5HKAA

Crystal structure of the cftr inhibitory factor cif bound to an amide inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Potent and Selective Inhibitors of an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain ucbpp-pa14)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CFTR inhibitory factor
total genus 112
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hkaA01
2C7BA 3C5WP 4BVKA 3O0DA 5JALA 2UZ0A 4DNQA 5JAOA 4EY4A 3DD5A 3V1MA 3IIIA 4U2GA 4EHBA 4FNGA 2VJCA 1EH5A 3R3YA 2HM7A 3DCNA 1MO2A 2CBGA 4EZIA 4UBMA 1E66A 2JBWA 1TK3A 5ALYA 1XZHA 4TGLA 4ARAA 4PQEA 3WKBA 3C6YA 1F6WA 3ZWQA 1UOOA 1A8UA 2VSQA 2QOEA 1AMNA 2EEPA 2XUQA 4H7IA 3DEAA 5D3KA 3FVRA 3V1LA 3WZLA 5HFNA 3HLKA 4YX9A 1L7RA 2XMCA 3V9AA 1CV2A 5CH8A 4J0JA 1C7JA 4QEKA 4FDMA 1CQZA 5KWJA 4IH1A 3NGMA 1KU6A 5C8VA 1CUHA 4JYMA 1FFEA 3EF3A 1DT3A 1F0PA 4OB6A 1EDDA 2WQZA 3KOOA 5JD6A 2ZYRA 1QE3A 1GGVA 3AIKA 3QMWA 2QUAA 4KE7A 3F8SA 2OQVA 3Q8WA 3OOSA 1QOZA 3O9VA 1XRPA 4Z49A 5A7FA 2CZQA 2B4KA 3I2GA 4TVKA 1EI9A 1UK9A 4MXDA 4W1RA 5ALRA 2BCEA 3EQ8A 4ITVA 1VLQA 2EDCA 5FOQA 3HZOA 4M0EA 3UUEA 4C87A 2WIJA 2QXTA 4A16A 3I28A 3OURA 4HS9A 4W9RA 4WCVA 5CT4A 5FRDA 2GBFA 1QJ4A 2DCMA 2OCKA 5AI5A 4E15A 2RAUA 5IVHA 5AO9A 3H04A 4P9NA 5JYCA 2XLBA 1CUGA 2Y2UA 4X91A 5FUMA 4EUSA 5JD5A 2WHPB 5JZ9A 5HF5A 4RPCA 1CUZA 4FTWA 2PM8A 4B85A 5FV4A 5ISMA 2XMDA 5ALSA 1QIHA 1XLVA 3PUHA 2BGRA 3A2MA 2E3JA 5FP0A 1DT5A 3E0XA 4AMYA 2AXEA 3WL6A 4BB0A 3C5VA 5K3CA 2P8SA 3CCBA 4JUIA 1WHTA 1HBJA 3TRDA 3BIWA 3C45A 2WUDA 1IMJA 3G9UA 5HF9A 4X85A 5KWIA 1EVEA 4BRSA 2XLCA 5AOBA 4NMWA 2EDAA 3L1IA 5AM2A 4UHFA 1R88A 4NZZA 5EHZA 5AK5A 1ZIXA 4CG3A 3D59A 1QONA 3FSGA 3SX4A 2X5XA 3R3XA 4UBJA 3NUZA 3MUNA 3JWEA 2CMFA 1QIFA 1DTEA 1CPYA 5J3JA 2AJDA 5DNUA 1MNQA 5AM0A 2V97A 3IVMA 2QXUA 5E4YA 4YPVA 4H35A 4HRYA 3LIIA 1BEZA 1QIDA 2IITA 4X71A 2RI6A 1NU6A 3KWJA 1QGED 2WIFA 2ONCA 5JAHA 1EX9A 4MWTA 3T52A 5C7YA 4QDXA 4BE4A 4AN1A 5D7BA 1B41A 3GA7A 3WK8A 2BKLA 4QWMA 1CIJA 4CG2A 1R9MA 4ETWA 3GBSA 3QH4A 