5HK8A

Crystal strucutre of a methylesterase protein mes16 from arabidopsis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
251
structure length
236
Chain Sequence
VIHFVFVHGASHGAWCWYKLTTLLDAAGFKSTSVDLTGAGISLIDSNIVFDSDQYNRPLFSLLSDLPPHHKVILVGHSIGGGSVTEALCKFTDKISMAIYLAASMVQPGSIWEYTYGEGTDKPPTGVLMKPEFIRHYYYSQSPLEDVTLSSKLLRPAPMRAFQDLDKLPPNPEAEKVPRVYIKTAKDNLFDSVRQDLLVENWPPSQLYVLEDSDHSAFFSVPTTLFAYLLRAVSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal strucutre of a methylesterase protein MES16 from Arabidopsis
rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Probable pheophorbidase
total genus 79
structure length 236
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.82: Pheophorbidase.
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hk8A00
3OPMA 1QJ4A 5LZ5A 1QO7A 3PICA 3S8YA 4EY4A 1J06A 3H17A 4RE5A 2AJCA 1YASA 3HRHA 2XMDA 3AIKA 5FOQA 3DYVA 5EIAA 3D59A 1QIKA 4B85A 4J0IA 3QVMA 1GXSA 4OD0A 5CH3A 2CZQA 3DLTA 4KR0A 2W22A 5AKXA 1DWOA 1CRLA 1R50A 2XMSA 4HAIA 4YK7A 2RHWA 4G8CA 1LZKA 1NU6A 3X3HA 3DOIA 4ARAA 2X8BA 1IUNA 5EI5A 2BUCA 3AZPA 1QTIA 1JKMA 1Y7IA 2CBGA 3NGMA 4V2IA 6YASA 1W1IA 3B12A 2I03A 3WMRA 3H04A 1DQZA 4GLBA 4H7JA 4DYHA 1WB4A 1LNSA 1MJ5A 3RARA 1N1MA 2X5XA 4CI9A 5D7BA 3R3ZA 3ILSA 1EI9A 3RK4A 1QOZA 4G4JA 3IB3A 5CBKA 2PL5A 4QWMA 2XUGA 4HRXA 1P0MA 1XLUA 1K6EA 4NZZA 3E1GA 4UPDA 1YS2X 1AKNA 5CH8A 3R0VA 2PUJA 5CMLA 2RONA 1AQLA 1GQSA 4WY5A 2I78A 2VSQA 3BIWA 1DX6A 4WDQA 3A2LA 1UXOA 3WK4A 3FSGA 1L7QA 2PBLA 4HXGA 2AJBA 3WK5A 4ETWA 3NOXA 1QZ3A 2QJRA 5EIEA 2IIVA 1P0IA 1TKRA 2K2QB 3FWHA 3W06A 3HLKA 4X6YA 1BRTA 3HJUA 4Q1VA 5IVHA 4KE8A 3M81A 3WKCA 3T4UA 4FBLA 4PSDA 5A71A 3GZJA 3MVEA 4H7DA 1M33A 3STWA 3H18A 2JGKA 4PV7A 4BDSA 2HU8A 2VT7A 5HFNA 1ETHA 4N8SA 5CW2A 1XZBA 1ZJ4A 5DNWA 3C45A 1RWQA 4KEAA 1BN7A 3BIXA 4OU5A 4Y2TA 4G1FA 3OC0A 1VA5A 4G9GA 4EY6A 5JYCA 1ZI8A 3VJKA 3LCRA 5AKYA 4B80A 1WB6A 2UZ0A 3WYNA 1E8MA 5FPQA 1UK7A 1VE7A 5DYTA 3M3DA 2J4CA 4BBZA 1AC5A 3BL8A 4X3CA 2VT6A 4ZRDA 1XRNA 3I28A 2XUJA 1GQRA 2G63A 4MJ3A 4Y2VA 3WL8A 1ACJA 4J0CA 3WWDA 3BDIA 1ISPA 4WFJA 5ALVA 1KU0A 2WJ4A 1ZIYA 1MX5A 3FYTA 2ECFA 1C7IA 4OYYA 4Y2SA 4HZGA 2YH2A 4OUKX 3PUIA 5DLPA 3WZMA 3Q8WA 3QPAA 5I7UA 4QDTA 5HKAA 2C58A 4HXEB 3FYUB 1W75A 5K3DA 4P93A 2G5TA 4MYSA 2DFPA 3WA6A 4EY8A 4FNGA 3O4GA 4UBMA 4Y2JA 1ACLA 3WKAA 3IUQA 2BGRA 1QE3A 4CCWA 4CIAA 4EY7A 5ESRA 1L7RA 4CCYA 1XZLA 1YAJA 1E89A 3WKBA 4JUIA 5AM0A 2XUQA 1VZ3A 4IQ4A 4O08A 5HF8A 2XMGA 4B9EA 1NU8A 3OTQA 2OGZA 2VJDA 3WK8A 4CG2A 2V96A 2XMRA 2QKYA 3GFFA 4P9NA 4QA9A 2V9ZA 1XZDA 4KAJA 4A16A 1AMNA 2RHTA 2HM7A 5C8XA 1Y37A 4K6KA 2XMZA 4FDMA 1EK2A 5JAPA 3FSGD 2QT9A 3MGAA 4DLNA 3I2JA 5LYYA 2JGMA 5ALFA 1DWPA 4GWLA 2WIFA 1ZIXA 2VAXA 4MXDA 1Q0RA 4UHDA 2WJ6A 3H19A 5I8PA 3WK7A 2BAGA 5CT8A 1CUDA 1IMJA 5AKJA 3I2IA 1IZ8A 1LPAB 1WB5A 1UOPA 4UBKA 1MX1A 2XUAA 4Y2XA 1IUOA 3QH4A 1MT3A 3VXKA 5EIHA 3I2FA 2GBIA 3GUUA 1GZ7A 1F0PA 2DHCA 3PE6A 3VJLA 2C7BA 3PFBA 3B3QA 4BAGA 5LP1A 4H7IA 5BWCA 3C6YA 1WM1A 4XX1A 3LLCA 1H2ZA 2CB9A 2QUBA 5ALSA 1VZ2A 1LBSA 4BRSA 4Y2UA 4EA6A 3WWPA 1GPNA 4PSUA 4X7BA 4X91A 4C4YA 3EQ8A 1N5MA 3OOSA 2ZJFA 4LYEA 3ESAA 2OXEA 4BDTA 3I6YA 3TGLA 1HLGA 4E11A 3R41A 1XQWA 5A7GA 4N5IX 5AKZA 4Q82A 5BOVA 3C43A 3FLAA 5AIBA 2IITA 1CUGA 2VQ6A 1CR6A 4DMFA 2B4KA 2WFMA 2XQFA 4H0CA 3OURA 1RYYA 1YA4A 1WHSA 4J3JA 4BATA 1DTEA 4G4GA 3FLEA 2OG1A 2PUHA 1EDDA 4BC0A 1GKKA 1A8SA 2RI6A 4LXHA 1CUEA 5AKLA 2JEYA 1UKCA 1XZHA 4FLFA 4M0FA 4UHFA 1EK1A 3L1JA 3H2IA 4Y2QA 5CXXA 1ZI9A 3HI4A 5K3CA 1J2EA 4C01A 3BDVA 2WILA 4BVKA 3FVRA 2GBFA 3FVTA 1K63A 3GROA 4ROTA 2WQZA 1HKHA 4PSCA 4QLAA 1TQHA 4X93A 2CJPA 1WCYA 4W1RA 5ALWA 4K6GA 2WG2A 1O6FA 1Z68A 4AQDA 4X85A 3G0GA 1WHTA 3Q0TA 1QO9A 2CMFA 3IIIA 3R3UA 5KWJA 3E0XA 4BZZA 3ZI7A 4QNNA 1UKBA 2QVBA 4OSEA 1UOOA 1XZCA 1E8NA 2QM0A 3L1HA 1JJFA 1N8SA 1XRRA 2J3QA 3DKKA 4GXNA 3WIBA 2BCEA 3I1YA 3G9TA 1T4MA 5K3FA 1SCKA 5CRIA 4B9AA 3W05A 3T52A 1ODTC 2VJCA 2XUHA 3DD5A 3ZLVA 4UBOA 3D5EA 1ZGCA 3QMWA 4WJLA 1MO2A 1EDBA 4I19A 4J0DA 3DKRA 1VXOA 4LIPD 1U2EA 3QZUA 4IHAA 1JMKC 4J0JA 1R4ZA 3TEJA 3U1TA 4AO8A 5HF5A 4DIUA 3ED1A 4H18A 1QIGA 5AJHA 5ALUA 1E8DA 2O7RA 4J03A 2WJ3A 2Q0XA 5ALRA 3R3VA 4K6HA 1U65A 4NS4A 4U2BA 5A6VA 3F98A 3O4JA 4AMYA 3QPCA 5CH5A 2Y2UA 3DDUA 5ALTA 2JGLA 4EBBA 4A5SA 4JH0A 5LZ9A 5ALIA 5DJ5A 3JW8A 3EBLA 1XZGA 4KRXA 1FFAA 1UFOA 2WHPB 4ZREA 3K6KA 3AINA 3V1KA 1MNAA 4IH9A 4EUSA 2PX6A 4MWSA 1G66A 1THGA 2H1IA 4QDZA 2O7VA 3IUMA 3C5VA 3D2CA 4J0KA 1CUXA 1PFQA 3STTA 2HA7A 4NVRA 1TCAA 5BWBA 1XKTA 1F6WA 1O6GA 4KJXA 1CEXA 1UKAA 2XQKA 4BAZA 1TK3A 4AO7A 2P8SA 4AN0A 1W76A 3AIOA 2XB6A 4UHEA 1YA8A 5AK6A 3F8SA 5T4BA 1UK9A 3O4HA 3WKDA 1KU6A 5DTJA 4H77A 4BB0A 1QIFA 1XZKA 5ALLA 2JGEA 3RKSA 1BN6A 2DCMA 3WWEA 4X6XA 2ZJ7A 3AILA 2Y6VA 2H7CA 4GI1A 3OG9A 5JAOA 4EHBA 3R3XA 1AX9A 1K5PA 5LKRA 2WKWA 3HC7A 1TRHA 3BWXA 3WA7A 3ESBA 3O9MA 4KACA 3W2TA 1CUSA 2D0DA 4PNZA 3EIOA 5AM3A 4BCBA 5AKHA 1N5RA 2PSHA 2D5LA 2EEPA 7YASA 1ODCA 2O2HA 2ZJ6A 4A23A 4BVLA 3DS8A 3F97A 1AZWA 3AZQA 5FP0A 4B7ZA 2PPLA 5K3FB 4TGLA 3NWOA 2WSLA 5ALZA 4XVCA 2RGUA 5FPPA 1ZD4A 4KAFA 1XRLA 3PF8A 3IDAA 4RNCA 4ARBA 