5HKAA

Crystal structure of the cftr inhibitory factor cif bound to an amide inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Potent and Selective Inhibitors of an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain ucbpp-pa14)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CFTR inhibitory factor
total genus 112
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hkaA01
1DX4A 4XVCA 1QGED 2V9ZA 1QIJA 1Z68A 3WWCA 2YH2A 2O7RA 4MQMA 4G8DA 3QMMA 1ZD5A 3KWJA 1E3QA 4UBMA 4H18A 2XLBA 4BBZA 1MPXA 1QIKA 1AMNA 2VF2A 4JUIA 4LYEA 3SK0A 4BTVA 4IQ4A 4FBLA 3R40A 4N8SA 2HU5A 1WB5A 5HKAA 4L0CA 4QDXA 5LIPA 4C4YA 5ALOA 1CEXA 4UBNA 3DLTA 1CUCA 4B0PA 3A2NA 3TRDA 4G8CA 4ZREA 3WWDA 1JJFA 3WWOA 4MWSA 1EB9A 5IVKA 2Y2VA 4U2BA 3H0CA 2HHAA 1W52X 4BVLA 1K5PA 1DINA 2J3QA 3EF3A 5LZ9A 3EQ9A 4LXHA 5KWJA 4FMPA 3K6KA 2DHDA 3V1MA 5EFZA 1ODCA 4EY8A 5DYYA 4UHCA 2J4CA 4WFJA 5ALQA 1PV1A 3WLAA 4FHZA 4C01A 4BAGA 1GPLA 5AI5A 4K6KA 4KE8A 3S2ZA 4K6HA 4J0CA 4Y2XA 5JADA 4KE9A 4Y2QA 4DMKA 4EA6A 5EHNA 1MX5A 1W6RA 1XRPA 3U1TA 2WTMA 2XUHA 3MUOA 4RE5A 1Q0RA 4QWWA 2ZYRA 3C6BA 3LIPA 3WZLA 5CXUA 3AZOA 3CXUA 3T52A 1DWOA 1E8MA 4NS4A 5AM1A 2C0QA 2CEKA 2RIPA 2BUBA 1ZD2P 1Y7IA 4X97A 4DNOA 5JD6A 3LCRA 5AI0A 2H7YA 3HYSA 1QOZA 4FWBA 3LLCA 4UFNA 4H7EA 4H7JA 3OPMA 4KRYA 3G0IA 1IUOA 4FKBA 5AP9A 5JD4A 3DD5A 1THTA 4E14A 1EDDA 4EY7A 2PL5A 4CFSA 3WYDA 2BUAA 4W1QA 3KWFA 3W04A 1LBTA 3ESDA 1BRTA 4WDQA 2HA0A 1GQRA 2VA9A 5ALKA 4HTAA 1VA4A 1BEEA 4OYLA 3A2MA 3WK4A 1E8NA 3F96A 1AQLA 1G66A 4BATA 3HRHA 2G4LA 2DCMA 3L1IA 2H7CA 1X2BA 3ZPXA 2CKMA 1QIHA 2OCKA 3F9CA 5AKZA 4UHHA 4TGLA 4AO7A 4J0KA 2WHQA 5DYTA 3G9UA 4GXNA 3W2TA 4KRXA 3I2JA 2PU7A 1A88A 1IZ8A 1XLWA 5JIBA 1ZD3A 3IUMA 1Q0ZA 4X92A 1MT3A 3U0VA 1YAHA 3QBJA 1ODTC 2EDCA 1CVLA 5HZGA 5ALDA 2OGTA 4RNCA 2AXEA 4JYMA 1W4LA 1XZEA 4OB7A 2HA7A 1XZLA 5AIAA 4S0XA 3WIBA 5KBYA 2VATA 1IUNA 2PUJA 2IIVA 1CUFA 3KSRA 1SCKA 4B0OA 2ES4A 2OCLA 3C8HA 2BGRA 4BAUA 4KEAA 3RLIA 1CUSA 3ESAA 1CPYA 1CUDA 3H1AA 3ZLVA 3PFCA 1LPMA 5CURA 3TJMA 2K2QB 2AJBA 1BU8A 2GZSA 4HZGA 3BL8A 1K8QA 5JD5A 2Q0XA 1R88A 5DLPA 5C8ZA 3BIWA 4BVJA 4KE6A 1SC9A 4E11A 3I2FA 5SYNA 4G4GA 3I6ZA 3EQ7A 1QIDA 2XUDA 1C7IA 3R3YA 2JGFA 1ZJ5A 1G42A 2ECFA 5FV4A 2PU5A 2XUGA 1AKNA 1J07A 4P08A 2AJ8A 5CXXA 4U2FA 5LKAA 3R3UA 2O2HA 3R3VA 2VJAA 4AZ0A 1ETHA 4H7FA 2WUDA 4W1SA 2XUKA 4BDTA 4JNCA 2B20A 3QPDA 4JEIA 3H2HA 1VE7A 4B7ZA 3F98A 2XUAA 1GPKA 3OM8A 2EEPA 3W9BA 4N5IX 4WY8A 5A62A 2XQIA 1QE3A 3G0GA 2PPLA 5HFAA 4X71A 3UUEA 3GBSA 4UBKA 4OB8A 2ZYIA 4EZIA 4GEGA 5BWCA 5CH3A 1PJAA 1BCSA 2WG0A 5ALTA 2WIGA 2XMQA 5LKRA 1EX9A 5E4JA 2E3JA 3AIKA 1BCRA 4Q34A 3STWA 4HVTA 4J7AA 1QJ4A 3VVLA 1WPRA 4I3FA 4Q82A 2XMDA 4DSAA 2XUJA 3QZUA 3ESBA 3ZV7A 4BP9A 3WK7A 1XZGA 1N1MA 1P0QA 3JWEA 5D7BA 2HA3A 4L9AA 4B82A 3C70A 4Q05A 1CUZA 5ALNA 4AXBA 5DNUA 1ZI9A 1EA5A 2RI6A 1TRHA 3W06A 4W1RA 5ALWA 2VJBA 3DEAA 1C7JA 5HF5A 2JGEA 1YS1X 1GGVA 4AO6A 5AJHA 1U65A 5FUMA 5CT8A 5EGNA 3NUZA 3M81A 2XUPA 5E2IA 4BDSA 3I1YA 2BUCA 4UBLA 2WQZA 3JYHA 1H23A 3QVMA 1TCAA 2GYUA 1ZGCA 1MU0A 4GLBA 1MX9A 3DYIA 1R9MA 1IZ7A 1CQWA 5DTJA 3WKCA 1H2XA 1WCYA 4ITVA 3I1IA 4DIUA 3QM1A 2AJLI 1XRRA 4B85A 3WQHA 4OU5A 3H17A 1XLUA 1LBSA 2Z3ZA 1G5FA 3WWPA 5T4FA 3DL7A 4G1FA 4CIBA 1D07A 5DWDA 1MNQA 1FJ2A 1VLQA 2ROQA 2HA4A 3R0VA 5ALEA 3O9VA 1XQVA 3I2IA 1EHYA 3DS8A 5D6OA 3WKEA 2W22A 5HK9A 1XRMA 2VJDA 3LS2A 3DJYA 4G4JA 3G0DA 5HK8A 4L3WA 2D0DA 4QEKA 2DHEA 1VA5A 2Y6UA 2IX9A 1JMKC 4OUKX 2HIHA 2ONCA 4EB0A 3PF8A 4Q1VA 4X90A 2GYVA 1LLFA 4WFKA 4G4IA 4A16A 4X6YA 2OGZA 5ALVA 4C6HA 3CN7A 4BCDA 3STTA 4MEAA 5ALYA 2JBWA 4Y7DA 4EY5A 3G9ZA 5KREA 1USWA 5LZ8A 4Y9SA 1JJIA 5K3FB 4A5SA 5AI6A 5LP1A 2ACEA 3C5WP 3DOHA 3LP5A 1RWQA 1R4ZA 4OPMA 2B9VA 5DYWA 4P9NA 4J0JA 4FNGA 5AK4A 5EIEA 1CUYA 1BROA 5CT6A 2CZQA 1XQWA 4DYHA 2PM8A 3R41A 4C88A 3QH4A 3WL8A 3NOXA 5JASA 2DFPA 2ORYA 5A2GA 2O2IA 5A7HA 4Y2RA 1EB8A 3RARA 3O4JA 4BC0A 3FYUB 4X6XA 1UK9A 2WFZA 5HF9A 1UK7A 4BTLA 5FDFA 5JAUA 3D3NA 5AKGA 4X00A 2W6CX 5HQ3B 2H1IA 5DJ5A 3TGLA 3DKRA 5ISMA 4QLOA 2OXEA 2BCEA 3PE6A 1DU4A 1UK6A 2B4KA 1F6WA 4PV7A 1FSSA 5E4TA 2XMGA 1HKHA 5EHXA 1AGYA 1NX9A 5EHQA 1EK1A 1ACJA 5HKBA 2QUBA 2ZJ7A 1WOMA 4F0JA 1MO2A 4ARAA 3RKSA 2OGSA 1EVEA 4KAJA 3IA2A 3ZWQA 5IH7A 1GPNA 2I03A 5ESRA 5E4YA 5AM3A 2GBFA 1DT5A 1LZKA 3H19A 1XZIA 5CW2A 4MJ3A 4AN1A 3B5EA 4Q3OA 1I6WA 3A6ZA 4INZA 5H3HA 3FYUA 5T4BA 4DMHA 4IH9A 1ORWA 1YB6A 3OC0A 2XMSA 4I19A 2O2GA 2ZSHA 1EVQA 2DHCA 1KU0A 3G9XA 1ZIXA 3WK8A 4DLNA 3RK4A 1VZ3A 3VVMA 3QYJA 1GQSA 5I8PA 3M3DA 2YYSA 4KYVA 5IVDA 3Q0TA 5CH5A 4WFIA 5JAOA 2ZVDA 3H2JA 1E5TA 4HXGA 2QR5A 3IIIA 3BDIA 1O6GA 3AIMA 4CI9A 1GKKA 4V2IA 4XJVA 2XUFA 2XUOA 1N5MA 1YAJA 4Y2VA 1XLVA 3ANTA 5CT5A 2XLCA 1UKAA 2X5XA 1ZGBA 1DQZA 2AJDA 3O0DA 4OU4A 4PO3X 2QXUA 4XWGA 3N0TA 1DT3A 3HXKA 1AX9A 5AI4A 4FDMA 4FTWA 2JGKA 3FSGA 4J03A 4J0HA 1MX1A 3AFIA 4PNZA 4B84A 1J1IA 3FWHA 3D0KA 4KAAA 2QXTA 2BAGA 1YS2X 2RHTA 1CUXA 1AUOA 4M0EA 4C4XA 3IDAA 1JT2A 3I2GA 5CRIA 3IURA 3DDUA 1YA8A 4RPCA 2WU4A 4W9RA 4H7KA 3E3AA 5ALGA 4X6UA 1EDEA 2J4FA 4Y2TA 3ANSA 1O6FA 3AZQA 4K5QA 3HJUA 