4K6GA 1A8QA 1VXRA 2OGSA 3WK5A 3ESAA 1IUNA 3I2HA 1YCDA 3WWPA 3FNBA 3S2ZA 5AKZA 1H2ZA 4KYVA 3FLAA 1ACJA 1EXWA 5ALZA 3BDVA 3R3WA 4BTLA 3FCXA 1FJ2A 4FBLA 2JGJA 1OXMA 4OUKX 1XZFA 3BF8A 3HABA 4A23A 3E4DA 1E8DA 3RLIA 4WY5A 3G0GA 1AZWA 2QS9A 3I2FA 4N5HX 4GBGA 1WPRA 1SCIA 2HU8A 2HHAA 2H7CA 5K3BA 1E5TA 2HA0A 4BP8A 1A7UA 2BUBA 5JD4A 4G1FA 5ALFA 2BUAA 2WIGA 1GXSA 3C6XA 4QLOA 2W6CX 5DYTA 5AI9A 2DFPA 3G0BA 4QWWA 1O6FA 2FJPA 4NVRA 1N8SA 4QDOA 5I7UA 5FLKA 2XUIA 5LZ7A 2O7VA 4C4ZA 4OU4A 3I6ZA 4K2AA 5T4EA 1X2BA 4G9GA 5LIPA 1I6WA 3H2HA 1QTRA 3MVEA 2VATA 3IULA 5ALWA 1LLFA 2VTVA 3A2LA 4B7ZA 2J4CA 5H3HA 1ZI9A 5FXMA 4EA6A 1SFRA 3RM3A 2J3QA 3AZPA 4KE9A 2XUKA 5CMLA 2V98A 2G5PA 1TRHA 4MQLA 2ES4A 3H19A 3UUFA 5JAUA 1ZOIA 2PUJA 2FX5A 4LKOA 4UBLA 3AFIA 3VVMA 2XMQA 5ALHA 2H7XA 5DJ5A 3IUJA 3SWWA 2I3ZA 2OGTA 4E14A 3WL8A 1LPPA 5JATA 4BCCA 3O95A 3A70A 3AINA 1ZD3A 4YASA 5AKLA 3CN9A 1DX4A 1CR6A 5A7GA 2WJ6A 1XRLA 1HKHA 4INZA 1LGYA 4H7KA 2WG1A 1ZGCA 4FLEA 4Y2JA 1L7AA 2OG1A 1LPMA 4CCWA 1SOMA 4C01A 3FVTA 1F0NA 1MAAA 4BVLA 3VKFA 4LXIA 5LZ8A 1HL7A 5ALLA 4FLFA 5IVDA 1QLWA 1XZGA 2DR0A 1GKLA 4UHDA 5AHXA 1YR2A 4CCYB 4CIAA 1LPNA 3R40A 5IH7A 4QDUA 2HADA 5YASA 3LP5A 4Y9SA 1EDEA 1RP1A 3H1BA 4I3FA 5IVKA 3KSRA 2XUFA 3IA2A 3D2CA 4CCYA 1DQZA 3WJ1A 1H23A 3QYJA 4LHEA 1QO9A 1XROA 1XZIA 2C58A 3BJRA 4L72A 3D5EA 1DQYA 2VEOA 5JZSA 2WFMA 4X6YA 5CXXA 5ALTA 1XZAA 2GYVA 3FYUC 4WY8A 4B81A 1KU0A 1JMKC 3AIMA 4DTCA 3D3NA 3D7RA 2OAGA 4BE9A 4RE6A 2XMRA 1DU4A 3HJUA 3WA6A 3BJMA 1CUAA 1DWOA 2ORYA 4OB7A 1Z68A 4Q34A 4DM7A 1XLWA 4Y2RA 4BVJA 1BE0A 1R50A 1ZJ5A 2ECFA 3PF8A 2JEYA 4FHZA 2BJHA 2V96A 4PSUA 5HFAA 3PICA 3K2IA 1LPOA 2G4LA 1VE6A 3OM8A 3W05A 4KEAA 3KDAA 5LKAA 3B3QA 3WKEA 5EHXA 3WK9A 4B9AA 3PI6A 3GELA 2O7RA 1LBSA 4K6KA 5EHQA 1UZAA 4A5SA 5AICA 3CN7A 4PSCA 2HIHA 5AK6A 1QIEA 4KR0A 1FFDA 5ALIA 2XUGA 1LPSA 5DYWA 4I19A 1O6GA 4U2FA 1U65A 4GWLA 2CEKA 2GZRA 4IHAA 3AZOA 1YAHA 2QM0A 3E3AA 4DSZA 4GECA 3RK4A 4W1PA 3EIOA 5ALPA 1HPLA 4WFIA 1QIMA 1VKHA 4IQ4A 5ALEA 3W2TA 3MUOA 