1UZAA 3D4LA 2BUAA 3C6ZA 1BCRA 3I2KA 1BU8A 2ZYHA 2PKYX 1Q83A 5CT6A 4FOLA 4UHBA 2FX5A 4W63A 1DQYA 2HU5A 1YCDA 1YSCA 5DNVA 4DNFA 3KD2A 1EX9A 5AK4A 5C7YA 2PM8A 3ESDA 4DNQA 4WFKA 3ZV7A 5AO9A 3FYUA 4TPKA 1EINA 2XLCA 3QBJA 3WK6A 3IA2A 2FJPA 1PJAA 2PSJA 3G0BA 3N0TA 1OILA 2XUPA 2WU4A 4OU4A 3WYDA 1XFDA 4UBLA 2HA4A 4PQEA 4AZ3A 5A2GA 5LKAA 3H2JA 1FFEA 5LZ2A 2XQJA 3IURA 4N5HX 4LKOA 5ALXA 1E5TA 4U2CA 1R88A 5DYYA 3AUKA 4YASA 1MN6A 3SK0A 3N2ZB 2FUKA 3I2HA 5JATA 1XLWA 3KXPA 5IH7A 2Z3WA 2H9YA 3V48A 1CUAA 1SCQA 3VVMA 2WIGA 1MU0A 4X97A 3RLIA 4IH4A 4HS9A 5CT5A 1ORVA 1OXMA 2E3JA 3SC2A 3QMVA 4YX9A 1JMYA 2JGFA 4E15A 3LIPA 3BJRA 1R9NA 3VISA 2AJDA 4PW0A 1CVLA 2WIKA 4B0PA 1DWQA 4GW3A 1LPNA 3C6XA 3GBSA 4MYDA 4B82A 3U0VA 4H7KA 3HYSA 1BEEA 4OB8A 4CCYB 1MNQA 3UMJA 4UFPA 2PU7A 4ZGBA 1H2WA 3EF3A 2GBGA 4D9JA 2R8BA 5J3JA 1G4HA 4QE3A 3W9BA 5AOBA 1W4LA 2DQYA 2PSFA 2ORYA 4U2DA 4MQLA 2WIJA 2OCGA 4H35A 4DTCA 3G0DA 4UHCA 1CUJA 4K5QA 1ODSA 2Y1KA 1CIJA 2PSDA 4GHWA 3HSSA 4OCZA 1XZEA 4QWWA 5IVDA 4LXIA 3TJMA 4DSAA 5BV7A 5AM1A 3G7NA 4S0XA 5DWDA 5AKKA 1CUFA 1EHYA 2HU7A 1IVYA 5JANA 3BE8A 3VKFA 4G8DA 5ALPA 3E3AA 3BXPA 3K9BA 4NMWA 3C8HA 1QIHA 1XRMA 3HABA 4HRYA 4Q3KA 4B84A 2VTVA 5E2IA 4B83A 2WM2A 3H2KA 4G8BA 2HADA 3KWJA 2WHPA 1OCEA 4KRYA 4AB1A 2WLSA 4W9RA 3FNBA 1EB8A 2OQIA 5ISMA 1S8OA 2WUDA 2I3DA 1CUBA 3KSRA 1WPXA 3STUA 3V1MA 4Y7DA 5ALYA 1ORWA 3BJMA 2YYSA 4G5XA 5LIPA 1XZIA 5ALOA 2WTNA 2XUOA 2QXTA 4FLEA 1K8QA 2ZVDA 2Z5GA 5JALA 2VATA 4GEGA 1XZJA 4Y2YA 2DSNA 4AMZA 1CUYA 4AO6A 3M83A 5A7FA 3EQ7A 1R9MA 5EHQA 2QMQA 4OPMA 3D0KA 1YS1X 3C70A 4FTWA 5AI5A 4C4XA 1QONA 1BEZA 3R40A 3CN7A 3F67A 3STVA 1HQDA 4BZWA 2WUFA 5EHZA 5IVIA 4ZXFA 3ANSA 2OGTA 2WFLB 2V97A 5JADA 5CTAA 1XZAA 1G42A 1X70A 3HZOA 3G02A 5CT9A 1ZGBA 4PF1A 1P0PA 2OAEA 3H1BA 1GT6A 1HDEA 1XZFA 5HQ3B 1LPPA 4MQMA 4C87A 5AIAA 3HXKA 4JEIA 5EHNA 1UK8A 2J4FA 2WU3A 1VE6A 5HQ3A 4J0GA 1QTRA 3DOHA 1KEZA 4WCVA 2XMBA 4ZI5A 1DT3A 1H22A 2BUBA 4X6UA 3G9UA 1G5FA 2BGNA 1UOQA 3JYHA 2DHDA 2O2IA 1ZICA 1VA4A 4WDRA 4CG3A 1H2XA 5E4JA 1XKLA 4QDUA 1UWCA 4DMHA 4DNPA 1CUHA 1A7UA 5AKIA 5DTIA 4UHHA 2GYWA 2HFJA 5IVKA 3CCBA 1VLQA 3D2BA 3O0DA 1L7AA 4E46A 5K3AA 3STYA 4CIBA 2C0PA 3O95A 4DMKA 3ZPXA 1AGYA 2CUTA 4FFVA 3QM1A 5FKJA 3F9CA 4HTAA 3ANTA 1GKLA 2WTMA 5C8ZA 1YB7A 5JZ9A 1CV2A 1JT2A 1QFMA 2OCIA 1QIJA 3DL4A 4Q34A 5FRDA 3DCNA 4BC1A 3WQHA 1J07A 5AK5A 3FAKA 4QDOA 3AJAA 3ESCA 4UBNA 1EXWA 3WI7A 1FFBA 3AIMA 3WLAA 4KAAA 5D3KA 2IX9A 4F21A 2OQVA 1QIMA 5ALEA 1FFCA 1ZD2P 1SOMA 1MAAA 2AJ8A 4J7AA 4Q3LA 4DNOA 3QPDA 3LP5A 1XQYA 2HFKA 4AX4A 1VXRA 5LLSA 3G9XA 1MAHA 1CUWA 2QTBA 4ZWNA 4BTVA 4KE9A 5FLKA 3G8YA 4F60A 1QIIA 5JIBA 4BE9A 5AKGA 5T4FA 5JD5A 5EFZA 1TCCA 3H2GA 5T4EA 1ZOIA 3H0CA 3IULA 2CKMA 5HK9A 3WL5A 4FHZA 1U4NA 5HCUA 4BTLA 2HRQA 4KE6A 1I6WA 5AHXA 1J1IA 2XUIA 1AURA 3WK9A 4QDXA 4H7EA 1CQWA 2C5FA 2HDWA 3KOOA 1C7JA 2BJHA 4JYPA 5CXUA 5DNUA 3WWOA 3A2MA 2B9VA 1QLWA 4YPVA 1VOTA 5HFAA 2ZSIA 3C5WP 3CXUA 5AP9A 2GYUA 4X92A 2YXPX 3ZWQA 1DU4A 1ZI6A 4HXFB 5AI0A 4GECA 2Y2VA 1ZD5A 1LBTA 3GELA 1BE0A 2X76A 5AI4A 3DJYA 1BS9A 2G5PA 3JWEA 1CUVA 1MTZA 4OB6A 2W6CX 1T2NA 2VA9A 5E4TA 2Z8ZA 4Y2RA 3IVMA 5JD6A 1E3QA 5KWIA 5ALQA 4IH1A 3IUJA 1EH5A 4INZA 1Y7HA 1W6RA 2HRRA 5ALKA 2HA3A 1CQZA 1JJBA 3BF7A 2OLEA 4P08A 5HK8A 1A8UA 2OGSA 4M0EA 4QEKA 2RAUA 5F4ZA 3DQZA 2HHAA 1B6GA 3I6ZA 2HA6A 3LIIA 1QGED 2XMCA 5AM4A 4X90A 4LYDA 3SX4A 5E4YA 3VJMA 1FJ2A 3R3YA 2CEKA 2WG1A 3QITA 1EDEA 2QZPA 1ZD3A 5SYNA 3C8DA 3L1IA 2EDCA 2WFZA 5AH0A 5AI9A 2J3DA 2WFLA 4DSZA 4I3FA 3LS2A 2ZYSA 1C4XA 2XQGA 2XT0A 3G0IA 1HPLA 5H3HA 4Z49A 1FSSA 1VJ5A 1EA5A 3YASA 3DYIA 4BP8A 1GPKA 2V98A 2B61A 4BCDA 5D6OA 4X94A 1ZJ5A 3EQ9A 5JZBA 4RE6A 5KBYA 1CUIA 5AI8A 1DINA 1F0NA 3WJ2A 3A6ZA 3BF8A 4C88A 4DM7A 2JBWA 2VF2A 1CUCA 1X2BA 4H7HA 2BKLA 4U2FA 1IZ7A 2DHEA 2QS9A 2B20A 2HA0A 3PI6A 3V1LA 5ALMA 5HKBA 2PU5A 5C8VA 5FV4A 4FWBA 3MUNA 4MEBA 3AZOA 2ZSHA 1LPMA 1A88A 4F0JA 1LPSA 2GYVA 2WG0A 1TCBA 3MUOA 3C87A 1H2YA 4AZ0A 5FXMA 1WOMA 1F8UA 1BROA 2DR0A 2RIPA 4FFWA 2PSEA 2Z8XA 3F96A 3ZLUA 1JI3A 2OCKA 5A62A 2GBCA 1W52X 2ROQA 4J0HA 5SYMA 2XI4A 3O4IA 4PO3X 1AUOA 1HL7A 3KWFA 4N8DA 1UT6A 5AKEA 1EVQA 4E14A 1R3DA 2JGJA 2VEOA 4HVTA 1QIDA 2QR5A 4U2GA 3TRDA 5JASA 1LLFA 2HIHA 4L72A 4W1SA 2NW6A 1LPOA 3FOBA 5FUMA 4BAUA 4XIIA 2LIPA 4AN1A 2C0QA 4Y9SA 3S2ZA 2BFNA 3UUEA 1YR2A 4WY8A 1CFJA 3SWWA 4X00A 3D7RA 4F5ZA 3HEAA 4FKBA 3OM8A 3FBWA 4IO0A 1RP1A 4AXBA 3I2GA 5LZ7A 5EGNA 1VKHA 4FMPA 1GGVA 4G4IA 4ITVA 3R3WA 1DT5A 1Q0ZA 1UK6A 2VJAA 3VVLA 2GZRA 4M0MA 4BRZA 4LXGA 5ALJA 5AI6A 1B41A 2AXEA 3QMMA 4MWTA 4OYLA 4GDMA 3ZLTA 3D3NA 4B6GA 1U8EA 3ICVA 2WUEA 2FJ0A 1X2EA 5EHXA 1TIBA 1MPXA 4UUQA 4UBJA 4P92A 4Q3OA 2XE4A 4C89A 3IBTA 3PF9A 3UUFA 4L0CA 1E66A 2QRUA 1XRQA 1FFDA 4RPCA 3IUNA 3E4DA 5AK3A 5LZ8A 3I1IA 1A8QA 2WUGA 1R1DA 2HA2A 1USWA 2EDAA 2H7XA 1XRPA 3A70A 1LPBB 2JGIA 3HACA 4X71A 4H7FA 1XQXA 1CLEA 1CUZA 5ALHA 5A7HA 1JFRA 4EZIA 4XWGA 3AFIA 2AJLI 3STXA 2ACEA 1LZLA 3PDCA 3WZLA 4EB0A 2XUDA 5I9IA 1IUPA 2Z3ZA 5C81A 1SCIA 5K3EA 2VAVA 1H23A 5KREA 1P0QA 4G9EA 5CT4A 4X95A 3PFCA 3DNMA 2O2GA 3I6MA 1PV1A 4B0OA 2C4HA 2ACKA 4ZV9A 3KDAA 5DYWA 1BCSA 