1L7RA 2VJCA 2FJ0A 5HF8A 1OCEA 3V9AA 2ZJFA 2ZYHA 1CFJA 3WJ1A 1HBJA 1A7UA 1AZWA 2C58A 4OYYA 4N8EA 3BF8A 7YASA 2G5TA 2PSEA 1VXOA 4ZXFA 4ZWNA 3PUIA 4ZV9A 4B6GA 3HI4A 1W1IA 4CG2A 1MJ5A 1Q84A 4H7IA 1MAAA 2DSNA 3IUQA 3BXPA 3JW8A 2FX5A 4X95A 5AKYA 1BEZA 3LIIA 3WA7A 5K3AA 2UZ0A 4KACA 3C6YA 1TCBA 4C89A 1F0PA 3GUUA 4XIIA 4GW3A 1QO7A 1ISPA 1WHSA 4U2GA 5K3CA 3IULA 4WDRA 4GI1A 4C87A 3D2AA 3PI6A 4DM7A 1NU6A 4OCZA 2ACKA 4AZ3A 1XZAA 4CG1A 1DQYA 2OCIA 3HACA 3IUJA 3O4IA 3I28A 2OLEA 1R1DA 2WG1A 2OAEA 5ALSA 5JAPA 1DX6A 2G63A 2EDAA 2WILA 3EQ8A 5AKHA 4EY6A 3FCXA 4FOLA 4PF1A 4ZV7A 2HRQA 5AOAA 3WMRA 4DNFA 4QZVA 1CUJA 4UBJA 5JANA 2WTNA 3AIOA 2QUAA 2GYWA 4H0CA 2OPHA 4YASA 5AI8A 4G5XA 1HDEA 1XRQA 2PKYX 1IMJA 5AKEA 1E66A 5AKKA 3C45A 1AURA 1EDBA 1XZJA 1B41A 1XROA 4Y2JA 2J3DA 2PBLA 2VTVA 3WK6A 3CCCA 3P2MA 4C4ZA 2RGUA 3PF9A 4BVKA 3MVEA 1CQZA 4BYMA 4UFPA 1OILA 4TVKA 5AOCA 3V1KA 3WWEA 1XKLA 3C87A 4MXDA 3V48A 4OD0A 1Q83A 1EH5A 3FVRA 5LZ5A 4F60A 4QNNA 2WJ4A 4Y2UA 4IH1A 2QJRA 1U8EA 2V97A 1G4HA 4B9EA 4HRXA 2NW6A 2PVSA 4KJXA 2YASA 2XB6A 5LYYA 5ALMA 4ROTA 3O4HA 5A6VA 3WYNA 4FLEA 3R3WA 2G5PA 4BE4A 2WJ6A 2WU3A 3W9UA 4IO0A 2OQVA 3K2IA 5ALFA 2WUEA 4EUSA 1FFBA 4HRYA 4MEBA 2OG1A 5C7YA 3ESCA 1T4MA 4BCCA 3FVTA 3HZOA 2R11A 4U2EA 1UT6A 2C5GA 2JIDA 4HXEB 4UPDA 4CCYA 3ICVA 3I6MA 2XQGA 2XI4A 1TK3A 2IITA 3PDCA 5AICA 4F21A 1GT6A 3HEAA 1XZMA 1EXWA 3KXPA 1Y37A 5EHZA 1CR6A 1ZIYA 3O4GA 4G9GA 2XQJA 3ZI7A 1CLEA 5ALJA 2VSQA 3E0XA 4QE3A 3GROA 4AX4A 3V1LA 2BJHA 4B83A 3C6XA 5CT4A 2WUGA 4WCVA 3WK9A 2DR0A 1CUIA 3G9TA 1VOTA 1QIMA 2XMCA 4LIPD 5CTAA 3BJRA 5FPPA 3ZLUA 5JALA 4MWTA 3STVA 4OSEA 1QONA 3FSGD 2QM0A 2WHPB 4KE7A 3WL7A 3UUFA 2DQZA 3R3ZA 4JYPA 6YASA 5AHXA 5DTIA 1ZI8A 4CCWA 2CUTA 3A70A 4CG3A 3GFFA 1NU8A 1Y7HA 2GBCA 1XQXA 2HFJA 3A2LA 1UZAA 4FLFA 3OURA 3H18A 3AINA 1KEZA 3FOBA 1EI9A 1YB7A 4BRZA 4BB0A 4XX1A 4GDMA 4G9EA 5FXMA 1P0IA 4GWLA 3QMWA 2QVBA 1C4XA 1WHTA 4KR0A 3IVMA 1LPAB 5DNVA 2WIJA 2YXPX 1H22A 3SX4A 4LKOA 5ALZA 3C5VA 4FNMA 5IVIA 1VE6A 3H1BA 5C8VA 3D7RA 1F0NA 4E15A 4BCBA 2VQ6A 4X85A 5D3KA 1XZBA 1L7AA 3FLAA 2WLSA 2PSHA 5AI9A 5A71A 3KDAA 5ALHA 3WL6A 3BE8A 3H2GA 1HPLA 1FFDA 1A8QA 5BOVA 4DSZA 1XZFA 2GBIA 1VJ5A 1JMYA 4ARBA 2OAGA 1H2WA 5D3ZA 3W05A 4X94A 5LZ4A 5ALLA 4CIAA 1SCIA 1CUWA 3DCNA 4DTCA 4IHAA 1J2EA 5CT9A 5JYCA 1LPNA 2P8SA 3CN9A 1R50A 2PSDA 4Y2PA 1ZICA 4PSCA 1CUHA 3WKDA 2VT6A 1J06A 5HCUA 2HRRA 4P92A 4U2CA 5J3JA 1QZ3A 2C7BA 1H2ZA 2FJPA 3N2ZB 3STUA 5FP0A 3AUKA 1F8UA 2BFNA 3D4LA 4N8DA 5CH8A 4KAFA 2RONA 5K3DA 5HF6A 4F5ZA 2H7XA 2XT0A 1ACLA 2HU8A 2QT9A 4DMFA 1ZJ4A 5F4ZA 2JGIA 3CCBA 3WK5A 1VXRA 3MUNA 4QLAA 4UHEA 4QDZA 5C81A 2XQKA 3M82A 2PX6A 2Z5GA 3QPCA 4BC1A 5JAHA 2RAUA 4J0DA 4UFOA 1GZ7A 5K3EA 4AB1A 1UK8A 1XZKA 4X7BA 3D2CA 4WJLA 4LXGA 1A8SA 1M33A 5AM2A 3C43A 5JATA 4QDTA 2D5LA 2C4HA 1UKCA 2WUFA 3EBLA 2PSFA 5FOQA 2X8BA 3OG9A 5JARA 3GELA 3GZJA 3FYUC 3PFBA 2HA2A 5CBKA 1OXMA 2GBGA 4FLMA 2WFLA 2WM2A 3C8DA 1X2EA 5ALRA 3WL5A 4GHWA 5LLSA 5BWBA 1UWCA 1YCDA 3VJMA 1TKRA 3I2HA 2HM7A 3E4DA 3H04A 3GA7A 3L1HA 4N5HX 2QRUA 2I78A 2WFMA 1YASA 2LIPA 2HA6A 4NMWA 2R8BA 4ZRDA 1FFEA 4PSUA 1U4NA 3G7NA 5ALUA 1BN7A 2CB9A 3EIOA 1TIBA 3DYVA 3B12A 3T4UA 5HQ3A 3S8YA 3I2KA 1R3DA 3H2KA 2QJWA 2C0PA 2WHPA 1BN6A 4OB6A 1QIFA 1LPOA 3G0BA 1DTEA 2WJ3A 5AO9A 2QMQA 1MN6A 3VJKA 2AJCA 1EINA 4U2DA 1N8SA 3BDVA 3KD2A 1CUUA 3DQZA 1UKBA 5JZBA 1JFRA 4QA9A 2WIDA 3QITA 2HADA 3X3HA 3WA6A 1W76A 2JEZA 4ZI5A 3ILSA 3FLBA 3G0CA 4UHFA 3VISA 1HL7A 2ZYSA 4YPVA 4Z49A 4DMCA 2X76A 1E8DA 2XUQA 1CUGA 1QIEA 2WIKA 2Z3WA 4EBBA 4ETWA 4BP8A 4H7DA 4E46A 5EIHA 2V98A 4PSDA 4HXFB 2Y1KA 5C8XA 3MGAA 3BWXA 5IKXA 4BE9A 3DL4A 3NGMA 4M0FA 2O7VA 1QFSA 1MNAA 1SFRA 1XZCA 2VT7A 1JJBA 4UHDA 2WG2A 2XMBA 3WKAA 1GXSA 4ZGBA 1TCCA 4TPKA 5EI5A 4FFWA 3L1JA 4RE6A 4IH4A 4RGYA 2Y6VA 3FLEA 4AMZA 1XFDA 1LGYA 4PW0A 2GZRA 4K2AA 4CCYB 1B6GA 5BV7A 2JGLA 1U2EA 1YR2A 2XDWA 1N5RA 3SWWA 4MYSA 4DGQA 3KOOA 1WB4A 3STXA 1QLWA 1K4YA 1JU4A 4X93A 5HFNA 2CMFA 4M0MA 1CUEA 1RP1A 3PUHA 5AM5A 4G8BA 4AN0A 2ZJ6A 3QMVA 1UFOA 5KWIA 1H2YA 4AMYA 1TQHA 3OTQA 2VAXA 3VXKA 3D5EA 3HSSA 5CMLA 2QZPA 4FFVA 2I3ZA 3VKFA 2RHWA 2BKLA 2QTBA 1ZOIA 5FKJA 4AQDA 5FLKA 3WKBA 3R3XA 3BIXA 1XRNA 5AKIA 5AKLA 3K9BA 3F97A 4BZWA 2OQIA 3WJ2A 2I3DA 4EY4A 5IVHA 3ZLTA 1QIIA 5ALXA 1BS9A 1THGA 4Q3KA 5AIBA 1LPPA 3M83A 4NZZA 4BRSA 4J0GA 4YK7A 4H35A 1CUAA 1UXOA 4H77A 4W1PA 2WIFA 4MQLA 4JH0A 2WHRA 4UUQA 4LYDA 3Q8WA 2CBGA 2WFLB 1XKTA 2QKYA 3G8YA 4FBMA 1K63A 3QPAA 2H9YA 1VZ2A 4X3CA 4DNQA 1ORVA 1IUPA 4L72A 4DNPA 1JI3A 3F8SA 1P0PA 5AK3A 1TAHA 4MYDA 2OCGA 3IB3A 3AJAA 3DNMA 1LZLA 1FFAA 1RYYA 2JGMA 3F67A 1KU6A 1QTRA 3D59A 2XMZA 3DKKA 1AC5A 4HS9A 3FBWA 3BJMA 3OOSA 5T4EA 2HFKA 1VKHA 2PSJA 4LHEA 1LNSA 1CV2A 2HA5A 3HLKA 4W63A 5AM4A 4Y2SA 5K3FA 1WB6A 3PICA 2Z8XA 5AH0A 3FAKA 3SC2A 2XE4A 4QDUA 1CUBA 1K6EA 2JGJA 5ALIA 5I7UA 3AILA 1MTZA 2HU7A 4O08A 1YA4A 3TEJA 1QFMA 3ICWA 2QS9A 5JZSA 1XZDA 4WY5A 5YASA 5T4HA 2VEOA 3BF7A 1FFCA 4UBOA 5LZ7A 1UOOA 3HABA 1JU3A 5K3BA 1W75A 2JF0A 4GBGA 1QIGA 4QWMA 1R9NA 4A23A 4Y2YA 5FPQA 2C5FA 3I6YA 2VAVA 2QOEA 1T2NA 