1S8OA 1UK7A 4KAFA 4UBOA 2JGEA 1BEEA 3PE6A 3VXKA 2ZVDA 5LP1A 2R11A 1GQSA 1AURA 3HEAA 5HF8A 5JZBA 3I1YA 5AKJA 1QO7A 2BUCA 4HAIA 2HU5A 3ZLUA 4Q3KA 4J0GA 4KJXA 5ESRA 5JANA 3MGAA 2PSFA 3KWFA 3G7NA 3I1IA 2O2IA 4E11A 4XX1A 1XZBA 3VJLA 2Z8ZA 1U2EA 3G9XA 3PFBA 1VA5A 4WFKA 4F21A 4U2EA 3KD2A 2OQIA 3L1JA 4B83A 5HZGA 5LLSA 4Y2YA 4PNZA 4AXBA 4D9JA 3H2KA 5K5EA 3FOBA 4GI1A 1N5MA 1CQWA 1K4YA 2IIVA 1AGYA 4H7HA 1CUFA 3H17A 4Y7DA 2WG0A 2XMSA 4DYHA 5ALVA 1DWPA 4X7BA 1Q0ZA 3BE8A 1JJFA 2HDWA 2XMZA 5ALOA 5D6OA 4B6GA 4X95A 1UFOA 3HXKA 1GKKA 4OYLA 1QIIA 4X6XA 4OPMA 5AKGA 4QDZA 3ZI7A 1C4XA 4BTVA 3WKAA 4G5XA 1YAJA 4BAUA 4J0CA 3DYIA 1QIKA 1CUYA 4YK7A 3FYUB 3GROA 1EA5A 1MX5A 2AJCA 1C7IA 5ALNA 5LYYA 1JFRA 4EY5A 3DDUA 4BAGA 3WMRA 3EQ7A 3ICWA 1NX9A 4AO6A 5AKYA 1R3DA 3QBJA 4QZVA 4OSEA 3FAKA 1MN6A 1U4NA 3R3VA 2O2HA 5BWBA 2DHCA 1LNSA 1Q0RA 1ODSA 2QT9A 4Q05A 1CUSA 3RARA 3I2IA 4EB0A 5HQ3B 4X90A 2HA4A 3TGLA 4AN0A 3LLCA 1WB4A 1DINA 2GZSA 5ALXA 4H7EA 1Y37A 3G02A 5EIAA 5LZ4A 1ORWA 2Z3WA 1JJBA 2CUTA 4ZV7A 4PSDA 5LKRA 1A88A 4DMFA 3SK0A 2XUAA 3O4GA 1XZJA 2OCGA 1VOTA 4BDTA 1IZ7A 3H1AA 4RNCA 3WK4A 2H7YA 1YS1X 3M82A 1YB7A 1WHSA 5ALMA 5K3AA 3ZV7A 4L3WA 3G0IA 1P0MA 3CXUA 3O4IA 1QTIA 3VDXA 1AQLA 3VJMA 5HKAA 1W6RA 2QJRA 2DSNA 4X92A 5AOCA 3ED1A 3O4JA 3AUKA 4CI9A 1Q83A 3WWOA 4AZ0A 4W63A 3E1GA 3BWXA 3R0VA 5LZ9A 1QFSA 2XQIA 4RE5A 4QE3A 3W9UA 4HXFB 1X70A 3BDIA 3AJAA 2OCLA 1H2WA 1VJ5A 3WIOA 2BAGA 2ZYHA 2JGKA 5CURA 5CRIA 4C89A 2RHTA 2XUJA 4KAAA 4WDQA 2AJ8A 5A6VA 4F5ZA 3DJYA 3DNMA 1TCCA 4C4YA 3ZLTA 5I8PA 1XZDA 1ZJ4A 4H0CA 5AM5A 4UHEA 1TKRA 1UXOA 4BZWA 1JT2A 3DOHA 4UPDA 1HQDA 4UFNA 4GLBA 2WFLA 4KE6A 5SYMA 1Y7IA 3ESBA 1TQHA 4B82A 4DSAA 3ICVA 4MEAA 4X00A 1MPXA 5K3EA 4Q82A 2C4HA 5AK4A 2VJAA 4OU5A 5AIAA 1JI3A 4UHHA 3WIBA 4AO7A 4PF1A 5CH3A 3D0KA 1VZ3A 2XI4A 1FFCA 3DYVA 5AM1A 2ROQA 2XUHA 4BATA 4N8EA 4Y2TA 2XDWA 4BRZA 4J0IA 4ZGBA 1E8NA 1W76A 3LCRA 3CCCA 2Q0XA 4BC1A 3I6YA 1ZD4A 3AZQA 3I2JA 5AM4A 4ZRDA 4W1SA 1GPNA 2WFLB 4I4CA 2GBGA 3ANTA 3IUNA 2HA5A 4C88A 