3CN9A 5JZSA 3PUHA 2VJBA 4W1PA 5ALNA 3G0CA 3WL6A 2XMQA 4KE7A 3B5EA 2GZSA 5AOAA 4BVJA 3FLBA 4RGYA 1XQVA 2H7YA 4C4ZA 1HBJA 3GA7A 2HL6A 2Y6UA 3FCXA 4CG1A 5JD4A 4QLOA 5HZGA 1DX4A 2HA5A 2JEZA 4BCCA 3DL7A 4L9AA 4FLMA 3A2NA 2XDWA 1EB9A 5K3BA 5AICA 4XJVA 4DGQA 3WKEA 1GPLA 5HF9A 4UBIA 4ZV7A 2JIDA 2G4LA 4LHEA 1Q84A 3V1NA 4Y2PA 4U2EA 5AM2A 4CFSA 1XLVA 1QIEA 2XQIA 2ZYRA 1QFSA 2XUKA 4KYVA 2QUAA 2ONCA 2DQZA 4MEAA 3FYUC 4UFOA 4L3WA 3K2IA 3DEAA 3C6BA 4BP9A 5HF6A 5ALGA 5T4HA 1K4YA 3WJ1A 4FNMA 5FDFA 4B81A 4I4CA 1SFRA 2XLBA 3ICWA 2QOEA 1EVEA 2PVSA 3H2HA 1SC9A 1TAHA 4WFIA 5K5EA 1CPYA 3W9UA 3WWCA 4EY5A 4BE4A 3M82A 3O9VA 3FCYA 3H1AA 3G9ZA 4N8EA 4JNCA 2YASA 5JAUA 1JU4A 1JU3A 4FBMA 4JYMA 5JAHA 2QJWA 5IKXA 3WL7A 2WHQA 4TVKA 1XROA 1MX9A 3W04A 3VDXA 5YASA 3CCCA 5CURA 2OCLA 3RM3A 2I3ZA 2C5GA 2ES4A 1CUUA 2JF0A 5AM5A 2XUFA 2WIDA 4Q05A 4OB7A 4K2AA 4C6HA 3P2MA 1XZMA 1WPRA 2WHRA 5ALDA 2ZYIA 3WIOA 4UFNA 3V9AA 5LZ4A 4DMCA 1THTA 4W1QA 1YB6A 3QYJA 5D3ZA 2QXUA 1D07A 1LGYA 1JJIA 3NUZA 1NX9A 2OAGA 4BYMA 3D2AA 1YAHA 5AOCA 2OPHA 5JARA 4QZVA 2R11A 4GBGA
chains in the Genus database with same CATH superfamily
3OPMA 1ZNWA 2IWRA 3EGDA 1GG2A 4EFLA 3AY6A 3I39X 1GAEO 1NBIA 1S4QA 3PICA 2Y1WA 3AEYA 3EXHC 4YN3A 4YRSA 2K4MA 1ZRNA 4O0LA 5TPZA 1J06A 3CLUD 4I8DA 3D8RA 2AJCA 4OBXA 4KIGA 4IVRA 3NHUA 1RBQA 1PEKE 3BMQB 3BPSA 3DPSA 4MV0A 4X54A 3AIKA 4Q16A 1Y9AA 3RI3A 4CIVA 3AR8A 1DKPA 1LWOA 2GBPA 2RHCA 4Z9AA 3FTNA 1FMJA 1I6MA 1WSWA 3V4RA 3MJTA 2FW0A 3HR7A 4NABA 5F3RA 2YIVX 1ECLA 1T0BA 2KB0A 2G7ZA 3SHFA 4L02A 2ZIGA 1LB1B 4BLVA 3UC5A 1S3IA 1EJ2A 1H8EA 1SIOA 4M87A 5CH3A 1V1RA 4MR8B 5I3CA 4JXXA 4FC7A 4C6RA 1MUUA 2PKRA 2R751 1MRNA 3MRVA 1MQSA 1DXQA 3CKMA 1R50A 2XMSA 1A0OA 3E8XA 3OEED 1B73A 1XP5A 3NVDA 2RHWA 3I4CA 2Z9BA 2R62A 3DP9A 5JMTA 3U37A 3ME5A 3D54D 3DOIA 3D6TB 1B0AA 4G5SA 3U56A 4INAA 3GQBB 2LCFA 3EC7A 1N2JA 3DV2A 3NHKA 5EI5A 1C9KA 3DMTA 2O4CA 2Q5HA 3FIJA 4B8YA 2CLKB 4C43A 3DE5X 1N8NA 1NKTA 3AM5A 5EMLA 3OTGA 6YASA 3KSAC 3EE6A 3PJDA 1GCUA 1NQOA 5KVCA 4FMDF 5CLGA 3ROEA 4XPIB 2EJCA 3A6LA 1ECPA 3WMRA 1B1AA 3GLSA 4XB1A 4TUYB 4ZO7A 4I8IA 2G9RA 1B3BA 1DQZA 2EFHB 3VR3D 2ETXA 2PYIA 3R0IA 4KX3A 3KYBA 2NZXA 2VO1A 1XHLA 4H7JA 5HIMA 4EPVA 3FKSA 1ZH4A 4ENVA 1DBPA 5JPCA 1TJPB 5FNVF 1LNSA 5JZVA 2OVFA 4L15A 1N1MA 4MWBA 1PS8A 2F43A 4ZCRA 1AZSC 1PWHA 1VE3A 4CQMA 2GXUA 3U7GA 3G82C 3GIDA 2ZJ8A 4LDAA 4BWVA 4BGVA 2JFHA 2O8CB 4KDEA 3D1LA 1QOZA 1G5PA 2YV1A 3SX0A 2PL5A 1RJWA 4QWMA 1QRAA 7GPBA 4JLBA 3OZUA 1XLUA 2FPGA 4URWR 3FPJA 2GPWA 1GZ3A 2OZLA 1Z5NA 4J76A 1DBQA 1BWPA 2Q8NA 3OZWA 4TTIA 1AKNA 1Y5MA 8ATCA 2OXRA 3KAQA 5K4GA 1PRYA 2VSQA 3BIWA 3AF1A 4JR1A 1A2OA 3GG2A 2QSJA 1IZZA 4JCCA 1T15A 1VG1A 3A2LA 3M49A 2I6XA 6CHYA 2VP0A 1NX6A 3FSGA 3I6IA 2PBLA 3QVJA 1KE2A 4BMPB 1EVYA 4E21A 5ITZA 2AUTA 2XBUA 1QP4A 4XDZA 3TJZA 3QA3E 4DM4A 2YOGA 3GFOA 2QIOA 3JD4A 2O48X 1YT5A 4ETWA 3GP5A 1F2UB 5EIEA 3DMRA 2IIVA 1TKRA 2K2QB 2VDRB 3L7NA 3T5AA 1T1RA 1A4UA 2TMGA 4TLMB 3IBYA 3KB1A 3QE2A 1V2GA 5DCUA 5DM2A 5IU6A 1JHVA 1TZKA 4ASUA 5LP6F 2QPLA 4HG2A 4X6YA 1IAVA 2M2IA 5TY0A 4B43A 1FTGA 1MH9A 1L9XA 2H0RA 2P69A 5LQSA 4YRFA 3J7AC 1HV8A 4OJQA 1INLA 4JJZA 3WKCA 8LDHA 1R8QA 3QKSA 4IWXA 3T4UA 3OT1A 2VP9A 5KYUB 2OKGA 4A26A 3HBJA 1GAQA 3TCNA 2PZ8A 5I6DA 3O75A 4M55A 5I4KA 1LH0A 2JZOA 4RZUA 3AR2A 4JBXA 5C35A 3MJ4A 3CX8A 3FYHA 1W30A 2F1IA 3PGJA 4FQ5A 2GBLC 5BNZA 1W59A 1G5QA 3FOWA 3F4LA 3GU3A 1KYQA 3ZHXA 5C5IA 1VCIA 1GCIA 1HFWA 3MUEA 3H18A 4RF5A 2FSSA 1OROA 2YRXA 3HHPA 4EA9A 2BGLA 5E38A 4CFZA 1O54A 3GJXC 5HFNA 4E31A 1X7WA 4MJLA 5BQOA 3LOPA 1CCWA 1OSNA 1TEXA 4IIJB 3FGNA 3O7MA 1S6YA 1VG0B 2A9KA 3NG1A 1LBIA 1CJTC 2OD9A 4RY8A 5BN1A 3B7PA 4K0KB 4YJHB 2VF8A 2EU8A 4WNAA 3FNFA 3SJBA 5IM4F 2ASEA 3HM2A 3OC0A 4Y2TA 3DDNA 2JAXA 5JISA 3IO3A 4K1XA 3R0JA 2QX6A 1MDBA 3K53A 1LRLA 4PBTA 1QRRA 4HEA1 2AFHB 2PTHA 4A03A 3LCRA 4C03A 2P9HA 3ZK7A 4IGFA 4C3OB 2PNFA 2Q4DA 4R1NA 5D87A 2FX3A 4OLAA 1DBWA 1FNSA 4N7MA 4V0ME 5BVGB 4ZODA 4UZSA 2L69A 3PC4A 3UVEA 3M3HA 3RHSA 3IEPA 3DH0A 5GONA 5JEEA 2E4ZA 2RI0A 1X8XA 1WU7A 1M7GA 3TRIA 1OZGA 2JEOA 3KTFA 2FH5B 1HDGO 1VE7A 2OILA 2P0EA 3PDIB 3Q2OA 4QTUB 5DGDA 1XTPA 4AG5A 5AUOB 5CB4B 3UK6A 4C04A 3S0JA 2HC9A 3FMPB 3HBLA 4ZK2A 2WM3A 2IYAA 2D1YA 3BL8A 1I5OA 2WW8A 3O8OA 4G1BA 4JLDA 4Q9AA 2PO7A 4YLGA 4HQNA 5KKNB 2ZRNA 5CNKA 1RRVA 1W5FA 3PYLA 4NG5A 4KFSA 4L78A 3FW1A 3I28A 4OV6B 4E32A 1CZNA 2IXEA 2JBHA 1YC5A 1GQRA 3EVCA 3FNIA 2AK2A 4EGAA 2Q9AA 5JSHA 1EZ1A 4NOJA 3WL8A 1Z08A 4OHUA 3RSQA 1UMKA 4DUYB 1ZGGA 1A77A 4TS4A 3C6QA 3UO8B 4D9FA 3W79A 1HDCA 4J0CA 1SBZA 5J40A 2J7PD 2PH1A 3WTCA 4F2WA 1GTVA 4CF7A 1M6NA 2NTJA 3BDIA 2BTQB 1GJRA 1ISPA 3DC7A 3DLCA 3EB9A 4TQ9A 1JHZA 3GEMA 4ZU3A 3WBKA 5CJPA 3ZWDA 4P35A 1Z0DA 5TQVA 5ALVA 4ZCMA 1V71A 3G1UA 2DULA 4UAGA 1U28C 4XUCA 1C1XB 4HQRA 1MX5A 1YBMA 5C8DA 2RGXA 4MVJI 4OQ4A 1UXKA 4YAEA 2ECFA 1SM4A 4EHJA 4I81A 3AFNA 4KGDA 4Y2SA 5CEEA 4Q1CA 4IX9A 1L7EA 2ANBA 3HZRA 4ZEOA 5BURA 4EGSA 1KFEB 2J9ZB 1J5PA 4W6QA 5BMOA 1Z2CA 4JI0B 2O0LA 3E27A 1KHHA 2BFCB 2VDUE 2G28A 3DTTA 3G79A 4IQFA 4MP8A 1FDOA 5DLPA 2YHAA 5IHXA 2BGIA 3ZCRA 2Z4SA 4TX1A 3ZCQA 1QQ5A 4XJSA 1WZEA 