5HK8A

Crystal strucutre of a methylesterase protein mes16 from arabidopsis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
251
structure length
236
Chain Sequence
b'VIHFVFVHGASHGAWCWYKLTTLLDAAGFKSTSVDLTGAGISLIDSNIVFDSDQYNRPLFSLLSDLPPHHKVILVGHSIGGGSVTEALCKFTDKISMAIYLAASMVQPGSIWEYTYGEGTDKPPTGVLMKPEFIRHYYYSQSPLEDVTLSSKLLRPAPMRAFQDLDKLPPNPEAEKVPRVYIKTAKDNLFDSVRQDLLVENWPPSQLYVLEDSDHSAFFSVPTTLFAYLLRAVSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable pheophorbidase
molecule tags Hydrolase
source organism Arabidopsis thaliana
publication title Crystal strucutre of a methylesterase protein MES16 from Arabidopsis
rcsb
total genus 79
structure length 236
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.82: Pheophorbidase.
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hk8A00
5CBKA 2Z8ZA 4ZRDA 3HC7A 3W05A 1SFRA 4ARBA 5FDFA 1R1DA 3MUNA 4H77A 2WUEA 3FBWA 2DSNA 3BL8A 4BP8A 1CRLA 5CRIA 3K9BA 3WYDA 2XQFA 1CUXA 2OGTA 4U2FA 1DT3A 4ZGBA 3I1YA 4OB6A 5JASA 1CPYA 2XUAA 5K3FB 2ECFA 2BFNA 1MU0A 3O4HA 2C5FA 1VE7A 1XQXA 5SYMA 3LLCA 3A2MA 3IULA 3BJRA 4C01A 1XLUA 4OUKX 2WIJA 4K2AA 2GYUA 3I6YA 1O6GA 3BF7A 4B84A 4MQLA 2RI6A 4HZGA 1WHSA 3H2JA 3QPCA 2OCIA 1VE6A 4J0JA 4ZV9A 2H7YA 2PSFA 2VT6A 4M0MA 1PJAA 3G0CA 4BP9A 3WLAA 2HL6A 3V1NA 4X71A 1AQLA 1ISPA 1OILA 4H7JA 3WIBA 5AOBA 4GECA 4XX1A 3HLKA 4MXDA 1EHYA 3H04A 3I28A 1YA8A 1MNAA 1XQWA 1EA5A 2D5LA 1CUDA 4LIPD 3D5EA 4DTCA 1U8EA 1F0PA 1W1IA 4X00A 5IVIA 3DDUA 3ZLTA 5DYWA 4QDXA 2DQZA 1ZD3A 4G8BA 4KAJA 1BN6A 1VJ5A 5AHXA 3WL5A 1XRMA 4B85A 1JI3A 3N0TA 4P92A 4UPDA 3O9MA 1QFMA 1TIBA 3WA7A 4PO3X 3V1LA 3SWWA 2XB6A 4DNFA 3FYUA 2I78A 2ZYRA 3ZLVA 1L7RA 4BCCA 4C4ZA 1G5FA 1E66A 2BKLA 1TKRA 2B4KA 4X90A 2VA9A 4KYVA 1YR2A 4MEAA 2P8SA 3DD5A 3G9ZA 5AIBA 2VF2A 3LIPA 1F6WA 4HTAA 4FFWA 2HIHA 3DL7A 4C88A 1C7JA 3EBLA 1LPOA 1IZ7A 1QONA 3ESAA 5IVDA 2VSQA 1K4YA 2QM0A 1UZAA 4JYMA 4GEGA 5AM2A 5CT4A 4DMFA 1UT6A 1QIFA 1TCBA 2XQJA 4QLOA 3C45A 5BWCA 1CUBA 2OCLA 4OU4A 4QZVA 4MYSA 1WB5A 5JAUA 3EIOA 1O6FA 4NS4A 4UBIA 3X3HA 5DYTA 1VZ2A 5AI5A 5CW2A 1K8QA 4J7AA 4AN1A 2BUCA 1XLVA 5AI0A 3D0KA 3IVMA 4X93A 2XUJA 4EZIA 1NU8A 4LYDA 5K3EA 4F0JA 4BRSA 3QZUA 3IBTA 4X92A 1N1MA 1ACLA 4DSZA 5ALHA 4EUSA 3G9TA 5ALPA 1CUHA 1DX4A 1JU4A 1EDBA 1DQYA 3H2IA 1MJ5A 2HA0A 4DMKA 4Q34A 1WM1A 3R40A 4BVLA 4BAGA 1XZKA 3OG9A 4K6GA 4W63A 5D3KA 3R3XA 4G9EA 3AIKA 2WM2A 4J03A 3IUNA 1X2BA 4HVTA 1XZDA 1VXRA 3I2IA 3K2IA 2ZYHA 2E3JA 2X76A 2QZPA 3ICVA 1ZJ4A 3TEJA 1YAJA 3WZLA 1AGYA 4EY5A 2G5PA 4Q3LA 3JYHA 3L1JA 4DMHA 2JGKA 4W1QA 4YPVA 3STTA 1HQDA 3VJKA 5EI5A 1CUGA 2CEKA 5ALXA 3QITA 4WFJA 2CKMA 2QJWA 3QMMA 4TVKA 4K6HA 3D4LA 5LIPA 2OAEA 2YXPX 1XZIA 4WJLA 1IZ8A 3P2MA 3S8YA 3AZPA 1BS9A 1XLWA 2XMBA 1QIJA 5IH7A 3G0IA 4KRXA 2QXUA 3B5EA 2CMFA 5F4ZA 4RGYA 4PV7A 2ZSHA 3O4IA 4B0PA 5ALJA 3UUFA 4MYDA 1SOMA 3QH4A 1LPNA 3F97A 3TGLA 5DNVA 1GXSA 3JW8A 1XZJA 2ONCA 3OURA 5C8XA 5AJHA 5AKJA 3L1IA 4FHZA 2JGLA 2WJ4A 2Z3WA 2VATA 1H23A 5ALOA 4UHHA 3VJLA 2C7BA 2DR0A 3HYSA 3STVA 5A71A 1VKHA 1B6GA 2Y2VA 3QVMA 4BATA 4BE4A 3G0DA 5CH8A 4PF1A 1DWPA 4AXBA 2FX5A 4XJVA 5K3BA 5JD6A 2QR5A 3WYNA 3FSGA 5T4EA 3H2HA 1XZCA 3QMWA 1W4LA 2HA4A 2HM7A 2IX9A 2XUGA 1XRQA 1NX9A 3DEAA 4G4GA 3KWFA 5I8PA 4FMPA 4J0DA 5JATA 2H7CA 3BE8A 3WK9A 2G4LA 2WILA 5JYCA 4KAFA 3H0CA 4X7BA 1G4HA 2BGNA 3GZJA 5DTJA 4BVKA 1EI9A 4QE3A 1JMKC 4FFVA 2WHPB 1ZJ5A 1CEXA 4PSDA 4B81A 4H18A 1MX9A 2WHPA 1UOQA 3QPAA 1CUVA 4X95A 4J0CA 1BN7A 1N5RA 1BE0A 3AINA 4H7HA 3IUMA 2GBCA 3I1IA 1ZGCA 3C5WP 1E5TA 2JIDA 1CV2A 4X85A 1CQWA 2ZJ6A 5AICA 3HRHA 1GPKA 4UHEA 4DSAA 2B20A 4KEAA 1CR6A 5EHZA 5AI9A 4G1FA 5AKXA 2ZYIA 5EIHA 3ICWA 2XMDA 4HAIA 2VJBA 3ESCA 2Z8XA 2PSHA 2RAUA 5A7FA 1NU6A 2BUAA 3KDAA 3ILSA 1XKTA 1IMJA 1JMYA 5AKIA 1XZFA 1K6EA 3H2KA 1Q84A 5HFAA 5ALRA 4WDRA 5CT9A 5A2GA 1DWOA 1MNQA 1ZD2P 3C6XA 3QMVA 2QRUA 3ESBA 3VXKA 1XZAA 3WL7A 1GT6A 1GQRA 1N8SA 1Q0ZA 3PF8A 4LXGA 3FYUB 4M0EA 4DM7A 3C6BA 4N5HX 5HF9A 3YASA 5IVHA 4BB0A 5JAPA 3BJMA 1EK2A 5HQ3B 3D3NA 3PUIA 3H19A 4ITVA 3LIIA 3F67A 2JF0A 2W22A 3RLIA 1MAHA 3G02A 5LYYA 4B6GA 2Z5GA 4DNQA 3WKEA 1WB6A 3AILA 1AKNA 4N8EA 2WTMA 1OCEA 3WKDA 4BYMA 3ANSA 1KU6A 2CJPA 4IH4A 4B9EA 3MGAA 4J3JA 5H3HA 3GUUA 1UKCA 1K63A 1XROA 3DCNA 1F8UA 3DOIA 2HU5A 1U65A 4B0OA 2BJHA 3A70A 2V96A 4UBOA 1SC9A 1LBSA 2V98A 4QDTA 5AM5A 2K2QB 2JGIA 1AMNA 4G4JA 1U4NA 4OYLA 1XZHA 3ZV7A 2PU5A 1ZGBA 3T4UA 4ZWNA 2QJRA 1UK7A 4CCYA 3DLTA 3EQ9A 1QLWA 1F0NA 4DMCA 2G5TA 4KAAA 1L7AA 4OPMA 5JD5A 4CCWA 5ISMA 1R3DA 2PKYX 5CH3A 5DYYA 2WIKA 1EB8A 4TGLA 4UFPA 3DOHA 3LCRA 2HRRA 4LYEA 5DNUA 3O4JA 1JJBA 4RNCA 2QUAA 1HDEA 2WHRA 1DU4A 2ZJFA 4IHAA 2XUPA 3L1HA 4RE5A 3BF8A 4FLEA 5AKHA 1EDDA 3TRDA 1VA4A 6YASA 3STYA 2GBIA 2J4FA 3FCYA 1LPMA 2ORYA 3BIXA 1UK9A 3VKFA 5EHNA 4AB1A 2QVBA 5AKYA 2XMQA 1XZGA 4QDOA 3FAKA 5JZBA 4UFNA 1E3QA 3WJ2A 1UK8A 4AZ3A 1LZKA 4GLBA 3I2HA 5T4FA 4ZREA 1WCYA 4UBJA 4C87A 1FFDA 4Y2YA 4AO6A 3C5VA 3WK8A 1XRRA 3R41A 2ACKA 4PSUA 3R3ZA 4N5IX 3G9XA 4A5SA 4BAUA 1WB4A 2DQYA 1KEZA 2IIVA 4S0XA 4Q82A 3R0VA 1LGYA 3DKRA 3WKBA 3V1KA 3LS2A 4J0GA 3W9UA 3SC2A 5CTAA 5LZ7A 4BTVA 4FBMA 4AZ0A 4HRXA 3PICA 4HS9A 