2WILA 2B20A 1YA8A 1USWA 1ISPA 4L0CA 4G4IA 3SC2A 2HRRA 4J0HA 5D3ZA 1U8EA 3IDAA 4B0OA 1R1DA 3JYHA 2RHWA 4M0MA 1H22A 1J1IA 1VE7A 5EGNA 3WLAA 5T4BA 3BL8A 1UKAA 4KRXA 4BP9A 4KAJA 4EBBA 1MAHA 5LZ2A 5EIHA 4JH0A 4N8SA 4J0KA 4DNPA 4UBIA 3F67A 5AI0A 2GBIA 4H7JA 2YYSA 2JF0A 4AQDA 1QIGA 3WWEA 4C6HA 4S0XA 5CT8A 5DLPA 5E2IA 3DLTA 1E89A 5AIBA 1WCYA 5CT5A 5DTIA 3FBWA 3GZJA 4FLMA 6YASA 1ACLA 2OXEA 2C0QA 3ESCA 3WZMA 2CJPA 4WFJA 2PU7A 1UK6A 1CUXA 3C6BA 1G5FA 4FBMA 2AJBA 2QVBA 4FNMA 5HQ3A 2HA2A 3WQHA 1EINA 4B0PA 1XQXA 2H9YA 4B80A 1XQVA 4U2CA 3WKCA 2QZPA 4XWGA 2ZJFA 5EIEA 5AKKA 3ESDA 3F98A 4EY8A 3PFCA 3W04A 2PSJA 4AX4A 1HDEA 1CLEA 3IBTA 1ZD5A 1XZLA 3PDCA 1EHYA 2DHEA 2YASA 2OPHA 4UUQA 1TIBA 3FLEA 3L1HA 3RKSA 4K6HA 5EHNA 2J3DA 4BZZA 5AP9A 2DQZA 1CFJA 3A6ZA 4XIIA 3DQZA 4UHBA 4C4XA 1BU8A 2WKWA 2Y2VA 5FKJA 4UHCA 1MT3A 3FSGD 3P2MA 2WHPA 2WLSA 1CUUA 4G4GA 3M83A 4DGQA 1XFDA 1UT6A 5AKIA 1WB5A 4N5IX 2HRQA 3FYUA 2D5LA 1TCAA 2PBLA 3HYSA 1XZKA 3D4LA 4QDTA 4HRXA 2LIPA 3O9MA 3U0VA 4E46A 2DQYA 4XVCA 3KXPA 3IB3A 2IX9A 1G4HA 2G63A 3OTQA 1QIJA 4MQMA 5A2GA 2WTMA 1AC5A 4BCBA 1JJIA 3FWHA 1WPXA 2RIPA 3EQ9A 4J0DA 5SYNA 1XZEA 3V48A 1OILA 3N0TA 2Z5GA 2Y6VA 1L7QA 4M0FA 1N5RA 4Y2PA 3H2IA 4X3CA 1YB6A 3V1KA 4AO8A 4UBNA 5ALQA 1JMYA 3G0CA 5T4FA 3FCYA 2JGMA 3H0CA 4Y2XA 2OLEA 1GPLA 4GDMA 3QM1A 1IZ8A 4HTAA 2PSHA 4WJLA 4Y2VA 4AZ3A 1G66A 4DMKA 5AH0A 2BFNA 4B9EA 1GZ7A 4ZI5A 3H2JA 4Q1VA 4Y2QA 3QVMA 3PF9A 3QPAA 1WOMA 5CT9A 4OCZA 4JNCA 4DNFA 2RGUA 4L9AA 4W1QA 3TEJA 2JGLA 2WM2A 2VAVA 4FFWA 2VJBA 2ZJ7A 5DNWA 3YASA 2PUHA 3DL7A 4X93A 1FSSA 3G0DA 5F4ZA 5A71A 4OD0A 1CEXA 4WDRA 3HSSA 1MX1A 1E3QA 4FOLA 4HXGA 1DWQA 3QITA 1XZMA 4G8DA 5E4JA 4J03A 2JGFA 1EVQA 4BBZA 3AILA 5BOVA 2DHDA 2GYUA 3U1TA 2JGIA 2ZYIA 1MJ5A 1BN7A 2OAEA 3EBLA 2WFZA 2WUEA 5AI6A 3QZUA 1MNAA 4JEIA 3C70A 1KEZA 2XT0A 3PUIA 4F0JA 5CW2A 3R3UA 1IVYA 3NOXA 4FMPA 5K3FB 3UMJA 4BCDA 4GEGA 1Q84A 1K8QA 1LPBB 1WM1A 3WYNA 1QZ3A 2I3DA 2WJ3A 1E8MA 5JADA 5CH5A 1P0QA 2GYWA 5C8ZA 1ZIYA 4ARBA 4AB1A 2PX6A 3OG9A 