2GAAA 1HZZC 5HE8A 3S27A 2I80A 3I6BA 3U3KA 4JASB 3WGGA 1H6BA 3ZGVA 1MVLA 1U4SA 3WY9A 5IJ0A 1Z7GA 3FYUB 4K86A 2XW6A 3N5CA 1GTMA 2ZQYA 4PZAA 1ZGHA 4QUAA 3UOAB 1YZFA 4RTOA 1M72A 2XD4A 3KJGA 4O4JF 5COQA 4BNDB 4TTQA 5KNDD 1E0KA 2CXPA 2G5TA 3C0KA 1TM1E 2P9EA 1TZ2A 2BSAA 1TQ2A 2DFPA 3N3AC 4V0LA 3UAXA 3HVKA 1D1PA 5T8KA 1WXEA 1ORTA 2F8SA 1D0IA 3JQPA 5BUCA 4GMDA 4DCNA 3IUQA 4O1MA 1U0FA 2C9OA 1J70A 2LBPA 3COZA 3THOA 4G8JA 1YVUA 1QE3A 2CBZA 3P45A 3Q9NA 4H15A 1WXFA 4EY7A 4G5RA 3I9LA 4PQRA 4DXDA 5TXGA 1W36D 1IWBB 3A6HA 2OK8A 4CHGA 1Y33E 1L7RA 4NU8X 3AEKA 2BM1A 1P18A 3NETA 1GA6A 3A9UA 1A27A 2XZOA 1RWNA 3NTLA 5AM0A 2B8EA 2H17A 3D6MA 3UCXA 4KVAA 2EJUA 3K20A 4XOUA 5BR1A 2AD1A 2OE2A 4UCFA 5HF8A 1EUZA 2AGVA 4HDNB 3OTQA 2JARA 3ORRA 5FBHA 3OUTA 3H5NA 5G0VA 3TQTA 3T9BA 2JDIA 5JQGF 4AT1A 4MDEA 4OSPA 4CG2A 3HUDA 3K1AA 2NNLD 3EIEA 2XMRA 4RK7A 1MDFA 1WXXA 2OO3A 2QKYA 3LVBA 1E7SA 3FUVA 3H5LA 3IXLA 2X0EA 3ZZUA 3RC8A 1XZDA 3DO8A 1KGDA 3UY4A 4GD3Q 5HIKA 1CY0A 1QG4A 2D54A 4EYKA 1G7SA 1O6BA 4NJOA 4DT1B 2O7SA 1XNHA 1NMQA 2KSQA 2YJ3A 2VOEA 3MGAA 4YUXA 4GWGA 2C83A 2Z2YA 2F67A 3KQYA 3PGKA 4YRZA 5JMOA 1YVPA 4TQGA 4EFDA 2POQX 1VL6A 2ZTLA 5ALFA 5AUNB 1Y4UA 2F3UA 2XYVA 1U2SA 3LX5A 4WZBA 3TBHA 5BY2A 2FFBA 4CKBA 1Y5NA 3BFVA 1VDZA 4ZYTA 2C82A 3WRYA 2FLKA 3GJZA 3GNTA 2FKNA 2NUAA 1BHQ1 1W4CA 2FHSA 3E4CA 3JALB 2B5VA 2HTEA 2I2BA 3OPNA 3QPVA 5AVUA 2G72A 3OP1A 4MIOA 4P7GA 1UWKA 2WIBA 5FI1B 4UU1A 3TLZA 2X0FA 2B0JA 3JQ6A 1HNNA 3EF1A 4RENA 3UJAA 2VDWA 5I8PA 4YR7A 1U31A 4PRKA 3HCDA 1SC1A 2G88A 2VJQA 1IMJA 3KKQA 3E3LA 4GPEA 4OYRA 1GZVA 1S8FA 2YN0A 5ELXA 3PJEA 3LWNA 5AXCA 5AW0A 3ETCA 4UE3S 1J2JA 2CMDA 3NYRA 1FS5A 3FUUA 4HUQB 4CCAA 1Z0SA 1AS2A 2FSFA 1DRWA 4OQPA 4BIMA 3I9OA 5FOXA 2O23A 1FFYA 1CJMA 1IUOA 5F98A 5I9TA 2YKGA 2EW1A 3DHYA 2AI3A 2VYQA 5ELMA 4AJKA 1E1YA 3K9GA 4Z4QA 4RX1A 1ZP6A 3MW8A 1NLYA 1D04A 3CT6A 4BQEA 4PTLA 4BP1A 1YR7A 1MO3A 2XZPA 4CJXA 3QXXA 1HYBA 3PE6A 3V7UA 1RXYA 3VJLA 4MUFA 2OO7A 4Z86A 3RUAA 1ZMRA 3M0EA 4AKIA 1HG1A 4H7IA 4EQ6B 1VYTA 2GUWA 2JCVA 4LUCA 3U80A 2BYTA 1BQEA 3OSUA 3IDZA 3PI7A 1KEUA 4X60A 2R6ZA 2CB9A 2XB4A 4HX9A 2WWFA 4L0MA 1MENA 1BE8A 4MDYA 3H9JA 1NUSA 3K9CA 4BRSA 1TOAA 1LBQA 2DBVO 3HRIA 2ZI5A 2FDRA 4OBWA 1D7OA 3WRXA 4D8VA 4UTNA 4E4TA 5CLIA 1PR4A 2B35A 721PA 2FOIA 4DWWA 4PLYA 4KRFA 1KC1A 2CLMB 4Q9LA 4M8IA 2XCRB 1N5MA 1X7GA 1UBNA 4NBLA 3ZU6A 4LYEA 5LBTA 1B15A 1U5BB 3VYRB 3U4QA 1MC5A 1DB3A 3BFXA 5C9ZA 2CHUA 2FUG6 2OXEA 1XIVA 1RE1A 2QUKA 3AEUB 3CRVA 1Y3CE 3I6YA 1I4LD 4C6TB 3E7DA 4OFBA 3U4DA 3L8FA 1YC2A 4G0WA 1Z25A 1FP7A 2I8CA 2ETVA 4HWGA 1MAWA 4IW3B 3TO5A 3WB0A 1NF2A 4ALNA 1N3LA 5DHSA 5KYKA 4DWOA 2OM6A 3FLAA 1JFLA 1XTQA 4NOKA 5GGXA 3ROPA 4B5LA 1CUGA 3WADA 4C4OA 4D99A 4F6RB 4DUZB 2H4XA 3D8HA 2CF5A 3MOGA 4JITA 4L8YA 4RD2A 4L4RA 2B4KA 4M1SA 5FUWA 2WJYA 2PYDA 1GV0A 2MR6A 4IDOA 1AB5A 4KPFC 3U3XA 2DR3A 1JLHA 1VIDA 3AF3A 1RYYA 3NOQA 3OURA 2XTZA 1YA4A 3L0CA 1ZNZA 2ZCUA 3VH2A 3COVA 3FTQA 2JKZA 3ZDBA 1RAEA 1XCLA 3MSXA 4J3JA 4UASA 4BATA 2IVZA 4I5IA 4BNGA 4IMRA 2AHOA 3T5PA 1J2RA 2XECA 2PMEA 2QZZA 4GOLD 4DYDA 3LQYA 2WF5A 1ZUD1 3FPAA 4R8MA 5FUBA 1N2ZA 1NG1A 2ZUVA 4QQ8A 3GO4A 2PNJA 4OJKA 5LQMA 4HGYA 2OG1A 2XDQA 1KVQA 2OV8A 1IM2A 1TF5A 1S2OA 3KZXA 1PTKA 3W34A 3I01A 3ZWYA 5FWXB 1GKKA 2QD5A 5GIOE 1ND6A 3ZHCA 2VUIB 1QVWA 3QF4A 3ZHBA 4QJ3A 1KVUA 2IZ0A 3DFFA 3P9YA 2QI9F 2QG9A 3TNYA 3GXBA 1CK4A 4B34A 1YKSA 3TR6A 3JZIA 3CB4A 4UNNA 1Z17A 2YRWA 4D0GA 2IPMA 2WZCA 4GZMA 3W2EA 1UT8A 2DUJA 1UBLS 1T5LA 4YP9A 4MW5A 3IDOA 3K6SB 2AXPA 4E09A 5FWNA 4GQBA 4BFTA 2DERA 1K5GA 4HQ6A 2BKUA 5JFTA 1VLHA 1OLXA 1OB2A 2XDYA 3PQCA 3HCEA 3E2PA 3TD2A 3NAZA 1T9KA 4IVQA 1JECA 3FVTA 4JSTA 2J07A 3D9QX 3UAOA 1D2MA 1JAXA 1T1EA 4EB6B 3KTAA 4G5QA 1D1SA 3GRVA 4JC4A 1BGWA 2WQZA 1ZFNA 3HE3A 1MA0A 3NGLA 1DPFA 4RESA 4F12A 1PYOA 1S0UA 2Q2OA 4LE2A 1J90A 2FRDC 1NW8A 1G20A 2UKDA 1CS4C 1VIAA 4R1MA 5FTWA 4EX7A 5KNBD 3HM9A 4RHFA 5HQJA 2AS0A 2R87A 2F4VB 4ALIA 5BVHB 4OAQA 3WG9A 3EVEA 1HT1E 1LF5A 3PFHA 4DA4A 2VEDA 1GTZA 1P5RA 4DCPA 4YRPA 1TAUA 1O6FA 4AQDA 5PGMA 4IQGA 3KE8A 2PR7A 4GGPA 3ZJUA 4ER7A 2B8JA 3IQZA 3ZHSA 4QKQA 3EZ7A 3VR2D 3GOQA 1G5HA 3MS7A 4D9EA 1QU3A 4F45A 1K6XA 3LUPA 5I3ZA 2QRNA 3AXTA 3U6BA 1IN1A 1IN5A 3TAHA 1UKBA 4FQ7A 1ZUWA 5D84A 4DHEA 1LF0A 3BGVA 1M10A 1CIPA 1XZCA 1QYXA 2GZAA 2JVIA 3K6RA 3VNAA 3D3EA 4YAUA 1W4BA 2B0CA 2NU6A 4KL8S 3IE1A 4DV0B 3SYRA 3FSEA 1JA0A 2XADA 5JS1A 2YV4A 3KC2A 5HSGA 3ROZA 5KNBH 2Q7XA 5BSTA 2NXEA 1YFLA 1Z5GA 3Q88A 2RGDA 4I7EA 2YWRA 2HLPA 3INYA 2VSXA 5F5XA 4Q0MA 3T94A 2FGJA 3KQNA 1XMSA 3W8EA 4R7ZA 4WKNA 2NO4A 2OXFA 4P5DA 4IEIA 5DHPA 3Q9SA 1HDYA 1DC3A 4QDJA 5ADWA 5LMNB 2AEEA 3HN7A 3CBQA 3ZD9A 1QM5A 4IHJA 1NVVR 3SEQA 5HKOA 1O96A 4YMGA 4EVQA 4I55A 1DLJA 4PQYA 1MEEA 1XEXB 2WBLC 1N9KA 1DFHA 4I55F 3K0FB 4LWZA 1SKQA 3IKLA 4UM9B 1JBQA 1XALA 2BMAA 3UK2A 3RSLA 1G8SA 1I3OA 1PFUA 5EZSA 4WXMA 3OMXA 4KXXA 1MR3F 4G36A 5F77A 1AQYA 4CLHA 2ZFUA 1H05A 3AVVA 3BAZA 2XQVA 1EM8B 1GCAA 3M4NA 4FW8A 4I3GA 1YOVA 3LX4A 4IHAA 2PMDA 2RI1A 3Q10A 2G1AA 3IP1A 4J0JA 3F3SA 3HFSA 3T7EA 2G7MC 3JATA 1JDUA 4WERA 1UXIA 4OLHA 1SZPA 4OP1A 1R4MA 3HYNA 4MUNA 4QTZA 4E33A 