6A 1ZQ1A 4XU0A 4B9XA 4ELZC 5GANd 3GP8A 1UGQB 2CYZB 2D9TA 2C06A 2VGMA 4OP0A 1N8RC 2RI5A 1FX7A 3PMIA 3OQ5A 3JCMX 4M7DF 1B34B 2RK1A 5HK0A 1VQ7T 3DLLA 4PJOA 1Q86C 1G5VA 2I2LA 3CCVA 1VQ8T 2RJCA 4C8QE 4M75G 4OB1B 3LWHA 3JAME 2BKDN 3OYDA 4JRKA 1K8AC 1NE8A 3SB2A 1K73C 2GFAA 1M1KU 2DPPB 3UPUA 3MHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSC A;  1VUB A;  4MZT A;  5CKH A;  4OF1 A;  5CKF A;  5DLO A;  3HPW A;  5CCA A;  5CQX A;  4ELZ C;  2VUB A;  5HK3 A;  1UB4 A;  4HKE A;  3G7Z A;  4VUB A;  5HKC A;  2C06 A;  2KMT A;  5CKE A;  4MZP A;  3TCJ A;  5CR2 A;  5CKB A;  5HK0 A;  3VUB A;  2MF2 A;  5CK9 A;  5CQY A;  4ME7 A;  4ELY C;  5CKD A;  4MDX A;  3JRZ A;  3NFC A;  5CO7 A;  1NE8 A;  1X75 C;  1M1F A;  4MZM A; 
#chains in the Genus database with same CATH topology
 3EGX A;  4XTV A;  3GNG A;  3OYJ A;  1YJW Q;  2KY9 A;  1TU0 B;  1TG0 A;  3OMC A;  3CBO A;  4XTY A;  4ZGJ B;  2K2V A;  2R5A A;  4M7A E;  2JS0 A;  4C0D C;  1I5L A;  3M54 A;  4PJO B;  1SKU B;  4J83 A;  5LJ3 j;  4JJN K;  2RQU A;  1VQ4 T;  1WZO A;  4RCB A;  3EG9 B;  5KYX B;  3EHR A;  3OYB A;  3EFR A;  2PU9 B;  3CQT A;  4RTV A;  3ZL7 C;  3OSS C;  1YJ9 T;  5HK3 A;  2VUB A;  4AMC A;  4AFQ C;  1LOJ A;  1ZUK A;  4PFP A;  2OTL T;  3FB9 A;  4AFU C;  4M7A F;  1VQN T;  2EKO A;  2KGT A;  5CK9 A;  4NOY A;  2EVR A;  5GAM d;  1S1N A;  5GAO n;  2XU8 A;  4E7L A;  4FU6 A;  4GLM A;  1WJQ A;  1KC8 R;  1LCK A;  1BYM A;  2YLC A;  2Y4Y A;  3LGL A;  2RHY A;  1K9A A;  3KFV A;  4NL3 A;  5FLX E;  4HVU A;  4JPB W;  4KT0 E;  1X6O A;  1WHJ A;  4M75 A;  3CCU Q;  2KEA A;  1U3O A;  1UDL A;  2GQI A;  1GXI E;  4OB0 B;  2F5T X;  3L2Z A;  2DIL A;  1VQL A;  4PFO A;  1V1C A;  1VQ7 Q;  1NLO C;  3LWI A;  2OTL A;  1RAD B;  3CME T;  2L3Q A;  1ZBX A;  2KQW A;  3CPW A;  1H92 A;  2VV5 A;  3DB4 A;  4GBQ A;  4OGE A;  5FU6 B;  4HA8 A;  3MEU A;  1W6X A;  4EPC A;  3C0C A;  1Y96 B;  3L42 A;  2OI3 A;  2ZAE A;  4M78 D;  1RAG B;  4J5Y A;  4E7H A;  1U8R A;  4CRI A;  4Z88 A;  4PNO A;  5IHI A;  4FT2 A;  2X51 A;  1W1F A;  5GAN g;  2DYI A;  2PVG B;  4ZN3 A;  2HEQ A;  2FPD A;  2LX9 A;  3URG A;  1GCQ A;  3NFC A;  2VYT A;  1SSH A;  5J26 A;  3CME A;  4PLI A;  1YJN Q;  1ZSZ A;  2E41 A;  2JMA A;  4N4H A;  1XOV A;  4LXC A;  2QQB A;  1FWZ A;  1RAI B;  2V1R A;  1BI2 A;  1OQK A;  3H0H A;  3OW2 S;  2AK5 A;  1UEC A;  2DJQ A;  1KC8 U;  7AT1 B;  4KUD K;  4C8Q G;  3QYH B;  3CCU A;  1C1A A;  3RKY A;  2SEM A;  4F7U G;  5D6W A;  3RR6 A;  2ATC B;  4E7J A;  3E9F A;  2CGH A;  3HL8 A;  4BDY A;  4M77 D;  1VQ7 A;  1SG5 A;  3CCM Q;  3TCJ A;  1AEY A;  5IXB A;  2H3E B;  1JXM A;  2QEX Q;  3DKM A;  2WSF E;  2HNI A;  3CBM A;  4C92 A;  2DLP A;  2QA4 T;  2FL7 A;  4HT8 A;  4QKU A;  2VGN A;  2BZY A;  4IUQ A;  1ZX6 A;  5CQX A;  2KAF A;  1BI3 A;  1UJY A;  4JUV A;  5GAO q;  4M78 E;  3LH0 A;  1VQ5 Q;  4J9F A;  1GCP A;  1M90 U;  3RUX A;  3FEO A;  4AG1 C;  1IB8 A;  1QVF S;  4QVZ A;  1FXX A;  2L3P A;  4FYY B;  1R8O B;  3QDF A;  2DTH A;  2G6F X;  4M78 F;  3I56 Q;  1T0J A;  1TUG B;  3KBG A;  1U1S A;  2LJ1 A;  1RAB B;  4PJM A;  4J6W A;  3JCM f;  1UUE A;  1OPK A;  1Y71 A;  2RHZ A;  1G3W A;  5GAN 3;  3Q1J A;  3BE3 A;  3FIF A;  4PKC C;  5CQY A;  2K4Y A;  4FCY A;  1RAC B;  2VVK A;  1M5Q 1;  3JB9 I;  2PNI A;  2M51 A;  3QXE B;  2LT1 A;  3OYH A;  2E65 A;  1JO8 A;  4JZ4 A;  2DVJ A;  3T9N A;  5FU7 B;  1U5S A;  3FJP A;  4A4G A;  2EIF A;  4FSS A;  4M7D B;  1FMW A;  2V26 A;  4AFZ C;  1NM7 A;  2YDL A;  4AG2 C;  4LUE A;  1D0X A;  3QYG B;  1H8K A;  3QZ9 B;  3CCM A;  2QQ9 A;  3FDR A;  3ZFJ A;  2RQT A;  4M77 E;  5AYF A;  2L2P A;  2QQR A;  2O31 A;  2QEX A;  2L89 A;  2QYZ A;  4EIK A;  1W2B S;  2MMP A;  3CC4 T;  1TUD A;  3LLR A;  3P8H A;  3CMA Q;  2CZ1 