2VAVA 3G0BA 1AUOA 3PFCA 4CIAA 4QLAA 1XRLA 2AJDA 2XE4A 5JANA 5EFZA 2VEOA 4G8CA 4X6UA 4BBZA 1HL7A 3WWCA 5ALGA 1E8DA 4OCZA 3R3UA 2AJBA 5LKRA 3D59A 4GXNA 5HF8A 5AK6A 2WFLA 4FNMA 4MWTA 4KACA 3H17A 2PSEA 5LZ8A 4DIUA 2D0DA 4L3WA 4LHEA 4DLNA 3WIOA 5J3JA 1Y37A 5ALKA 5AI8A 4F5ZA 2CUTA 3HXKA 3UUEA 4GI1A 3I2JA 3C6YA 2PUJA 3ZPXA 1S8OA 1QIMA 1P0PA 5ALWA 3CXUA 4D9JA 4BZWA 1W75A 2AXEA 4JH0A 5DLPA 4C89A 3AFIA 5C8ZA 2CBGA 1ORVA 1WPRA 4DNPA 2QT9A 1EVEA 3V48A 5ALIA 2I3ZA 3NGMA 1GPNA 1YS1X 4N8DA 5JZSA 1QZ3A 4UUQA 1ZIYA 4U2EA 4OYYA 2ZSIA 3MUOA 4Y2TA 1AC5A 4U2DA 3QBJA 2OPHA 4BCDA 2FJ0A 2VJCA 2RGUA 3FYTA 2WIFA 4G5XA 1JJIA 1YA4A 3WJ1A 5LZ4A 1YCDA 4Y2JA 4UFOA 2Z3ZA 1C7IA 5AO9A 2DCMA 2WIGA 3IDAA 5YASA 2JBWA 2XMZA 4L9AA 4W1PA 1XZBA 2ROQA 4Y2VA 5JALA 2XT0A 1ETHA 2WKWA 2X5XA 5I7UA 3A2LA 2HRQA 2QKYA 2QTBA 1UKAA 5DWDA 2OQIA 5CH5A 1TQHA 4WY8A 4H35A 5FV4A 5CT8A 2JGFA 1JFRA 2BGRA 5FPPA 1R9MA 4BVJA 1QGED 4BAZA 1EXWA 3PF9A 5A6VA 2WU3A 3R3VA 3CN7A 2VTVA 3DYIA 2ACEA 1ORWA 2HA5A 3HJUA 1K5PA 2G63A 4Y2SA 2PL5A 4EY8A 3STXA 1FFBA 3EQ8A 3VISA 5DTIA 5ESRA 2J4CA 2XQIA 4LKOA 1ZI9A 4X6YA 5HKAA 5K5EA 5K3CA 5HF5A 2QMQA 2XUDA 5CXUA 3C87A 3I2KA 2CB9A 3KD2A 5A62A 4UBNA 4XVCA 1MPXA 2EDAA 3F96A 3PI6A 4CG3A 1QIKA 1TAHA 2WFZA 1ZD4A 3G8YA 2RONA 5HF6A 4LXIA 4J0IA 4G8DA 4E15A 4KR0A 4ZI5A 3VDXA 1MO2A 5LZ9A 4PW0A 2WHQA 1CUSA 3O4GA 2XQKA 1P0MA 4EY4A 2HHAA 4FKBA 3M82A 2HA2A 2NW6A 1LLFA 2HFJA 4CCYB 2LIPA 2XQGA 2H1IA 1A7UA 3CCBA 3FSGD 3WK4A 4KE9A 5AOAA 4QWWA 1HKHA 4H7FA 4W9RA 1R9NA 5HCUA 1LPPA 4RPCA 4X97A 1CLEA 4FLFA 1BU8A 1J2EA 1THTA 2WG2A 2OAGA 1A8SA 4HXFB 4XWGA 3WWOA 3U0VA 3AIOA 1UK6A 3NUZA 5ALDA 1EINA 5CURA 4I4CA 1GPLA 2PM8A 1LPSA 1G42A 3ZWQA 1ZD5A 5ALTA 3KOOA 4KJXA 3V9AA 1JKMA 5SYNA 2C0QA 1EDEA 2QUBA 4KE7A 4FOLA 3KWJA 5HQ3A 2FUKA 5ALYA 1QFSA 2CZQA 3FLBA 3OM8A 4P93A 3E1GA 5D3ZA 1E8NA 2BCEA 2AJ8A 3FNBA 5C81A 2Q0XA 3WL8A 2W6CX 3IA2A 4RE6A 2WJ3A 2OXEA 1MX1A 3I2FA 2GBGA 1QIIA 3KSRA 1ZOIA 5AKGA 3G0GA 2WUDA 1H2XA 4UBLA 5AKKA 4MQMA 3E4DA 1UOOA 4EHBA 1ODCA 4U2GA 3IUJA 5FP0A 3ZI7A 3PE6A 4CIBA 2VJDA 1B41A 3DKKA 1CUYA 2PSDA 4OD0A 1AURA 3Q8WA 4JEIA 3TJMA 2PBLA 3FLEA 5FUMA 3NWOA 4WY5A 4DNOA 2XUQA 1QIGA 5JAHA 2J3DA 3DJYA 4X94A 2DHEA 1FFAA 5HK9A 4UHFA 3JWEA 3OC0A 4LXHA 1D07A 1ODSA 5ALUA 2O2IA 1DINA 3C70A 1QO9A 5E4JA 3HEAA 1Y7HA 1A88A 3AZOA 1ZICA 5DNWA 3WWEA 1DQZA 2WUGA 5CT6A 3S2ZA 4CG1A 1SCIA 2Y6UA 2XMCA 1M33A 1T4MA 1CUFA 4IO0A 4MEBA 3AZQA 3RARA 1VA5A 1E8MA 1EH5A 2O7VA 4W1SA 5HZGA 1N5MA 3DNMA 1HPLA 4PNZA 3D2CA 4AO7A 1Q83A 2PVSA 1XQVA 4BC1A 2WQZA 3WWPA 4CG2A 4JUIA 3Q0TA 1FFEA 3IUQA 5AK5A 5FOQA 1CUZA 5KWIA 2WIDA 2OQVA 3VVMA 3O0DA 2J3QA 1QIEA 4P08A 1LNSA 4X91A 2VJAA 1KU0A 2JEYA 1U2EA 4ETWA 3H18A 4GBGA 5HK8A 4Q1VA 2R8BA 1OXMA 2YASA 1Y7IA 1XZEA 3GELA 3HSSA 1EVQA 2ES4A 5IKXA 2DFPA 3AUKA 3G9UA 3BIWA 2ZVDA 3I2GA 2OG1A 1J07A 7YASA 4NZZA 3O9VA 5AK4A 3BWXA 5AI4A 3SK0A 4H7KA 5I9IA 1QE3A 1T2NA 1GGVA 1GKLA 5AI6A 1AX9A 4IH9A 3SX4A 3FYUC 1JU3A 1P0IA 1YB7A 1GQSA 3HABA 3BXPA 4Y2QA 4BZZA 3PFBA 4WCVA 3C6ZA 1J06A 5CXXA 2BUBA 3UMJA 4I19A 1TCAA 3RM3A 1XRPA 5T4BA 3W04A 4C4YA 5ALLA 4X3CA 4BC0A 4INZA 4V2IA 3V1MA 2Y1KA 5K3DA 4AO8A 3DL4A 3EQ7A 4ARAA 1CUEA 1IUOA 4AQDA 5C8VA 2WLSA 3H2GA 2C58A 5FPQA 3WZMA 2GYWA 4F60A 3RK4A 2Y2UA 1YSCA 1USWA 3D2AA 5KREA 1I6WA 2VQ6A 2EDCA 1CUIA 1WPXA 4AMYA 1QOZA 3AIMA 5K3FA 4K6KA 1W52X 4EA6A 4EY6A 1VXOA 5EHQA 1VOTA 1CIJA 3M83A 2XMSA 2YH2A 3C8DA 3IB3A 1UOPA 4ZV7A 1E89A 5LLSA 5HFNA 4I3FA 4YASA 3QPDA 3G7NA 2WG0A 1FSSA 3GA7A 1MAAA 2O2HA 4Y2XA 3W06A 1JJFA 4MWSA 3EF3A 4KE8A 3C8HA 4W1RA 4BTLA 2I03A 2JGMA 3FVRA 4J0HA 2PUHA 4B7ZA 4BDSA 1ACJA 4FBLA 3ANTA 3IURA 1TK3A 5E2IA 4N8SA 3H1AA 1GZ7A 2C0PA 4GWLA 3GROA 4L0CA 4OSEA 2OCKA 3CCCA 1LBTA 5ALNA 1Z68A 4H7IA 1JT2A 1RP1A 1J1IA 5FXMA 4K5QA 3N2ZB 4BE9A 4E11A 1IUPA 5ALSA 1XQYA 3IIIA 4KE6A 5JARA 2WU4A 5ALEA 2Y6VA 4YX9A 1VZ3A 2HA3A 1EX9A 2PPLA 3WKCA 2GZRA 3WA6A 1H22A 1MTZA 5LZ2A 5BOVA 1QIHA 1BROA 2YYSA 4L72A 3WKAA 3STUA 2AJLI 4B80A 1G66A 2DHDA 2XUOA 1H2ZA 3FCXA 5E4YA 4Y2UA 5KWJA 2HA7A 1UFOA 2XDWA 5AM4A 2V97A 3RKSA 2H7XA 5DJ5A 2B61A 3WK6A 5IVKA 3LP5A 2XI4A 2GBFA 3VVLA 5ALFA 4FLMA 3WWDA 2HA6A 3ESDA 4PSCA 1QO7A 1W76A 4C4XA 1XFDA 4EBBA 5ALQA 1TRHA 5KBYA 4UBMA 1UWCA 4ZXFA 4O08A 3STWA 2OGZA 5AOCA 3VJMA 5K3AA 4H7EA 2PU7A 1XZLA 5EIAA 4Z49A 1QIDA 5EGNA 4EB0A 4QDZA 3MVEA 4UHCA 4FWBA 4QNNA 2XMRA 4P9NA 4Y7DA 5C7YA 2QXTA 2EEPA 4YK7A 3H1BA 3K6KA 3FLAA 3U1TA 4F21A 2V9ZA 3T52A 4IH1A 4UBKA 3HACA 2WUFA 2X8BA 3A6ZA 1L7QA 1BEZA 1XKLA 5AM0A 2HADA 3DYVA 5D6OA 1PV1A 3OOSA 3BDIA 5JIBA 2RHTA 1LPBB 2VT7A 3D2BA 4J0KA 4C6HA 2RHWA 1UKBA 5AKEA 1X70A 2BAGA 4WDQA 3FVTA 3B3QA 4X6XA 1C4XA 4AX4A 1R50A 2XLCA 4QA9A 5ALMA 3WMRA 5JAOA 4GHWA 5CMLA 1UXOA 1WOMA 1YS2X 2OGSA 1H2WA 2JGJA 3I6MA 4U2CA 3ZLUA 1A8UA 3AJAA 3F9CA 3ED1A 1XRNA 4IQ4A 3WK7A 4JNCA 1BEEA 4Y2RA 1IUNA 4CFSA 5A7GA 4QDUA 1AZWA 1X2EA 4HXGA 3R3WA 3I6ZA 4NMWA 2GZSA 2XUHA 4AN0A 3WK5A 5BWBA 1YAHA 4BRZA 4ROTA 3B12A 1H2YA 1DWQA 5FKJA 2JEZA 1CUJA 4XIIA 3PUHA 5ALVA 4FTWA 2PSJA 2JGEA 1CFJA 2HU8A 1HBJA 4MJ3A 4NVRA 4Y2PA 2OLEA 4JYPA 3M81A 2XUKA 4FDMA 1A8QA 1P0QA 2OCGA 5LP1A 3FWHA 2C5GA 3DQZA 