1CUJA 1N1MA 5BWCA 1LBTA 1JU3A 5E4TA 2Z8XA 4ZREA 5CXUA 5JAPA 1EB8A 5AK3A 1R9NA 3QMMA 1ZICA 2PKYX 3STVA 1ZI8A 1BCSA 5ALGA 1SC9A 5DNVA 4ZV9A 3ANSA 2G5TA 5LZ5A 1ETHA 2RONA 2XUPA 4FKBA 5C81A 2FUKA 3STTA 3G8YA 1BCRA 1YS2X 4DNOA 1M33A 3Q0TA 5HKBA 4N8DA 3D2BA 2JIDA 4CIBA 5AKEA 4F60A 4P92A 2CB9A 3DS8A 4KRYA 4MEBA 4Q3OA 5IKXA 5JARA 1XRRA 3LS2A 1AUOA 3HC7A 4OB8A 2I78A 3BXPA 2PU5A 1IUPA 2JEZA 2YXPX 4PO3X 4U2DA 3C6ZA 2VF2A 1YASA 2HFKA 5AOAA 3X3HA 3GFFA 4GW3A 2WU4A 3H2GA 4G4JA 3QPDA 1IUOA 4UFPA 3DKKA 3WKDA 1WB6A 2FJ0A 4P08A 2WIDA 1ODTC 3V1NA 1JU4A 3B12A 4MYDA 2BGNA 5HCUA 4ZXFA 4G9EA 1ZGBA 5AKXA 2J4FA 3WL5A 4H77A 5BV7A 3WI7A 1K63A 3S8YA 5KREA 2WTNA 2YH2A 5HF6A 2PSEA 4KACA 3WA7A 1JKMA 3ZPXA 4LXHA 3QMVA 2QR5A 3B5EA 1LPAB 4ZWNA 1G42A 4B84A 3C87A 1UOPA 1NU8A 2PPLA 4X97A 2PSDA 1K6EA 1XKLA 1A8SA 2ACKA 4ROTA 5A7HA 2X8BA 5DYYA 4QNNA 4EY7A 1W4LA 1DX6A 4U2BA 4QLAA 4CG1A 4QA9A 3GUUA 4BDSA 2WG2A 3WK7A 2ZSHA 1T4MA 3H18A 4J7AA 1AKNA 1BROA 2XE4A 4O08A 5K3DA 2XQJA 4H7DA 3W06A 2QJWA 1FFAA 2ACEA 1Y7HA 3G9TA 4IO0A 2XB6A 5JIBA 1SCKA 2WJ4A 4LYEA 1AX9A 2ZYSA 2XQFA 2VJDA 3IUMA 2HU7A 1BN6A 4PW0A 3OC0A 4UBKA 1XRNA 3TJMA 3FYTA 2HA3A 1RWQA 1EB9A 2I03A 4LXGA 3G9ZA 2NW6A 4CFSA 1T2NA 4Y2SA 1PFQA 2Y1KA 1XRMA 5DTJA 1X2EA 1ZI6A 2ZJ6A 4BC0A 1P0IA 3C8DA 3VISA 1THTA 1ORVA 3WJ2A 3I2KA 4OYYA 1D07A 1GT6A 4J3JA 2WHRA 1BRTA 1MX9A 3N2ZB 3WYDA 2R8BA 4MYSA 3WK6A 1BS9A 1EDBA 1CUIA 3BIXA 2VT7A 2WUFA 1XQWA 1K5PA 2QTBA 2H1IA 3C43A 1MTZA 3AIOA 3BF7A 4BYMA 1XLUA 3ILSA 1EK1A 4RGYA 5CBKA 4H18A 4TPKA 2Y6UA 1OCEA 1R4ZA 4MWSA 5ALJA 1UKBA 1UOQA 3STUA 4IH9A 3F96A 2Z3ZA 2B61A 3WWCA 4GXNA 2VT6A 1GPKA 1TCBA 3QPCA 5DWDA 3W9BA 1UWCA 2GBCA 2HA6A 5KBYA 3FLBA 4GHWA 4AMZA 1XRQA 3WL7A 3HI4A 1CUCA 1UK8A 1MU0A 2WUGA 3A2NA 2QMQA 5AM3A 3R3ZA 5AKHA 4V2IA 2XUOA 2W22A 2XQGA 4EY6A 4HXEB 4UFOA 1F8UA 5K3FA 3STYA 2HFJA 2K2QB 5C8XA 4LIPD 1W1IA 1LZKA 1CUBA 1H2YA 1P0PA 4P93A 1J07A 4Y2UA 2XUDA 4FWBA 5HK9A 2PL5A 1PJAA 2OGZA 1J2EA 5FPQA 3C8HA 3OPMA 1W52X 1UKCA 5CT6A 1ZD2P 3I6MA 2XQKA 