5AKJA 1MAHA 2V96A 1DWPA 2ZSIA 2WKWA 3NWOA 1QO9A 4NVRA 4B9AA 3DOIA 2B61A 5EIAA 4B80A 5K5EA 1WPXA 3G02A 1BE0A 5AM0A 4X91A 5AOBA 2HL6A 2DQYA 3WIOA 1P0MA 3WZMA 4EHBA 5LZ2A 4D9JA 4QDOA 1WM1A 1XQYA 2JEYA 1JKMA 3FCYA 1UOPA 3C6ZA 2XMRA 2Z8ZA 3H2IA 3B3QA 3V1NA 2XUIA 4UHBA 1L7QA 3ED1A 4PQEA 1LPBB 5ALPA 5AKXA 3D2BA 4BAZA 4UBIA 4P93A 1LPSA 1EK2A 1S8OA 1XZHA 2WSLA 1SOMA 4K6GA 5A7FA 3E1GA 4AO8A 1ODSA 3AZPA 3RM3A 3VDXA 1SCQA 3O9MA 5SYMA 4J3JA 2Y2UA 1HLGA 5A7GA 2PUHA 2HDWA 3VJLA 5DNWA 3FNBA 4YX9A 1CUVA 3WI7A 4Q3LA 3IUNA 1CRLA 1QTIA 1A8UA 2XQFA 3YASA 3UMJA 3O95A 3STYA 2FUKA 1ZD4A 1UOQA 1GKLA 2BGNA 4HAIA 2CJPA 3FYTA 4LXIA 4H7HA 1XRLA 1X70A 1YSCA 1PFQA 5FRDA 1DWQA 1HQDA 1E89A 5I9IA 3HC7A 4B81A 4BZZA 5AK6A 1ZI6A 3IBTA 4J0IA 1CIJA 5AK5A 1IVYA 4I4CA 4GECA 5JZ9A
chains in the Genus database with same CATH superfamily
4BO6A 1DX4A 1QF9A 1PD0A 1QGED 1RRGA 1Z68A 3GIWA 4Q15A 3WWCA 2FY8A 1ZIDA 5FOVA 1HFKA 1VHJA 2NACA 1JPJA 2QT0A 1QGUB 4I4TB 3JQDA 3L6OO 4PIMA 2BMAA 1ZD5A 4XDHA 5E9QA 4AY4A 2XCLA 3WB2A 4YHHB 3NDPA 1E3QA 1RCTE 2C2WA 1E3SA 3RAPR 4H18A 4DR3B 1DMSA 4MAAA 2IVFA 4Q00A 1C7QA 1PZEA 1QVZA 4IEFB 4KQXA 3PX2A 1DCMA 1WSAA 1ZVKA 2XF2A 5K3OA 2WIAA 5KVCA 2BP7B 4RIFA 4QSHA 4XLLA 3ESQA 2RHCA 3FBTA 2E89A 1N0VC 1T6XA 2EXXA 3SK0A 4QUDA 3AHDA 1JEYA 4YCLA 4NABA 3TR0A 4FBLA 2GX6A 2CZCA 5G4KA 2QMZA 4Q1DA 5L4LA 2A0KA 2HU5A 2VKQA 5T6MA 1QC5A 1QF6A 4P0TA 3QVLA 3IELA 1ZOOA 3BVPA 4KIUA 1Z6XA 3CX6A 5IUNC 4XPIB 3U7RA 1B8PA 5E1BA 1IBLB 4UBNA 3IAM6 2ZETA 3MTDA 1PV2A 3O83A 3P5SA 3RS9A 4AF8A 3DLTA 4PSAA 3ZCRA 3S68A 4GUDA 1S6YA 1MQ8B 2BEVB 3M6IA 3FG9A 3GUCA 3W3ZB 1E4VA 1DXOA 1E4OA 1TZBA 1W4ZA 2I2WA 2XCOA 2YMLA 4AVYA 1HNWB 1SUPA 4JLDA 1BIFA 1M73E 3A2NA 3KR1A 3E1SA 4G8CA 4HX5A 3TPZA 2GTHA 4B0PA 2OWEA 1DKNA 2AG1A 3AP2A 3D02A 4JJEA 4R41A 4RH3A 3WWYA 1JIQA 3GRZA 2JLRA 4MWSA 5F5XA 2RARA 3PTAA 2ALJA 2BT4A 3TCKA 3U7GA 2FB9A 1GCOA 1QSGA 1L1QA 2PN1A 4LOIA 1H8HA 3ZE2B 4E2WA 3LQQA 5F77A 1V8DA 2WRZA 3RBVA 3EQ9A 3SSOA 4G4SO 1IM8A 1NVVQ 2I55A 1L3CA 3ZJYA 2IH5A 2HK9A 3I1FA 3KOXA 2OXTA 2V0GA 1GJRA 2Z2KA 1PV1A 3EAGA 2YOGA 4CRWB 5CM8B 5AI5A 2AWNA 2NPOA 5CEEA 3GEBA 2W58A 2C9DA 3CKYA 3OF5A 4KE8A 3RHZA 3L46A 4C0KA 4A15A 4MCHA 1DUVG 1U6JA 2D54A 2P5YA 1H3FA 1NY6A 5EXEA 5HUQA 4J0CA 2O3TA 5BUCA 5ERGB 5F12A 3U4GA 1OFVA 1E4EA 3ZDZB 3IAHA 4B6QA 4HYEA 1AF7A 2OFPA 3DVLA 1BMTA 2BFOA 2HGZA 4OMDA 4TS3A 3MUOA 4X1KA 4HATA 3FPJA 1WCIB 1Q0RA 4QWWA 2AEMA 1US8B 3AVOA 3JQ8B 5EKDA 1EG7A 1G5IA 2GN2A 2J7KA 2RB5A 5EUBA 3WGMA 1LDGA 1QCDA 4EG3A 3RSOA 1FUKA 3MTAA 3FTQA 2ST1A 3CXUA 1T4GA 3P9IA 3VSEA 4RK7A 1RJDA 4ETMA 1DWOA 4JJ8A 4C4PA 4B4OA 5CA0B 1DIAA 2QL7A 3K7EA 4LYAA 5AM1A 2C0QA 2JCBA 2RIPA 3MWLA 1PLLA 3MJTA 2OVFA 3R7SA 1Z0KA 4EKEA 3ZQ4A 1UDCA 1YC5A 1OJLA 3PQEA 3ZZTA 5J5VA 1G5TA 1Y7IA 2WKPA 3SZMA 4F4DA 4NAHA 2HWXA 4X97A 3TSOA 3U9TA 1UDXA 2WDPA 2I4MA 1L7EA 4UPVA 3EB9A 1W5BA 1WXXA 1KY2A 3BSWA 3E2MA 3OE1A 3ZJVA 3FB1A 5AI0A 4FWBA 1VJRA 3GCZA 3LLCA 2N46A 1AHNA 3QNMA 4MQ5A 3Q8LA 2IZOA 2ZJ4A 3PNKA 4HPJB 1TQ6A 2C95A 4L57A 5JZOA 1A5SB 2GVDC 3G0IA 1IUOA 5AP9A 4UU8A 4FGUA 1YE3A 1K2VN 2XB4A 4CM9D 3CZ5A 3LOQA 1E5VA 3REQA 1EP1B 1H8HD 2ADMA 1QG6A 4LQCA 1J9ZA 2JI6A 3D54D 4E14A 2ODEA 4PS1A 5C5DA 1EDDA 3EEYA 1A2QA 3PFKA 1KQNA 2F3TA 2VBCA 5HRUA 1XQ9A 3UB4A 3K0KA 2PL5A 1QZZA 1TM5E 4PYIA 2MSEB 4KKVA 1ZH4A 4RXMA 4CKZA 2X3UA 3BFJA 3PC8C 3WYDA 1ADGA 2BUAA 5HS6A 5EJEA 3UGJA 1XD8A 3F6BX 5CBPB 4Z53A 3VSDA 4EH1A 5GY7A 4DIKA 2GYYA 1C0IA 3KWFA 4PVDA 4U7TB 4BGIA 2P2LA 3DXXA 3HWX1 3JD2A 4N03A 3ESDA 1RLMA 4PWZA 4D4GA 1N34B 1BRTA 2AYYA 3KKPA 4WDQA 1GQRA 3AERB 2PZBA 4WCFC 4Z9FA 5I9NA 2D1SA 5E6UB 3RVDA 4OYLA 1DFHA 1OI2A 4BQIA 3QFRA 5EMLA 3GUYA 4ER3A 2AG8A 4FR0A 5C7IO 4JLAA 3U3MA 2JGAA 1PS9A 4BTEA 3P1JA 3WK4A 3W2IA 5J1SB 1IQ0A 3EVEA 1E8NA 4DREA 4XFKA 3SQMA 2FHSA 2EJVA 4Y6OA 4L07A 1V3UA 4YRBA 2G04A 2JANA 5IAGA 4Q4JA 3TSAA 3L7JA 4F1JA 1CEQA 4RNDB 3DZFA 4CMEC 2BYTA 3VPBA 2X19A 2PZKA 2DKFA 4RA6A 1T36B 3L1IA 3DBRB 4WACA 4XIYA 5KNCA 5HJ7A 2HQRA 5LNK1 4TLEA 1G3QA 3JALA 5GAJA 3TDMA 3OTOB 1TA0A 1QIHA 2OCKA 3WL3A 2CDRA 4HC4A 1G9TA 1ZH0A 1ZWKA 2JLXA 2FSUA 4ZOAA 5KYVA 1QQBA 4WCFB 1XDWA 3CNHA 4TGLA 4EP1A 3K2QA 3TQQA 3VMFA 4L7VA 2X22A 2WU0A 4QOHA 4KRXA 4Z8XA 4UTNA 3UA4A 4PCUA 1SN7A 4CU2A 1P60A 1Z2CA 1QYCA 4GSKA 3KJGA 2HSEA 2O2CA 1ZD3A 2WBLC 5JIBA 2H00A 3PHHA 2G25A 2OBNA 3F2VA 5CLFA 1Q0ZA 4X92A 2IYFA 3VZCA 3IX7A 3PD0A 4JT2A 3A58B 1WP9A 3R5XA 2A78A 3IAAA 1ODTC 1JQDA 3ABZA 3DF7A 4YALA 5G41A 2PZLA 3EEFA 3MMNA 4ZO7A 4HQRA 2YJ3A 1CVLA 3KLNA 4JROA 1AKEA 1RI1A 2G0AA 5ALDA 1ZHFA 2H11A 1O94A 3AB8A 1HXHA 4RNCA 3RVRA 4JYMA 3AJDA 4MX8A 5CUQA 1Z5NA 3SVZA 4UNPA 1VBMA 4M98A 5F3DA 3Q87B 4R2KA 4RH1A 4S0XA 2Y1WA 1HYHA 2V8BA 3RRXA 2JDIA 4P3OA 2AEEA 3NIFB 4PXSA 3AC0A 3ZWPA 2ODAA 4KK3A 3H05A 4RTKA 1RAFA 2W43A 1ZCAA 1UAAA 2EW8A 1NUUA 1ZM9A 1A7JA 1KK1A 4Z7OB 5EYPA 4UEJA 3WLJA 3NX4A 1FXWA 1B8VA 4IQ8A 5FTNA 1NV8A 4ZAGA 2OCLA 3CZCA 2QP3A 3GRUA 3OZRA 3H5OA 2V6IA 3PLRA 1Y4DE 2FGKA 2VP4A 2DLCX 2IU3A 2X6QA 3LWBA 2I4LA 3NORA 5E3IA 1PJRA 3UH1A 2NTEA 3UBMA 4Q47A 2EKBA 1C1XA 4LZJA 1CHDA 1GGJA 