1XZMA 1EK1A 1R4ZA 3E0XA 4B83A 3F98A 1QTRA 2O2GA 2XUIA 2PX6A 5EHXA 3C43A 5CT5A 5AP9A 1LPAB 5E4TA 4G4IA 3QM1A 4DYHA 1LZLA 2R11A 4DGQA 2RIPA 5AK3A 4Y9SA 3HZOA 5AM1A 4EY7A 3GFFA 2HU7A 4G9GA 3CN9A 1QJ4A 2WJ6A 5JADA 5AIAA 1MT3A 1ZI6A 2WSLA 1R88A 4OB7A 5LZ5A 2WFLB 2QOEA 2VAXA 3NOXA 4FNGA 5AKZA 3W2TA 5AH0A 1SCKA 2ZYSA 5FLKA 1RWQA 5BV7A 4OU5A 4A16A 1ZI8A 4OB8A 4HRYA 4H7DA 5EIEA 4Q05A 5JD4A 1TCCA 1WHTA 2XLBA 2WG1A 1CQZA 5ALZA 2O7RA 1CUUA 1MX5A 2HFKA 2C4HA 3R3YA 5LKAA 1RYYA 1GKKA 3A2NA 3HI4A 2ZJ7A 2HDWA 2DHCA 4GW3A 1FFCA 4CI9A 2I3DA 5HKBA 4BCBA 4A23A 4QWMA 1IVYA 1THGA 1HLGA 2AJCA 5JZ9A 1BCRA 3GBSA 1CUCA 3PDCA 3D7RA 1EB9A 3OTQA 3OPMA 2UZ0A 3FOBA 4B9AA 3QYJA 3KXPA 2B9VA 4PQEA 1SCQA 4TPKA 5AKLA 1W6RA 1MN6A 1ZIXA 4AMZA 4HXEB 2WTNA 1VLQA 4H0CA 4B82A 2IITA 3M3DA 4WFKA 1PFQA 4KRYA 4GDMA 4BDTA 1BRTA 3BDVA 4UHDA 1DTEA 2QS9A 2GYVA 4U2BA 4E46A 1CUWA 4WFIA 1CUAA 1DT5A 4E14A 1YB6A 3WI7A 1DX6A 5T4HA 2FJPA 2WFMA 5A7HA 3O95A 2XUFA 4Q3KA 1ODTC 4Q3OA 4QEKA 1FJ2A 1Q0RA 2H9YA 1QTIA 5FRDA 3E3AA 3WQHA 4UHBA 1CVLA 1BCSA 2XMGA 1YASA 3DS8A 4M0FA 3WL6A 5D7BA 3W9BA 3F8SA 5AM3A
chains in the Genus database with same CATH superfamily
1X38A 2Z8ZA 3O74A 2H9AA 1SFRA 3THRA 1K5GA 2IVFA 5EP2A 5FDFA 2J0UB 5KOJB 5L6LB 1R1DA 2OV1A 2R6ZA 4JQSA 3COPA 2MYUA 4F85A 3BWCA 3OT4A 3RV4A 5LYJA 3WRYC 5CEEA 3NJ8A 3NBFA 1A76A 3NDJA 1PG5A 4PXAA 3RSQA 1GQYA 1GKYA 4BV8A 1WTCA 2WAAA 4XOUA 3L5OA 4KG7A 4GM4A 4KQEA 1S7CA 3QVKA 4BQOA 1BO6A 3WYDA 3H9QA 2HLHA 1K3UB 3ZKAA 2GHIA 1KYTA 2O3TA 2Q49A 2DU8A 2XQFA 1EK0A 3GD7A 4M55A 3UEOA 1ZCJA 4KJZA 3BICA 4EOGA 2VP3A 1SEVA 3WYGA 2OGTA 5KVAA 5F1OA 2PRZA 1WS6A 4OB6A 4BASA 1U8CB 1ST3A 5FUWA 1D9ZA 3BFVA 1PR3A 3UJCA 1JKJB 1CPYA 1W0JD 4BWFB 1ZD8A 1HKUA 1MVOA 2C2YA 4BUJA 4EY3A 3LOQA 1MU0A 4BQIA 3HY6A 2QTHA 1IU9A 5IC5A 3IYLW 2EBHX 3A6HA 1G41A 1XQXA 2P68A 4EGSA 3A2MA 2QW0X 3GUYA 3P7MA 3A04A 1SWVA 2IYLD 3GLGA 1T5LA 1J8MF 2ZXFA 4BFWA 3IULA 2FEOA 3DL0A 3AK4A 3ABZA 4R0NA 3KR9A 3O84A 3IMKA 5HVNA 1GPWB 2ZBVA 4GUAA 4HDMB 5HQJA 3WGGA 2HSEA 2F3PA 2HT1A 1N3IA 1UDAA 3ZHZA 4R8VA 3LA8A 3I6YA 1O6GA 3NYRA 3G5AA 4JI1B 2JIMA 4P81A 4WXHA 4AS1A 2C2MA 4RV5A 3OJEA 4MQLA 3MTQA 5KSPA 1WHSA 1FB5A 1E1RD 2JJ8A 3QPCA 2IBTA 1VE6A 1P9OA 3R7WB 2B5VA 3HBNA 3R5TA 4J0JA 4DA4A 1PE0A 2W6JA 2CMDA 3LDHA 4ZV9A 1JG2A 3LT5A 3OQHA 3WR5A 3KQNA 2HLDD 4F4HA 4QPCA 2VT6A 3OEYA 5KWVA 4DKJA 3QFFA 1UM9A 2W2XA 4EHNA 1LFAA 3FMVA 3KQMA 4RD4A 3U37A 3HA2A 1E3DA 1FTQA 3IKMB 1E94E 4IRUB 4Q4HA 3WC4A 4P4LA 4X71A 4YRLA 5CLGA 1O4VA 1T35A 4ZOAA 5AD1A 3D3QA 1K89A 1O96A 3T9EA 4FW9A 1J0AA 4EHKA 3OJXA 1DMSA 2IHBA 3EA5A 2P4EA 5I7HA 5JJ5A 5AOBA 5TMEA 3EW7A 3TQFA 2XE8A 5FOSA 2AG5A 1JEQA 3NIGB 1KR5A 2FAXA 3K1TA 5DP1A 1EA5A 2IYEA 5K51A 1CUDA 1VB3A 3GT3A 1NN5A 3BTSA 2RGNA 1B8PA 4O6VA 4LJSA 1U8EA 1U1CA 2XTJA 1C41A 4N12A 4WCFA 5B58C 2H5EA 1F0PA 1Q0QA 5FWXA 2BKAA 2QX4A 2C82A 4X20A 4II7A 4BQSA 4BYGA 2XXAA 1LXCA 1PGQA 2X6TA 4S1PA 3DDUA 3ZLTA 3QKSB 3BS4A 4GR4A 2CLOB 3D81A 3L7OA 4JLAA 4S3MA 5E95A 2G0TA 3P9YA 5FR1A 3RYHA 3ZYCA 2X23A 2AN1A 1P7CA 2CJYA 5CLJA 5FPKA 3R8CA 1E7SA 2ZRBA 2DQZA 3LBIA 2RB5A 3P9CA 4B34A 1VKNA 4HAWA 4CLOA 1Z6ZA 1KWGA 5CA1A 4MDEA 4L16A 2RK3A 1DC6A 2H4JA 3A6KA 1QLJA 1G9TA 1VJ5A 5EEGA 4EKIA 4FW8A 5AHXA 4GKKB 3V32A 2LXNA 2PKWA 1ZWLA 1YO6A 3RKUA 3AVUA 2A2ZA 3O9MA 1GZ6A 1UBEA 3VTFA 3MT0A 4ADSG 4B1FA 4LSGA 1TLTA 1TIBA 2Q6IA 4RPLA 4C14A 5IYZF 3PUZA 1KVSA 2A9FA 2C61A 4MCAA 1PEAA 3V1LA 3SWWA 2ZB4A 1G6Q1 1J0XO 4OL0A 3WFIA 3PEUA 4Q4DA 4XZ3A 2B1QA 1VL1A 2IQ5A 3ZK9A 5JW6A 4JYZA 4GYJA 4YO8A 1OFUA 1G5FA 2QDXA 3O73A 4BX8A 2JI4A 5CB4F 1XA3A 4GMKA 1TKRA 3JQAD 1F2UA 4FYMA 4J1TA 3X43A 3SX0A 1QRSA 2B4KA 1VC2A 2COUA 3C3AA 1C7EA 4KFUA 4UM8B 2VA9A 4KYVA 1L8OA 4EVSA 4NG4A 4UNSA 3PC4A 4MEAA 4LYGA 1W85B 2XKAA 1DKRA 4M7OA 1IJBA 3GFGA 1CP3A 3ZWCA 3DKVA 1X9GA 4Z3OA 2PJZA 1L5WA 1JDJA 1QHHB 3I72A 2P0AA 1Z2OX 2ATIA 3EFBA 4FQ8A 1P2UA 2K7ZA 1X1SA 1JHXA 2WF9A 2YNMD 2RCYA 3GUCA 4NOJA 4HTAA 3W0LB 2RGEA 4O2BB 3BGOS 4WXYB 3FZEA 4IJ5A 1IWPB 3WFJA 3CWQA 4J4HA 3CJTA 3TS1A 1NNEA 2GDJA 4P4SA 1HYHA 1WVIA 4BNKA 2P6PA 1LPOA 2PUWA 1IZ7A 1QONA 4QNRA 2K6GA 4R2LA 3UG7A 3W3AD 3RSGA 3B1ZA 3KZKA 1E2LA 5AT1A 1K4YA 3H4MA 1SU4A 4J3NA 1AF7A 1B3BA 1C8BA 4GE3A 1JSLA 2QM0A 5FWYB 1V4NA 1FQWA 4JYMA 3VTKA 4JT4A 4GEGA 2EKQA 5AM2A 1KZ1A 4IEEA 3AJEA 1NUAA 2W58A 4AUMA 2BRUA 3LDAA 1XTKA 2IXEA 1YVEI 2DFNA 1JEEA 1BQEA 3QE3A 4FNAA 1O5IA 2I2FA 2VHYA 3P4XA 1JE1A 2OCLA 4U0JA 1LF5A 4OU4A 4R1TA 3I9OA 1QGZA 1L5YA 3KOMA 1XB2A 3LK7A 1KKMA 5CD1A 1CW2B 2H1FA 2QL5A 4MYSA 4BMDA 2WJAA 2Y93A 3RBVA 3WLTA 2XGJA 5JAUA 1EUDA 2O1XA 3EIOA 1GGHA 3GJTA 3PVCA 5DXAA 3TLYA 3WBFA 4C04A 4HX9A 1PNVA 2AXQA 4NC9A 2BDEA 3KQUA 2ASEA 3QJ5A 5L4NA 1R9JA 3DP7A 2ZPTX 5DYTA 2Z2JA 5CDHA 3VAYA 3N6VA 4PNPA 1S4QA 3FPJA 4C7VA 4FHDA 4DUZB 5PGMA 2ZWVA 2A1TS 2GAOA 3QK7A 2CL6X 2B3DA 1TLLA 2IHTA 3NONA 4WLNA 1EYZA 2PMDA 2QTZA 5CFLA 4KVFA 1GAEO 3V4LA 5HJ2A 3SQNA 4OXYA 4MV9A 4C0KA 2ZTLA 2XUJA 3I1FA 2Q29A 3DNPA 1P2VA 5AXBA 4D81A 5I3ZA 5K8TA 4BRSA 3GG9A 3AFHA 3V8BA 2ZRQA 3DE7X 4EJ2A 5CDSA 1EDZA 1W0CA 1XT6A 2FPIB 3DVAA 3UMVA 2LRHA 3SHVA 2C83A 2J3KA 3GL9A 1Q74A 4JMLA 4NDZA 3UMMA 3GLIE 