B;  2D0N A;  1KQ2 A;  2ECZ A;  4M77 F;  1MUZ A;  1T3S A;  4QW2 A;  2DVE A;  4HCK A;  3OYG A;  2JS2 A;  5LJ3 h;  1VQ5 A;  1UGP B;  4PFZ A;  1HK9 A;  1LNX A;  4RG2 A;  3L2Q A;  5GMK m;  2RHX A;  3VUZ A;  1ZA1 B;  3OS5 A;  2HL5 C;  2M16 A;  2LC4 A;  4BE0 A;  2RM4 A;  1OI1 A;  5HKC A;  3OW2 P;  3I56 A;  1M3B A;  2CZ7 B;  1ZSZ B;  2EBP A;  2B8A A;  4OGC A;  1T0H A;  1M2V A;  1N9S A;  2CUD A;  2RQR A;  1ACM B;  1WGS A;  1M4Z A;  4PK4 A;  2CP6 A;  3PVQ A;  4PLL A;  1M1K R;  2HAX A;  3GIB A;  4M7A G;  2DF6 A;  2RNA A;  4A54 A;  5FRM A;  1UGR B;  4C8Q D;  5GAN h;  3EGD B;  2RD1 A;  2A36 A;  2M1H A;  5CKD A;  2DIQ A;  2ENM A;  4EMK C;  1Q7Y C;  1Z9Z A;  2JM8 A;  1IGU A;  3H6Z A;  4CC3 A;  4R56 A;  1BU1 A;  1R0B G;  2NUP B;  1VQP Q;  2ESW A;  4ESR A;  1YWP A;  3G4S T;  3CCS T;  3FLG A;  1XQH A;  2PVO B;  5CKE A;  2H3J A;  2AKK A;  2LDM A;  1RAH B;  3CMA A;  3VS1 A;  3OYM A;  2J7I A;  2VC8 A;  2Y4X A;  2YRD A;  2HKN A;  4F04 B;  1PKT A;  3LX7 A;  4AFS C;  2BZX A;  2LQW A;  1HSQ A;  2FZC B;  3HRS A;  1WLP B;  1RLQ C;  3A1P A;  2DD4 A;  4A4K A;  1WDX A;  5J3B A;  4J6Y A;  4R55 A;  4DBH A;  2K57 A;  4M7A C;  4C0G A;  4IUP A;  3EH2 A;  3GF5 A;  3CC7 T;  3A5Z B;  5FWC A;  3OS2 A;  2X3X D;  1NZ9 A;  4JS4 A;  3OW2 A;  4QT7 A;  4FIB A;  2KSS A;  4X9C A;  1ARK A;  4B9X A;  1B3Q A;  2BZ8 A;  1S72 Q;  4KGX B;  2RI5 A;  2RK1 A;  2EPD A;  1YHQ Q;  4PJO A;  1G5V A;  4C8Q E;  4M75 G;  2OTJ Q;  3EG9 A;  5KYX A;  1NE8 A;  3SB2 A;  1MMG A;  3CCL Q;  2LJ0 A;  1M1K U;  3UPU A;  2RQW A;  1KQ1 A;  5KCO A;  1WQ7 A;  2ABL A;  1QKW A;  3RKW A;  4BD3 A;  2JTF A;  2HSP A;  4C8Q F;  5FWB A;  1VQP A;  2AZS A;  3M0U A;  1QP2 A;  1KIK A;  2XDD A;  1PSE A;  3L2R A;  3CCR T;  1KHC A;  4OMN A;  2RHI A;  1MMA A;  3OS1 A;  3VYH B;  3CD6 T;  4Y91 A;  3QJ6 A;  3VKI A;  1IZ6 A;  4ZTJ A;  4DEX A;  2DZC A;  1VYU A;  4O5V A;  1RI9 A;  4F17 A;  1C0M A;  2DD5 A;  1H64 1;  4II1 A;  3CCV Q;  6AT1 B;  2YLB A;  4LDY A;  4M4Z A;  4IIO A;  2PQW A;  4ELY C;  2MI6 A;  1X27 A;  2KT8 A;  3V8L A;  1H3H A;  2EQM A;  4OMP A;  4Y92 A;  1WXT A;  2QTV A;  4PJO F;  2KRN A;  1X2Q A;  2AZV A;  2FEI A;  3LW5 E;  1PSF A;  4IIM A;  5IN1 A;  3N5B B;  2GF7 A;  1BKB A;  3E2U A;  4FYW B;  3JCM g;  2FVU A;  4KUL A;  4EMG A;  4KGV B;  4M7A D;  1KD1 C;  1M1G A;  4FW1 A;  1Y96 A;  1G3S A;  3I55 T;  2DAQ A;  4J7I A;  3QWY A;  1S72 A;  4A63 B;  4M78 G;  2YWW A;  2GQV A;  1G83 A;  1YHQ A;  3EFO B;  2V8I A;  3A98 A;  1PD0 A;  2JW4 A;  5LJ5 d;  3QO3 A;  1OU8 A;  4JRI A;  3ME9 A;  2OTJ A;  1ABO A;  1PCX A;  4LD6 A;  2M9U A;  1VQ8 Q;  5A0G A;  3CCL A;  2F69 A;  1NPP A;  3JB9 H;  5GAN 8;  2DNU A;  2E12 A;  2KDS A;  5KCH A;  3CPF A;  1DJ7 B;  1HJD A;  3MKD A;  2YUO A;  2ED1 A;  2RB6 A;  2LZ6 B;  4C92 G;  1N27 A;  4R0K A;  1VQ9 T;  1VQK T;  3HTR A;  3J81 E;  3UA6 A;  1K4U S;  2K5I A;  1YIJ T;  4C5G A;  1WJR A;  4A4F A;  2HQH A;  3J80 E;  1EFN A;  4D6W A;  2DEQ A;  1YJ9 Q;  2CUB A;  4IUT A;  3S6W A;  2OAW A;  2OTL Q;  4PJN A;  1UTI A;  1VQN Q;  2A7Y A;  2K3B A;  5GMK j;  4M77 G;  1QVG P;  4M78 C;  3MJX A;  5LJ3 e;  1ZUY A;  5GAO l;  2CT4 A;  3SFM A;  4JJC A;  2KNB B;  2X3W D;  1MHN A;  3QII A;  1RL2 A;  2X4W A;  2DFU A;  3VV0 A;  3TU4 K;  3JRZ A;  2KRM A;  4EMH A;  2FPE A;  3E19 A;  4M75 D;  2NLU A;  2GCX A;  5KYY A;  1J3T A;  2QGF B;  1NJI C;  3UAT A;  1K0X A;  4J8O A;  1W70 A;  3RMQ A;  2JUF A;  3L2V A;  1VQ8 A;  1OEB A;  2K6D A;  5EC7 A;  1WHK A;  5GAM g;  1OZ3 A;  2CZ6 B;  3CME Q;  3G71 T;  2P0P A;  2RJF A;  4J7F A;  3VRZ A;  4HCB A;  2YHT A;  3A8G B;  3H8Z A;  1D3B B;  4YTL A;  1KD1 R;  2XMF A;  1AZE A;  3BW1 A;  3CXC S;  4BY6 C;  1QWE A;  2ZPB B;  4XU3 A;  3EAE