5L4NA 1LCIA 1RYHA 1C8BA 4KDEA 5CIYA 3IAEA 5B7GA 3PFNA 5EZ6B 2EKLA 4P2BA 4RZXA 5COQA 4ZCQA 5GTDA 3TRJA 4ZN6A 2H4YA 1Q16A 2AZ4A 1U8FO 5H8WA 3OT4A 5CURA 4MPPA 4R8SA 1YVUA 4FUQA 2XYGA 1A1SA 2AJBA 4KXXA 2BFMA 4UTOA 1EJ2A 4TOIA 2LP4Y 1KZHA 1NF2A 4PZPA 3RRZA 3EZ7A 1IHUA 2FLKA 3QFHA 3ND5A 1K8QA 4JC4A 3VU0A 2C4MA 3VO1A 5JAIA 4M9QA 3BCHA 4PAMA 1SD1A 4G86A 4UJ5A 4WKGA 2J9RA 5JCOC 1I33A 2PYIA 4UCWA 5FOUA 2BH2A 1ISSA 2VC2B 3CX4A 4YVFA 3K1AA 1N0IA 3CZAA 3QKSB 4L9RA 5AWFC 1QP7A 2WKRA 4M1WA 3SVLA 4GOMD 5J5AA 1QZXA 1YJ5A 1R7RA 2L19A 1RJ9A 3O1HB 3U62A 1XTJA 1BKYA 3B6IA 1TM1E 3E27A 1N2SA 3P0JA 4GC5A 4ZMSA 1UXKA 1B26A 5KKAA 4GI7A 4Z4EA 1WMFA 3AY7A 5BR1A 2R79A 3AUUA 2NADA 5IUKC 4DJDC 1BE8A 1QIDA 8ABPA 1MR3F 4MINA 1C7IA 5JWRA 3MK31 2PX5A 1X7YA 3JAKB 1G42A 3IBCA 4WTOA 2O3SA 2PU5A 3M6WA 4IICA 4X8MA 2O6HA 4PLFA 4UNNA 1FYDA 1AKNA 2C4WA 4OHFA 1OLOA 3CO0S 4YP0A 3UWDA 2G9ZA 1CRWG 1YCGA 1TRKA 2G3YA 1BGVA 1X39A 2JL1A 2JLSA 3B9BA 4O4LB 3MJFA 5E95A 3VGPA 2IHUA 4U2FA 3GLIB 2WJJA 3M4JA 1EDOA 1PVVA 1W5AA 3PZBA 3ZEAA 4C08A 5LMUB 2KWIA 3PL1A 5GONA 4GL2A 1P7YA 1SVMA 2Z1MA 3K1ZA 3FXAA 3A6GA 4OGWA 4X24A 4GZ5A 4MQFB 1WMDA 5BWLA 3ZGOA 3LCUA 2VJNA 3KT0A 3CR8A 4KLCA 4B4KA 3F6CA 1ETHA 2XYVA 3ZXYA 5H16A 4JI2B 2Y0BA 1QVVA 2R6AA 3C98A 4AULA 4W1SA 1J0AA 2FMXA 3R8CA 1G55A 1I2DA 1PEAA 4QTXA 4OHBA 2ZRJA 3FDFA 5FUBA 3PTLA 2BRUA 4BDTA 4KPEC 2A0UA 3AGQA 4JNCA 3ETDA 3H2HA 5TGZA 3ILYA 3WLHA 4EHHA 4ESOA 4YFYA 4F38A 1F2UB 3G8BA 5IU6A 3DLAA 3BSSA 2GN1A 1QQ7A 1GPKA 1XL0A 5FUVA 1I24A 2QTVA 3EVDA 1GRVA 1M0TA 1YR9A 1Z8FA 2FWIA 2J3EA 4RLHA 2GVNA 4W7IA 2EEPA 4A0RA 3WX0A 3L0IB 3ZW8A 1AXGA 4BMDA 3SJAA 1D9XA 4U4AA 2O0MA 5KKCA 3K70D 3LUHA 1PWYE 1QE3A 3G0GA 1O7JA 2PPLA 2WNSA 3C7AA 1UQRA 2DUNA 4R05A 4XEHA 4X71A 4UNQA 2Q5JA 4YMSA 1NVGA 3VSCA 4XRRA 3ZK7A 2D2EA 3GBSA 2BN4A 1R5JA 4D25A 1MEEA 4RKYA 5ILOA 1REQA 4MYTA 4F2PA 1YJCA 3GCGA 5A4DA 1UIRA 3LPCA 1OZGA 2KPOA 3A6LA 4QJIA 2FW1A 1IYZA 5E8JA 5JAZA 2WTBA 1L3BA 3R6LA 4GEGA 4YAWA 4Y8VA 2ZR7A 5BWCA 1N2CA 4NV0A 4CDGA 4JR1A 1Q1ZA 2NYVA 4LXYA 1PYDA 5TSDA 4E0BA 3Q15C 1QV9A 5LD2C 4HWKA 1ZJZA 2WIGA 4OQPA 5CX1B 3IT1A 3FOEC 3PP8A 1EX9A 3ZEIA 1Y89A 4TZ6A 3GBPA 1BVHA 1SWWA 3CPSA 2E3JA 4TZ0A 4HXYA 1Z0ZA 2YZ2A 1P2SA 1BCRA 1CJTC 3FGNA 3NTOA 1RXSA 4MUAA 5EE0A 4EI8A 2F48A 4M60A 5FUYA 3IQDB 5G0WA 3A9CA 4HVTA 3BE4A 1UXHA 2YFHA 3GDHA 5EJIA 2HLDD 3LDUA 1JHRA 3TI9A 3UG6A 3EEBA 5H83A 5JJIA 421PA 1L4HA 1LRKA 2I80A 2P2ZA 4TX1A 1G6KA 2QX4A 3WGLA 3DDSA 3NHFA 3W6OA 5KOJA 1NRJB 1YHNA 3KJIA 4JEMA 4I5DA 4REMA 2YTZA 3WK7A 3TGWA 1I7LA 2QTFA 2PQ2A 2B83A 2CJWA 4GMFA 1TO1E 3DE5X 3R3HA 2P3SA 4PPFA 3DKVA 2JC3A 4P81A 4NNJA 4TMFA 4YP1A 1OTHA 3AOGA 1P0QA 4B3TB 3B6KA 3N2LA 2HA3A 4PQRA 3OI7A 4A0FA 2HRZA 2VQSA 4L9AA 4ASUD 4B82A 2GMWA 3D1JA 3R23A 2W70A 2ORED 4Q05A 5ESXA 1XP8A 3W78A 5DNUA 3TLGB 1ZKDA 3DOUA 2PO7A 4GOJA 2RI6A 2WDZA 4PTYA 1SIBE 1X80B 1AQYA 1FDWA 1TRHA 1GZHB 3S1SA 2Y3IA 4BZXA 3JAWA 4W1RA 4WZAE 5ICSA 3NM6B 4Z7JA 3FNFA 4PYKA 2YDYA 4KMRA 3OX1A 1E2PA 3QLVA 1ESMA 1AB6A 2EC5A 1C7JA 1F9AA 3EZ9A 5HF5A 1ZA1A 3PQCA 4A8JA 1LS1A 4U7DA 1E3JA 1YS1X 2VCEA 4MB6A 1GGVA 2HDHA 3FFXA 4J7UA 3RV3A 4JITA 5AJHA 2VWHA 1YS9A 2MTBA 2ZYTX 4XD7A 5IYZA 2Q4TA 5EGNA 1Q0LA 2XA9A 4A4DA 4C4OA 4AZ3B 1UINA 3Q2IA 1GG5A 2MSDB 4RKQA 2ZYWX 1RJ9B 3NUZA 2XUPA 1COZA 3HVUA 1LV8A 4DV2B 1L4YA 1DADA 4L6CA 4CG0A 4L0MA 2IDKA 2V7QD 2VUUA 2XDQB 3IJEB 3U13A 1AV6A 5BV8A 2CW5A 3EDRA 2BUCA 3I1YA 4JB0A 1TK2A 4UBLA 4UDXX 3ZHOA 1HR0B 2H2FA 3JYHA 1H23A 3QVMA 4JQOA 4NDAA 3P9NA 1KO4A 2PJUA 2XZDA 2HXYA 3UC5A 3ROKA 1ZGCA 2VZ8A 3IA7A 3H1TA 4DUZB 5IC4A 1VG1A 1MX9A 1SCDA 5KTSA 3D81A 4DEYA 1UBHS 4OHKA 4V1CB 2JAQA 1PP4A 1CY1A 5JTUA 1CQWA 1N2GA 2VNSA 4HEA1 4PFJA 2BLNA 3KXKA 1WCYA 3B89A 4TWJA 3V4RA 1Y8QB 4ITVA 2VYVD 4JA2A 3I1IA 2O4CA 3ZW7A 2Z9DA 1HH4A 3MWYW 1Y7PA 2AJLI 4PHGA 5D3MB 1F8FA 5DM0A 1OU4A 2FFBA 4JZKA 2QY6A 4GO1A 1L4NA 2IE0A 4JLJA 3UO8B 1HY3A 3PXBA 4J76A 4L15A 4J16C 2FSHA 1SMKA 5J63A 3SF0A 4ZDIA 2JHAA 3MHPA 4PLPA 1VKNA 2X8LA 1JSZA 2GN8A 1SXIA 3OIUA 4PHHA 3IE0A 4ZVUA 3MAJA 3OPQA 4I4IA 5HIAA 1QG0A 2QD1A 3KKKA 3VOBA 5ALEA 5KYWA 2A7XA 1VKZA 2RCYA 4BNZA 3GHYA 1VECA 1KK2A 4OMUA 1G8AA 1XQ6A 3CNEA 4TV9B 3VPHA 4HV4A 2JHGA 3IJRA 3FA2A 3G8CA 3NIGB 2WVGA 3CW2A 2W22A 4ZKDA 3DMTC 3RTBA 3D7NA 1NZJA 4QUBA 4RX1A 3JR3A 4YAFA 1NSFA 2VJDA 1ECCA 4QICA 1KOLA 2A5JA 4DPLA 2IPLA 1N2JA 4G4JA 2O8EA 4WKNA 4L3WA 4Z4FA 4JJFA 4LJ6A 3VR5H 4LCBA 4HHEA 1IE3A 1RZUA 2E1RA 1HF3A 2CXSA 3GDFA 2DHRA 1YS6A 3RODA 3GVIA 1T1JA 4TVOA 5KNBA 1RJEA 1IPFA 3QF4B 2VJMA 4ZAYA 2CUNA 3SIXA 3UQYS 4RMGA 3U61B 1AKRA 1RFLA 2XTJA 2NNLD 2EU8A 2DHEA 1U4OA 1A8PA 1G6OA 5KTOA 1T0JB 4TKVA 2ZJ2A 1WDTA 3NNDA 1UWKA 4CKWA 3AT1A 4ALKA 3O8DA 1O77A 4XRGA 3UMSA 1PR5A 4ATNA 3ROTA 3K8OE 5TPZD 4ZAZA 2VP3A 2FPGB 5ITVA 2H7VA 3ADBA 2CDAA 1FPQA 4CFYA 2W83A 1M7GA 3FRJA 1HEIA 3I8XA 2OGZA 5BPHA 4C6HA 5HWSA 5A3QA 1V1RA 3TNDA 1ESNA 2GPAA 3QKSA 4B6RA 3STTA 3I23A 2ID4A 1ID8A 4DC0A 1DEHA 3QNWA 4Y7DA 3NZEA 1JFFA 2PKEA 4AKSA 4EECA 4YDHB 4UQLA 5KREA 2IRWA 3ENWA 3A0RB 3DEFA 3VR2A 1U04A 3QX8A 4JXKA 2OO5C 2C8JA 2OC9A 