3CEHA 4IINA 4FCVA 4ZTZB 2LBPA 1PDOA 2OBFA 1MJ5A 5HPYB 1X9HA 4RQUA 1YQTA 2HA0A 4LJ5A 4DMKA 1Z0FA 5BN5B 4WVLA 4JUCA 4MUIA 4BVLA 4CMIB 3NHFA 3ORQA 3VR5D 4YAFA 1UC8A 2ZATA 4FQ7A 4FZVA 1JBKA 2VWGA 3D64A 1Z6QA 3DOOA 3OG9A 1RRGA 2AC7A 2WNHA 2WZQA 4DA0A 3ZGZA 2FR1A 3HKEB 3TRFA 4I9HA 1GV1A 3EEBA 1ORTA 3MZ0A 4L4ZA 1U90A 3PGJA 4RSHA 3DCYA 3R23A 3SN6A 2W48A 5KC8A 5HRUA 1PNRA 5HDBB 3R3XA 4R9NA 4Y0VA 2FW1A 2FZ4A 2RGYA 3KVRA 1M8JA 3PFGA 4J03A 5TF0A 3U7RA 2CXSA 1QE0A 3M3HA 3IC5A 4FFSA 4X1IA 1KIFA 1RKBA 1WSWA 3QKIA 4ITUA 1XDDA 2KYRA 4J4BA 4R4JA 3MHTA 3LECA 6LDHA 1XZDA 2VUTA 1RJFA 3AHIA 1VXRA 3E48A 5DE3A 3TLCA 5DNDA 4PBSA 4TTJA 2GK7A 3HPQA 4MW6A 1NQVA 3K9WA 4L5BA 4EO7A 3GH1A 2YWDA 1MENA 2YN0A 1PL8A 2QTWB 5DU2A 1EZ1A 3SEAA 3VR3A 4M0CA 2D5CA 4CR8A 1AGYA 4QU8A 1DQRA 3PWZA 4EY5A 4ZMSA 2G5PA 2ALJA 2YR0A 1ONBA 5A5VA 1F8GA 1O96B 4L7QA 5D5PA 3R9IA 2VVTA 4Q3LA 5B3AA 5K0TA 4MYCA 2UU9B 1EVKA 4F2HA 3CZPA 2JL1A 1TXGA 4RTSA 1S1CA 1O57A 1UDCA 2GFHA 1K97A 2GCOA 2RI1A 2W2TA 2QN1A 3DH0A 3G13A 3L1JA 3P45A 3BL6A 4O1MA 4PFJA 2X6QA 4NU5A 1DXYA 1N4DA 4YMIA 1FJXA 1E96A 4C29A 1Z4NA 2TRSB 3SE0A 3N2IA 2BWJA 1VJTA 2G4CA 3GYGA 3ZHYA 1U8AA 5FH9A 1SR8A 4EQ6A 2Z9CA 1IONA 2EL9A 1YQ9A 1JDNA 2C3PA 4IGIA 4BEWA 1CUGA 1U3CA 1N6PA 3NBYC 4PO9A 4U9IS 1KP2A 4WWHA 4DHEA 2H63A 2VNAA 3QITA 4WFJA 4O1HA 1NASA 1Z0ZA 1EJ2A 1E0JA 1YKGA 4FI3F 4TM8A 2FMHA 1YB5A 3P2OA 4YCCA 5BMVB 3QMMA 3SX2A 1QYXA 3IP5A 3F46A 3IHKA 3LQ1A 3UJHA 5TDHA 5K8JB 1JG3A 1CCWA 4QTZA 4URFA 3D4LA 3KEOA 3U7GA 3G5LA 1M73E 4ZAGA 2YXPX 3OZGA 4BB5A 4D3DA 1NW6A 3ZWYA 1P80A 4ZA2A 3MAGA 1E2NA 2YJZA 2NNLD 2Q5JA 1Y9AA 4O4HB 3GN1A 1CT9A 2Q1WA 3EGCA 1YMUA 1V8FA 4CMJA 4IUYA 1CNEA 4PZDA 2ZTSA 2VI5A 4UMEA 1QO0D 4A73A 2GN2A 3HJNA 4FIDA 3L7AA 4IMIB 3GT0A 2XMBA 5G4KA 3TSZA 3A3YA 2H2FA 3UBMA 1E6KA 3RVKA 4HLCA 4KRXA 4YFVA 4I1SA 4HB3A 1U6JA 2N46A 4JIGA 2JKVA 1P4JA 3HB7A 5F4ZA 4BFVA 1E2EA 1YDGA 5KJEA 2BFPA 1S9DA 3TM5A 4DXDA 4ZI3A 1ATIA 1KO7A 3FUVA 3IBYA 3MMZA 5TJHA 2A30A 1ZYUA 3BHIA 5IHXA 2PBFA 4YI3A 4MW9A 3ER6A 1XAIA 3UUFA 1SOMA 4FKMA 1LPNA 4PSAA 3AM3A 3R2JA 3IP6A 4HWGA 3F97A 4QFBA 4XWAA 2QNBA 3CH5A 3P32A 2OQRA 4PPNA 4UDNA 5TSDA 1JTVA 1X7XA 3LW7A 1VJRA 2HN9A 4FZ5A 2HHHB 1G3MA 2GZ2A 3OOHA 1RZRD 2ONCA 3K70C 2F4VB 2PV0A 4MRNA 5P21A 1IHUA 1X3SA 1HT2E 2AQHA 2XGMA 3TW8B 3QYFA 2XYGA 5DOZA 1O0SA 3Q3IA 4C5BA 3Q9SA 5BQOA 4FHZA 3Q41A 2JGLA 2A9OA 1UJBA 1G64A 3OC6A 4C4AA 2VHCA 4NPCA 3T7EA 4M9RA 2F8MA 4REQA 5ALOA 5I9BA 4UHHA 4JQYA 3PRJA 5CXSA 4M54A 4AC9A 2VLBA 1LQUA 4ZAWA 1KQFA 3DUFB 5FLEX 1XCLA 4LOKA 3AX6A 4LRXA 2A84A 1DTWA 1VKHA 3K1AB 5A71A 2EP5A 3X1ZA 4DTIA 5L3VA 4C4OA 1KI6B 1B6GA 2ZBGA 4LJRA 2Q6OA 4YMSA 5EZYB 4M4SA 3EIWA 4GNRA 5BURA 4KQWA 4EA7A 5LQCA 5K0CA 4PIVA 1SIUA 4BNTA 3FD8A 2VTBA 4D4LA 3FNHA 1SQSA 4OHVA 1A9QA 3MTDA 2J0EA 1OWOA 4PTZA 1IN8A 2PL3A 4PF1A 1JPJA 5HG0A 4HWPA 3F7MA 2IOYA 4Q9AA 3Q8MA 1X6VA 4IQ8A 1T25A 1ZLXA 3T3MB 4BWGA 3U4AA 4S1VA 3E18A 2YQ5A 3WHPA 3CZ4A 4XLLA 4AJ9A 3QVWA 1NA5A 5JSHA 4V24A 1W1UA 4UVIA 5ESDA 5ABPA 3FSGA 3VO9A 4BXOB 3Q88A 3E0QA 2Z4RA 3KSAC 2WYIA 1D2HA 2H48A 2I29A 1BU5A 5FOWA 3KXIA 5DV9A 2OGWA 4PAWA 1FFXA 2H5JA 2NZWA 5ECDA 1QV6A 1CLUA 2HM7A 1Z7GA 1XI2A 1GQFA 1L8QA 1P81A 1XRQA 4MQBA 3CLTD 4OK5A 2X0RA 4LMRA 4NBVA 5IARA 4C0WA 1U2ZA 3D7KA 2C7GA 2J5BA 3BKWA 4BO2A 1T4GA 3URKA 3BXGA 3BSYA 1G8FA 2YWBA 3SXJA 3E9CA 4DV6B 3HK2A 4P3NA 2JIQA 3OCVA 2AZMA 4FYIA 4QUJA 4TSKA 4MUNA 2YJGA 1WP9A 2ZSUA 4MRMB 4OHBA 2PZLA 4BQRA 4WADA 2PZKA 4A1FA 3UWKA 3I0MA 4K1LA 4L08A 4NZMA 5HJ7A 5JXHA 2BI7A 3GZJA 4DHWA 2G17A 3KG2A 4BVKA 2WKRA 4QE3A 5C18A 1N3BA 3MTIA 5EUBA 1BSVA 1WABA 2ODBA 1NBMD 2P3QA 4H18A 2FZVA 1GL9B 4DE5A 3DHWC 2PGXA 3WLOA 3LV8A 2VFAA 3CF4A 3LWBA 2HF9A 3QKTA 4OYRA 3D1LA 2AFHA 2PD3A 3DFFA 3ZKWA 1RE1A 2W4IA 2CGEA 5FO0A 3RS9A 1BN7A 1AZSC 1BE0A 3AR8A 3H1FA 2RJNA 1B15A 3ND6A 3EOZA 3EARA 3PCRB 4MV0A 3I1IA 1D1PA 1R4MB 1OYWA 3C5WP 4XUCA 5HE8A 1XEWY 3F6YA 3O2JA 4LGMA 3T1HB 2V74B 2C9BA 2G09A 1CV2A 4N7JA 1HFKA 2NX2A 3B3FA 4LAFA 1VE5A 3KTFA 4IXWA 4MOWA 4AVYA 4BWVA 4MWEA 2I4NA 2WD7B 4BMXA 2REXB 3DLPX 1P8JA 3JRXA 2PQ0A 3EVTA 2H5LA 4QM7A 5JHHB 1U99A 2B20A 4KEAA 1YFLA 4A91A 5CB6A 5EHZA 5AI9A 4G1FA 2CD7A 5KYTA 3G2IA 3F4KA 4B31A 4RPHA 2ECQA 3QPUA 2QV0A 4MRSA 1W88B 3W5UA 3TNDA 2Q3JA 2ZYIA 3GEGA 5EIHA 3ICWA 3TIXB 4FYXA 1T3GA 3PENA 1PLJA 2RBEA 3G8BA 3D4PA 1FSGA 1H65A 2IYFA 3KQLA 1FLVA 3G7UA 1O58A 4OOEA 5LN1A 4OAPA 1QQ6A 2NUTB 4FNOA 3ZCUA 1NHGA 3KDAA 4X62B 4WZAE 3RHZA 2G06A 3ILSA 4HBGA 5ICEA 1XAJA 1XKTA 2YV3A 1E3WA 3KUKA 4WCFC 2GESA 4AF8A 3M0EA 1X8XA 4BX0A 1ZN8A 4C1BA 1W44A 2P4SA 4DC1A 1JMYA 4LOLA 1WBJB 2CY0A 4AJJA 2D2EA 3NTQA 2ONZA 1XZFA 1CWUA 3ABQB 2F1OA 1DCMA 1GYPA 4DDHA 4YRGA 3KKKA 4MCJA 1K6EA 4Q9IA 4I3GA 1YVPA 1OIWA 3NGXA 1TDJA 3QKRB 2HD4A 3KCQA 2XJ9A 2ZDQA 3BK2A 3VMMA 4MUXA 4D98A 4H3SA 3ZH9B 5A4DA 2OZLB 4PVDA 1WZUA 1J25A 2GVNA 1Q1QA 1TMGE 3U3JA 5CFNA 3HYNA 2Q4OA 2JFZA 3GO4A 3OQPA 2FJUA 4H60A 2AR7A 4FXOA 4JUDX 4MR8A 4TQGA 1K06A 3FKJA 1D5CA 3H87A 5ARBA 5JQGB 2RC5A 4NYJQ 1MNQA 2H1VA 4QYTA 4YBZA 5BQ3A 2ZFUA 4BLUA 5CYGA 5A1JA 3O2SB 3DMTA 3SJ7A 3COYA 4AWAA 5ENDA 1KY3A 4X8LA 5EE0A 2X0JA 5JSQA 1H66A 