A;  3M55 A;  1XJW B;  3RBB B;  1YJW T;  3SWN C;  5GAN j;  2GTJ A;  4M77 C;  1UGS B;  2ROL A;  2QAZ A;  1VQ4 A;  1SSF A;  3A8H B;  3LYI A;  2ZPH B;  4M7D A;  3TSW A;  1YJ9 A;  2XG8 D;  2COY A;  3V7R A;  2C0T A;  1M27 C;  4OMF B;  1YI2 T;  2L5Q A;  1VQN A;  2QTX A;  2VKN A;  4E7I A;  2C0I A;  2O9S A;  2ZPF B;  5LJ3 d;  5GAO r;  5IHK A;  5D6Y A;  1M90 R;  3GPL A;  3JCM W;  2LMJ A;  4BB7 A;  2EKH A;  1Q82 C;  1QVG A;  1IRE B;  1ZSG A;  3I35 A;  3QBY A;  4MZM A;  2R57 A;  4RTT A;  4JJB A;  3E1S A;  4OB3 B;  3VYG A;  2KXD A;  4EMK B;  3I9Q A;  1G3Y A;  1KSW A;  4M75 E;  3OA6 A;  3MO8 A;  1NEB A;  2RJE A;  1WPY A;  2GBQ A;  2DER A;  2K5F A;  2QGG A;  2LJ3 A;  3M53 A;  3VRY A;  4BDZ A;  5I21 A;  4C5E A;  4OVA A;  4M75 F;  1AWO A;  2XK0 A;  1JXO A;  2IG0 A;  4C92 D;  2RMO A;  3JCM h;  4VUB A;  2LRQ A;  1U1T A;  2CDT A;  4E7Z A;  3QPH A;  3OMG A;  2M0Y A;  1UHC A;  4ORZ A;  1IHW A;  3H0I A;  3L2W A;  2EGE A;  2K3X A;  2HCK A;  2E1H A;  1TWB A;  3S3O A;  2CSQ A;  5FW9 A;  2HZY A;  2F2X A;  3BDU A;  3PIP A;  3X25 B;  2QDL A;  4CC2 A;  1KD1 U;  1WA7 A;  2KK4 A;  1TS9 A;  3TEE A;  3OYA A;  3EGD A;  1MND A;  3S3N A;  3NGP A;  4J6X A;  2EYZ A;  4QVC A;  2D8J A;  2HBP A;  5HY6 A;  1X43 A;  2YXY A;  2B86 A;  1YWO A;  2AKL A;  3R6O A;  3WVD B;  3NTI A;  3EFS A;  1LVK A;  2NUP A;  2YUP A;  4K11 A;  2L3R A;  1QVP A;  3X28 B;  2JNG A;  1OX8 A;  3PNW C;  3V7S A;  5KYY B;  5DLQ E;  1EX4 A;  3OYF A;  1UHF A;  1MV0 B;  4N0A C;  4J9B A;  4X9D A;  1N5Z A;  4PJO G;  2CP5 A;  1YJN T;  2F5K A;  4OMQ A;  1I81 A;  1BI0 A;  5D6X A;  3CCE T;  2XDB A;  3VU3 C;  2MWP A;  2DL5 A;  2GTO A;  3QZ5 B;  1AD5 A;  3X24 B;  5J39 A;  2EQU A;  3GBQ A;  1JRI A;  4C8Q C;  1JBM A;  4HCZ A;  2D1X A;  3PVL A;  4RTW A;  2DRM A;  2KVQ G;  2A3L A;  3CC4 Q;  4C92 E;  1JU5 C;  5ECA A;  5GAN 7;  1JB0 E;  3RKX A;  4HVW A;  2QA4 A;  1Q81 C;  1M3C A;  1Y07 A;  1B7T A;  3P8D A;  4DOW A;  5DY9 A;  5LJ5 f;  5GAN 6;  3C95 A;  4DQ2 A;  2NUT A;  2CP3 A;  1CKB A;  1V29 B;  4C92 F;  2EJ9 A;  2JJ9 A;  4ZTF A;  1SEM A;  4MML A;  4LN2 A;  1VIE A;  4BI8 B;  5DM7 R;  5GAM h;  4B9W A;  3O8V A;  4PJJ A;  3MPU B;  4RTX A;  3MP1 A;  2ROT A;  5GMK i;  5CKF A;  5GMK h;  1JQQ A;  2MWO A;  4ZNX A;  4HVV A;  1B07 A;  2DA9 A;  2GFU A;  1QQJ A;  5KH6 A;  1X2K A;  2D9T A;  2LQN A;  1N8R C;  2DL3 A;  1RLP C;  4J9H A;  1FYN A;  1Q86 C;  2I2L A;  2RJC A;  1Z9Q A;  2MOX A;  3M0Q A;  4RTU A;  3JAM E;  3OYD A;  1Q95 G;  4JRK A;  1K8A C;  3ULR B;  1RAF B;  1K73 C;  3V7C A;  1IHV A;  2DXU A;  5AT1 B;  2FZK B;  2P0Q A;  4LUD A;  5KE3 A;  4J9D A;  4HXJ A;  4C0F A;  2J6O A;  1UFF A;  2E10 A;  2M0O A;  5GJW B;  4Z02 A;  4LD9 K;  4FYX B;  4MDW A;  4E7K A;  3QKJ A;  2CT3 A;  3G4S Q;  1QCN A;  1TSF A;  1D1C A;  3CCS Q;  2K7A A;  2XD0 A;  2DJZ A;  2QI2 A;  3MP6 A;  2P84 A;  3DB3 A;  4IUU A;  3CC4 A;  3HPW A;  1TUC A;  3HFN A;  1PKS A;  4JRP A;  2P0K A;  2KMT A;  2JT4 A;  1WHG A;  1MMN A;  2V8K A;  1JJ2 S;  2ZZD A;  2EAY A;  3EFO A;  4A53 A;  3ZEH A;  3CCJ T;  1QCO A;  3G6E T;  5GAM f;  1VQM T;  2JMC A;  2RA2 A;  3OYK A;  4RKU E;  4OMO A;  4HCC A;  3GLX A;  4JLI A;  3VS4 A;  2O4X A;  3CC7 Q;  4A4E A;  3OY9 A;  1QVF P;  1HD3 A;  1RUW A;  2RI3 A;  3JCM P;  1KHI A;  1R77 A;  2LP5 A;  3OB9 A;  2D8H A;  4C0D B;  2RF0 A;  1IO6 A;  3JCM Q;  1VQ6 T;  2J06 A;  5KYW B;  2YUN A;  4Z89 A;  1TTH B;  1M1F A;  4PJO D;  2HSE B;  3HP9 A;  3EG0 A;  2MIO A;  1ZBJ A;  3DLM A;  1OX9 A;  1UB4 A;  1V76 A;  2FRY A;  3CBP A;  4WF2 A;  2FZG B;  4NL2 A;  4BI4 A;  1MMD A;  2V8J A;  1ZA2 B;  3G6E A;  5LL6 S;  1LJO A;  3CCQ T;  1X01 A;  4BY6 B;  2DBM A;  2A28 A;  5A0D A;  1ZLM A;  2EFI A;  2LT4 A;  2D0Q