4EITA 1MRZA 4TLCA 4AO8A 2I2DA 2QLMA 5J9FA 4C7JA 1F8FA 2I6GA 3ED1A 4IFEA 4WKCA 4Z9BA 1CJBA 5B1IA 1QIGA 5AJHA 3GAFA 3UG7A 4DLTA 2IP4A 3ZXIA 3THXB 5JZOA 2R2GA 3QVOA 1KIFA 2ZUDA 4GG1A 1GGMA 5C31A 3EPPA 3AVYA 3QX9A 3ZS9A 2GKOA 3NIGB 2Q0XA 4QUJA 3CEMA 3R3VA 4OH7A 4K6HA 1LK7A 5ALRA 3RRMA 1WQ1R 4KXMA 4TMZA 4O2AB 4XR4A 4NS4A 5HM8A 4XSGA 1NW4A 2N1MA 3SYTA 3ZBQA 2PKCA 2V7QA 2YL2A 4U2BA 5A6VA 2YICA 2GK4A 2WABA 4JKIA 1N34B 3ENVA 3BGDA 4RDHA 4C06A 2DFTA 1G8YA 4RVSA 3LXXA 4C0WA 4LZZA 4KP7A 4DS3A 4F6RA 5LZ9A 3OEEA 1Z6PA 4CCSA 3JW8A 4J3NA 2VH1A 1LA2A 4ZDKA 1PQYA 1H0KA 1GUAA 3QG5A 1XTJA 3WV4A 1XF9A 3VYSB 4LNHA 3G9QA 1NQWA 4KRXA 1I3KA 4YPOA 2IPOA 4PZPA 4ZREA 4YYEA 5J4KA 5IS2A 1P61B 2DLNA 1TM2A 1NURA 4FVTA 4HAYA 1OPXA 3E6AA 2FF5A 1ECJA 4GIBA 4B5KA 5KX5B 2C8KA 1EWVA 3GT0A 4G01B 1ORIA 2WNHA 4YACA 4EUSA 3P2KA 2BFCA 3WIDA 1SQ0A 3AV3A 3WLFA 1YDGA 4XWYA 1I14A 3V33A 5A4FS 5BV2P 1FRQA 2XTJA 2PX6A 1CIVA 3PQFA 1VP9A 5M5BA 1Z6GA 1A8IA 5HP4A 1E20A 3A4VA 3ADBA 2P67A 2CFIA 2BF4A 2AQKA 3GJ7A 3DCJA 1QHEA 3C5VA 4IDEA 1U6KA 2R6CA 3FYCA 5EYPA 3OCYA 3IKVA 5A3SA 4G07A 4N3CA 3T9FA 1YBFA 3BE6A 1GFWA 3BH6A 3RANA 4HGPA 4A36A 3UTDA 2WM8A 3B13B 1U2GC 2BFFB 1S3SA 2TMKA 3G59A 3NDIA 3OQOA 1F6WA 2D6FA 1G21E 3KZ1E 1JSCA 3LY7A 1O6GA 4FCVA 4MVWA 3ZQUA 5LD2C 2VH2A 1GGKA 3IAS1 3KVRA 4FE3A 4JHXA 3PDWA 5EMKA 4NL4H 1Y8AA 4A2PA 2P8SA 4NOLA 4MHOA 4F11A 3QEMA 2CJWA 1W76A 4BNJA 2AQ8A 2QL9A 2VK4A 3AIOA 3UT5B 4A91A 4NXMB 3SOPA 1J7JA 2HZBA 1PJTA 4UHEA 3D5TA 4CNBA 1IPFA 4O4HB 3FYSA 1N2BA 2I2CA 2XF8A 5AK6A 4XEHA 3WLEA 4IUCS 1M0WA 3ZQ6A 2MMGA 1UPAA 4LSGA 5DULA 5I7WA 1T2DA 2B99A 4AZVA 1FL9A 3MWFA 3SU8A 2VHQA 3TVTA 3FVVA 4CL2A 2WB2A 4A6DA 3ILHA 2O0KA 1UP7A 3CJTA 1OH6A 3T99A 5DTJA 3VDRA 1UBUS 1O94A 3LL7A 5ALLA 1HT3A 1TIPA 2FPRA 5FI5A 4EEZA 1JEJA 3IO5A 1RMYA 2FSIA 3PLRA 5GPBA 4J8PA 4QSHA 4G09A 1GSHA 4B1FA 1KORA 2HMVA 2GSDA 1Z2PX 5EGSA 2ZT6A 4KR7A 4BFZA 5SZKB 3ZDFA 4JVNA 3R3XA 1K5PA 1NF9A 2NQTA 3SLRA 2WKWA 1RMQA 1JB1A 5CLHA 2VPIA 5AVOA 4E70A 3C3EA 5H3LA 3PEUA 1JQBA 5ER9A 1WZ2A 1A82A 3BWXA 4Y1RA 4DFDA 2YHSA 3CF4G 2Q3BA 4OQFA 1V0JA 3BMOB 2CCJA 1Y5LA 1V45E 2TMDA 2ZYUX 1POXA 4GX1A 4LVCA 4N5DA 4CL3A 3LUBA 2IS1A 1EG2A 2N9UA 1CUSA 4LCEA 5AWFC 2O2EA 4MYRA 1R16A 2Q9BA 3PJGA 2A1UB 4XB2A 2ALJA 2FWJA 3I0MA 1RE0A 1MG5A 5F7XA 1JA1A 4XARA 3TF5A 3ZQ4A 2BGKA 2LRHA 3C15C 1OVMA 4KWCA 3Q8LA 5EE0A 4QFDA 5IPFA 2UYHA 3WGNA 2PWAA 3ES9A 2D5LA 3B2NA 2QK4A 2E5FA 4FUTA 4AL4A 5CLFA 2WJJA 3OZDA 4AD8A 4YRNA 1UDBA 9ABPA 1Y1KE 2O2HA 1NPYA 1TZJA 4HAOA 1NE2A 4RBNA 4BVLA 4QM7A 1IY0A 2K6GA 3H5AA 2AFHA 3KPWA 3JVVA 4UZEA 2EARA 1U7WA 4RS4A 3WHIA 1GQ2A 1CULC 1WCWA 2FPWA 5LDHA 5LNK6 3HDVA 3IX7A 1V35A 1IZ0A 1YDEA 2QP4A 3R5SA 5TPWA 4UEJA 3ZGXA 3LCUA 5K3FB 1FTSA 3RWMB 1KARA 1KMIY 1Q1QA 4C20A 3KXDA 2IW1A 1JXMA 4Y30A 4AQ7A 1SCDA 3LKBA 2IYNA 2WSLA 3ZTTA 4ER0A 4Z0HO 3L4EA 3PQ3A 2IHVA 3T4PA 1TO6A 4FFBA 1R6AA 2RGUA 1AXRA 3P0FA 3DMNA 4KDRA 1TVKA 1U3DA 1TW3A 4XVUA 4QU0A 1XRLA 2AC4A 2C7GA 2VP5A 3PF8A 2VT3A 1TF2A 3FDZA 5DNDA 1AV6A 3RSHA 1MB3A 1Z07A 2VQDA 3AEKB 1T8SA 4EH1A 5KNDH 1QF6A 1B14A 1J00A 4PCUA 3IRUA 1RQ7A 1ULUA 1YQQA 1T43A 2FXVA 4LMRA 2M1ZA 1ITZA 4H1TA 4M46A 1N1DA 2ZYHA 4K1LA 3TNFA 1Q77A 1KY5A 3HCBA 3WIVA 3WLOA 2D0PB 2JJQA 4D8UA 2VDVE 3RS2A 4BX9A 1H9CA 4AJ1A 3F1LA 1N3YA 4XD7A 5EHIA 421PA 4YV2A 2HU5A 1I2AA 3CLRD 3T3OA 4XW2A 3GR6A 3VTZA 3SCZA 3LZ6A 2X13A 1QKKA 2YJ5A 1EX9A 2VHUA 1XWFA 1N7GA 3TOXA 1GKIA 3ZBUA 3LGSA 3LRPA 1ADFA 3PUKA 1PVDA 4I5GA 5EQDA 3TSYA 1IL0A 1EINA 3BG5A 3K35A 4L7QA 4II2A 2ZOSA 2GEKA 1NIJA 4JU8A 4WBXC 3R5JA 1UPTA 1HO3A 2FMUA 3WK6A 2QR2A 2FWIA 1PJAA 5IARA 5AFSA 2PSJA 1VHWA 3SNHA 4LHSA 3P0HA 2CV1A 1Z4NA 1C9NA 4S1VA 5DEIA 4GM0A 2HQRA 2XUPA 1NN3A 1W8DA 3IALA 2WVGA 1VPLA 3DDSA 1G2PA 1TMKA 2H4WA 2YCBA 3HB1A 3M9WA 1XFDA 4MIKA 4PBRA 2GZDA 1AF7A 4L73A 4PR0A 1EESA 4N1AA 1VKNA 2X4GA 2HA4A 5TARA 1I6LA 4PQEA 5G0WA 1YB2A 1W9MA 2BFPA 2NZYA 3HB4X 3HJBA 3E0QA 5LKAA 4TXJA 3V4FA 4DJJA 1X3LA 3IQXA 2QL6A 3O26A 3G1WA 3KXIA 3PB3A 4UZFA 3RS0A 3KUXA 2O8CA 2DSTA 5ALXA 1E5TA 4MGIR 4EOGA 3MD0A 3N87A 4AUEA 4PAOA 3U4CA 5DYYA 3ITEA 2GPTA 3AUKA 3OWOA 5E7QA 4YI3A 3ADCA 1COZA 3D6FA 3N2ZB 4UD2A 2XT9A 2P78A 2ZAYA 3PGMA 1C8VB 3ZDCA 2REQA 1DO8A 1N0VC 3UMVA 5C1PA 2GWRA 4V3CA 4DOMA 2R3SA 4ZI7F 2FN4A 4HB4A 4D82A 2O8BB 3TMAA 1Q22A 4US0R 1XLWA 3G8DA 1T0HB 2P9QA 3KXPA 1JVNA 3G3EA 2X4DA 2GPAA 3P5BA 4EW3A 2H9YA 2GCPA 2IYPA 4RPGA 5E6SB 5J5AA 3LC2O 1CUAA 2IFTA 2WPDA 3ETLA 3GDFA 3HCRA 5FUXA 4UMVA 1T6XA 1XPUA 3HA5A 2W48A 3ETEA 2H16A 3GA5A 3KQTA 5F2KA 1NUPA 2ZB2A 3OIFA 5IAJA 2WIGA 4JI8B 4O8CA 1SAYA 1IBKB 2ZM5A 3ZGZA 5FWYA 1PR0A 4MVJF 4QPZA 4X97A 3EWIA 4LJLA 3BE4A 1OWLA 4Q1DA 2H1SA 2OOKA 2JD2A 2NVOA 3LU1A 1Q0LA 2DLDA 3VZDA 2QQ5A 4M1WA 3SC2A 5EJ6A 2WP0A 2NM0A 3DJFA 1FZTA 4ML3A 4D02A 1HDIA 4TZ6A 3DE1X 2KLBA 3ONVA 4EP1A 4EKDA 4F56A 3LO5A 4I1UA 3SIRA 1JG7A 4HJRA 2C5LA 3RASA 1JIIA 4E5KA 2BJWA 3WIEA 1M1UA 4YJHA 3UYKA 4GKBA 4B7CA 3VJRA 2R7NA 5GONF 2AJDA 3I09A 2J3HA 5B7GA 4URUR 5KSOA 1IY9A 1MW8X 3L8DA 2ZIXB 4PW0A 3IBGA 3VA7A 3H4MA 2G5GX 3HKBB 1KP2A 1G8FA 2XD9A 3ENQA 2DJ5A 2WIKA 3WGUA 3LUCA 2ZIZA 3JQGB 4GW3A 1LPNA 3C6XA 