1US8A 1SY7A 1NONA 3N76A 1GQRA 1Z35A 4QXAA 3WG9A 5C8YF 3P9RA 2B6NA 5E8RA 3K5IA 3C6BA 4ASUD 3CV3A 3A6PC 4I46A 1I2CA 5IKEA 1JYFA 3TTYA 2HV9A 5BW5A 1SHUX 4OQPA 4OAOA 1MFPA 2JLXA 4KCGA 1RJ9A 2EQBA 1IK4A 2ODQA 2O1EA 4EG6A 3L77A 4KPGA 2XZLA 2D1RA 4R2XA 2HNAA 2IEAA 3PXEA 1JLHA 2H4XA 3A1FA 3INRA 3WRXC 4HMOA 3KT8A 3WMWA 3W1WA 1J2TA 3OZDA 4C3VA 1X15A 2IA5A 1X92A 4LGYA 3ZWAA 3HN6A 4G67A 3ZZTA 1VYHA 1GTSA 1R12A 2ETXA 4G5FA 2B8WA 4C06A 4JYBA 4E5NA 1BVYF 5ULLA 3RR2A 4KQXA 2C2XA 1MAHA 3RLIA 5F4BA 1MZPA 1EP9A 1JNYA 1AKWA 1HDRA 4QYWA 4KRFA 3E9YA 4UE3S 4Q02A 3OX1A 4RZXA 3RSFA 1CB7A 3UG6A 4N9WA 3UK0A 3GDGA 3HRIA 3D6AA 3GJ0A 2Z2XA 1L5FA 1FVHA 5JVDF 3TXYA 3NHSA 4U39A 1NJFA 3WKDA 1OHHD 4HC4A 1ZMRA 3O3CA 4V02A 5LQKA 1TM7E 1XMQB 4J3JA 3KPVA 4Q3EA 3QNMA 1MKYA 5HX7A 2JD2A 2YV4A 5B64A 3L7JA 1XE3A 4NG5A 3JATB 1R64A 2JFFA 2VK2A 3NV7A 4YR9A 1PEDA 1VECA 3LPDA 1PFVA 4MVYA 4JJGA 4DAOA 2V98A 4HPJB 1ZSVA 1J99A 5A0FA 3MUEA 1EFVA 1KOFA 1P8AA 1PX0A 4G4JA 2RGWA 1LV7A 2A7XA 2RCNA 1RE0A 1U94A 1F0YA 2IZ5A 3AHFA 3HE3A 1D1SA 4OYLA 1XZHA 5TPWB 4Q7QA 2RGCA 3DHNA 1JG6A 1Y1RA 2BLNA 2PU5A 2B1GA 4KWEA 3FW1A 3RHSA 4YI5A 2YN2A 1M0TA 3U7JA 2NU9B 1NUHA 4XQGA 3EYWA 1EFAA 3L93A 1NQ5A 3EQ9A 2I9KA 3LQFA 2WJIA 3FIJA 2FGJA 4YXWA 3VOBA 2XCRB 5A5DA 1KMNA 3HP1A 3NUQA 4FYHA 5EIXA 2G5TA 4OPMA 1QZTA 4IMRA 3ILYA 1H9CA 1MA0A 3ISTA 2JJYA 3A3PA 2XA9A 3NB0A 1HE4A 4NY1A 4AECA 1RAHA 1E92A 4CCWA 5ICGA 4AKGA 3FUXA 1PJBA 4BL5A 2PKYX 1NYQA 3ZIDA 2XJ4A 4JVSB 3VR4D 5JEEA 4DADA 2QUZA 3S44A 3E7DA 3V4ZA 4L7VA 3BK1A 2JLCA 4FFPA 5JWHA 4AZ3B 1ZGAA 4NFSA 3W5JA 3EEOA 4GC5A 1SB9A 2NZVG 4YVFA 1CJMA 4TGLA 1IYZA 1N25A 5COQA 1PT9A 3U3RA 4C43A 3QUAA 4YJGA 3LPNA 3VNVA 1UZUA 4OI0A 1VBFA 1RYZA 2G0AA 4DV1B 2WSSA 3HBLA 5DNUA 2WU8A 1V1MB 1DO0A 3I64A 3PTLA 1PZNA 3RWBA 2VPTA 4DF3A 5ADWA 1HX7A 2FRDA 3MAAC 2VWHA 4PC3A 1M76A 3ZHBA 3IR7A 2UZ1A 4HT3B 3DR3A 1E4EB 4K88A 2VSYA 4J8PA 1DMRA 5DBOA 3PJGA 4AL4A 5CVCA 2I4OA 3IAUA 4ZVRA 3SXUA 2EV9A 4ZVLA 2X0EA 2NUPA 5BNZA 1CX9B 3SS8A 3QP9A 2HSJA 3KR2A 3L1HA 4KXLA 4D3YA 4J91A 2CXTA 2R751 5IMBA 5AKHA 5C1BA 1JXAA 3AR5A 3PI7A 1C9JA 5IF9A 1VA4A 2H11A 3STYA 3V80A 2GBIA 4CM8B 1KDZA 1PBNA 2QV7A 2PJRA 1FP4A 3ZCQA 4F9FA 1G8HA 5G1PA 4EW3A 1GQQA 3LUDA 4OFBA 1BXZA 1EFCA 4XDZA 3VKFA 1DBRA 1RRVA 1T9ZA 2XT6A 4AB1A 4B3DA 3V33A 1XEWX 3O4RA 5FNVB 4Z8XA 1VIDA 4CMGA 1ID1A 1XKQA 3H6KA 3HL0A 1VHLA 4QXPA 1HK7A 5JZBA 4C7OB 2QTGA 3PFIA 1UKEA 2HK8A 2ZWMA 3WJ2A 1J5PA 1ZOSA 4ZOCA 3D7LA 1EFPB 1YJQA 1A98A 2F1RA 2PRIA 2FMIA 2ZYDA 3I2HA 4MR7B 2IV7A 3BX1A 1P1HA 5FBVB 2WZCA 1YD7A 3FWPA 1YV9A 5T4FA 1Y3CE 5E6RA 1WCYA 2OFXA 4ZREA 2H1OA 4C87A 1H85A 2ZROA 4BOYA 4BX3A 4RJLA 1GHTA 1PS0A 1QHYA 3VC1A 4QBTA 1BS1A 2WD8A 4FZJA 5SY9A 1VPWA 2Y0PA 4ENVA 4TLLB 5IXYA 1D2EA 1LY1A 4PYKA 3WK8A 2QUKA 5LR6A 3AERA 2QZ4A 3R41A 1PX2A 1DAMA 2PGIA 2ACKA 3DW1X 2P91A 2QLLA 3F74A 1M6NA 3B13B 4JX8A 1TF5A 4PSUA 4B3IA 4KPEC 2A7QA 1ZJWA 4KIFA 4MUEA 5TEWA 3R3ZA 4UZSA 4WK0B 1SU7A 3G9XA 4YRKA 4HWSA 2OZLA 4V0ME 3DW3X 2DRIA 3S5UA 3ZHXA 2HK6A 4GLOA 3PYXA 1EX7A 3GLGE 1RPNA 1NJ2A 4DL9A 2O48X 4C6SA 2IIVA 1RZUA 3ZVKA 4HPXB 4HTFA 4S0XA 4OLFA 1FSZA 2UYOA 1YB2A 3I92A 3R0VA 4Q82A 3DKRA 4YB8A 4FHFA 3OPVA 1ZXXA 4YYEA 4RMJA 3GJ4A 3T7IA 4J0GA 3W9UA 1IZZA 1AKRA 1VL5A 2XYHA 3QHQA 3TNLA 4I6EA 5EWMB 4D96A 5EJMA 4Q66C 5LZ7A 5LDDC 3PX3A 2JHCA 2PBRA 1Z9BA 2UKDA 3R9KA 3CNHA 2N42A 4NOLA 3LGSA 4JSRA 4AZ0A 1NXTA 4Z4GA 1U2RA 1CRQA 3AEQA 1JIKA 1PV2A 4MS4A 4CIAA 1IUKA 4HAOA 3TBFA 4Z4IA 1RQ7A 1Y4AE 1JZQA 2QW8A 2H07A 3TMYA 3TB4A 1TZCA 5EFZA 2WLTA 3UV6A 1EFDN 2W2OA 1OWMA 3Q1KA 4TYYA 1NXOA 2GK4A 2VYVD 4G85A 2PUCA 4OCZA 3R3UA 4M7WA 2J6IA 2R48A 3QF7A 1NI3A 4E2XA 9ATCA 1CDOA 1Z88A 1U0GA 3D59A 3H5IA 4M86A 3T06B 5I01A 4JU9A 2D7CA 2YXEA 2DYKA 1EM8A 4GXNA 3B6JA 4FFDA 3SDSA 1G8PA 1QHFA 3SQOA 4E31A 3CY6A 1AHIA 5AK6A 4G5HA 4RGBA 3TM4A 5C52B 3K09C 4DJTA 3ZVLA 3E6AA 4MWTA 4L8GA 3UKDA 1ECPA 1DAHA 2VT2A 4R8RA 1SRRA 1XYYA 4KL8S 4LPSA 2Z57A 3LHDA 5JZVA 2PSEA 3LMKA 2IZZA 3RYIA 3RAFC 1T2DA 3RVOA 3AR4A 1PVOA 2D0DA 3V6LA 2CNDA 2X7HA 4DLNA 2CWWA 1ZBQA 1SO8A 3L4KA 5A4IS 3TX2A 4ZZ0A 5JS2A 3T1VA 3T41A 3UAGA 4FDAA 2XRYA 5J3JA 2O0LA 3AVVA 5AI8A 5A3RA 3BA6A 4K1XA 3A1UA 3DFKA 5CNIA 2C42A 3C15C 1B23P 2CUTA 3NCHA 5F7OA 2KX7A 1RXSA 3C2QA 4LK2A 4B3XA 3NH6A 1NLFA 2I66A 3BORA 4FSXA 3OZ7A 4WVFA 3UJ8A 1HRKA 2FPPB 5A9TA 2IRWA 5F77A 2Q8NA 2H51A 1YFKA 3F7TA 4DA7A 5ICSA 2GEDA 3C6YA 2QN7A 2HXGA 3NRJA 1Y98A 4DA8A 4P98A 1S8OA 1ENPA 1T8WA 3MJRA 2LDBA 1QIMA 2VR1A 2GKSA 3LQKA 4JOBA 4F5EA 2DHQA 2V9CA 1PHRA 4YBRA 5ALWA 3UJ6A 4D44A 5B57C 1V37A 1GZDA 3GK3A 3IHLA 4O4IA 4ENRA 4NK4A 3VHXB 4C89A 4FZRA 4WZZA 3QX8A 4RQTA 4MVCA 4RHEA 5G4KB 4KGDA 2CBGA 2C7OA 3AGQA 4ZRMA 1OR8A 4RH0A 2XYPA 5K0GA 1JZSA 2JZOA 1WPRA 4DLKA 1BTOA 1XHLA 2G9VA 2RJ3A 4IXMA 5JMTA 4IDHA 1ULUA 2YMPA 4G0OA 1IQUA 3WBJA 1TUBA 2C5LA 4HQ0A 3QUBA 1TYAE 3LUGA 2Q0QA 5HOQA 1JB1A 1O4WA 3PVSA 1V1RA 1GPNA 3DBOB 1QGYA 1QFXA 3G3EA 3PQ3A 3ZNPA 1E2KA 2Q0SA 3DVAB 3Q0IA 4X45A 1QZ3A 1P7ZA 4BGIA 4UUQA 1KS2A 4OX9Y 1Q57A 5GZ1A 4EPRA 3E61A 1Q1EA 1V7ZA 2ZSIA 4OYYA 4D0NA 4D9IA 5B6PA 3ROZA 1JHZA 3SZOA 4DQLA 2I3GA 4MLZA 4ATNA 3GGPA 1KZ9A 