4NS4A 3K9BA 5AI4A 1W75A 1YSCA 4KE8A 1TAHA 4IH4A 3R41A 2WIKA 4BAZA 2HL6A 1RYYA 1CUWA 3WWDA 4G8CA 3F97A 4DLNA 2D0DA 1FFBA 1THGA 3DL4A 2WHQA 4X94A 2C5GA 1B6GA 2OCIA 2WSLA 5JASA 1YA4A 2PVSA 5HK8A 5ALDA 2XMBA 5ALUA 2O2GA 3NWOA 5I9IA 4G8BA 1CUEA 2VAXA 1LZLA 4HZGA 2V9ZA 1EK2A 4DMCA 4DMHA 1CRLA 1HLGA 3IUQA 5IVIA 7YASA 3STWA 2ZSIA 3HACA 3F9CA 5EFZA 2QRUA 2VA9A 1CUVA 5ALKA 3T4UA 4Q3LA 1J06A 4H7FA 5A62A 1H2XA 3VJKA 2QKYA 3D2AA 5EI5A 3M3DA 5T4HA 1GQRA 1CUDA 2AJLI 2WU3A 2X76A 2C0PA 3LIPA 2VQ6A 1ODCA 2XMGA 4PV7A 2B9VA 3HRHA 3DKRA 3M81A 3O4HA 3JW8A 1CVLA 3VVLA 1PV1A 2HA7A 1QFMA 3STXA 5AJHA 1SCQA 5CTAA 4X6UA 5FPPA 1VA4A 4FFVA 5FDFA 2QUBA 3IURA 3ZLVA 2CKMA 1VZ2A 4HVTA 3K6KA 1XKTA 3DOIA 4JYPA 1XZCA 4LYDA 4K5QA 2C5FA 1XQYA 4MJ3A 1VXOA 5AI8A 4XJVA 4DIUA
chains in the Genus database with same CATH superfamily
1NQVA 2C7BA 1FNMA 1A4UA 1XCOA 1XZ8A 3VOSA 2Q5FA 4EZBA 2AMFA 4I0WB 4NAHA 2UZ0A 5JALA 5L4LA 2GGSA 5JAOA 3G5AA 4EY4A 3DD5A 2BHRA 4G5FA 1R0YA 2C2BA 2XKBA 3KU1A 3CURA 4U2GA 3RYFA 3W2FA 3WLLA 2EFJA 3HYNA 5E4FA 1UAGA 1R74A 2DX7A 5JNVA 2G17A 3R3YA 2QVXX 3DCNA 5CVVA 1SKQA 4ARCA 1UXJA 3C3AA 2C84A 3LPMA 2NTEA 4GOXA 4JEHA 4DWWA 3BFKA 1V11A 2MMGA 4EVIA 4J4TA 1Z5OA 1DXHA 1KH1A 2Y0BA 3MAJA 1L9XA 4ZC1A 4RD2A 1I51A 2BBOA 3VZDA 3WGIA 3AEQB 4G5HA 1XZHA 1X7XB 4ARAA 3IT3A 4HDRA 3UQYS 5JNRA 4AKSA 3KUUA 5HRCA 1S3IA 1EP3B 4F2HA 2O6LA 3D1VA 3VYSB 2VPXA 1Z2AA 2VSQA 4LN1A 3ZE1B 2EKPA 5JJ5A 3L84A 3BWBA 2QN7A 1AMNA 1YS9A 3EPPA 4ZVTA 4C4SA 2XUQA 2YQ5A 1SHLA 3DEAA 3EG9A 4H7IA 3NC1C 4NBSA 4OGLA 1GV0A 3PNSA 3FVRA 4OK6A 4RSMA 1AF4A 1ODIA 2ODEA 3BMNA 1OBOA 5EGSA 1CXZA 4W5TA 4BXOB 4FYYA 3QHPA 3RS8A 4S35A 1KIMA 2ISQA 1U5BB 3IJ5A 1JB9A 4HB2A 1U9IA 2IYQA 3DPSA 2D2FA 3KZKA 5DCLA 3QBTA 2IBSA 3H4MA 2ZUFA 2OZLB 1UADA 1P80A 1I0LA 4GOOD 3ZY2A 4K6FA 3TE6A 5A5EA 3C8MA 4JAVC 4PAWA 5JO9A 4V0SA 4JI1B 2B8TA 1HNXB 4NFHA 2J08A 3QKIA 4CIYA 1G6Q1 4YUXA 4BWFB 5GGXA 2YQZA 4KXUA 3O93A 4CLEA 2AEJA 4FIDA 4X3OA 3LRXA 4U7FA 5ECDA 3G8CA 4INAA 3CE6A 5BOSB 3U7IA 