3GBSA 4D3YA 3HYRA 4EG1A 5G1PA 1POWA 3LW7A 1A9PA 1N75A 3QKRA 1YDWA 2YMPA 3H1TA 1O0CA 2N42A 3ZIAA 3OEWA 1XVVA 4WZZA 3ZZNA 1AKUA 1XFAA 2QTFA 3CZQA 3OX4A 4OB8A 4LV8B 4RVDA 3WRYC 1N4DA 1YB5A 3LPMA 4CCYB 3UT5A 4UFPA 1OBOA 3IQFA 5D3MB 4ZGBA 3I6QA 4AXXA 5K8TA 1U1FA 1YNOA 4DQVA 1T9DA 4HBZA 1DC4A 3EGVA 4KNWA 4Q4AA 4PYNA 9MHTA 5FBKA 2GBGA 4M1EA 4D8WA 2IEIA 1IN6A 3W8DA 2IF0A 1EMDA 3T06B 5CYFA 5J3JA 1G4HA 3K96A 2ZZKA 3L43A 1H5QA 5AOBA 1THZA 4J2TA 1TPZA 3TB4A 2Y92A 4E1VA 3EZ2A 1WLYA 2WEKA 3C1OA 1GZ6A 4K6MA 4A8PA 3L7CA 1BNCA 4J94A 4P6VF 4GNRA 4RPLA 3CZ4A 1L7VC 2FQWA 2ORED 2POCA 1K6JA 3OBIA 4Y1GA 3UHOA 1OHHA 4UHCA 2MU1A 1YGYA 5F51A 1SN7A 3NKVA 5F78A 3FGZA 4ND8B 3N0XA 1KFJB 4I3HA 4MUBA 3X1DA 3HSSA 5AVVA 3SYKA 1HSZA 4Q6BA 3R7WB 4LXIA 4DR1B 2PFKA 2WF7A 4IILA 4CGYA 3BA6A 1NAHA 4O4JA 4FPXA 4KB5A 3BFPA 2G80A 3ANXA 3CWQA 2ZSBA 2GD6A 5HX7A 1USUA 2P1ZA 3G7NA 5LQCA 1LFAA 2O8FB 2Q62A 1OT3A 1HF3A 1HE1C 2W4IA 2DWOA 3RRFA 1TADA 4R2MA 2EV9A 3HY6A 5DWDA 3NBUA 3H11B 2H5EA 2QPAA 5DV9A 3UB4A 3UH0A 2GDJA 4TVBA 4IV0A 5JTUA 1IVYA 4LQCA 3TTUA 1JQ5A 5EL0A 3HPRA 1N0IA 5JANA 3U3RA 3ZY2A 1PT6A 2I7XA 3IJPA 3JD0A 4EA7A 6Q21A 4I4IA 3JTMA 2GWHA 3RREA 1JEYB 5F1YA 1K8XB 2NTYC 4E5SA 4BPBA 1JKIA 3BXPA 3CNQS 3ECCA 1T5OA 3G68A 4NMWA 1OTXA 1ZITA 4CTMA 1XRMA 3HABA 5BQ3A 4TUYA 3IT1A 2FUNB 5FR2A 3RS4A 4RLHA 3V9PA 1C2TA 4RD4A 2XGSA 4B84A 4NKRA 3R20A 4EI2A 3RRNA 2FQXA 2I65A 2VTVA 2Z6UA 4FFMA 4AUNA 5KX5A 1CRZA 1U9ZA 4G1UC 1JQDA 4UKDA 2N3ZA 3TLEA 4MW6A 3G49A 3BQNB 3F2IA 3H16A 1YHYA 2WHPA 5FR1A 2JVJA 2I66A 4AB1A 4DREA 4ZT3A 2D2FA 1EB8A 1PYDA 1XLTC 2VXYA 3L05A 2OQIA 3FAZA 3N28A 5IXSA 5HWSA 2Q49A 4CM5A 2B8WA 5HOEA 2I3DA 4LI0A 3B9RA 3DBOB 2FETA 4MA5A 3OM1A 3BGSA 4BYGA 3E3NA 2B83A 2C5AA 2QTMA 1SU4A 2XEDA 4FDTA 4MPJA 3RCBA 1DEKA 3KTDA 2CLCX 2AMYA 1E1QA 4CQMD 1U2ZA 2CXXA 1UBKS 2A0YA 1NYTA 2KWIA 3O31A 5CX1B 4DZRA 3VDNB 1ISJA 1ZH8A 3IPRA 2PT9A 3NXSA 1QS0A 4L3VA 5FAXA 3SPXA 1G8GA 4X64B 1EXNA 2CNDA 4B45A 1QWOA 5DXFA 3WQQA 3P4UA 3K0FA 1OAOA 5B1YA 2YYSA 5FL3A 3KCNA 1XE3A 2DRIA 1DHRA 2YWCA 4IUBS 5E0KB 2EZ8A 1XZIA 2IOFA 5EHXA 5DYGA 3VRHA 5D5HA 2XUOA 3D8NA 5C3MA 5IJXA 5ES3A 3BUSA 3ZEAA 1P17A 1A9RA 2OHIA 1W5EA 1X8JA 4AIIA 5K0GA 3N1UA 5CTJA 1QE0A 3H5TA 3NPAA 3VM6A 2YVLA 5JG7A 3U2QA 2C04A 4BKMA 2R7LA 1GSAA 1U98A 3CRMA 1PR9A 2M6RA 3HYTA 1YOVB 2HWKA 4MUMA 1I80A 1L1FA 1CR2A 3UFBA 4AO6A 1EFRD 1F2VA 3BQ9A 1RRGA 1RYZA 3EQ7A 4GICA 5A7FA 1NFFA 2JK1A 3ISJA 5SY6A 3UJ8A 4D8XA 3D0KA 3T5TA 1WZIA 1WG8A 1E1QD 4ZEMA 4GRAA 2DKOA 4EUKA 1YL7A 4C2BA 3ZJYA 4C4XA 1QONA 3RFUA 1JLSA 1RPNA 1XV5A 2AV6A 2JB9A 4BNLA 1HQYE 3O3OB 4YEDA 2E18A 2Z1NA 1YDHA 4M1TA 3Q6NA 4PG5A 1G41A 3F5SA 4KHPB 4LJ9A 3KOZA 3VNBA 3LT1A 1Q7TA 1FZQA 1W5SA 4F9GA 1XCPA 1WW8A 1DZ3A 3PJFA 3K1JA 1Q1NA 2FSVA 3E7XA 1BG6A 3PE4A 4QT4A 4G84A 1M34B 4IO1A 3L7KA 1QZUA 3ZLBA 4AJEA 1P81A 3QKUA 2X7HA 1AB6A 3DHVA 1LXCA 3JQ7A 5BNIA 4ZXFA 1SCUA 2JNWA 1AKRA 1FTYA 3B53X 1TUGA 2J7PA 5C5EA 2CHVA 3QTTA 4C7VA 1L5FA 4I9FA 3HH8A 3Q7RA 2QTGA 1W7AA 2EW8A 3FCAA 4WCDA 1X70A 2YS6A 2WU0A 3G02A 4DA0A 4E4YA 4BFUA 5CT9A 1RQRA 2RHRA 3IDQA 5I9NA 3DLHA 4PF1A 2OAEA 3H1BA 3WMGA 1XZFA 3UICA 5HQ3B 5JAIA 4KTVE 2OXTA 1KEKA 2IUFA 3TXXA 3NOVA 3PUYA 1C0PA 1ZNXA 3HXKA 4K9QA 1A50B 1HG0A 1TYDE 1V7QA 1D2RA 1M2OA 2C0CA 2ZYDA 5F2EA 5JVDF 2ON6A 3K0SA 3G85A 2IP1A 2WU3A 4BMOB 4BV2A 3IIEA 5FQOA 1WIWA 1ARZA 2AOUA 4BNUA 5ARCA 4RIHA 2NO7A 2QUIA 1M76A 2WPDD 4PSVA 1DAHA 4F96A 3D6VA 1DDOA 4I9GA 4PHHA 1JZSA 2JAUA 2GCGA 4ND2A 4IXMA 4R9NA 4U6QA 1V5GA 1E9DA 2I1WA 1GILA 2BUBA 3QNMA 3WGVA 2H3EA 2H9AA 3F71A 2YWBA 3G9UA 4MW9A 4R40A 1P4AA 4R51A 4RJIA 1SHUX 3BL6A 2EKQA 2QZ9A 3D7LA 3EEFA 4FGWA 1OGJA 2BHLA 4R1SA 4Y9RA 3R74A 2BGNA 4W5OA 4RM3A 1H0SA 3GGPA 1ZM3A 4HNVA 1CFZA 2FPIA 1O95C 1NXTA 3QHPA 3GUZA 4ENRA 2EW2A 2DHDA 2UZ4A 1M2FA 2XVAA 5LWHA 1E5LA 2O2IA 5E2BA 2ATXA 5JSUA 2PX8A 4RACA 1JHDA 3DMDA 3TQQA 1QS0B 2XTMA 3KBBA 2PXAA 4OHXA 5E4JA 3KVYA 3HSYA 2RGAA 4PLWA 1L3BA 1EHCA 2IY9A 3QFFA 4UVHA 4W82A 3SZLA 1U63A 3EDOA 5BT9A 2DUNA 4I1YA 4DNPA 4H0NA 1A7UA 2GI4A 4FYJA 3ZQJA 4YMHA 4INOA 4QATA 4MMXB 5AKIA 2DBYA 3AUJB 1RXEA 4IHKA 3ODGA 2ENWA 2F1JA 4AP6A 4MARA 1YOBA 3JQAB 4MW2A 4WY2A 1WXIA 3U6KA 4XM0A 2CNOA 2WNSA 1RM3A 5B1EA 2A5YB 1GD1O 2P9FA 4JT8A 4ZMBA 4FDAA 2VPYA 3KLBA 3D2BA 2VHJA 4DA9A 2Q7OE 4OFZA 2B1QA 4P81A 4EJMA 1FMLA 1U5BA 5T41A 3R0QA 4WN9B 3CPHA 4R9SA 1ZOOA 2C0PA 2COUA 2GPSA 4UTXA 5BV8A 3LO8A 1RZVA 1PLKA 3S3TA 4JBLA 5JDCC 3ZPXA 1KQPA 5HGXA 3TTSA 4ZT5A 2LV8A 3HDQA 1XPRA 1JN0A 5H9VA 1E3EA 3WC4A 3IP5A 2XZLA 3QNWA 4RIIA 3RC2A 3QFTA 3OEYA 3RVBA 3U44B 4OMUA 3E18A 3I1FA 2F8TA 3GDGA 4WXYB 4HLNA 2D1RA 1DADA 5C8ZA 1YB7A 4J0EA 3VFDA 5MGNA 3UFXB 5KNLA 1QFMA 4ZOAA 1QIJA 3PPVA 4Q34A 2DQSA 4FDVA 1G8MA 4S1NA 3EPJA 2HMTA 1W34A 4BC1A 3P4YA 3A1VA 5D00A 3HVHA 4EMUA 3R7WA 2CCKA 4M9ZA 3PEYA 4GZLA 3U4QB 3Q3VA 1NOKA 1QB7A 3KNZA 1GIAA 1U7TA 1Z73A 4UU8A 1QTNA 2PWBA 4F4CA 1TVEA 2C9ZA 4M8LA 5AW3A 5J43A 1FX0B 4UBNA 1IHYA 1EXWA 4DR4B 3W6PA 1WSDA 3CZCA 3NIBA 2Y0CA 5LXTA 621PA 2Z5LA 4NZ9A 2QNBA 5BXYA 1GPDG 2P5SA 2R9VA 4RAQA 5TR9A 4D57A 1L8XA 3JYLA 4JIGA 2XRMA 3LTEA 5U1PA 3DTVA 3H7IA 3EWNA 3X0DA 