4MKGA 3AY6A 1F48A 2OGUA 3EOBI 3INTA 3OT1B 4F6RA 1HT3A 3CF6R 1ZESA 3U3KA 1AGRA 1L9XA 3T5DA 2L17A 5BWMA 1WXGA 2WY2D 2Q5LA 4KQ9A 4C4TA 3PEWA 1DX9A 3B1XA 3HJGA 1XCJA 3FYTA 1BA2A 1T0PA 3DMPA 4AZ0B 5CX4A 4EI8A 3IR5A 5AVOA 5TQVA 2B4RO 2WTAA 1YA4A 2A67A 2IU4A 3WJ1A 2FN4A 4GR9A 3AY0A 3HKBB 5FADA 5LZ4A 2J7PA 1TUIA 3Q87B 4NMLA 5A4MS 1C50A 3UMSA 5AO9A 2PMEA 2XMZA 1XQ9A 4O2AF 2W71A 3DR5A 3N7TA 1TB4A 3B2EA 4AXXA 5G1NA 1D6MA 4E5MA 4JN6B 5JALA 2XT0A 1PWXA 3MC1A 3X2EA 2YJTD 5IABA 3E9NA 2IL1A 2X5XA 3VC2A 5DIFA 4DCMA 1PL7A 4CMIA 2X9NA 1Z5NA 1NF2A 4MQ5A 2CW5A 1VKZA 1TC2A 2J9FB 1N2GA 2IW3A 1COZA 1Y1SA 1V2HE 2QTBA 3DAHA 3QXJA 2GN4A 2JASA 2VCHA 4IV5A 3GLSA 4JP1A 4L9RA 2OQIA 1TO6A 5CH5A 5F5XA 1TQHA 4YP9A 3VUFA 3D7SA 4ACBA 3G2KA 3EVBA 1VG8A 3SQWA 5DM2A 5JWRA 1JFRA 3WJAA 1M0SA 2BGRA 5KYUB 4JBYA 5FPPA 4ZJZA 4PN3A 1R9MA 1W46A 3TR0A 1CQIA 1QGED 2W43A 2IUFA 3RKRA 4CTKA 2DUWA 4JAVC 3KALA 4Z7QB 1X1EA 5IBPA 2Y1DA 1KEWA 3E7WA 3AONB 2YFKA 3PF9A 4FM9A 2HJHA 4PLFA 4H1HA 1CSEE 5SZJA 1GNLA 1T1GA 1X7XB 3HB0A 2FWNA 2IYPA 3O38A 1WR8A 3OZBA 3TGWA 4AUKA 4BZPA 3VVCA 3D6VA 2A78A 2I76A 3CVJA 4LSMA 4NBTA 1YCHA 2G63A 2I2BA 4PLPA 3ZLBA 5AESA 2BCGY 1L3BA 4PSVA 4RHTA 3QU9A 3PC2A 1QF9A 4K26A 3T4EA 3P9XA 4CWAA 2Y9MB 1BQ3A 2GVDC 1J7JA 4ETIA 3M89A 4ZU3A 3BUSA 5T5QA 2HX1A 3T1OA 4BTEA 1FFBA 2G28A 2WKQA 5MF6A 3SOZA 2E1RA 2YN4A 1U3DA 1PCXA 1Z4OA 2DTDA 3TB6A 4CR6A 5DTIA 4PE5B 4X5OA 4E07A 2OV6A 2H59A 2KPOA 2QMYA 1JFFA 3FF1A 3FGOA 1QKIA 2JFWA 1RWKA 2XQIA 3QY0A 3BJEA 4II2A 4BGEA 4EPXA 4QHYA 2XRMA 3JRNA 3HY3A 3R77A 4QXRA 4ZYXA 1QU2A 3NCTA 2R0QC 1XTVA 2BE7A 5KYGA 2XUDA 2XPCA 1TU4A 4QOFA 2P2NA 3C87A 1P61B 4ETMA 3HZRA 2WM9B 2GB4A 3KD2A 4G5YA 3BMOB 3CA8A 5D5QA 4D43A 1ESZA 4BNHA 4UBNA 1QRTA 3AIIA 4OKIA 1RI1A 3HKCA 2VWPA 1PW5A 2EP8A 2VJLA 3C8MA 4CPDA 3R5XA 5HQTA 3NV9A 3GCWA 5LDGA 4FFBB 4U3JB 4BO8A 3FHTA 2WFZA 3G8YA 1N8NA 4WMLA 2RONA 2D1FA 2ZXEA 2ZTUA 1CF4A 2VF7A 1R0BA 4G8DA 4UHJA 3SF8A 1E20A 4YDRA 2P40A 3LX6A 4R69A 4BP1A 4KR0A 1EVYA 4Q3CA 2ONKA 3ABSB 3U48A 1H0KA 3A26A 1GCGA 1MO2A 4A26A 5LZ9A 2WHEA 2OK8A 1VDZA 2PLFA 3EUAA 3QOXA 1JAXA 2EJTA 4LCEA 1EFHA 1FP1D 3PWTA 5DTRA 4E12A 4F46A 3TPCA 4FKBA 1XSEA 3ETHA 4E70A 2A0XA 2M98A 3T7KA 1RKUA 3LCVB 5BN3A 2BRUC 3IQXA 3JQ6A 3BEOA 4MS3B 1HQCA 4QXQA 1Y1KE 3E4CA 4UTRA 3IIKA 5KYYB 3IUSA 2RHRA 4ND8B 3E9QA 3GVCA 2PX4A 3PNQA 4QELA 6PFKA 2P7IA 2Z8YM 3OI7A 4PYLA 5DSTA 3UUWA 4CCYB 5M5BA 4G0UA 3UMCA 1HURA 4HFNA 3JQ8B 2BVNA 2BONA 1GTMA 4HV4A 1EFLA 5J23A 1JFTA 3CGGA 2QP3A 3QV2A 3ZWKA 1Q19A 1ZM9A 1Z37A 2GUGA 3X1DA 1Q91A 3W6ZA 3B3AA 4CZ2A 4R1LA 3MMSA 2QIPA 5CDFE 3QG5A 4W9RA 1NX6A 1R9NA 4WK4B 3A8TA 2QY6A 3EDRA 4URWR 1Z07A 2IQIA 4Z86A 3WLPA 4J2HA 4KU4A 4MI9A 3TK1A 4UNRA 3HXMA 4OX9B 1UQUA 3PEYA 1EFUA 1QDEA 1K5HA 2IHJA 3Q2IA 4DB4A 1YHNA 4J9VA 4MWOA 2QMZA 1NL3A 3H11B 3H9CA 1OPRA 1G291 1I3OA 4X97A 2B37A 2DULA 5IZCA 1AJEA 4YGYA 5IDQA 4OHOA 4DV2B 1QU3A 4FLFA 3GLFE 2B9EA 1O94C 4PPGA 1ZKDA 3FSRA 1Z2AA 2M6SA 1BU8A 3WSTA 4AN4A 4YUXA 5C32A 4KZKA 3CLHA 1GP2A 3LT2A 1IXYA 5DP2A 4YP0A 2WG2A 4RS3A 3HCBA 3ZN2A 3JD4A 5LOVF 5J2TF 2C5EA 2D0OB 3QQ5A 3IEKA 3ZCRA 4EQ6B 5DHAA 2IC5A 5EAIA 4HXFB 4XWGA 1MIOB 4B79A 2QPOA 1M67A 8MHTA 3GNSA 2W4MA 4U7TB 4JJFA 2CNOA 5FA5A 1W5BA 4O4JF 1KSGA 5ICFA 3LY9A 3WBKA 3DV9A 4FFNA 4ALNA 3QBEA 5ALDA 1P5HA 4I4CA 1GPLA 4M89A 2Q3HA 3T95A 2F43B 1KK3A 1MEEA 4N01A 3H5NA 3LX4A 4ABTA 2BIFA 4Z0PA 1C4KA 1CY7A 1M1YA 4NBUA 5C35A 3L07A 1ZNWA 1Y8AA 2WPDD 1UFKA 1J8VA 5SYNA 1XN4A 4HEHA 1X74A 4ZC8A 1J49A 5EJFA 1EDEA 1LSJA 3FPBA 3MCWA 2UXBB 4D3ZA 3P97A 1QQBA 5DF1A 5JNRA 2FUKA 4OHKA 1EUYA 5ALYA 1TIPA 5FEUA 4GL4A 5IANA 1QFSA 3CUVA 3OM8A 1TLFA 1Z4KA 2I7XA 3D0RA 3AT1A 1P4HA 4K8RB 3KKNA 1VE3A 4FFOA 5B1YA 2BTQB 4KIUA 3RDPA 3LTNC 1E8NA 4F1WA 4PG5A 3OU7A 4P4NA 3FTQA 1JHPA 4OGLA 5LB2A 5I4BA 2XNDA 2QTCA 5EJGA 4B73A 5E1OA 2Y1GA 3KC2A 1W0JA 4PYOA 3L4JA 3ZDCA 2DPHA 1I3CA 4NZ9A 4GX0A 1TU3A 2NZJA 1KJQA 3T3PB 2AK2A 2A3RA 4MGKR 1Q2XA 3HYRA 4QU5A 3WMEA 4L8LA 2EJUA 1HDXA 2ZJ5A 1RLUA 1QIIA 3QPBA 3HNOA 3KSRA 4QGHA 1LU9A 3UAWA 2EYQA 2B8NA 4Z7OB 3SYRA 1I4EB 2QRKA 1Z33A 2YZ7A 4AMUA 4BMCA 5HYVA 2A5LA 2G67A 2ZUWA 3DGFC 4JL8A 3AOEA 1TJNA 1RI5A 6AT1A 2HHCA 3QBVA 5JR3A 1T4CA 1EUCA 1YTLA 1DADA 5H3CA 4IIVA 4E6PA 4F7DA 2IXDA 4F11A 2AMYA 3SOPA 4IQGA 1UOOA 3L6UA 3FXAA 4F6CA 2GF9A 2ZVQX 1U6KA 5L3SB 1H69A 1E99A 1RVV1 4EHBA 3M4YA 4P7JA 5JJLA 1NW7A 1TYZA 5KX5A 2GD6A 3T5GA 5LYJF 4RYDA 3IUJA 2LVBA 2WJJA 4CLRB 3HUEA 3OOEA 5IHPA 1JYEA 3H75A 3UGQA 4YQYA 3PE6A 4BHTA 4DS3A 2BPOA 4PZ0A 5AVRA 4CIBA 1XVVA 1SXJC 5I6DA 3K96A 1N7JA 4GD3Q 4HB4A 3HJAA 3B9QA 5L7WA 1M5RA 1ZH6A 3NFRA 2CWDA 5I5EA 1P2TA 1XD2A 1EPUA 3HUUA 3L3BA 4FE7A 4QGBA 4QARA 2BGWA 1QDLB 3GLQA 5IJZA 1NUQA 4BP3A 4TV9A 4JGGA 2C29D 2J0SA 2VNJA 4NAVA 3HN2A 4WI1A 4C2BA 5KQSA 1KGSA 1PGNA 2I6FA 4DNOA 1XA0A 1MAVA 2QG9A 1RC1A 3N2KA 1L1FA 2WWGA 1GY8A 1EBUA 1GL6A 4LYAA 3H2SA 5H7XA 5K6TA 1SCAA 4RM3A 1R37A 2RAFA 4PS0A 2RGDA 3RUAA 3IPCA 2OKCA 3FF4A 1PU2A 2BMFA 1GAWA 2XVYA 4BMSA 3U80A 1F0KA 1SQ5A 4FGJA 2PBZA 2R1TA 2X8AA 3G8AA 1XN1A 1EK6A 2AE1A 3R5KA 5DCWA 5HK9A 1TZ2A 1U1DA 3E70C 3G5TA 2CUKA 2Y0CA 3LNTA 1WMAA 1SXJB 5DTEA 1KH1A 