B;  3G4S A;  1N8R R;  1NLP C;  2LX7 A;  5EG2 A;  3CCS A;  3EH1 A;  1GRI A;  3SWN B;  3CCR Q;  4M77 B;  1YNZ A;  3CD6 Q;  1WJS A;  2CSI A;  3NMZ C;  2D6F A;  2NUT B;  1WXB A;  2EQJ A;  1KJW A;  1SRL A;  2WSC E;  3MEW A;  1W2B P;  1KFZ A;  1NBE B;  4CC7 A;  2KT1 A;  2KI7 A;  1D1B A;  2E3H A;  3EG2 A;  2DL8 A;  4M7D G;  3NPF A;  1YIT T;  1WYX A;  1TXQ A;  1NPR A;  4HKE A;  1O75 A;  1FMK A;  1IGQ A;  1GFD A;  3VS0 A;  3IQL A;  3CC7 A;  1NEG A;  3JB9 F;  1M3A A;  1AWJ A;  2O2O A;  2A37 A;  2RHU A;  2HKQ B;  2F2W A;  3HHT B;  1D3B A;  1QVF A;  2IVW A;  1VYV A;  1PRL C;  2XDP A;  1BIA A;  2QXF A;  3I55 Q;  5LJ5 j;  5HCK A;  2Y90 A;  4FM4 B;  2EYX A;  2L3S A;  4PJO E;  3M58 A;  1Q7Y R;  3CC2 T;  2EQK A;  1Q81 U;  4C0Z A;  3JCM c;  4F16 A;  2FO0 A;  4IUR A;  3P8B B;  5L8R E;  3VS2 A;  1VQO T;  3O5Z A;  1YCY A;  1JJ2 P;  4M75 C;  4EDU A;  2P4R A;  3MP8 A;  3L2U A;  1I4K 1;  1G3T A;  5FU7 C;  3EGU A;  3CCR A;  2DZ9 A;  4L6V 5;  1TOV A;  4WTO B;  3CEY A;  3CD6 A;  4XTZ A;  1VQ9 Q;  1VQK Q;  4JRQ A;  1X75 C;  3TVT A;  2J6F A;  1YIJ Q;  1WHH A;  1N8R U;  3BDL A;  1SF9 A;  5LJ5 g;  3ZBD A;  4NS5 A;  4EMK A;  2AT1 B;  3M0R A;  4JDS A;  3NTH A;  1KC8 C;  2EYY A;  3VS5 A;  4RTY A;  2O4X B;  1W2B A;  4BE1 A;  1K73 U;  5FRN A;  4L5G A;  5IHN A;  1MV3 A;  2ZGW A;  1AWX A;  4DBR A;  5KYU B;  4BI3 A;  1BK2 A;  2XKO C;  4OMM A;  1QMC A;  2DEU A;  4XU2 A;  4C5H A;  3GOX A;  2R58 A;  4LDW A;  5CCA A;  1RAA B;  1GCQ C;  2JOY A;  2JN0 A;  1A0N B;  3I55 A;  4XU1 A;  5GMK e;  1G8X A;  1VQ4 Q;  1KG1 A;  2FYK A;  1T3L A;  1I5O B;  1RI0 A;  3GNF B;  4KGZ B;  2DRK A;  3WXM B;  1ZSZ C;  4E2F B;  1U06 A;  2P4T A;  3BFM A;  5GAM j;  4QQD A;  5GMK l;  1VA7 A;  4OF1 A;  3KXT A;  1P92 A;  5DLO A;  2YRC A;  4C8Q B;  2VXF A;  2HQX A;  4X1V A;  4XAX B;  4F7U B;  5IAY A;  3G7Z A;  3G71 Q;  1Q7Y U;  9ATC B;  2DET A;  1PD1 A;  3EG3 A;  1I8F A;  4RTZ A;  2LQ8 A;  3FRN A;  3I5R A;  4XTX A;  5I22 A;  2CS7 A;  1JJ2 A;  1N6A A;  4L59 A;  1VQ9 A;  1D0Y A;  1SRM A;  1VQK A;  2PUK B;  1CKA A;  4IKF A;  2K5L A;  2A0F B;  1YIJ A;  2HQE A;  2X9H A;  3L1A A;  1QCF A;  3ASK A;  5C0M A;  4M7D D;  1YBY A;  1JEG A;  2LNV A;  3HKS A;  4C92 C;  3JV3 A;  2W0Z A;  1PHT A;  2CP0 A;  2X4J A;  3C4S A;  4MMK A;  4BE2 A;  1PM3 A;  4O6J A;  1YI2 Q;  3PFS A;  3BY7 A;  1NG2 A;  1D09 B;  4FSX A;  1ZHI A;  5GAN e;  3SDZ A;  2ZPE B;  1Y7X A;  5CIU A;  1VQL T;  1VIF A;  2XHC A;  3PE0 A;  4LDX A;  3OBW A;  2X35 A;  2KBT A;  2K2M A;  3PMT A;  3S3M A;  2YRV A;  1AZG B;  1BBZ A;  2JXB A;  4JS5 A;  3SD4 A;  3HFO A;  1QW1 A;  1GL5 A;  3UDC A;  1MGQ A;  4FW2 A;  1EIF A;  2CP7 A;  2RH2 A;  2O9V A;  3TRE A;  3M59 A;  1D1A A;  1AVZ C;  3R6N A;  4P5N A;  2O01 E;  4GY5 A;  5CVI A;  2ED0 A;  2QQS A;  4ZGE B;  2DMO A;  3AHU A;  3VUB A;  2LQK A;  3QG1 A;  1PRM C;  4J9G A;  5LJ3 g;  2JVV A;  3G71 A;  1QWF A;  3PIO A;  2JTE A;  1GFC A;  2M02 A;  4RCC A;  1Y57 A;  1WHL A;  5KE2 A;  1VUB A;  4QVD A;  3C12 A;  2XI9 A;  1MNE A;  2OAU A;  3U23 A;  4UC4 A;  2EYW A;  2CZ0 B;  4DA4 A;  1K76 A;  1YJW A;  3NTK A;  1QKX A;  2A08 A;  2COZ A;  2YT6 A;  2FHD A;  3TSZ A;  4M7D E;  1OYX A;  2E4H A;  1F1B B;  2C0O A;  4XTU A;  2NWM A;  4D8D A;  1YI2 A;  3CCU T;  2NUZ A;  4DBQ A;  1ZQ1 A;  4XU0 A;  4F14 A;  3GP8 A;  5GAN d;  2GNC A;  2KR3 A;  2CYZ B;  1AOJ A;  2C06 A;  4OP0 A;  1VYT A;  3PMI A;  3JCM X;  4M7D F;  1B34 B;  1VQ7 T;  2EQI A;  3DLL A;  3H41 A;  2QA4 Q;  3M0P A;  4KH0 B;  8AT1 B;  3FC3 A;  3REA B;  3FJ5 A;  3MHX A;  1I1J A;  2LCS A;  1NJI R;  3LH5 A;  2PVD B;  2XIC A;  3UWN A;  5LJ5 h;  4DEY A;  2CH4 W;  3M4G A;  3RIR A;  3RER A;  2W10 A;  3H0F A;  3F70 A;  4M7A B;  3JB9 G;  