4DBLE 1ZL2A 3PEFA 1ID8A 1X7HA 2WAXA 1EWQA 4P7FA 2JI8A 5KDOA 2A6PA 3G2JA 4LHVA 2J4DA 3PDJA 5ALEA 4NEQA 1ONPA 4ZU6X 5DIFA 4BB6A 4QJ5A 5KQLA 3A4NA 3CUVA 4CEHB 1UXGA 3UWSA 1SOMA 2AC7A 1MAAA 4ZOLF 4Q3LA 4J1TA 2P35A 4AY4A 3KXKA 3L77A 4MR7A 4ZVRA 2CXRA 4LDJA 3T34A 2BBOA 2W58A 3FMVA 2I9PA 4B2PA 4EPTA 5DLQC 1WVGA 1QK4A 1GA1A 1DRVA 1MLDA 2SCUB 4KMMA 4MRRA 3K9FC 1EDZA 4M0KA 1UMBA 2NUBA 4CV1A 4DABA 4HADA 4XSHA 5EUMA 1FLDA 3FB4A 4UNQA 4MWGA 1X94A 1HK7A 4WEQA 1OLUB 3WJ7A 5IUNC 4TN5A 5T3YA 3VOTA 1YA6A 1UDRA 3G9XA 5T6BA 4F5YA 2QTBA 2B36A 4Y6PA 5H16A 4N03A 1SBYA 3BREA 4EMBA 4KIJA 1XN1A 3LBIA 3ZHOA 1O6ZA 1NR1A 4KWTA 1M74A 4Z2YA 2JFYA 3TFOA 1NZFA 3ML1A 5T4FA 3QPUA 2G71A 4HZUB 4KFCA 4YPFA 4YJ3B 5DSTA 5JD5A 3QU2A 1QANA 2GRAA 2XNDD 4ZOCA 3SIPA 3WE7A 4HLCA 4IFTA 4W5HA 4HH3C 3SD7A 1HZZA 5A1TA 1KVRA 4PGFA 3H0CA 1US8B 3ZCVA 2VDQB 1P31A 1MO4A 3OQIA 3B1ZA 4S2UA 3O93A 2ZVPX 3IULA 4G81A 5IF9A 1ISRA 1VLVA 2WJVA 3EVTA 2WE8A 3R5TA 3BK7A 3NH9A 4FHZA 1U4NA 3JQ8B 3K92A 4XGQA 2HRQA 2EQBA 3BRSA 3M33A 3N5KA 1NVXQ 3OU6A 3QU4A 2Q4RA 4JGIA 4KE6A 3L8EA 2XUIA 1D3AA 2FG5A 3MLAA 1GDDA 3O4RA 4QDXA 3F5QA 3AL3A 3GK3A 1K6MA 2R97A 3ZWXA 4Q1BA 2FRDA 3FH0A 5HKLA 5KWSA 4JV5B 5ARBA 2F7SA 1JVBA 2CEAA 1LC0A 4ZHQB 2C5FA 2AQHA 3NBZC 4IXTA 4WT7A 3EN0A 3GEEA 1YR1A 2BJHA 3MWLA 3V80A 4D9BA 3E9QA 3QVSA 5DNUA 2RHJA 3QPWA 3WWOA 3RD5A 4E5UA 2QP3A 2ZANA 4OK3A 3DV9A 3F49S 3KP1A 1J0DA 1XDZA 2YDXA 2B82A 1QYCA 3EXG2 1OU4A 3I9KA 5HFAA 3MGKA 3L5KA 4OHPA 4JLMA 3QX3A 5HCIA 4GZ6A 4P22A 3KYCA 4NEHB 4FD3A 2GYUA 4ENWA 2MSEB 1RAIA 1ZRSA 2YXPX 1GRNA 1L7PA 4ZI3A 2J32A 1S4MA 1SD1A 4X1KA 5HBGA 4HXFB 3AERA 4EW1A 1SUBA 2B2CA 1E98A 1T1GA 3A31A 3KWMA 3PDUA 3EQ2A 3PNKA 1Q3TA 2BLLA 4DADA 1BE0A 4M8SA 5AI4A 2Z6AA 3N0WA 1CUVA 1MTZA 3OCVA 5BUZA 4OB6A 1IFXA 2O2DA 4LW8A 2CW5A 1D6MA 5K0CA 4KIFA 4F4JA 2NXNA 2ZBQA 5E4TA 5ADVA 2Z8ZA 4O1HA 1OGIA 1DAMA 2NTEA 3REQA 5JRDS 1EFPB 3MB8A 4I9HA 4KDFA 5CA0A 5JY1A 2OXCA 4RMJA 3Q9LA 1E3QA 1D5WA 1N5JA 4X44A 3R6TA 4IH1A 1E96A 2Q50A 1PT9A 1B2RA 2OZLB 2Q4BA 2R8XA 4INZA 3OT4A 1RKXA 2YX1A 2O20A 3PEVA 3EC2A 4IMJB 3IVCA 1ULHA 2WMYA 3RWOA 1H2BA 2WI8A 3T5CA 1CQZA 2X15A 3QE4A 1XSEA 3VZPA 3PXAA 1RKUA 1P91A 2CZCA 4DZTA 1PW7A 4Z4IA 3TZQA 3MA0A 4CQMB 4PZCA 4C2UA 5JQGA 2A8YA 3N70A 3A1TA 1TE2A 5HK8A 3H2SA 3VTKA 2WUVA 4O5OA 2PZJA 2J7KA 2L42A 1RJDA 1G18A 2WJHA 1IN8A 2C3OA 3U1VA 4JXJA 3PRYA 1YGPA 4GLFA 2GETA 4PSAA 1XDBA 3ABIA 3KJFA 1B6GA 2J33A 4B46A 4BQQA 4W9MC 1QGED 3FDJA 2P3SA 4J75A 1Z8HA 2ACVA 1E1DA 2Q4OA 2FPUA 3PNYA 3TKAA 1BHJA 2Z4TA 2WSSA 5HYVA 3ZW7A 5A9SB 1XMXA 1FJ2A 1YKGA 1S9DA 4Q3EA 2HXGA 1ILWA 1WPQA 2IUTA 2JGRA 2YZ2A 3R3YA 2JAPA 3DKPA 3PQDA 1Z6TA 1FYEA 2KBEA 3CYFA 5I7VA 2YZ7A 4MRAA 2BTQA 3X1KA 1TTTA 4I9NA 2X6QA 5KHLB 4URVR 2HN9A 2D4HA 3SXPA 4ZVVA 4D9GA 1NNUA 1QF7A 3LA8A 4JUBA 4CV3A 1Z28A 1JEEA 1JNYA 3DW3X 4N18A 5AI9A 2AIRA 2TMYA 2WFLA 1M1ZA 2WMDA 3BAFA 2WD7A 3MJVA 3JQ7B 4EHLA 3WDMA 1R0XA 4YAGA 4UCWA 4M8NE 4QO7A 2HYDA 2OCBA 4ZOEA 4HQLA 3NW9A 3WMEA 1E1RD 4ZO8A 3C7KA 1PNRA 1FSSA 2QENA 3H86A 3IT2A 2XGOA 2XEXA 5FNVB 5LYJA 3ITNA 1KI9A 3I04M 2OD2A 3BVPA 4KK4A 3EXIA 3BXEA 2ZT7A 4BP8A 2UZ3A 2ZTUA 4M9CA 2V7UA 3SZGA 3S2UA 13PKA 2ADOA 4AI6A 1OYOA 1E61A 1NJ2A 4D79A 3GLQA 2X0RA 2Z5VA 2H2FA 4IJUA 4KREA 1H5UA 2J0QA 4KOAA 3A6ZA 5F76A 3WQBA 2GLXA 3F7OA 4Q37A 4AYXA 4YFVA 3RHFA 4DM7A 1XXHB 2YOHA 2VF2A 5KYYA 4H6PA 3DAHA 3VU9B 4G2TA 2FSPA 3B52X 3MT0A 2NZJA 4AJIA 4AS1A 2HJGA 1G5RA 4K3VA 4GVLA 1FUIA 2W6QA 2CL5A 3DBHB 3GGDA 3I53A 3KFXA 4BEBA 5IFKA 3QEAZ 2DETA 3KHKA 2QS9A 2IYTA 1XVUA 2B20A 3S1AA 5BMVB 2QLTA 1X7XB 3PYMA 4DM3A 1N6LA 4MUKA 1E1MA 2VPXA 5BNWA 4REQA 2PU5A 2QRPA 3OHSX 2VJMB 3DNPA 4CTJA 4BLUA 5KPDA 4TT3A 1FYFA 1Q6YA 4DG9A 4Z5XA 3AM1A 2V4MA 5E8JA 2ZSHA 1LPMA 4AU1A 4ERXA 1A88A 4R8VA 1LPSA 1UQTA 1F4LA 1MZPA 1D2NA 4DCMA 2EFYA 3OHPA 4J91A 3MUOA 5DGHA 3C87A 2QL5A 4GP7A 4YMLA 1RTTA 3LC7O 1Q3HA 3MHPA 4GQAA 5DPMA 3TDNA 3PHCA 4AZ0A 5JJIA 2QMUA 4ZAVA 3EOAI 1YBAA 2FK7A 4NBWA 9LDBA 4O4HA 1LUAA 2BTOA 2OZEA 3QKTA 4NQRA 3EZYA 2RIPA 4FFWA 3KFVA 2AKYA 3T1QA 4B47A 2PSEA 4JHLA 3IHKA 2V8BA 3FI0A 2ZB7A 3MAJA 2B1RA 1QQ7A 1YS9A 2ZUSA 3DHEA 3C7TA 3DKIA 4K3UA 4OMFG 4RYDA 3HP4A 3CTMA 3USES 2ATVA 4R7GA 5A62A 2R4UA 3X1JA 2QE7A 5GJWC 1UBRS 2R1VB 2WU8A 2X2PA 3MZ0A 1AGXA 1J6UA 1EQUA 4BVHA 3HGTA 3UAZA 2FW1A 4MYTA 4EVIA 5ICEA 1TGVA 4X1IA 1VKZA 3R7NA 4E03A 3TIXB 4RSRA 5DX1A 1KMCA 1O94D 2GAFA 4N8DA 5DW3A 1XO1A 1JI0A 4N0QA 3KZNA 5CBPA 4FGJA 3NTQA 4IIJF 1R3DA 2HSEA 3MAGA 4FZVA 4EK9A 1D9XA 1SHLA 4N12A 1KQGA 3ROTA 1QIDA 2QR5A 3WWZA 4ZGGA 4EIWA 2XCTB 2SICE 1IY2A 2HIHA 2ODEA 4HPJB 4BBAA 1ESMA 2WDPA 4BNTA 4S05A 4F4FA 2PQMA 4WX2B 2XF2A 2ZRMA 4V0NA 1K08A 4MMYB 4RTNA 2BMWA 1ZVKA 2BR4A 2WYWA 2ZBGA 4AIRA 4G5GA 4D3SA 4EKYA 1T2EA 3B2EA 4MS3B 1DBIA 4YS6A 2BH2A 1H69A 2VRNA 2XCQA 1IC6A 2ZR8A 4LSWA 4Y9SA 5TS2A 1N4AA 3RT9A 2VP3A 1DUSA 4WOKA 1Z5VA 3G5AA 2OBYA 4WGFA 5G41A 2BR3A 3SWWA 2DG2A 5AW2A 1XK7A 5BPFA 4RV5A 1JG6A 4FKBA 3OM8A 3VHRA 2Y71A 4YP1A 1GTG1 5K6AC 3TG2A 2CXHA 4IM7A 1VKRA 4IO0A 4ND8A 5KAMA 1NPDA 4LJKA 5KWVA 4PXSA 5KYWA 1Y3IA 2IHUA 3ILYA 5CB4F 3N8KA 1R66A 1SZJG 4JLJA 2C1XA 3AF6A 5COBA 3EPKA 