1ODSA 3E82A 5ALUA 1QNFA 4BFSA 3G9QA 1Y42X 3PKZA 4Q9DA 3OFKA 4URVR 1DRKA 3TE6A 1CC1S 3ODPA 1R7RA 2W93A 4KTVE 5F78A 4BY9E 3VPXA 4NR0A 4I4IA 3HDGA 5EJ2A 3GFVA 5JBQA 3OUUA 2BEJA 3HEAA 1EWKA 1RJGA 1Y7HA 1IH8A 1LF0A 3AJDA 4US1R 4W82A 1ZICA 1WQ1R 4QSHA 1SBZA 4FUTA 5DBEX 1Z5OA 2N0SA 1A71A 3AHJA 4HDSB 4UXHA 1NUTA 1TT7A 1UT5A 2XGSA 3NFYA 5DNWA 3RROA 5KNBD 5KNCA 4LBWA 4B2LA 1HEYA 3RVSA 5HBRA 1IHYA 1X7HA 1M33A 4KN9S 1T4MA 3ZHRA 1CUFA 3COVA 3W8RA 3A1EA 4MVJA 2OXRA 1GUZA 5FNVA 4TV9F 4J0QA 1NMYA 4N5LA 5LD2C 4IO0A 4FBGA 3HYLA 5T6BA 2QM8A 5INTA 4CF6A 5JY6A 2GN0A 1XDBA 3AZQA 4W5WA 3UHPA 4LOAA 3HLYA 3T1QA 3R0ZA 5IC4A 3TCKA 3FZYA 3TLKA 4KSCA 2P5SA 4LC1A 4BO0A 4EYQA 1KF0A 4MCHA 1QHGA 2HO5A 4MJ7A 2F3TA 3DPIA 4UVEA 3UAYA 1CYDA 2O3QA 4TZ0A 4JLSA 4OQYA 1JHYA 4BFZA 3BRWD 4CN9A 4AO7A 2Q1UA 1EHIA 2Y9PB 4FD2A 3L7DA 3K0SA 3LY7A 1L1RA 1QBGA 2IUYA 3COZA 4FEGA 1XQVA 4BC1A 3T5BA 1NG1A 3SI7A 4LV5B 4DCJA 1W93A 3DYBA 4FB4A 4JUIA 5IFKA 1GYRA 2JARA 1KMMA 5AK5A 3IAFA 1E1DA 3NR2A 4OMCA 4YMLA 5FOQA 3ZCXA 1CP2A 4R3WA 5BYJA 2OQVA 2PSSA 4KLRA 2BELA 2J3QA 6NULA 3MEQA 4YAUA 4R5MA 4P08A 1RAFA 1II8B 1YDMA 1KU0A 2J9GA 3OZIA 3PGMA 1IN1A 1XWWA 1Z62A 3UYKA 4ETWA 2YWFA 1SUWA 3MS2A 1VHDA 2O8VA 1EBFA 3ASUA 4RUKA 3ASVA 1IBLB 4HLDA 1C1XB 3CKKA 4O2LA 3PJDA 4YJHB 1Y7IA 1ZM2A 2WVHA 3TL2A 3IT3A 1CEYA 5BUSA 2XBLA 1Y3FE 1M72A 1JWAB 1RNLA 1I5OA 1T0HB 3BE5A 3GELA 3H83A 3B6ZA 4J2OA 1D4ZA 1IIBA 1MA3A 2RC6A 2C4KA 2SCUB 2VYFA 5FIUA 4L95C 5DCLA 4CMEC 3ZY3A 3RAGA 1J8QA 2DFPA 2MTBA 3EGWA 2OY0A 2QRHA 3O1HB 2VK8A 5I7EA 1S02A 3I2GA 1DQPA 4J76A 5JNUA 2OG1A 4CEHA 3NUGA 2ECOA 5M2QA 1RLTA 4QYIB 4X54A 4BKPA 4N76A 3FOWA 2HGZA 3M4JA 4HYTA 1LBEA 3WWZA 1JH9A 3SIXA 1KEEB 1V35A 2NXJA 4PC6A 3T5PA 3FIUA 3D6MA 4PFSA 4Q1FA 3KQKA 4UUPA 3VPFA 4LWOA 2FHPA 3B5IA 4GKVA 1ISGA 4AJEA 1N1GA 1GL7A 4F72A 5T3UA 2OHIA 1M1UA 4A2PA 2EX1A 4PIPA 5EPEA 2IPMA 4DANA 5AXDA 3FYUC 4LE1A 4KBGA 2L0XA 4QUEA 4F6LA 1OI2A 3ZJYA 2ZIFA 1GQSA 1ECJA 3EVEA 4DIMA 4YH1A 1DWUA 2UVQA 2ZREA 3GQVA 1U0EA 4S1WA 4Y2QA 1P75A 1Z5WA 1Y9DA 2BMDA 4BV2A 1VIMA 3DO8A 5J4VA 1WZEA 5DN6A 3OWHA 1R3UA 3BK7A 3EQZA 1H0RA 4IXTA 4NYIR 4UTZA 4D8TA 3B1FA 5ES4B 2I4LA 3FGNA 4AMVA 2N1MA 4IX9A 1A8HA 1DDGA 4GLJA 4IIFA 3VYSB 5JTUA 3RYCA 2WV9A 5GIPE 3CO0S 1XNRB 1R0XA 2LKCA 3LWZA 1P44A 4JY7A 4YAJA 4EHLA 1TCAA 5HTOA 3MJCA 1I3KA 2FOLA 4FKZA 3KK0A 4X3CA 5ALLA 4BC0A 1H0SA 4V2IA 4ZAYA 5KTTA 2PUFA 1PUXA 3BCUA 3UK6A 1FUUA 2DPYA 3MWYW 2FFAA 4B3BA 1N2IA 5GWXA 3EQ7A 4ALIA 1L3IA 4MKHA 4PAQA 4E7OA 3MTGA 4JZKA 2F67A 5EMHA 4RL6A 5LUBA 3TQTA 5LP6B 2UUCB 2YVQA 5TQ2A 3RC8A 4DDWA 1J4AA 1MF7A 3H2GA 3COWA 2C58A 3U6BA 4N47A 3L6RA 2C5BA 1N5LA 5JPIA 3R6LA 3KVNA 3RK4A 4ZIRA 1RXVA 1Z12A 3H9GA 3DA8A 4RDIA 4M83A 3KKQA 4RX1A 1USWA 5FB3A 1NMEA 5MDHA 3RH0A 3SM3A 4PG6A 4UTVA 2EDCA 3N8KA 2ENWA 4YRJA 2VDVE 1HMPA 4NCKA 4AMYA 4BO6A 5DLEA 4Z2AA 2DF8A 5GV8A 4J4TA 1YK1A 3JZDA 3MF4A 2AFVA 4EG3A 5HJ5A 1BCRB 1NR7A 2Q2OA 2WR8A 3BH0A 4LXTA 2XDQA 1JDZA 2ADFA 4DMLA 1W52X 3AERB 1D8TA 1Y8RB 1TAQA 2C9DA 4EA6A 4YRSA 1F2TB 2OC9A 1Q3KA 2DPMA 2PGNA 1E1CA 1I10A 2HC9A 4EY6A 3O83A 2H2AA 3ET4A 4PFKA 3TLJA 3W1EA 3W8NA 1O9HA 1CIJA 3M83A 2GI4A 4NULA 5GZ6A 3U13A 1RADA 1YI8A 4RVCA 3BL5A 4WXRA 1L6IA 2NPOA 1UFQA 4CM3A 3KM0A 2CK3D 4M1WA 1RWVA 4MULA 5DLDA 3RS4A 3JR7A 3S2SA 4MR9B 4XAQA 1KDRA 1EU1A 3LYLA 1YBMA 1SJ9A 4I3FA 4Q1CA 1KI1A 1HDCA 1U5BB 3G7NA 3GLKA 2AOWA 1BXRA 1MAAA 2YIJA 3IAEA 4U5XA 5KNCD 4JR1A 2PJDA 4NEQA 1W8IA 4MWSA 4PQRA 4ZVQA 3L8EA 1O2DA 3OMWA 4MKZA 1EP3B 1E6UA 1GFIA 2IIPA 2K87A 3KQOA 3PR1A 4UVGA 5IYZB 1PW7A 2W2MA 4J0HA 4KIWA 4W99A 2PUHA 3UAOA 4UAUA 2ZUUA 1VBKA 4B7ZA 1ACJA 7GPBA 2QWXA 5I3CA 1DUVG 2AKYA 2YL2A 3ANTA 4FDVA 1KYWA 1YQGA 4MV8A 3EDQA 5ERGB 3UHAA 4F5DA 1GZ7A 4W5HA 1WRBA 3M34A 3IOCA 4Y18A 2F62A 1ZK1A 3ETDA 4IOLA 2OB1A 4I66A 4L0CA 4OSEA 1ULSA 1VCIA 1OMOA 1MHPA 3KOUA 1GTVA 3M5CA 3RFUA 1BW9B 2ODTX 5ALNA 3T12A 4BNDB 3G8DA 3RRFA 1JT2A 3GLHB 4NLLA 2OCYC 1YONA 3P5SA 3UXMA 4A0HA 2F17A 1SIOA 4KP7A 1NDHA 2J7KA 3TIFA 3HNRA 2HIGA 2DKNA 2XB2A 3ZV3A 2D3TA 4X20B 1OASA 4ZVOA 5CHEA 3I32A 4POAA 3ZEAA 2YHIA 3RYCB 4FSDA 2PMBA 3Q7TA 2EW2A 3GDHA 4TL9A 1RM5A 4G8JA 2W6PA 2WZDA 5AYVA 4EHDA 5EIBD 5CG2A 2C96A 2EKDA 2HMTA 1U5AA 1TUEA 1PT6A 3OESA 1H22A 3ROPA 4G0ZA 3GJ8A 1M8GA 5LZ2A 5MFPA 4XARA 2WJYA 4ZCSA 1BROA 3EY9A 1DP4A 1W25A 1YUMA 1ECFA 4R2KA 4CQJA 5CFZA 1JQ5A 1TE2A 2A88A 4KX3A 3KJXA 1F2VA 2ZI7A 3STUA 4MMYB 1IEWA 2OWEA 4UU0A 3KBBA 4B80A 2XWSA 4ZO9A 1P1CA 3GRVA 3QVJA 1K7YA 3V4SA 3W2GA 4EO4A 1WZNA 5EERA 3ETJA 4ZGWA 1H2ZA 1YK0A 2UAGA 3RBXA 5EJ9A 5J2TB 1SCBA 1V2GA 1LK0A 1E1MA 3FCXA 4HS4A 3OQ6A 3B7WA 3G2NA 3K0EA 4D4MA 1XMVA 3OD5A 4DLRA 5AR1A 3ADBA 3E7FA 1S2OA 5KKNB 5HP4A 3RS5A 2X4DA 4EGFA 3QKRA 1FW6A 1ZMTA 3HXOA 2H7XA 2Q3BA 2ZBQA 3AESA 1V26A 2EAUA 3MYYA 5DJ5A 5IVKA 4ZQGA 2CCGA 1THMA 3IOYA 2HB6A 2XOKA 4Q6BA 1K98A 2AF4C 3N8IA 4RXUA 4BMYA 2ZWIA 1BDHA 1XXHA 3ESDA 8AT1A 1E98A 3TVYA 4X65B 1ULBA 4MITA 4AQ7A 4CTMA 2V7QA 1W76A 4ZVVA 1HDOA 1A5AB 1XNHA 2BEVA 3QW4B 4HMQA 3NHBA 3SF8B 3GNTA 5LB4A 4EBBA 5TQJA 5ALQA 3PC8C 2AI2A 3TAXA 3MG9A 5DULA 2ENUA 1UWCA 5IBQA 2IY9A 4FGUA 3QU4A 5DGTA 4EEXA 2CC2A 4HDOB 