4J9E A;  2DL7 A;  1OV3 A;  1K0S A;  3CCE Q;  2RI2 A;  2ZCF B;  4QQ6 A;  4M78 A;  1UEB A;  2AHJ B;  5I2M A;  3RDV A;  2DTI A;  1NYG A;  3HSB A;  1R0C B;  1D0Z A;  2BIV A;  3EGX B;  4GLK A;  1WX6 A;  4XTW A;  2L8D A;  2EGA A;  2EGC A;  2COW A;  5IH2 A;  5KYW A;  3A8L B;  4RG8 A;  3SEM A;  2DXB A;  3KUF A;  2KXC A;  2ZPG B;  3M57 A;  1WI7 A;  3PGG A;  3CXC P;  1PNJ A;  1WNL A;  1YFN A;  3UF4 A;  1FMV A;  2LTO A;  1M1K C;  2HDA A;  2DKG A;  2EWN A;  3OBY A;  2K3Y A;  3MET A;  2JTM A;  4MZP A;  1Q82 R;  2MF2 A;  4LNP A;  2R5M A;  3X20 B;  1GBR A;  1OOT A;  1K9M C;  3VS6 A;  3VS3 A;  1E6G A;  3CCM T;  3A8M B;  3SWN A;  4M77 A;  2QEX T;  1KK7 A;  3A8O B;  2VXE A;  2PZ1 A;  2PTK A;  2GGR A;  2KRO A;  2E6N A;  1YJN A;  2HBW A;  3G1J A;  1H3Z A;  2YSQ A;  2L0A A;  5A2Q E;  3CCE A;  2RN8 A;  2VWF A;  1X69 A;  1VQ5 T;  3QHS A;  1NJI U;  4M75 B;  2DO3 A;  2WSE E;  4Z8A A;  4PJO C;  1WHM A;  4ATO A;  4AT1 B;  2X4Y A;  2FRW A;  1OPL A;  1BCO A;  2F2V A;  4E6R A;  3I56 T;  3MCA B;  4FT4 A;  2LVM A;  3J7A F;  4FYV B;  1AWW A;  2QDY B;  4D8K A;  5L23 A;  2ZPI B;  3JSC A;  1W4S A;  1PWT A;  4N4I A;  1XNI A;  2KE9 A;  3X26 B;  1QLY A;  1N9R A;  4J9I A;  3CCJ Q;  3EG1 A;  3G6E Q;  2YUQ A;  5M9O A;  1VQM Q;  3CXC A;  1WQW A;  5CR2 A;  3D7S B;  3AT1 B;  4KBM B;  1AT1 B;  2LCC A;  1KQS S;  2VB6 A;  3NHN A;  2DE0 X;  1GBQ A;  4DOV A;  1UJ0 A;  5GAN 5;  3RES A;  2HMA A;  4LDV A;  4FL6 A;  3OYE A;  5D7U A;  1SPK A;  4LE9 A;  2CRE A;  2DK3 A;  5IT9 E;  1VQ6 Q;  3M56 A;  2X4X A;  3C94 A;  1XTD A;  3JCM V;  4BUG A;  2DYB A;  1SHF A;  2J05 A;  1I0C A;  1CSK A;  3M0T A;  5GAO m;  4B6M A;  4OML A;  1Q82 U;  2E64 A;  3RMS A;  2F1L A;  2FPF A;  3JB9 D;  5FRO A;  3OYL A;  3CMA T;  5C6S A;  3OYN A;  4M78 B;  5FU6 C;  3I5S A;  4MZT A;  3OYI A;  2FB7 A;  2LCL A;  1I07 A;  4QQG A;  1NYF A;  3VJP A;  2RO0 A;  3CCQ Q;  1IXD A;  4KRT A;  1K9M R;  5KYU A;  3JB9 J;  2QQA A;  3OYC A;  3VS7 A;  3M5A A;  1Q81 R;  1BB9 A;  1UE9 A;  4PL6 A;  3MEA A;  4N0A A;  1AHJ B;  2K9G A;  3MEV A;  5A0L A;  4Q5W A;  4N4G A;  4JZ3 A;  4C92 B;  4XQ3 A;  1E6H A;  2WAC A;  1QP3 A;  1WXU A;  1OZ2 A;  4E7S A;  2HL3 A;  2JM9 A;  1ZUU A;  1YCS B;  4V2S A;  3OS0 A;  1YIT Q;  1M9S A;  3CCJ A;  2DX1 A;  1VQM A;  5LJ3 f;  3QDR B;  2EJF A;  2J6K A;  4ZN1 A;  5I2S A;  3OYY A;  4C8Q A;  4CC4 B;  2QAS A;  3M9Q A;  4F7U A;  1OU9 A;  5IXF A;  2RJD A;  2DL4 A;  1Q86 R;  2MK5 A;  1K1Z A;  1PG5 B;  2E6Z A;  3WVE B;  1UGV A;  4C5I A;  1VQ6 A;  1C6V X;  1K8A R;  1VQP T;  1M8V A;  3OSV A;  4E47 A;  1K73 R;  4A4H A;  3JCM e;  2IPO B;  2MYS A;  4JLG A;  4RMO A;  5CKH A;  3UA7 A;  2NYS A;  5I11 A;  3QJY A;  3CC2 Q;  3CPW S;  3JCM J;  1IRX A;  1OUL A;  5GAN f;  1VQO Q;  5GAN 4;  2OJ2 A;  3RNJ A;  1QVG S;  4ZGD B;  5LJ5 e;  2G3R A;  3HRT A;  3CCQ A;  2FG0 A;  1VOM A;  3V8K A;  4MDX A;  2CKK A;  4F7U E;  2SRC A;  2E70 A;  2HD0 A;  3V8J A;  1KQS P;  1O9S A;  2QG9 B;  2PUO B;  1BI1 A;  1LPL A;  1K9M U;  2BE9 B;  1X6B A;  4F7U F;  5KYN A;  4ME7 A;  3ER0 A;  4Y28 E;  8ATC B;  1S72 T;  3REB B;  4HT9 A;  2MPX C;  1X6G A;  5CAI A;  2JZ2 A;  1YHQ T;  4TVR A;  1YIT A;  3QUI A;  2MCN A;  3QSU A;  2OTJ T;  4X34 A;  2DM1 A;  1Y0M A;  1M30 A;  3CCL T;  4KUI A;  4J9C A;  4PJL A;  5GAN 2;  2KYB A;  5CKB A;  2IIM A;  1UG1 A;  4M7D C;  2DXC A;  2VAS A;  2H8H A;  4CI0 C;  1YN8 A;  2DTO A;  2QK0 A;  1M2V B;  2E3I A;  2I0N A;  3TQ7 P;  2DIG A;  3UT1 A;  2E5K A;  4XK8 E;  1BCM A;  2BTT A;  3JCM d;  3EHQ A;  2KYM A;  1BIB A;  4BAC A;  1Q86 U;  5GAO p;  4LDU A;  2EW3 A;  4WCI A;  4ANJ A;  2CH4 A;  4KH1 B;  2EJG A;  1WIE A;  3CC2 A;  2Z0W A;  1K8A U;  1G2B A;  3PT9 A;  2RPN A;  1M8M A;  