3NJ4A 1EK0A 3GJQA 3UPTA 3R76A 5IFLA 3ELWA 4L74A 1Q0PA 1TYDE 3LP5A 1CD5A 1ML3A 1JDBC 4H3VA 1FX0A 2WMNB 2ZJAA 5KTKA 4FYIA 3V7YA 1EWTA 3LZCA 2R1VA 2QN2A 4QXMA 2J9FA 5EKUA 1ESZA 5AK4A 5EIEA 4BMVA 2O5RA 2QAGB 5AJUA 3D6VA 3HDGA 1BROA 2QD4A 3NT4A 5CT6A 2CLIB 1TLFA 3LVRE 3TQOA 4DYHA 4Z9AA 2H85A 1GD1O 5DBEX 1N5OX 3QH4A 3SXPA 3WL8A 3WXBA 2XYRA 2DFPA 2ORYA 3N05A 4QDKA 4RAOA 4EYSA 5A2GA 2O2IA 3I5XA 1KDOA 1Q1EA 1XXHB 4KV9A 3N6XA 1RDFA 4H1HA 3HHPA 5KVQA 2A0YA 4FFBA 2I54A 5IK2D 2IA5A 4PNPA 1CQJB 2YQ5A 1UPAA 2DWQA 4TZTA 2QUKA 4RMHA 2YHAA 2F7SA 3OLYA 3G2IA 2GAOA 4PC7A 4F5EA 1UMDB 4MQFA 5IABA 2WFZA 1K3UB 1W87A 3BCRA 5BRNA 4CF5A 2VHUA 5BPFA 3KM0A 2UYOA 3KUXA 3M9LA 4OHCA 5AUPB 2FRVA 2NP7A 2RB4A 5FDFA 4QHTA 1TC1A 2GDZA 2XXAA 5C7OO 1XMVA 4NZNA 1WULS 3U19A 1C9JA 5JAUA 4C7OB 5AHOA 3C3YA 3JQQA 2GF9A 3CBQA 3HJCA 4L7QA 2YBDA 4I5GA 5JV5A 1HORA 3UEOA 3W5SA 4BVBA 1NRXA 4MUMA 4AG3A 3HN2A 4X00A 1XT6A 5JDIC 1OI4A 2W6CX 3MFQA 5K4HA 2O3RA 2QMOA 5DJ5A 4IHJB 4RVHA 2BFFA 2XTNA 3KYIB 4K9PA 3ZTTA 2V6GA 4YO7A 4NAUA 3ESXA 1JNXX 4CLOA 3PE6A 2EGHA 1S8NA 1YKFA 1Z18A 2B4KA 3FPSA 3AMVA 1IZYA 1FDUA 1O6CA 2WM3A 5KTPA 3T4PA 3VKWA 1T0IA 1W30A 4O3MA 1K88A 2KLBA 3H1GA 3EXFA 1V9CA 3ZV5A 4WKOA 4QG3A 1M6NA 2XMGA 1HKHA 1DCFA 3QLUA 4RGQA 1P18A 1ADCA 1R37A 1SHZA 1GRRA 3U3DA 5EHQA 1W48A 1UBJS 2DFVA 3WNQA 5SICE 3NUQA 3ZUGA 2GRAA 1EK1A 4EVRA 1ACJA 4AQ7A 3Q8KA 3BXFA 1Q7EA 2KB0A 1P5ZB 5EPUA 3TZBA 3UCFA 2QEQA 5EC8A 1Y6FA 1R6TA 1FRZA 2JIRA 1V7PC 1PJLA 4M53A 1OE0A 4KSBA 4TXHA 1KEUA 1DQNA 1DSSG 2W2QA 2YY5A 2B21A 2PRSA 4KAJA 1M8JA 2OD7A 4P36A 1Q1QA 2IZZA 4QQKA 1S3SA 4C0BA 1NN5A 1Q44A 2QDKA 1EIWA 4MLCA 3TRFA 2X3FA 4NF2A 3ZQKA 2HZ7A 2NO5A 3GU3A 3GJ5A 1NQAO 3NT5A 2EBHX 2D4HA 4KQCA 4K9RA 4OQMA 1X86B 2BFWA 2NX2A 2HGSA 4M7WA 3BG5A 3O1LA 2H57A 2WSMA 4FD3A 4YQFA 5I4CA 1W36B 4N39A 1LZKA 4Q7LA 2YHBA 3QBTA 4Q3EA 4XB1A 4MS1B 4JP8A 1C0EA 3B6ZA 3H86A 1XZIA 2VNAA 2IKSA 1CZUA 4MJ3A 2A9QA 2BJWA 3B5EA 4OI2A 1L1RA 4NECA 2DWCA 3A6ZA 3D6FA 2WP0A 4V0ME 3TRIA 1O5OA 4KDCA 2D8AA 3GH3A 3HKCB 4OQLA 1L9XA 4EHKA 4GNRA 4LRYA 1OKKD 2I99A 2D3WA 3T7IA 3VDQA 3W7AA 2FWRA 3ZE6A 5HQJA 5G1PA 2AIRA 1ORWA 5F2KA 2H1OA 4QODA 1XUOA 3OC0A 4IEEA 5B7NA 2O2GA 3WMWA 3HLTA 4NFLA 5IANA 4DLZA 3BX1A 4MS1A 4ETIA 3DFMA 5IPFA 1XD2B 1C3VA 4Y1FA 1DI0A 2WJZB 3E0QA 3ZCVA 4RJTA 2JK1A 4NCJA 2ZB4A 4XYMA 2PL9A 5I7RA 3DHEA 1CRPA 3UJ3X 3U56A 5KTTA 2J09A 3RK4A 3EFHA 3EZNA 3UMRA 2QQ5A 3OQ1A 4GF5A 5DLDA 2WY2D 4BUCA 2DULA 3I2YX 4WJZA 4DLLA 2NXJA 3CWZA 3SXUB 5LQRA 3D0OA 1KA9H 2OKCA 4H3HB 3RFCA 4XSHA 1O6ZA 3OA2A 2VJLA 2YYSA 1IUKA 4KYVA 4LBYA 1JTFA 1YS4A 5K01A 1H94A 4BFYA 1G8FA 2NZUG 3K5HA 4HDMB 4UNIA 1A95A 4G09A 2IV7A 3ZK9A 3EF1A 1BDJA 3JZIA 4WXEA 3ITEA 2P2NA 5KCMA 1NONA 1UAYA 3JVDA 5DBOA 1Z5VA 2BHLA 5EUQB 4C0HA 2ZVDA 3H2JA 3URKA 4GOXA 3OEHD 2O2EA 3TW4A 2VK1A 5LCXA 2QR5A 1EK6A 3N28A 4M87A 1O6GA 2VT2A 3UAWA 2FFAA 2ZJOA 3AUYA 3JVIA 3NYRA 5KVAA 4FCCA 2XUOA 1TGVA 5TMBA 2L42A 4FYWA 1QWSA 5CT5A 3TOSA 2XLCA 3U9LA 1M8KA 2HCFA 2X5XA 1PR3A 1TTPB 4DANA 3TSZA 3BIOA 4HDSA 2FZWA 1Z6YA 3HEMA 4FILA 3IQZA 4MK4A 9ATCA 3LW8A 4AJNA 1Z82A 2PUGA 4PO3X 3A14A 4GWGA 1HDZA 3CF2A 3ZW9A 2AR0A 2JGKA 2GN0A 3FSGA 3L5KA 1Z56C 3SDBA 1Q20A 5LWQA 3OZXA 5JPIA 4Q9HA 3H75A 3T7KA 3FWHA 4KAAA 4ND8A 4RK4A 1Z4MA 2C84A 3R8XA 3ZE9A 4ZO9A 2CLSA 3GGDA 3L43A 1VIVA 3DMDA 4WXHA 5LP6A 1A4UA 2IY9A 2NVWA 2PGXA 3NG1A 3LGXA 5LB4A 3QY0A 2V7QA 3GPIA 3ORRA 4QPNA 4BXOB 3MJDA 2RHTA 1CUXA 4PZDA 3BMNA 3K6SA 3DZDA 1HNNA 2RK6A 4P32A 3BS4A 3MSXA 3DWIA 4F71A 1NVVR 2XA1A 2E5FA 4MV8A 5CRIA 4MHTA 1A3CA 1NP6A 2ZAGA 2QVLA 3LKDA 4A7PA 3UWMA 3BFPA 3DDUA 4JIGA 1Y3HA 3G68A 1EFHA 2JIPA 3KTAB 3M5DA 4DLUA 4YO8A 4ZK6A 3ZGZA 1WDLA 2Y92A 3PQDA 2P2GA 4H7KA 1LSJA 3RSZA 3H5NA 4G23A 2AOWA 2PMEA 3PYLA 4HB0A 4AG5A 3H2YA 1UT8A 3NFYA 4TQUS 2OFOA 1I3CA 2OORC 2XAUA 2W98A 3E9RA 5JSHA 1Z47A 2LGJA 2JGDB 3GAZA 2PT5A 4Z1MA 4D8VA 1GTSA 4RF4A 4CN8A 3LWDA 5GZ6A 3AZQA 3V6LA 1BHSA 1KEVA 4XWKA 4JYBA 4Q39A 2FW6A 5A1TA 5HF8A 2FJ0A 1G1MA 5JS6A 2P6MA 3QPUA 2IHVA 1SVIA 2PLNA 3JQPA 1FLVA 1V8FA 3LUAA 2YIJA 2ZYHA 1CFJA 1C50A 3FUTA 4MWCA 1HBJA 3KVYA 4XSVA 2Q3BA 4UW9A 4YACA 4Q1BA 521PA 4YCCA 1VL5A 4YXFA 4ZZ1A 9GPBA 2QN1A 3OQIB 3QXSA 3CH5A 4J90A 3PHGA 5BW4A 4QU5A 1KARA 3SBOA 3BPSA 3I04M 2ZROA 4ER5A 3E2PA 4OYYA 1K7EB 5KNCH 1L5LA 2Z4TA 3UC9A 3L0YA 2G5TA 4YS6A 4WNIA 3PQ8A 2FR8C 2NG1A 4HZUB 3UJ6A 3E3LA 4IUCS 1UEIA 1I2BA 5BNFA 3CIFA 4BOYA 4DIFA 4B6GA 2YJZA 3F3SA 5AYVA 3DFKA 1BTOA 1N4AA 1PW5A 3JQCA 4QFMA 1K98A 5I51A 4CG2A 2O1XA 3E84A 4ZVTA 4Q19A 5JOQA 5C51B 1SQSA 1HYGA 1LRJA 1ZUHA 2WMOB 3PT5A 4NFSA 5CYFA 3ZQJA 4IGFA 1WS6A 1E98A 1OIVA 4KUEA 1AS3A 1KHTA 4V0SA 1EXDA 1PT8A 5TIIA 2J6IA 1R66A 5K3AA 1H0HA 1PR1A 3E70C 4HFMA 1H9AA 4LBZA 4KACA 4RYLA 4TT8A 4ESHA 1E5LA 5BN1A 4TVSA 3SJ7A 3AR4A 2NTJA 4GPEA 4JJ4A 4XIIA 1X19A 1E3EA 1NPTO 4GW3A 4IYRA 3NNSA 1WHSA 4NBVA 5K3SA 3IULA 4Z4GA 1RYDA 1JQKA 2W4MA 4U2KA 5CFZA 2QX6A 2XE7A 2YZGA 2G83A 2DQSA 2YQ4A 4XJTA 3H99A 3PDJA 2IBSA 1NU6A 1HC7A 3B9QA 2ACKA 3EDOA 3UAVA 4UUNA 2DFTA 2IUEA 3EH1A 1ZD9A 3KQTA 3NB0A 1PVDA 2BEUB 2WUVA 2E4YA 4GMGA 