3IKTA 2Q27A 3O03A 1L4EA 2O1WA 1U7PA 4MYUA 5AOCA 5CDFA 5GJBA 5K3AA 2XOKD 1NSYA 1G5RA 2HMWA 3QUSA 3BA1A 3BQNB 2QGZA 3CPSA 3C5EA 9LDBA 3NHJA 2PU7A 1XNJA 2IHNA 1XZLA 3BH6A 4FFMA 4Z49A 4B3JA 2Y3IA 4PHGA 3VKWA 1G3UA 3BYZA 4CI0B 821PA 2PMFA 4EB0A 3G1UA 2CJXA 4MI3A 4LWZA 3RHFA 3E81A 4QNNA 5DO9A 5A9SA 2N3ZA 2O0MA 3AUJB 3I0NA 4D0GA 4XGKA 2HDOA 4KO4S 1Z4PX 5SZKB 5M34A 1M34E 4C9BA 2IZOA 3P0FA 4B6SA 4XW2A 1O08A 4M1TA 1NIJA 5A3QA 4HDRA 4YK7A 2AN5A 4R71A 5HWSA 2V7QD 3FLAA 4M3NA 1HO3A 4IDDA 1NBME 3X1YA 1NOKA 3QI2A 5F3WB 2ZYUX 3KAPA 2CLCX 3CZAA 2I7DA 2NU6B 3KLNA 3T52A 3ZDZB 1KHTA 3H11A 3HACA 4IGAA 3UB2A 3ZWNA 5FT9A 1E79A 2FEWB 2GO1A 2X8BA 3BGDA 1TKAA 2QN2A 3PQ6A 1NYLA 4LA4A 5KJ6A 2BFCB 4KNYA 1BEZA 4QX6A 5E0OA 3KV1A 4DG8A 5JSZB 2PK3A 4NOKA 2WNSA 3D6TB 4JYAB 4B3CA 5AM0A 1KO1A 1V6CA 2Z2IA 4C0HA 3NTUA 4E08A 3HZHA 4UE2A 1BX3A 4R2WA 2GWHA 2QP9X 1SCDA 4OLAA 1CQIB 1N2OA 2BHTA 2FHSA 4GUDA 5DGXA 2BGKA 2D1SA 4WKNA 2VXYA 4NP6A 1PG0A 3M6VA 3QGMA 3NHAA 4CLXA 2VT7A 4QJ5A 2HJRA 5JG7A 4DBVO 1UKBA 3MLEA 2IYWA 4FEYA 1CERA 4TXLA 3VNSA 5BSWA 5BVGB 2YV2A 2Z1NA 3RK1A 1EG7A 5EKDA 2QX6A 5C5CA 2LKDA 4WDQA 2BBOA 3FVTA 5J40A 3B3QA 4KOEC 3WLJA 4RKEA 1LW7A 1RC8A 3W8EA 4Q21A 1C4XA 1AV6A 1MRSA 3MJDA 3LWDA 4EPWA 3GGJA 1R50A 2GH1A 2P1DA 2ZCUA 2QJTA 3H0KA 2QMEA 4X1YB 1O77A 3WS7A 5JAOA 1PZEA 5AW5A 1X80A 3K3PA 1HGXA 3H05A 1OX4B 3L7IA 4NFYA 1WDWB 1OOEA 1UMKA 2FSPA 3NTOA 3SE7A 3M1LA 4YQFA 5F35A 1RXCA 3EVAA 4MVJG 2OGSA 3DXZA 4OXKA 1H2WA 3I6MA 3NWBA 2E6UX 1C9KA 4OG2A 3FGZA 3RIEA 2ARKA 4GAEA 3FDFA 3F9CA 3VNRA 3I83A 5HRAA 4JNCA 3G2HA 3PIIA 1SKBA 4P0TA 5FBLB 5A7GA 3VJRA 2PVPA 3PPWA 1ZH4A 3JVEA 3OIDA 1SKYE 1XP8A 3WNVA 2X1LA 4MHOA 3A6EA 1AZWA 3NORA 2GMWA 3HCPA 1WVMA 3VI4B 3W7AA 4EHFA 3W7BA 4KN6A 3C7TA 4QQKA 2Q4DA 3R3WA 1NVKA 1VYUA 3I6ZA 4QQFA 4RFSB 5GONB 1F7VA 3K09A 1SK8A 4KFSA 3PB3A 2VDQB 1AUXA 1VJ1A 5DBFA 2AG0A 2I2AA 1K3TA 1E1YA 1O5TA 1ADGA 2UZ1B 3QIVA 4X1KB 1I32A 4Q7KA 3Q0EA 4DR7B 3OU2A 1L7XA 3PC8A 1M6YA 4H6PA 1NUSA 3ZZMA 5EMKA 1H2YA 3HFSA 4UCWA 4D9NA 3BG5A 3PFNA 5FKJA 5CDUA 1MBZA 3LCCA 1NP3A 5E7QA 2BV3A 3FNEA 2OCDA 1PLKA 4WGFA 1AH2A 1RJWA 2WYWA 3N75A 1CUJA 3CEJA 1H6CA 4K9OA 4CEIB 4QGGA 4N3AA 1CFJA 4WTOA 2HU8A 2G83A 4I7EA 4MVXA 3RCBA 1HBJA 2YC4C 2IPOA 1ODJA 4NVRA 3OSUA 1IRIA 4CR7A 3ZK8A 5G0SA 2JNWA 4DEVA 4QT0A 1LQTA 1Q7EA 2GCOB 3R24A 5HM8A 3FN4A 4NYJR 2PRSA 1P0QA 4PYNA 1LC0A 2YMLA 4IFEA 3CRW1 4B8ZA 2DQKA 1QGOA 1OA0A 2QHXA 1WUIS 5E7IA 4D3XA 1YIDA 4WA7A 2JVJA 2FPXA 3E0XA 4TUYF 2PANA 3CUYA 3OA0A 3NM5A 3F98A 4GSYA 3NHUA 4RK7A 1G5HA 1W34A 2WI8A 2O2GA 4JR2A 1VFPA 4I9GA 4P8RA 3I5YA 4BO7A 2XUIA 2ZJZA 1E1LA 2PX6A 1XELA 4HFJA 2AEFA 3TRHA 4TMKA 4QECA 1JWLA 2GAFA 3H99A 2I80A 4TQ9A 2DUNA 4R51A 4KGZA 4BLQA 1N57A 2E49A 1U2PA 2Q2VA 4RK1A 3EISA 2W0SA 5K3SA 1KDVA 3QM1A 3R6GA 3ZGXA 4DGQA 2YJ5A 1YR7A 3EPHA 4P4UA 2H06A 2ZKIA 4KV7A 2ILTA 3UICA 2XCTB 4UXJA 3CUKA 2V59A 2VAWA 3GJ7A 4G9GA 2VZ9A 3CN9A 3U4IA 2WJ6A 4CGZA 5H3LA 3W9SA 3CC8A 5J47A 1FLNA 4BQNA 2MSNA 1VPTA 1F4PA 1MT3A 3VR0A 1N1EA 4XVHA 4S12A 4F04A 4FDLA 5BN5A 3KZMA 1IBKB 3V55A 2R1VA 3UANA 3QEJA 1ZRHA 4TMXA 4CM9A 4TXJA 1NKSA 4MVJD 1ZC3A 1PTKA 5EC8A 1UMCA 3T9CA 2P3LA 1FRVA 3A9UA 4P3KA 4DRYA 2X9QA 1NT2A 2WWIA 3F2VA 3QXGA 3JAKB 2RG1A 4P54A 3W2TA 2ZPAA 3AG6A 3MELA 1RHJA 3QEBZ 5ICCA 1BJTA 2EW1A 3I39X 2CXPA 1P3JA 4O2AA 1RKXA 1WULS 2WAYA 1ND6A 3FTPA 1NVVQ 3A1SA 4IW3B 4TYQA 4QASA 2Q6KA 5BV7A 4OKSA 4WOBA 3C3CA 1Q0SA 1C8LA 2NVWA 5EZYA 2IXFA 1G21A 2H85A 5CG1A 1P1JA 1K8XB 2IXBA 3PS9A 3VZBA 5FFMA 3P96A 1JG4A 3HJCA 1ZI8A 1XTRA 1IHDA 1PJ2A 2OUKA 3IR6A 3P9PA 4RVUA 2VZ8A 3A4VA 4JDPA 5D85A 2WMOB 3AB8A 4HG2A 3GP3A 4KUEA 1UANA 4PIMA 3V46A 4PCAA 4GP7A 3HGMA 1SM4A 2IK8A 3O8OA 2XLBA 5F51A 5SZHB 5JAZA 4Q0MA 1O9GA 3IEXA 3NKFA 4D45A 4D5EA 1WUHS 1FTNA 1EG2A 4NBRA 4ITRC 3U9LA 2UZIR 2XWJI 5KNDH 1MX5A 2H0AA 5ARCA 3ZDDA 1SVUA 1BMQA 2EFDB 2W11A 5IN4A 2EZUA 3NYWA 4KFTA 3AF3A 4LY9A 2ACVA 2XVXA 3H5OA 3LP6A 4JJKA 4R40A 4UNPA 1MQ9A 3EBPA 4XIFA 2YW2A 3HI4A 1EUCB 5FUYA 5B7NA 2OBLA 3HU2A 4BVHA 1SC1A 4CT4B 3PVZA 2GZHA 5A03A 4JC5A 5LNK6 3I73A 1TAUA 2DHCA 4NDNE 4BMZA 1DV2A 1JILA 2I22A 5BVGA 1P2FA 3NEYA 1FPQA 3L0YA 5HM6A 4QWMA 2DE0X 4R5HA 4QU9A 2VP4A 1MB0A 1GJRA 4WXMA 4AYWA 2B8TA 3EPLA 1GEGA 5IJ0B 3AETB 1THGA 3K0BA 4OY3A 3LO8A 1EDOA 1U0BB 3EASA 4G65A 3LSTA 3C7DB 1AE1A 4WUVA 2QVXX 3CEAA 5LOVB 1KAGA 3B5JA 2FN9A 2IVZA 2W6IA 3H86A 1GDHA 3PDCA 2J87A 3KJIA 1EB9A 2JCYA 3OPMA 2JI8A 5GVRA 3FOBA 5BSTA 5KNDA 3T5AA 4FOOA 2Q4TA 4M0DA 3CHYA 3QYJA 1EXMA 2J9ZB 4EYKA 1KJZA 3I45A 1T1RA 3H2YA 4TPKA 1GSOA 4FN5A 4XR9A 2NUTA 4PLZA 4BNJA 1L7MA 4I99A 4LJLA 3DEHA 5JXIA 4KPUA 1R5NA 1SBYA 1XTQA 5EHIA 1SD2A 4OI1A 4CE6A 5IS2A 2XD9A 3IMEA 1Z83A 2ISSD 1GOTA 3DZJA 4KBYA 5JQGF 1LCIA 1M2OB 1VLQA 2VRCA 1T29A 3IVRA 3KV3O 1UBMS 3N53A 3N9IA 1VMEA 4M1KA 4UM5A 4EZBA 5HUQA 3F1LA 4B82A 1W5EA 1C9YA 3F7OA 1ZNYA 2W8ZA 1RMYA 3CLKA 3F4LA 2HSGA 2FSHA 2XAAA 5FWXB 3T61A 4YJFB 1PFQA 3AFOA 3R44A 1SA0B 2FW9A 2FLWA 4EEKA 1JQBA 2PAAA 2XAUA 3BEDA 4GDMA 2YRWA 4MO2A 3RYTC 4A6DA 2VPYA 1KYXA 5CLQA 4UREA 2XD4A 4UHDA 1UBHS 2BW0A 5KTRA 1QYDA 4P22A 3K5WA 2X5NA 4IVRA 2GYVA 1LLQA 4QM6A 4E46A 4HDKB