1WFW A;  2BE7 D;  3INZ A;  2K79 A;  1PC0 A;  3H9N A;  3CCV T;  5CO7 A;  1VQO A;  3HRU A;  2AIR B;  1HXD A;  4RUG A;  2E5Q A;  2OX7 A;  2LNH B;  3M4Y A;  1RAE B;  2MAM A;  3SHW A;  2EYQ A;  3LGF A;  1B34 A;  5GAM e;  4IUV A;  2XID A;  3PTA A;  3JCM b;  3M0S A;  1EZZ B;  2CP2 A;  1YP5 A;  4DBF A;  2BUD A;  1KQS A;  4JJD A;  1SHG A;  5GJV B;  1M90 C;  4OB2 B;  1ABQ A;  4M7A A;  2O88 A;  1E7O A;  1TH7 A;  2DXT A;  2RK2 A;  3E9G A;  4ELZ C;  1UGQ B;  1HYO A;  2VGM A;  2V1Q A;  1FX7 A;  3QWX X;  3OQ5 A;  5HK0 A;  2RQV A;  2DBK A;  1M2O A;  3CCV A;  1VQ8 T;  3CPW P;  1VQL Q;  4OB1 B;  3LWH A;  2BKD N;  2KRS A;  2GFA A;  3THK A;  2DPP B; 
#chains in the Genus database with same CATH homology
 2DXU A;  1KQ1 A;  2PVD B;  4XTV A;  2XIC A;  2P0Q A;  3UWN A;  5KCO A;  1WQ7 A;  3GNG A;  5LJ5 h;  3OYJ A;  5KE3 A;  3M4G A;  3RIR A;  3RER A;  2KY9 A;  3F70 A;  4M7A B;  3JB9 G;  4C0F A;  3RKW A;  4BD3 A;  2JTF A;  2E10 A;  4C8Q F;  3OMC A;  1VQP A;  3CBO A;  2M0O A;  4XTY A;  1QP2 A;  4Z02 A;  2RI2 A;  4LD9 K;  2XDD A;  2ZCF B;  1PSE A;  4MDW A;  4ZGJ B;  3L2R A;  2K2V A;  1KHC A;  4QQ6 A;  4M78 A;  3QKJ A;  3CCR T;  4E7K A;  2RHI A;  3OS1 A;  1UEB A;  2R5A A;  4M7A E;  3VYH B;  2AHJ B;  4C0D C;  1I5L A;  3M54 A;  3GIB A;  3CD6 T;  4PJO B;  5I2M A;  4Y91 A;  3QJ6 A;  4J83 A;  3VKI A;  5LJ3 j;  4JJN K;  1IZ6 A;  2DTI A;  4ZTJ A;  2XD0 A;  2DJZ A;  1VQ4 T;  2QI2 A;  4RCB A;  3MP6 A;  3HSB A;  2DZC A;  3DB3 A;  4IUU A;  3EFR A;  3OYB A;  4O5V A;  3CC4 A;  3HPW A;  2PU9 B;  2DD5 A;  3HFN A;  2BIV A;  4GLK A;  3OSS C;  4JRP A;  5HK3 A;  1H64 1;  2VUB A;  4II1 A;  2L8D A;  4XTW A;  1YJ9 T;  1LOJ A;  2OTL T;  3FB9 A;  2YLB A;  4M7A F;  2P0K A;  2KMT A;  1VQN T;  4LDY A;  2EKO A;  3A8L B;  5CK9 A;  2V8K A;  4NOY A;  1JJ2 S;  2PQW A;  2ZZD A;  2EAY A;  4RG8 A;  4ELY C;  2MI6 A;  5GAM d;  2DXB A;  3KUF A;  2ZPG B;  3M57 A;  4A53 A;  3V8L A;  5GAO n;  3PGG A;  2XU8 A;  3ZEH A;  2EQM A;  4FU6 A;  4E7L A;  3CCJ T;  1WNL A;  3G6E T;  1VQM T;  5GAM f;  1WJQ A;  2RA2 A;  4PJO F;  3LW5 E;  3OYK A;  4RKU E;  1PSF A;  4HCC A;  3GLX A;  4JLI A;  1BYM A;  5IN1 A;  2LTO A;  2O4X A;  3N5B B;  2GF7 A;  1BKB A;  4A4E A;  3JCM g;  2YLC A;  3OY9 A;  1M1K C;  2DKG A;  2RI3 A;  2FVU A;  2Y4Y A;  1KHI A;  4KUL A;  3LGL A;  3JCM P;  2RHY A;  4EMG A;  2EWN A;  3OBY A;  3OB9 A;  4M7A D;  2K3Y A;  3MET A;  1KD1 C;  1M1G A;  2JTM A;  4MZP A;  4C0D B;  4NL3 A;  1Y96 A;  1G3S A;  5FLX E;  2MF2 A;  3I55 T;  2DAQ A;  4J7I A;  2R5M A;  4KT0 E;  3JCM Q;  1S72 A;  1VQ6 T;  1X6O A;  4M75 A;  4M78 G;  3X20 B;  2GQV A;  1K9M C;  1GXI E;  1YHQ A;  1M1F A;  3CCM T;  4OB0 B;  4PJO D;  2F5T X;  3A8M B;  2V8I A;  3L2Z A;  5LJ5 d;  3SWN A;  1VQL A;  3QO3 A;  3HP9 A;  4JRI A;  3ME9 A;  4M77 A;  2QEX T;  2OTJ A;  3A8O B;  2VXE A;  3LWI A;  4LD6 A;  2M9U A;  2OTL A;  5A0G A;  3CCL A;  3DLM A;  3CME T;  2F69 A;  1ZBX A;  1UB4 A;  2KQW A;  3CBP A;  1NPP A;  3CPW A;  4WF2 A;  3JB9 H;  2E6N A;  5GAN 8;  2VV5 A;  3DB4 A;  4NL2 A;  1YJN A;  4OGE A;  4BI4 A;  5FU6 B;  4HA8 A;  3MEU A;  2E12 A;  2KDS A;  2V8J A;  4EPC A;  1H3Z A;  5KCH A;  3G6E A;  1Y96 B;  5LL6 S;  5A2Q E;  1LJO A;  3L42 A;  3CPF A;  1X01 A;  3CCE A;  4BY6 B;  1DJ7 B;  3CCQ T;  1VQ5 T;  3QHS A;  1NJI U;  5A0D A;  4M75 B;  2RB6 A;  4M78 D;  4C92 G;  2EFI A;  2LT4 A;  2D0Q B;  1N27 A;  4J5Y A;  3G4S A;  4E7H A;  2DO3 A;  1U8R A;  2WSE E;  5EG2 A;  4CRI A;  3CCS A;  4PNO A;  1VQ9 T;  1VQK T;  4PJO C;  3SWN B;  4FT2 A;  4ATO A;  4M77 B;  3J81 E;  2X4Y A;  2K5I A;  5GAN g;  1YIJ T;  1WJS A;  4C5G A;  1WJR A;  2PVG B;  2D6F A;  4A4F A;  3I56 T;  3MCA B;  4FT4 A;  2EQJ A;  4ZN3 A;  2LVM A;  