4LA4A 3B5JA 1EP2B 2BM0A 4G0QA 4D3YA 5KWJA 1ZH8A 3ODGA 1P2DA 3EZXA 2EKZA 1TE2A 4RNDB 4PQRA 4DBLC 1KIFA 1KU6A 1NKVA 2JASA 3NWBA 1CUHA 1SOUA 3HYCA 5JSZB 3UW3A 1MOZA 1IXRC 1C1DB 2C94A 3GOHA 3OHPA 4QL3A 3PDIB 4HPWA 2G9UA 1GVNB 3K9GA 2NO9A 1K66A 2OUIA 2PZJA 1JDPA 4DYVA 5FYQA 3CRZA 2F8MA 3EVBA 1FFEA 3EF3A 3MJFA 5C46F 3FOWA 1DT3A 1O97C 4OB6A 1EDDA 4Y9TA 2WQZA 2E18A 1D4ZA 4O8CA 2BFCB 2ZYRA 4W9NC 2QD2A 3B1FA 2O8NA 1ONSA 4YP6A 4MWGA 3INGA 3H4VA 3DBOB 5IZ4A 4M9CA 3CRQA 2BRUC 2BTQA 4KE7A 3OWHA 3HDGA 2IHVA 3AHGA 4D4JA 5JCOC 2XQVA 5JHHB 2VDPB 1GA1A 5JFGA 4UCWA 2FEKA 1AS0A 1L5RA 4QAQA 2CVQA 3GA0A 3O9VA 3OOSA 4G89A 3MIIA 1I2BA 2WF7A 3DYBA 5HUQA 1PFUA 1Y3HA 3SYTA 1XDBA 1ZITA 1U6IA 2CZQA 1QP4A 2CV1A 4FIZA 4MK4A 4DVGA 1D2GA 3LYAA 3Q7IA 2EEZA 3UPDA 1EP9A 4YWJA 5CEFA 5J4LA 4HBGA 1O77A 3VHXA 1T5SA 1E5LA 2OILA 1JHVA 3I6BA 4OSOA 5H70A 5KNBH 1L4LA 1XAGA 4ZPXA 1UK9A 1J9ZA 4MXDA 2ZAOA 3H11A 3EQ8A 4ITVA 4OQ4A 4RZHA 5AUQA 2WWIA 3A9CA 4ZOLF 4DWVA 3DW3X 5DHQA 4A8TA 3AERB 1SXHA 1M6HA 1DAFA 2Z57A 1V45E 1O0BA 1CNEA 3PXBA 4Q9KA 2QXTA 2HQ1A 3WMXA 4P38A 5ICFA 4JJFA 3I28A 4HS9A 5JISA 1K68A 3OOHA 4W9RA 3QOFA 5CT4A 4LFCB 3ZWDA 2GBFA 2YFQA 3LX4A 3PKIA 3WSTA 3UJHA 2PSSA 3T7AA 3SDSA 5E2BA 1LBEA 4FWIB 2GK4A 3C98A 3NM4A 4RD3A 3RR2A 3VI4B 2A7XA 2XKKA 2EKDA 1QUEA 2WC1A 3K7EA 3ZGOA 3OX3A 4JOCA 2BLNA 2I7CA 3CRMA 3OOWA 5JYCA 1NUAA 4FDAA 2Y2UA 4X91A 3PC8C 1D1SA 1Q7RA 4M8IA 4B8ZA 3LXMA 5JD5A 5IM4A 1OLSB 1XXHB 2YHIB 3EZYA 4GI2A 4QSMA 4QSHA 4YRDA 2PTHA 5JZ9A 1PJTA 2I4RA 2GCPA 2PMKA 3FX2A 2QNBA 5HF5A 4DR2B 1CUZA 1VQ1A 1USGA 3VH2A 1GHTA 3A36A 4WBNB 1VCMA 4U39A 3M6XA 4ZZIA 4MEJA 3WGVA 3G2NA 3L7JA 3UVEA 2PZAA 4B85A 5FPKA 5JQWA 1GGHA 4I9FA 4A2WA 4ND7A 1Z13A 5DI9A 4B3CA 4BMSA 1Z5NA 2XMDA 4UQOA 5FV4A 3RS2A 4GL2A 4XCQA 1QIHA 3PUHA 4V0OA 3INTA 4CKXA 3T3PB 3OIDA 3CLUD 1K8RA 2E3JA 1EQUA 2V3VA 4QECA 1T36B 3HKEB 3BE6A 3QEMA 5DOVA 5CXQA 5I6DA 2UAGA 3KOMA 1DT5A 2XRFA 3E0XA 3KB1A 1OC2A 3RBVA 1G63A 5HGXA 4RK7A 4WT7A 4K03A 2COUA 4AUMA 1AKWA 3KTAA 5J4YA 4FR2A 