3C7CB 3E03A 1M66A 2DT5A 4ENTA 5B3LA 2F4VB 4DL9A 3A1EA 3M49A 3O8NA 3QK7A 4QBTA 1XPJA 5BWMA 3AONB 3FNGA 3HB1A 4LC0A 2W2LA 5FH9A 3V2GA 1XMSA 1K66A 4MQEA 2WD7A 3NHMA 3BZUA 1E9FA 1LVHA 2WILA 3AF2A 1GL9B 3IEIA 3GEPA 3NJRA 3ES9A 4TLBA 2OR3A 5EA2A 2V4MA 3GFGA 3LKBA 4IKOA 4HI0E 4XYGA 4IRUB 4WBNB 1Y7LA 4M8KA 2CJXA 3HLYA 3LXRA 3H97A 3S2EA 3VV3A 1FS5A 4YXWD 1ADYA 4F91B 4MGKR 1MVNA 2A14A 2DY1A 2P41A 3RG2A 4MIOA 2W6MA 4LGYA 3O75A 3ZTYA 1NLZA 5L40A 2Z56A 5ITSA 1ONBA 2B4AA 4G2NA 5IS2A 2P6RA 1QC5B 3WMRA 1R9GA 2AB0A 1WMEA 1LDEA 3EOZA 2VTDA 2JI4A 2XTZA 2E6KA 1H69A 2I2BA 4J1QA 3RYIA 4A3SA 1D2EA 1V8PA 2R6R1 3OOYA 1RRPA 4MUHA 4PZLA 4QXOA 4DCOA 2F4NA 1X14A 4R8RA 4QZVA 1NUSA 2AFHA 1I2ZA 4A1FA 1I4OA 2W6IA 5EKXA 3D7LA 3HM2A 5JANA 3LZ6A 1CZRA 3RJ5A 7MDHA 3AIOA 4CLHA 5B6IA 5IEBA 2GYWA 4FDVA 2ZIUB 1QP8A 2EKPA 2HF7A 1W0CA 2G5CA 3DVQX 4I0WB 5T64A 3UHJA 1GPUA 2QW1A 2IIBA 5JDIA 3EGVA 3NHSA 5AW8A 3SU8A 3ND6A 3PWZA 3RVPA 4D79A 5KI6A 1HDEA 2C5AA 2O3JA 1P3DA 2PXHA 3MT0A 1CK4A 3EE6A 4R6XA 5K7SA 3RC9A 4HLCA 1NE2A 1S0UA 1X80A 1P9LA 1XG5A 1KDVA 2A33A 5EWJA 2IYAA 4B4WA 2PQMA 2IP1A 2QPAA 5FTWA 1EDBA 1W46A 5ELXA 2EGUA 2IXDA 2OENG 2GEDA 3HO8A 1B4DA 3O84A 3OZBA 2OZVA 4RZIA 5G3YA 3NCHA 5EWJB 3AESA 2AEJA 2ZVJA 3GC6A 3IIEA 3NC0C 3JY6A 4C6RA 1KAQA 1LC0A 3DDOA 3RRNA 3S8EA 3IE1A 3CVUA 2H2IA 2J3DA 4I08A 4QT0A 4BNLA 3RK0A 1RFGE 3FMVA 4U5QA 5EY5B 3ZIDA 4AL4A 1G7CA 1YFZA 1FUUA 1J7JA 1N0HA 3ZHRA 3I1JA 4IXNA 2SHKA 3H8WA 5IW8A 1F4LA 1QPBA 1OVGA 2Q5IA 2DCUA 3A37A 4Q3DA 4XX0A 3SS8A 2EJWA 4BFWA 3HFRA 4ESEA 2HPZA 4RJLA 3OAAD 3IR5A 5TF4A 2OBFA 4BYMA 2PL3A 5JPCA 1C81A 1RYZA 4TVKA 1IB6A 4DAOA 5CDFE 4F93B 3HYRA 3WWEA 3ZK8A 4IJWA 3C87A 4MXDA 4KCGA 4OD0A 2GCGA 4I5IA 1KBOA 4MGYR 5I9BA 4A73A 4I5EA 1SXHA 2ECQA 4G4SP 3LY9A 4NG4A 3FVRA 1WD5A 5LMCA 1MRZA 2QN9A 1MKYA 3DMGA 2ICAA 4G56A 3WGVA 4XM2A 4MUXA 5DGIA 1OX4A 4EG8A 2G9QA 4Y2UA 3ZOKA 2ATXA 4U0KA 2GN9A 1N1DA 2FFHA 3NUGA 3OTWA 2ZYUX 1YZLA 2NW6A 1JWBB 1SURA 3VR4A 1MVOA 2PVSA 4KJXA 2YASA 4JJ7A 1BA2A 4DA9A 1M2VB 3BTSA 2CV1A 1L7OA 3TOZA 2RHHA 1AY0A 2QY9A 4F6CA 3FR7A 3OY7A 1NYQA 5MF6A 5ANRB 1JG7A 4WCFA 2ZB2A 2ZXEA 1BAPA 1T6NA 3ISTA 3ZBTA 4MDEA 3G8DA 4RD6A 3HFSA 1E7MA 3W6UA 1IJEA 2G5PA 2WJ6A 5LQKA 2NIPA 2WU8A 4G07A 3ZXSA 2RGRA 3W9UA 1I7QB 3K2IA 1BVYF 3ZS8A 4W5OA 4CI0B 2N47A 3Q8MA 4UE3S 4YFVA 2PRKA 1WF3A 2W8ZA 3C3KA 4UM7A 1PJSA 4NESA 1KYVA 2OBYA 1NXPA 1QZTA 1B8UA 2H06A 3H0KA 4OJYA 1BEUB 4R54A 1YE8A 5LB2A 2V7PA 4X54A 1KYWA 1HRKA 4BGUA 1U02A 1YU9A 1ZM3A 2H51A 4RQBA 4IMRA 2PLWA 4IOLA 4HH1A 2R11A 4U2EA 1S2IA 2X9LA 4WRRA 3V34A 3IAFA 4V1CI 1UT6A 2PH3A 1Z7EA 4GZLA 1UUFA 2BGMA 4G24A 2BM9A 1Z88A 4N5LA 4HXEB 2Q0QA 5EHGA 5J9FA 3TLAA 3UPUA 1FJGB 5LDGA 3LC7O 5D6NA 3W79A 1Z5ZA 3A1DA 3A6FA 1E6UA 3BORA 3IV6A 4ZEMA 4I4LA 4FVTA 1DKQA 4IDGA 4U7PB 4U7FA 2XI4A 1TK3A 3NHPA 3QW2A 3L0ZA 2GK4A 3JZFA 2D7CA 3MWGA 2VPYA 4AF7A 3S2FA 1PX2A 3JTMA 3EDQA 4OA5A 5TQ0A 5AVXA 5I47A 1WU8A 2FHPA 3TCXB 4IMJB 2P9QA 1WAMA 2ZYAA 3HP4A 3UXYA 1EXWA 5DULA 1JSXA 4QUGA 4B76A 1ECBA 3E5NA 4RHEA 1CR6A 5E6RB 4U63A 3IOYA 4CR7A 1ZONA 4AJPA 3RU3A 5AD1A 3G2KA 3HP7A 5BWOA 4ZT4A 3N7UA 2OESA 3DL2A 2GD2A 4IS3A 5M34A 4OQXA 1FQWA 2QRVA 3OLWA 2C61A 1RE1A 2YV1A 1V7QA 2PH1A 2C78A 3MCZA 4FDTA 3TLZA 2B30A 4B83A 1E1DA 1QK4A 4CM9A 1D04A 1Y1KE 4G0PA 5CT4A 1M5RA 3R3SA 4X66B 2C9OA 5B6PA 2C7QA 4YCNA 1W34A 5M04A 2I4TA 1QS0B 3GLFA 3L6DA 1BMDA 4DA8A 3RRFA 3UK7A 1XKXA 3PD7A 2JKZA 2X6TA 4YWHA 4B6PA 2RK4A 1U1CA 1EP3B 1KQPA 1IXKA 3S5UA 3BJRA 3USES 1OYVA 3B6EA 9LDTA 1YI8A 3P9SA 5INTA 2XGGA 2H2HA 4ERNA 1SBZA 2WI8A 4MWTA 1SG6A 5FWXB 3L6BA 1FS4A 1L1FA 4RADA 5IN5A 3RHSA 2WHPB 1REQB 3WYAA 4FW9A 2B4YA 1SJ9A 2DQZA 1E2DA 1M10A 3ISJA 2XVXA 1ZC4A 5JVDB 6YASA 1OXXK 4NSNA 5A5GA 2HW8A 2BHTA 1ITZA 1JDNA 1WW2A 1ZI8A 4OATA 3RC3A 4IJUA 4RTQA 2C54A 3E5RA 2O4UX 3QJGA 4KO8A 5EMKA 3ROQA 1SZDA 1U0FA 3OEYA 2J5RA 3NHBA 1HG1A 2RGNA 1XLTA 2RI1A 2O8VA 2FP4B 1T24A 1V1MA 2GJSA 2Y1FA 3A70A 3OM9A 4HZIA 3TRHA 3ZTWA 3BZBA 4DMMA 4C07A 2I7VA 1Y7HA 3IALA 1CNFA 4FYHA 4M38A 3VNBA 5BVHB 1AN0A 1KAOA 2CJFA 3ELUA 3HUEA 3I4LA 1M2FA 4HBZA 1U6KA 3GJRA 4G3XA 2C3MA 3UKJA 3I37X 1GPAA 3QLUC 3U16A 1VC2A 3TJRA 2NO6A 1V3TA 4ZPXA 3DJFA 2GT1A 1JH8A 5CYGA 1N25A 3H18A 4TMXA 3ZY6A 4Q3CA 5E7MA 1M2KA 5A3SA 2NVBA 3SSAA 1NMYA 1WCWA 4K6CA 1MA3A 3DDCA 1U0LA 3LUBA 1N0WA 1CZHA 3RGWS 2OFWA 5AW9A 2QUHA 2HJRA 1A50B 3MCUA 4I4NA 2FX2A 2PSSA 3DLIA 2ZATA 4BFXA 4TTIA 4ZDKA 4HQFA 5FXMA 4XI9A 4QAJA 1EXVA 5D5HA 3CNNA 1IHOA 3L3BA 4RXUA 5E9AA 4KB5A 4BASA 3QMWA 3K9HA 2JFUA 3OA0A 2YJ5A 2P78A 1QWOA 3N53A 3TCNA 1FBTA 1I1NA 2ISCA 4J2TA 1F8XA 3BQNB 5DNVA 2HR1A 4LF9B 3RAGA 3G3EA 3QE9Y 2GO1A 1EE2A 1M67A 1SRQA 2Z58A 3JWPA 2I6TA 4R83A 2JAUA 3K9CA 3CVXA 3T5DA 5KYGA 2CDCA 1OXKB 1IHDA 2CF5A 3M89A 3SX4A 1YA6A 4U3JA 1O89A 1N4DA 1O9HA 2PWBA 2SICE 3C5VA 4D0NA 2ZUBA 4IIXA 4RVCA 1AKMA 5BSGA 1T2AA 4QG7A 5IYZB 2XADA 4NICA 4M7OA 4L5CA 4CT5A 4TYPA 1NWHA 3LKZA 1QP4A 3OZEA 2C2ZA 1C9NA 1G41A 4IHJF 4BCBA 2K6GA 2JCGA 3AP3A 3GT0A 4ALLA 4UEQA 5JS2A 1KORA 1K7YA 4AMBA 3JQFA 4X85A 4B35A 4EA8A 4AJ9A 2EKDA 3MJ4A 4GVPA 3FLAA 1L7AA 