3J80 E;  2LX9 A;  3J7A F;  2WSC E;  3MEW A;  4D6W A;  3URG A;  2DEQ A;  3NFC A;  2QDY B;  2VYT A;  4IUT A;  3S6W A;  4M7A G;  2ZPI B;  3JSC A;  1W4S A;  5J26 A;  4N4I A;  3CME A;  4M7D G;  1XNI A;  2A7Y A;  4PLI A;  3X26 B;  5GMK j;  3FC3 A;  4M77 G;  1YIT T;  4M78 C;  5LJ3 e;  2E41 A;  4N4H A;  5GAO l;  1XOV A;  1NPR A;  4HKE A;  2QQB A;  1N9R A;  1O75 A;  3SFM A;  5M9O A;  1FWZ A;  3CXC A;  1WQW A;  5CR2 A;  3CC7 A;  1MHN A;  3QII A;  4KBM B;  1RL2 A;  1BI2 A;  2LCC A;  1KQS S;  3JB9 F;  2X4W A;  3VV0 A;  3TU4 K;  2RHU A;  4DOV A;  3JRZ A;  3OW2 S;  3HHT B;  1D3B A;  5GAN 5;  3RES A;  1QVF A;  4LDV A;  4FL6 A;  2IVW A;  4EMH A;  3OYE A;  1KC8 U;  4KUD K;  4C8Q G;  2XDP A;  3E19 A;  4M75 D;  1BIA A;  2GCX A;  2NLU A;  3QYH B;  3RKY A;  3CCU A;  2DK3 A;  2QXF A;  4F7U G;  5D6W A;  5IT9 E;  5LJ5 j;  4E7J A;  3M56 A;  3E9F A;  2X4X A;  2Y90 A;  4FM4 B;  3C94 A;  1XTD A;  1NJI C;  3JCM V;  2CGH A;  4BUG A;  4J8O A;  3RMQ A;  3HL8 A;  2JUF A;  4BDY A;  4PJO E;  3M58 A;  4M77 D;  1VQ7 A;  5GAO m;  3L2V A;  3TCJ A;  1Q82 U;  2E64 A;  3RMS A;  1VQ8 A;  3CC2 T;  2EQK A;  3JB9 D;  1Q81 U;  5FRO A;  4C0Z A;  3JCM c;  3OYL A;  5GAM g;  3DKM A;  4IUR A;  3CMA T;  1OZ3 A;  2CZ6 B;  3G71 T;  2P0P A;  2RJF A;  4J7F A;  4HCB A;  2YHT A;  3P8B B;  2WSF E;  5L8R E;  5C6S A;  3OYN A;  4M78 B;  5FU6 C;  2HNI A;  3CBM A;  4MZT A;  1VQO T;  4C92 A;  3OYI A;  3A8G B;  3H8Z A;  2QA4 T;  1D3B B;  2FB7 A;  2FL7 A;  2LCL A;  4HT8 A;  4YTL A;  1YCY A;  2VGN A;  3BW1 A;  3CXC S;  1QVG A;  4QQG A;  4BY6 C;  3VJP A;  4IUQ A;  5CQX A;  2KAF A;  1BI3 A;  2RO0 A;  2ZPB B;  3EAE A;  3M55 A;  4M75 C;  4XU3 A;  4JUV A;  4EDU A;  3L2U A;  3MP8 A;  5GAO q;  1I4K 1;  4M78 E;  1G3T A;  3LH0 A;  5FU7 C;  3CCR A;  2DZ9 A;  1YJW T;  3RUX A;  3SWN C;  3JB9 J;  4L6V 5;  3FEO A;  5GAN j;  2QQA A;  1M90 U;  3OYC A;  1QVF S;  4QVZ A;  4M77 C;  3CEY A;  3M5A A;  1UGS B;  4XTZ A;  3CD6 A;  1FXX A;  4PL6 A;  4JRQ A;  3MEA A;  1VQ4 A;  1X75 C;  1SSF A;  1R8O B;  4N0A A;  3A8H B;  3LYI A;  1AHJ B;  3MEV A;  2DTH A;  2ZPH B;  3BDL A;  1N8R U;  5LJ5 g;  5A0L A;  4M7D A;  4M78 F;  4Q5W A;  4N4G A;  3ZBD A;  1YJ9 A;  4NS5 A;  3KBG A;  4C92 B;  4EMK A;  2XG8 D;  3V7R A;  1U1S A;  4XQ3 A;  4JDS A;  3NTH A;  1KC8 C;  4OMF B;  1YI2 T;  2L5Q A;  1VQN A;  2QTX A;  4J6W A;  2WAC A;  3JCM f;  1Y71 A;  2O4X B;  1QP3 A;  2RHZ A;  4BE1 A;  4E7I A;  1W2B A;  1K73 U;  1G3W A;  5FRN A;  5GAN 3;  2ZPF B;  1OZ2 A;  4L5G A;  3Q1J A;  3FIF A;  5LJ3 d;  4PKC C;  5GAO r;  5CQY A;  2ZGW A;  5D6Y A;  2K4Y A;  4V2S A;  3OS0 A;  3GPL A;  3JCM W;  1M9S A;  3CCJ A;  1VQM A;  1M5Q 1;  4BB7 A;  4BI3 A;  3JB9 I;  1Q82 C;  2XKO C;  1IRE B;  3QDR B;  3QXE B;  2EJF A;  3QBY A;  2LT1 A;  5LJ3 f;  4MZM A;  4ZN1 A;  3OYH A;  5I2S A;  2R57 A;  2E65 A;  3OYY A;  4C8Q A;  4XU2 A;  4C5H A;  3GOX A;  3E1S A;  3T9N A;  3M9Q A;  4F7U A;  5FU7 B;  2R58 A;  4LDW A;  4OB3 B;  5CCA A;  3VYG A;  3FJP A;  4A4G A;  2EIF A;  4M7D B;  2RJD A;  2JOY A;  4EMK B;  2JN0 A;  2E6Z A;  3WVE B;  1G3Y A;  4M75 E;  3I55 A;  4C5I A;  1VQ6 A;  4XU1 A;  5GMK e;  1VQP T;  1M8V A;  3OSV A;  4E47 A;  3OA6 A;  1KG1 A;  3MO8 A;  4A4H A;  2FYK A;  3QYG B;  2RJE A;  3QZ9 B;  1WPY A;  1RI0 A;  3GNF B;  2K5F A;  3CCM A;  2QQ9 A;  3FDR A;  3WXM B;  3ZFJ A;  3M53 A;  4M77 E;  2P4T A;  5AYF A;  3BFM A;  3JCM e;  4BDZ A;  2QQR A;  4QQD A;  5GMK l;  5GAM j;  5I21 A;  2QEX A;  4JLG A;  4RMO A;  5CKH A;  4OF1 A;  3KXT A;  2L89 A;  4C5E A;  1P92 A;  5DLO A;  3QJY A;  1W2B S;  4OVA A;  3CPW S;  2MMP A;  4M75 F;  4C8Q B;  3CC4 T;  2VXF A;  2XK0 A;  3LLR A;  2HQX A;  3P8H A;  2IG0 A;  3JCM J;  4C92 D;  4XAX B;  3JCM