2VHVA 1P9LA 4B3IA 1M8FA 1NJSA 4NPCA 4WBSA 5DP2A 4A2WA 1K4MA 3IAAA 2V9PA 3KZVA 4ITVA 2FW8A 2EHDA 4HB3A 1VRVA 3GLIB 3T3IA 1TVCA 1IHDA 4O4LF 5LD2B 1HMYA 1QORA 4H7PA 1QC5B 1R0YA 4JJ8A 4R69A 2C3PA 3ZWWA 4U7WA 4XTCS 3V4VB 5IKPA 4UDXX 1E5QA 1FNDA 1SPBS 1W0KD 3QMMA 4W8HA 3B1YA 1E2GA 2H4YA 1RLOA 4OYLA 5CD1A 4LOLA 4LFBB 5FFMA 1Q7GA 1T9AA 3SLGA 1BJKA 4AKEA 1C8LA 1HY3A 1R0SA 3D3NA 4TZ0A 3K5PA 2P2YA 4B6GA 1L3CA 1A98A 3VU9A 4M22A 4E2XA 5C3UA 1WKBA 1XXHA 2WVJA 4KQKA 2WUEA 2FJ0A 1X2EA 4U7HA 4XH9B 3RVLA 3TOSA 1E1CB 4XGIA 3JZAA 3KTOA 3BWCA 4HK4A 1W581 4FE4A 3HN6A 4TYPA 5B55A 3EVZA 3NRCA 5KQSA 4LF9B 3GOHA 5DVZA 1L7OA 2RB4A 4Q3OA 3KRTA 1U3TA 1CDEA 3HBFA 2Y1DA 2ASVA 4ZT7A 3R3SA 3IJRA 1BSVA 2XE4A 1JFSA 2JHFA 4MPRA 2XPCA 4U4AA 4REQB 1KOGA 3MQ4A 4Y7CA 3PEWA 1Y6JA 3JWPA 3RPEA 4DYVA 3SC3A 1EFVA 3ZU4A 3UUFA 1DG1G 2UV8A 1HYQA 3SS8A 3MC1A 1XU9A 4E2WA 4WJZA 2UYCA 1FFXA 4C2TA 2PKQP 1N2XA 2OK7A 3E4DA 4QU8A 3LE8A 4OQDA 4U1RA 2FEPA 1O6CA 4FR0A 4AS3A 1AU9A 2WHXA 3K94A 3VHQA 1E6WA 1H4TA 5B4VA 3REOA 4ZJPA 2UYYA 3IS3A 3W7AA 1IDOA 2YWEA 3FF4A 2E48A 3L0YA 5JS8A 2ZYTX 3A70A 3VKVA 1EX1A 3DB2A 5A0FA 2OV2A 3KXLA 2V1UA 1XMPA 4ZCPA 1Y6GA 3UA4A 4CKWB 2J0VA 4P7KA 1WLSA 2YOFA 4MGHA 3TQCA 4LDNA 1RKQA 3WL4A 2XOEA 4ADSG 1P1FA 3Q3JB 2IU3A 1LQTA 3F78A 2L0XA 4JJAA 1DRJA 4R4JA 5C7IO 1L4BA 3PNLA 3PXDA 3SHTA 3LOQA 1ZRMA 2EIXA 3DXYA 5DNCA 3T3HA 2HR1A 2A0WA 3T5GA 2ODAA 1G19A 1L4NA 3EOBI 1JFRA 1UEXC 3F3YA 1E92A 3OF3A 4G26A 4GOOD 3W9YA 3ZNOA 4EZIA 3HI6A 4EDHA 5K8VA 5KSYA 4TYMA 5REQB 1WKCA 5ICFA 3ET5A 3STXA 2YWDA 1ZBQA 2ACEA 1K68A 2REQB 1XXHE 3NBQA 3L1UA 5K0BA 4M9SA 1EXVA 1NQUA 2R8PA 2RGWA 1SA0B 3BRQA 5P21A 2AN4A 2GXAA 1CYEA 2Q4EA 4FYYA 4XEUA 3E15A 1KAGA 5LSAA 1WNFA 4BGDA 1J56A 1GGFA 2O7NA 4M99A 1GNQA 1U8ZA 5H02A 3VHLB 1M2VA 5EINA 3C98A 5CW1A 1H23A 3OZXA 1YNSA 5EP1A 4PZZA 2ZROA 4DV4B 5IJAA 1XTUA 3LX6A 5DTQA 1J8YF 1I3MA 1ONBA 3JQBA 4EL0A 4PC3A 4E08A 4Y0AA 1W0JD 2KJQA 1PDWA 3SXUB 3O8LA 3R5FA 4ZVOA 2YFKA 1AXGA 3CUUA 3KQSA 3M6LA 3SM9A 4BECA 5J4VA 4HI0E 1QCYA 4B0OA 5GJBA 1PZHA 2F3RA 1U2QA 1LLQA 4ZV9A 2DTEA 5IWAB 3CZ9A 1I5RA 4JFRA 2C4VA 3UWMA 1BCSA 1ZNQO 3I92A 3SN6A 4CTOA 1YZKA 4E2ZA 4QTTB 5TGTA 2VBGA 4YRQA 3S5JA 1Z4OA 2WF8A 4KQHA 2V5VA 3KJEA 2R7AA 5IAAA 3ER9A 3AJ9A 4OJTA 4P80A 1V6CA 2VJBA 1KAMA 2C78A 3C3CA 4D0NA 1KJYA 3G0CA 1F6DA 3R0ZA 2NP7A 3B5EA 5JNSA 1WBDA 4NWIA 1T1JA 4BVJA 1AKMA 1T6YA 1QQBA 1NDQA 2R1ZA 3CF6R 4HJXA 5EESA 3DZFA 4C4ZA 4LRTB 4DMUB 1T4GA 2HL6A 3B5JA 5EZYA 3A36A 5KJFA 1IEQA 3D6AA 1Y4SA 4KW7A 1L2TA 4K9LA 4QLOA 1U2DC 3MMSA 5K4AA 4WESB 5KVSA 1S7CA 2PGOA 3C7AA 3IYLW 3NC0C 1S8NA 4KCGA 4Q15A 1GTRA 3DL7A 4RCYA 4ARVA 3A0RB 3GVIA 3U26A 1Z3IX 4M9UA 3KL4A 2QVXX 1VBNA 1PL8A 3A04A 1E2HA 1YQTA 3CUKA 2ZIAA 1L5RA 2AW3A 3A2NA 4FLMA 4JLVA 4M0LA 4TXLA 4ZQCB 3V8RA 5M34A 4GC5A 4EI7A 1A04A 3N07A 1T5BA 4H6VA 3Q6IA 1UIMA 2BL4A 5D2CA 5H83A 1MXHA 4UBIA 3U3JA 3B5IA 4QAQA 1P7VA 2P40A 1F0YA 3QY0A 4N0EA 4B3FX 2ZUWA 3CHYA 3DZCA 2G4LA 1OQAA 3FFTA 2Z2JA 1U6IA 3CEAA 1V95A 5DHAA 4Y2PA 2A5JA 2YQ5A 2DJIA 2QXYA 1G7RA 1N6RA 2BV3A 2FP4A 4DLSA 2J30A 2QY6A 3ZY3A 3DFIA 4BEWA 1I6KA 1GQOA 1MOQA 3OZEA 1QFSA 1PX2A 2BMDA 2XUKA 4DQKA 2X40A 1VI2A 1ZJYA 3WNDA 2A88A 1PI3A 4B8ZA 3CLKA 3O2JA 3KEOA 3LCMA 3AVTA 3C1UA 1CZOA 3PUWA 1OXKB 2XBMA 3FYUC 2C9BA 3CH5A 5NULA 5BQ5A 4NENB 1IB6A 3DEAA 3HXTA 4JQSA 4RY0A 4A8JB 2DUUA 3CX4A 3OIDA 4HKTA 3T3DA 4GLLA 2JLRA 4KU4A 3RSZA 3IDSA 5H1YA 5HMLA 5ALGA 4D5EA 2ZAGA 1P80A 5T4HA 4CUZA 5FDFA 1VBMA 1ND5A 3HMKA 1SUEA 3A37A 4I4CA 4ZQFA 1IONA 5FLYA 4BIIA 1JYSA 2D1FA 3UKDA 2Z1MA 5EIBC 1OLUA 3L5OA 1Y1QA 3UCEA 3NWEA 4EQ6A 2C8JA 2ZP1A 3H2HA 4J4TA 4Y9DA 5KYNA 1SC9A 2FUG1 2ZRGA 1CNFA 2JZCA 1X1AA 1ZCFA 3ZHRA 4TXHA 1NJGA 4BE4A 2YS7A 5IW8A 4YJ3F 1FLVA 2JGDB 3GLTA 3GUVA 3VR5A 3G9ZA 4N8EA 1KZ6A 3FNGA 4JNCA 4NNOA 1YCHA 3NATA 3U3DA 1V8FA 2AVDA 4CRWB 2O5EA 2W93A 2PMKA 1XU4A 4FBMA 4D43A 1D2CA 2LR0A 2OMKA 2W8ZA 3DTVB 4KR2A 1OZ0A 2BZSA 2GJKA 1QNLA 2H5IA 2ZIEA 3D7NA 4BO1A 5L7TA 2G3YA 3H9QA 4WNCA 3LCJA 2JLXA 5DASA 3W6NA 4JLKA 4DC1A 3WL7A 1RC0A 1NVAA 1YJ5A 3AM4A 3CX6A 3JRXA 1WRBA 3CEHA 3GZNA 4DA7A 4F21A 1FLAA 1G3QA 1PR2A 1MIOA 3HCCA 1L4EA 1IRIA 1OVGA 1MX9A 3AETB 2HSWA 4ISBA 4UEOA 3TM4A 2SCUA 2VDWB 5YASA 3T38A 1ECGA 3G2OA 2GTPA 2FN9A 2B98A 3D81A 4IOJA 5JC1A 2FF7A 3BRCA 3OZIA 4J2HA 3RM3A 2I3ZA 5G4LA 2R6GA 4PPGA 2EBUA 3TINA 2EJWA 1TMOA 1F6BA 2A86A 1Q1BA 1SKYE 2PQ2A 3EDCA 3A28A 4OGLA 2PHZA 1DP4A 2JF0A 5AYVA 2C2WA 5T3UA 5I7RA 3ABSB 4XAQA 2QNRA 2V5AA 4OB7A 3BXHA 2Q1UA 3TOCA 2YC4C 4K2AA 4UUAA 1DS6A 4CKBB 2VKTA 4C6HA 2G77B 3P2MA 1XD9A 1GPJA 1VFNA 1XZMA 2JFQA 2NSDA 2VPWA 2PK3A 3KOWA 3SYNA 3WP0A 5KVAA 4OVKA 1RIIA 3DM5A 4L1KA 3HJRA 4MVJG 3B51X 3LPLA 2FDXA 1RM5A 4OP3A 3E9ZA 2ZYIA 3U44A 3DTNA 2G6TA 1CX9B 4DAOA 3KV1A 4B6EA 5LZ4A 4YAOA 3B7WA 2OBXA 1QYDA 3KJQA 1THTA 2ZT5A 1XC7A 1A7KA 2QXUA 1D07A 1BX3A 1Z4PX 2PMBA 1CWUA 1UBOS 4OF4A 1WD5A 1QZZA 4GFDA 3RYFB 4QUKA 1MCZA 1MJHA 1T4BA 4FWIB 3E8SA 2O1SA 1SQSA 4UMEA 3Q1KA 4KLNA 5FI0B 4UUNA 1BCRB 2OHFA 5FNZA 3TJRA 1QVZA 1RHJA 2W5UA 1YAHA 1NUAA 2JA2A 2AF3C 1LJ8A 4NARA 3FWYA 4L7VA 4Q7MB 1R0ZA 3GJYA 4FCWA 4XQ9A 5JARA 3UHJA 2R11A 2PO5A