3HJRA 2QRJA 3CISA 1HSZA 5ITZA 4GP7A 5AI9A 4F72A 1TKCA 4OK3A 1GUBA 2GLXA 3OD5A 4WK4B 3ZYCA 1H6AA 3Q7IA 4MV0A 2FPRA 2NWQA 5KHLB 3QYFA 4DCCA 1NVDA 3BE8A 2BEUA 3RSQA 5G1NA 1Z7BA 4CQLB 5LC1A 4HVCA 2REQA 4KODA 1HPLA 5TE9A 3C4JA 3CNQS 3I32A 3WBKA 5BOVA 4C0JA 3ZWNA 1XZFA 2H63A 3AWIA 1VJ5A 1AOXA 3GH1A 1JMYA 1Z26A 1GNTA 1ZNZA 3DWFA 1KKMA 3NH9A 4BNTA 3A2KA 3QU4A 5C5CA 1FU8A 1KVUA 4M0DA 2P79A 2XUZA 3CW9A 1M76A 3GXBA 1Y3DE 2ZU0C 3NH6A 3OOHA 4FR5A 5T3UA 3K09C 2I7CA 3T35A 4JX8A 1GKYA 5LZ4A 1EE1A 3O4FA 2CNWD 2VP9A 1Y1LA 2R4QA 3QVGB 5BSUA 3W5CA 1PV4A 2HSDA 1C7EA 2VHJA 2YR0A 3IBFA 3L1VA 3N76A 5HE8A 1GR1A 3QEMA 3V42A 1J2EA 1L5WA 4BX2A 1BXZA 4MQ4A 1Z4OA 3CLTC 4ZC1A 3L6RA 4FX5A 4E08A 1DAEA 3RWBA 5ECGC 1R8XA 2EYQA 1LTHR 1UJ4A 3EXAA 3VNAA 4C78A 4AKIA 4JP5A 1CUHA 3WKDA 4F6LA 1GRCA 2BTOA 2PS1A 2HRRA 2CVOA 5IBCA 2VZ0A 4CV1A 5DOVA 5JD3A 3OZAA 4NAVA 4RETA 3DQPA 3AI3A 1NDQA 2C4TA 2FMHA 3ROFA 4YQYA 1H2ZA 3N2ZB 4IWXA 1QKJA 3STUA 1IN4A 5FP0A 2AX3A 4CUJA 1Z5GA 3CVVA 4P86A 1F8UA 3BH6A 2AE2A 4X63A 1RI3A 5IDYA 1JFFB 1NKVA 2BFNA 1P72A 3D4BA 1AQ6A 1UEXC 1DBQA 1CY4A 3L1KA 1NFRA 2CL5A 4S3MA 4CLRA 2BFBB 1ORRA 4DZTA 5K3DA 4AKHA 1TYEB 2ZRHA 3QX9A 2VA8A 2VVTA 2ZBPA 3TMAA 4F5ZA 4N49A 1EXMA 2XT0A 2PIDA 2IY8A 5FQNA 3L9WA 3K1JA 1D1QA 4PU0A 5FYQA 2Y76A 1CQXA 4JQSA 3MTIA 3F7NA 4IL5A 1ZDMA 4FEYA 3WYGA 2JGIA 3JQFC 4KR6A 4JQZA 1U3VA 2WP8J 1LSSA 3TAUA 1F8GA 1MJGM 4RPKA 3KEGA 4WVFA 1CQIA 3MUNA 4MR7B 4QLAA 1PQUA 1I2AA 4UHEA 2CWWA 5C81A 1U99A 4YT5A 1KJ9A 3OLQA 1XRJA 3ZE8A 4A8JC 3I3OA 3M5PA 1QKKA 3SKYA 1I0LA 2DFDA 2FWAA 2HSJA 4G0VA 1BJTA 2AUTA 4B3XA 1DTWA 3FOAA 4UE2A 5AW2A 1DRVA 1Z34A 1NOIA 4BC1A 4W6ZA 1ZZEA 4UTVA 3KSAC 3KB8A 5AXAA 2I65A 2FZEA 2ZWMA 2IU0A 4J0DA 2JKYA 2PUWA 1GZ7A 3E5MA 4UFOA 1Y6GA 4HH4A 2P0EA 1SPXA 1UK8A 2CYAA 2J87A 3EEQA 4MLDA 4X7BA 1DKOA 1E5DA 3SIPA 4EG0A 2O0LA 3D2CA 2PZFA 4GD3Q 4DMUB 1KF0A 2P68A 4YDSA 1URPA 1NJ2A 3UOGA 1SVUA 1M33A 4G5RA 3TTUA 4C9BA 3OD1A 3C43A 2JBHA 3G2LA 4LJRA 3K3PA 2JJ8A 1RBMA 3HU1A 1E2MA 1GTG1 1O03A 1U5BB 4KUHA 5FOTA 2FW0A 1Y1SA 3QTLA 4D3FA 1NRWA 2P30A 5DMXA 2QWXA 4XTRA 1EVZA 1YR7A 5FR1A 3UJCA 4HDKA 3QHPA 4DLPA 4DAEA 2ZWPA 2X8BA 4IIUA 4NYJQ 4OHUA 1JTEA 2H9AA 3GZJA 3FYUC 4BHTA 5AVRA 3WGIA 1YZGA 2IEIA 2JFQA 1Y82A 3PFBA 1ATZA 3TLXA 1PL7A 2HA2A 2YNMD 3PUKA 1VCMA 4G1MB 4GAEA 3QIVA 1EX6A 1OXMA 2VRWA 4FLMA 1ISGA 3FPLA 1MGOA 1EZ1A 1RM3A 3BWYA 4REQB 1K7CA 3TIIA 2EKZA 3EVGA 1TMYA 3G7UA 4JCOA 1U8YA 4IXDA 1JG6A 3WL5A 4CUZA 3K4PA 3K94A 3SICE 2OXFA 2BF4A 1G7RA 3U7EB 4DLBA 1YCDA 1CULC 2IH4A 2IUFA 3L6CA 3VJMA 4OFXA 2YWBA 2WM8A 1F20A 5JBNA 3CUSA 4E2YA 5E9WA 1X7ZB 5B5SA 2O2ZA 3WAJA 4XUEA 3AF6A 4LDJA 2QRUA 2ZIXA 3VR6H 821PA 3UM9A 3GA0A 3ZQUA 2XNSA 1H1LA 3E9DA 4ANFA 4BV9A 2XKKA 3PX3A 3JALB 3QUTA 1WSBA 1DJOA 2Q2NA 3QJYA 3EMVA 1CEYA 5FJIA 1J21A 4NMWA 3T1HB 4C06A 4IQ0A 5GGXA 3BGIA 3HCPA 4GEKA 4OH1A 4A26A 1DG3A 3KSDO 4G97A 3X1XA 4FDAA 1I30A 1OLXB 2A1TR 2QN6A 1SQ0A 4MZDA 4Z1MD 2CHVA 4ZU1X 4M8SA 1EFLA 5FNVB 2GEBA 5A4FS 5EJ9A 1DO0A 1Q7RA 3EIOA 1TIBA 1KQ3A 3A25A 3DYVA 4WNAA 3S8YA 3ZDDA 1ZH8A 1KP3A 3DTNA 3HV2A 2ZJ8A 1F0KA 3BSYA 2HMAA 2QQFA 3GXOA 3DONA 2RK3A 3NWJA 5FCDA 3ZIAD 1QHSA 3H2KA 3EHDA 4BN5A 1ZD8A 5LOVB 3T3HA 3DFUA 3WTBA 3WGUA 6PFKA 1KS2A 4GH5A 4DE5A 4DLSA 1ABBA 5KEIA 3ZHUA 5CGZA 1LPOA 1CU1A 4YMIA 3MS2A 3X43A 4BQFA 3ITDA 1KO5A 2GXUA 2P91A 1DC7A 3WIDA 2Q3CA 4XDZA 4R8VA 2J48A 1G8KA 1V41E 5FBZA 1HOXA 1HQYE 3VJKA 1NE7A 1P2VA 3HJAA 2A57A 2VYNA 3AGPA 3DT8A 3DYBA 1N8SA 1UBUS 2JASA 3KD2A 1RHUA 3BUSA 1YQ9A 4MVXA 3D5TA 3COVA 4NBRA 4S35A 3FGPA 5HM6A 3CX8A 4OXQA 1NQVA 2E5LB 1KFBB 4S1NA 3FCEA 1KSFX 2ONYA 1L9KA 3QGMA 3WB0A 4CMIB 2HADA 4P4TA 3X3HA 3HXOA 4LJ4A 3V8RA 1N2BA 3P2KA 4XUGB 3RQIA 4D8UA 2R86A 3ILSA 2ZSAA 2KW5A 3FLBA 4UHFA 4YTEA 3VR0A 4BB6A 3CMMA 4BEJA 2TSYB 3VR4H 3CEAA 3VISA 4KXYA 2G1UA 3BL5A 5FUQA 2VOEA 2RGAA 2ZYSA 1G2OA 2I0FA 4G37A 2VP0A 4PVCA 3THOA 2XVMA 1E8DA 2FQXA 4JB3A 3PRKE 5HCNA 1J2YA 1GPDG 1CZLA 1XTBA 4RPHA 2P2CA 1Z3IX 1EZZA 1H8EA 1B16A 1N6NA 2RGNC 3PA6A 3UQZA 4JIMA 3GJ0A 4ZARA 3MJCA 1VSBA 3FCOA 5JNVA 1J49A 5EZYB 4JGGA 2JFHA 5H02A 4QYXA 3LXMA 3ED5A 4ZVQA 3LFUA 1X3LA 4KOEC 1JHXA 4PSDA 4CDNA 3D4OA 1Z6TA 5AK0A 1LX7A 1NQXA 2Q0SA 1OWMA 3WQBA 2PMKA 3RJTA 4NDNE 2WAYA 1GYRA 3PJEA 4JJ6A 2ZM5A 3H11B 1MC1A 2Q1YA 3A0UA 3GFRA 3NGMA 4M1ZA 5DBIA 4M0FA 3LFHA 1YUMA 5JQGB 1RIIA 4JKYA 1SELA 3F1LA 3B13B 1US8A 1W35A 3IAUA 3IIJA 3W1WA 4CHGA 3F7TA 1HEYA 1JJBA 3BHJA 3PG5A 4UDOA 1YRYE 3AI7A 1B15A 4RMIA 2ZZKA 4FK8A 4J1SA 1XLTC 2NT4A 4L4YA 4B5KA 4PX9A 3RF6A 4CMGA 2IXEA 1QV6A 2IY7A 2BP7A 3HA2A 3OJWA 4RLFA 3VX3A 1J9EA 5ADWA 1UMBB 4LHWA 4ZGBA 2QROA 1R8JA 4CT0A 4IX1A 3CEHA 3EODA 4DDWA 4TPKA 2ZBUA 3GUZA 5EI5A 3D4IA 4FFWA 4B74A 4ZAWA 3AUXA 1P8JA 2EG9A 2HMWA 5M3BA 1GYPA 1V39A 3COSA 1YQXA 4QRIA 4RGYA 1C30A 1G21E 2OVBA 5JW6A 5CFQA 1NLYA 4AMZA 3PGLA 2ASEA 4MI1A 1VBNA 3BREA 2BEKA 2X58A 5L7TA 4NU0A 1B0AA 1YDMA 4OP1A 4EW1A 1RAHA 2GXAA 2CFCA 1U2GA 3FWPA 3A1FA 4TMKA 1PGQA 4W9NA 3BBPA 5FA5A 1TMGE 4ZVVA 1B6GA 2NZVG 4KI7A 5BUQA 1KJYA 2JGLA 2B8TA 1QVRA 1U2EA 4XPZA 1UDRA 2XDWA 4MMYB 4OQZA 