h;  4F7U B;  4VUB A;  3G7Z A;  5IAY A;  2LRQ A;  1U1T A;  1Q7Y U;  2CZ1 B;  3QPH A;  1KQ2 A;  3OMG A;  5GAN f;  4M77 F;  5GAN 4;  1QVG S;  1I8F A;  4ZGD B;  2LQ8 A;  3FRN A;  5LJ5 e;  3L2W A;  2G3R A;  3HRT A;  4QW2 A;  2K3X A;  2DVE A;  3CCQ A;  2E1H A;  4XTX A;  3V8K A;  3S3O A;  3OYG A;  4MDX A;  1VQ5 A;  5LJ3 h;  2CS7 A;  1UGP B;  2CKK A;  4F7U E;  1HK9 A;  1JJ2 A;  1LNX A;  3BDU A;  3PIP A;  2E70 A;  4RG2 A;  3L2Q A;  1N6A A;  3X25 B;  2HD0 A;  4L59 A;  3V8J A;  1VQ9 A;  1VQK A;  5GMK m;  2RHX A;  3VUZ A;  1KD1 U;  2KK4 A;  3OS5 A;  2PUK B;  2M16 A;  2LC4 A;  4IKF A;  2K5L A;  3TEE A;  1O9S A;  3OYA A;  1YIJ A;  4BE0 A;  2RM4 A;  2PUO B;  2HQE A;  1OI1 A;  1BI1 A;  3L1A A;  3S3N A;  3ASK A;  5C0M A;  4J6X A;  4QVC A;  5HKC A;  1K9M U;  4M7D D;  1YBY A;  3I56 A;  2LNV A;  2CZ7 B;  3HKS A;  4F7U F;  4C92 C;  2B8A A;  4OGC A;  2HBP A;  5HY6 A;  4ME7 A;  2X4J A;  3C4S A;  3ER0 A;  4MMK A;  1N9S A;  4Y28 E;  3R6O A;  4BE2 A;  1S72 T;  3WVD B;  1WGS A;  1M4Z A;  4O6J A;  3NTI A;  3PFS A;  3BY7 A;  3EFS A;  4HT9 A;  4FSX A;  4PLL A;  1ZHI A;  5GAN e;  2JZ2 A;  5CAI A;  4TVR A;  1YHQ T;  2L3R A;  2HAX A;  3SDZ A;  1QVP A;  2ZPE B;  1Y7X A;  3X28 B;  5CIU A;  3QUI A;  2JNG A;  4A54 A;  1YIT A;  3QSU A;  1VQL T;  1VIF A;  2XHC A;  3PNW C;  2OTJ T;  4X34 A;  5FRM A;  1UGR B;  3V7S A;  4C8Q D;  4LDX A;  5DLQ E;  3OYF A;  3OBW A;  2X35 A;  3CCL T;  4KUI A;  3PMT A;  3S3M A;  2YRV A;  5GAN h;  4N0A C;  5GAN 2;  2RD1 A;  5CKB A;  4JS5 A;  4X9D A;  3SD4 A;  1YJN T;  2M1H A;  4PJO G;  5CKD A;  2DXC A;  4M7D C;  2F5K A;  2DIQ A;  3HFO A;  4CI0 C;  4EMK C;  1Q7Y C;  2DTO A;  1QW1 A;  3UDC A;  1MGQ A;  1I81 A;  3H6Z A;  1BI0 A;  1EIF A;  5D6X A;  3CCE T;  2XDB A;  4R56 A;  2RH2 A;  3VU3 C;  2DIG A;  2MWP A;  3UT1 A;  3TRE A;  3M59 A;  4XK8 E;  3G4S T;  4P5N A;  3JCM d;  2O01 E;  3QZ5 B;  3CCS T;  3X24 B;  1BIB A;  3FLG A;  1XQH A;  2EQU A;  4GY5 A;  5CVI A;  4LDU A;  5J39 A;  2PVO B;  5GAO p;  4BAC A;  2QQS A;  2EJG A;  3CC2 A;  5CKE A;  2H3J A;  4ZGE B;  1K8A U;  1JRI A;  3PT9 A;  3AHU A;  4C8Q C;  3VUB A;  2LQK A;  2LDM A;  1JBM A;  3INZ A;  3QG1 A;  4HCZ A;  5LJ3 g;  3CMA A;  2JVV A;  3G71 A;  2KVQ G;  3OYM A;  2A3L A;  4C92 E;  2VC8 A;  2Y4X A;  3PIO A;  5CO7 A;  3CCV T;  3LX7 A;  5GAN 7;  1VQO A;  1JB0 E;  4RCC A;  3RKX A;  3HRU A;  2QA4 A;  5KE2 A;  1HXD A;  1Q81 C;  1VUB A;  1Y07 A;  3HRS A;  2E5Q A;  4QVD A;  3M4Y A;  3C12 A;  2XI9 A;  2MAM A;  3P8D A;  4DOW A;  2OAU A;  5DY9 A;  5LJ5 f;  5GAN 6;  4UC4 A;  3C95 A;  2DD4 A;  4DQ2 A;  2EYQ A;  3LGF A;  1B34 A;  2CZ0 B;  5GAM e;  4A4K A;  1V29 B;  4IUV A;  4DA4 A;  5J3B A;  1Q86 U;  4J6Y A;  4C92 F;  4R55 A;  1YJW A;  2XID A;  2EJ9 A;  3NTK A;  3PTA A;  3JCM b;  2K57 A;  4ZTF A;  4M7A C;  4C0G A;  4IUP A;  4MML A;  3GF5 A;  3CC7 T;  1VIE A;  4BI8 B;  3A5Z B;  3OS2 A;  2FHD A;  5DM7 R;  5GAM h;  3V7C A;  4B9W A;  4M7D E;  2BUD A;  3O8V A;  1NZ9 A;  1OYX A;  1KQS A;  1M90 C;  4JS4 A;  4XTU A;  3MP1 A;  4OB2 B;  5GMK i;  5CKF A;  5GMK h;  4FIB A;  3OW2 A;  4M7A A;  2MWO A;  1TH7 A;  2KSS A;  4X9C A;  1YI2 A;  2GFU A;  2DXT A;  3CCU T;  2RK2 A;  3E9G A;  5KH6 A;  1ZQ1 A;  4XU0 A;  4B9X A;  4ELZ C;  5GAN d;  3GP8 A;  1UGQ B;  2CYZ B;  2D9T A;  2C06 A;  2VGM A;  4OP0 A;  1N8R C;  2RI5 A;  1FX7 A;  3PMI A;  3OQ5 A;  3JCM X;  4M7D F;  1B34 B;  2RK1 A;  5HK0 A;  1VQ7 T;  3DLL A;  4PJO A;  1Q86 C;  1G5V A;  2I2L A;  3CCV A;  1VQ8 T;  2RJC A;  4C8Q E;  4M75 G;  4OB1 B;  3LWH A;  3JAM E;  2BKD N;  3OYD A;  4JRK A;  1K8A C;  1NE8 A;  3SB2 A;  1K73 C;  2GFA A;  1M1K U;  2DPP B;  3UPU A;  3MHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...