2F3PA 1DBSA 4GSLA 4PN7A 4A10A 3KOOA 2DR2A 1ZGHA 4EB6B 1QUFA 3PDWA 2GZMA 1ORTA 2GCIA 3A27A 3O1IC 2JRLA 1F38A 1CVRA 4TN1A 1XRSB 3TIFA 1VPWA 3NLLA 1PHPA 1BDIA 4KHPB 4Z5XA 1HT0A 2YC4C 1Z16A 2Z8YA 2R44A 3EYWA 1IAQA 3PDIA 4M7PA 4PZ0A 4RENA 4B3MB 1UC5B 5IM5A 2ZRDA 4HD8A 5JLAA 4NJEA 1JU4A 5A6SB 1EG2A 3DT9A 1EBFA 3KVOA 1BWRA 4LTMA 5DN6A 5I9TA 5LL6P 3EPLA 1NVXQ 1XALA 3O2JA 1RP1A 2IZ7A 5JEDA 1LLCA 1O5TA 2PAAA 3H42B 4WNYA 5AJYA 4BB5A 5JDCA 4G8BA 3DEZA 2VDQB 3H65A 3MTQA 5T8KA 5E7QA 2IDZA 2FNAA 1Y81A 3KSUA 4QHSA 4Z4CA 5TNXA 2X42A 4MJLA 2OHGA 4DIBA 1Y4AE 4MYUA 2Z9CA 4WJKB 1W1UA 1AUPA 2WF6A 3KR9A 4INAA 3D5EA 3NVMB 4ITRC 4V0LA 1Y3IA 2AN3A 3HSSA 1SEVA 4JEUA 5CMLA 4D80A 4KQJA 2I3ZA 5EJAA 5CVEA 4EHDA 1FY2A 4LVCA 3QOWA 4NOMA 2JPDA 1Y3BE 1TYAE 1WR8A 1J5EB 1PZMA 4MUBA 3ONDA 4JVLA 1X15A 4YRRA 5EMJA 1JS1X 3SZGA 2FZLA 2IPMA 5TX7A 2GAAA 1ZOPA 4MUIA 1U8UA 4ZI3A 3OTHA 2IYQA 1M75A 5FKJA 1BQEA 4AQDA 4OH7A 4UVDA 2FRXA 3A7DA 1V25A 4NP6A 4R16A 1SG0A 4ZQFA 1XRNA 1UMBA 1P45A 3HRIA 3KLBA 1FMTA 3KHUA 5AKLA 5LYJF 2V7BA 4I1YA 4R1QA 1WNTA 3KNZA 3C6KA 3L41A 4JP2A 4BMPB 1G17A 4N5NA 1G19A 2W2TA 1YMVA 4EY4A 4DMGA 3AR9A 1WVMA 4DW8A 5K0NA 5JMOA 1TLTA 4F4IA 3OSUA 2Y27A 2IQ5A 1OC2A 4BLVA 3ZLTA 1O6BA 2A67A 2CHGA 2IOFA 4M76B 2KBEA 3L0SA 4TTTS 1P7VA 3OT5A 3JQGA 1QRDA 1FXUA 3QQPA 4FIZA 3I5AA 3EDYA 5EVCA 5KSWB 3A28A 4RL4A 3MD9A 3TPFA 4TV9A 4JBNA 2ZSJA 4AJJA 4GUAA 1VBKA 1UXOA 2V4ZA 3VKUA 3VUFA 1GEGA 3IT2A 3ZVMA 4QOSA 3HU5A 4OLBA 5B37A 3IVGA 3NOOA 3DV0B 1OI7A 1ZAKA 3OZVA 3TEFA 10MHA 4PPNA 2R7NA 3DBHB 1A9XA 1PS0A 1U0OC 2HQ1A 2NO4A 2VDMB 4AMGA 1N6RA 4LYDA 7AT1A 2HDNB 4BNHA 1QAQA 3AU9A 5IXJA 2CBGA 2WFLB 4O0LA 3KQVA 2V6BA 2G0TA 3ZGVA 3ZU3A 1RTKA 4MW6A 3OQNA 2AVNA 2QKYA 2FPWA 1DXYA 4KQHA 3RI3A 1Y8QA 4HDQB 5EZSA 4MH0R 2R87A 1K63A 3QLVC 1SXJE 2OLJA 4YJ2B 1LI5A 2YJ6A 4DNQA 2RHDA 5DWQA 2UYCA 4FXPA 1MJNA 3KL2A 2QLJA 4A2WA 1E69A 3G6KA 4P84A 4DJJA 4L6IA 1E3TA 1G7TA 1GZDA 2H48A 4JD5A 5C34B 3D7SA 4HLUA 4AX8A 2UXDB 5F7JA 1V6CA 5FBQB 4ENRA 2QORA 1ZNXA 5E7IA 1VG0B 5CJJA 1J23A 4FFDA 4NBWA 5AK3A 3VR3A 2B8JA 2OCGA 1NPYA 1TF5A 3EEOA 4B2PA 2IP2A 5L3SA 3DMRA 1UBTS 3OQIA 4QPDA 4Z4IA 1A9SA 1Z25A 4MVJI 3RVKA 1RYYA 1W5EA 4OBEA 3T0IA 1FTQA 2C5HA 2CKDA 3LC2O 3DEKA 1S7CA 3WNVA 3OJFA 2GXSA 3IAXA 2P2DA 3F5DA 2ZW9A 4RXTA 2JJQA 4U1RA 4UTXA 3ZDYB 1T8RA 4LTDA 1KVSA 3QEOA 2XMZA 4L9WA 2FR8A 3BMQA 1VE9A 3P94A 4RAQA 5DGHA 5B64A 1SC3A 16PKA 3Q5EA 4LJYA 4NZMA 1AKTA 3QXCA 3H6KA 4H4DA 3S1AA 1YI0A 1AC5A 3KB1A 4YRQA 1JLRA 2DSTA 3AB7A 1JG3A 5B1YA 1ZBDA 1R6VA 1DEXA 1V95A 3PNVA 3UJPA 4DIOA 2QAGC 4G5GA 5DM60 5LQDA 2VP6A 1FNBA 3HBFA 4X1KB 5T4EA 3LQRA 4BZQA 3U5ZB 4HSEA 4N5MA 1SC6A 3VC7A 1AQNA 1ZC3A 3DA8A 2HA5A 3ZWOA 5LQJA 1SOWA 4W63A 3AJ9A 5AM4A 4QTYA 3KJZA 4YMWA 4Y2SA 1T5DX 3ZWVA 5K3FA 3MWFA 5DP1A 4DA0A 2QPTA 4RF5A 3FJOA 1GAQA 1W2GA 2BONA 4FFMA 5AH0A 4CL2A 2QTCA 1DXQA 2XE4A 2GJAA 1R6BX 1W0JA 1ZG3A 4HDRA 4D9KA 4TTSA 1Z6QA 4TSRA 4UULA 5DEOA 4OXNA 1RAGA 2OO7A 3BJIC 4P80A 3Q7TA 4J29A 3ZCPA 5DASA 4TXLA 5I7UA 5K0BA 2XCIA 3U1BA 1Y8RB 3T15A 1DRJA 2Z3VA 2AC2A 4KR2A 3TEJA 3LPDA 3DE2X 2HF9A 3AEQA 4AMUA 1G4UR 2QS9A 4Q1CA 4WY5A 3TSYA 3U4CA 4P2GA 3E61A 4GKVA 4RESA 5T4HA 1JAXA 3T5PA 5FFFA 4DPKA 2BFFB 1GA1A 3A4IA 4PG5A 2HHHB 2YIMA 5LZ7A 3X2SA 1JDJA 1YRBA 2ZRBA 2UKDA 3R9IA 1V37A 4TT3A 2O54A 4X20B 4V0MA 2OOKA 2NMVA 5K3BA 3PUZA 4OSPA 9LDBA 2OV6A 1Y9AA 3LF1A 4OYRA 1U3DA 4PIVA 4MPJA 3KO8A 2HD4A 2RBEA 5BSHA 3QEJA 4DFDA 2HK8A 2II6A 3MUEA 2N75A 1FLDA 3UUWA 2DKOA 3KTOA 3LBAA 4NYJR 4DXHA 2AQIA 1DAMA 4LDNA 3RASA 5FQOA 4IJKA 4RK6A 3KQOA 1J9GA 4RVFA 5K0TA 5FPQA 1VBFA 2C5FA 2GCEA 5KINB 4Y6LA 1KAHA 5ELMA 2QOEA 3WLTA 4URHA 5TC4A 4AT1A 3LCMA 3M7IA 1H05A 1XJCA 1Z4QA 2GPJA 2CLHB 4CWAA 1NOKA 1NQOA 2QPOA 2BLLA 3CG0A 2FQYA 4YUXA 4KI0A 1H5QA 1D4ZA 2P35A 2QTZA 2BGIA 1UL1X 3H8JA 3NC4A 4NH4A 1H85A 1V11B 4ICIA 1DQSA 2ZRFA 4NVRA 4NL4H 3FWNA 3V80A 4Y0NA 1T2VA 3BC1A 4FNOA 4B5LA 4LHZA 1FYFA 3UV3A 3OAAA 1H4TA 1CQIB 4MR7A 4DWJA 1EDZA 2VPQA 1N2CE 3WSTA 3OPYB 4EHIA 1SOUA 2IW1A 2R00C 3PC4A 2HWWA 1CJUC 4ENSA 2PQ0A 1WPXA 4W8GA 1I5EA 5AM0A 4A6DA 2CMGA 1JQLB 3BHMA 1ZCZA 2HPAA 3EPPA 2PXXA 4XYBA 5TARA 2QG6A 2D1YA 1M6VB 4N65A 2B98A 4WINA 4BGDA 2Z5FA 1KJJA 3JD1A 1D0IA 3SP1A 2G40A 2A0XA 3IQFA 3B1JA 1PJ8A 1PR0A 1QANA 3LDHA 4EHBA 2AXNA 3TR5A 2PCJA 5LZ2A 4D4IA 2IUUA 2J30A 3TTSA 2E37A 3LY8A 4BV8A 1RABA 2A5DA 4D3YA 1OXSC 4JFRA 3K35A 1EZ4A 1XQYA 2CE2X 3P4XA 4N5DA 3UICA 4N6GA 2F9FA 3GFOA 5F1KA 3ILVA 3RT1A 1U7WA 3VBCA 4EX7A 1RPZA 5G1OA 1NLUA 3TDKA 3B60A 1NVWQ 3HG7A 1QGDA 2Z8ZA 1EESA 3EXG2 1TGYA 2CLKB 4Y98A 5CLQA 3GO4A 3X2FA 1KRHA 3BD9A 2HAEA 1KZ6A 3EHEA 3O4RA 3QUBA 5K0LA 5EAIA 2GZ2A 5JHGB 2KE5A 2RGEA 3Q1KA 1X1TA 1WB9A 4F2GA 1SOVA 3ILHA 2DE0X 4BFUA 2ZRKA 3ED1A 4PQEA 4M0CA 1MQ9A 2FPSA 4C43A 5FPKA 2BD0A 1Z6ZA 3EGXA 4JI3B 1KQGA 1Q7TA 1HZZC 3J80A 3D2BA 2UYGA 1XAJA 5L3QB 2EX1A 4M0LA 2BSQA 4BAZA 5I7WA 2R7AA 2J8ZA 3TUJC 4MRMA 3ZJ4A 5KNDD 2Z6UA 4C5CA 2ONJA 3V33A 1K0FA 1KBQA 4EDFA 1XZHA 1TF7A 3B48A 2M32A 2MR6A 2ABWA 3P97A 1HQCA 1PEDA 2GFHA 3G2MA 1E1QA 4LS3A 5A7FA 4BFTA 3MMSA 1JHAA 3O4VA 4K6MA