4JU8A 5EE1A 5K3CA 3C5HA 4C4RA 4XYLA 1RWXA 1DRWA 1YQDA 1WHTA 2BF4A 3FMFA 3UHAA 1HBJA 1EUCB 1FU4A 3DZCA 3R7NA 4IIJB 2ZJ3A 3ISTA 4E30A 1KSJA 1IMJA 3TIXB 5TS2A 3GAZA 1ULTA 1CDEA 1NI4A 3BD7A 4BRSA 1NDHA 4MVJG 3C3MA 2AV6A 3WGUA 4FFSA 4NJEA 4LXTA 2XLCA 1TD9A 121PA 4NMWA 2EDAA 1OGJA 1MFZA 3GFSA 3K0HA 3L1IA 4U3JA 4UHFA 1ES9A 3ZI0A 1JTVA 4KUGA 3AP2A 4NFLA 2YNMA 4BQEA 2OHIA 5EWMB 4X7PA 2OHHA 5JRJA 3AF4A 4DLYA 4F9GA 3WB1A 4YAIA 1RQ7A 5AK5A 1ZIXA 4AJ4A 4ZCPA 3UFXA 4M9XA 3A2KA 1FXUA 5B58T 3MMPA 3FSGA 2IUUA 4CM4B 2GH1A 3FSEA 2JD1A 3OD1A 2QP4A 2ZW9A 4Q9LA 3LGXA 1OX5A 3DBRB 1KYQA 1AQYA 1H2HA 1IDOA 2WNIA 3LECA 1XUOA 2PKWA 2GJSA 1JA9A 2X22A 3IKTA 3N2EA 1ZMBA 1VPWA 1A2QA 4ZQGA 4LQLA 3WG9A 4HD8A 1VCOA 2YBEA 3TLZA 3N05A 4AJJA 5K6AA 2XNSA 5F5XA 5ED4A 4MITA 2OD9A 1GPYA 1MNQA 4HX5A 1HT3A 3ENVA 5AM0A 1UQRA 3NJ8A 1HURA 2I0FA 3KHTA 4X1IA 4U6NA 4EA9A 1V95A 1PJRA 5JEDA 4KLZA 2HWXA 4YAJA 4RAQA 1C7EA 4DQKA 4M0CA 4HRYA 3LIIA 3SSNA 4F4HA 1QIDA 2QUIA 4JA2A 2QF7A 2IBTA 3ZD7A 4PWYA 4B71A 4X71A 2QZJA 4CMBA 3WGYA 1DKNA 3KPUA 4FYIA 2DERA 3M5CA 4WN3A 1QGED 4URVR 3VR3D 3I83A 5JO0A 3ZN2A 1KMHA 4LHSA 1D2RA 7GPBA 1Y8ZA 5AQ1A 4QQRA 5JAHA 2QW0X 1EX9A 1U8ZA 3O4VA 4OJKA 2JGNA 2NV0A 2PUBA 2GCOB 4MWTA 3T52A 1M6YA 1VIDA 5C7YA 5HYVA 3ZS8A 2WVAA 4QDXA 3WNZA 3SR3A 1ZD9A 4UNRA 3H8JA 2Y0DA 2EX4A 3K0CC 1LH0A 5IYZF 3WK8A 2GRAA 3ROXA 3AB7A 4W82A 1XZNA 5CLIA 1GPH1 5FOUA 1CIJA 2A0WA 2H52A 2PKXA 3A6KA 1OB5A 1G3UA 1E3JA 1U5CA 2I1WA 1R9GA 3GBSA 3KQVA 2FQXA 2B7BA 3FCSB 4MQUA 3LUPA 1DHRA 4NK5A 3K9CA 3LHDA 3PR2B 2C4TA 5KYKA 3K0BA 1KRHA 3JARA 5TQ0A 4R1TA 1RBQA 2CL0X 3NEJA 4M99A 3B82A 4Y9RA 4MI6A 3HDJA 1MIHA 4JQSA 1VJGA 3FM9A 4CT0A 3RADC 1PFKA 1BC5A 1T4DA 2FPPB 2E55A 2FOIA 1H2ZA 4JENA 1U7ZA 4KYVA 1Q15A 4IPTA 4UE2A 1ACJA 4ZVRA 4ZYTA 3QU4A 2J48A 4FSXA 3WJAA 2XCLA 1G64A 4WOPA 2BLLA 3CKLA 1TVKB 2QEQA 3EFEA 4EHAA 4ZI2A 3LA8A 3RTCA 4QU8A 3G0HA 1T9GR 3QG1A 4H16A 4EO4A 1FJ2A 1ANKA 3BSSA 2RGRA 2JFUA 2OXCA 3EE6A 4A15A 2J07A 3I52A 1N92A 3N7AA 3FDFA 4XXHA 3VM6A 4D96A 1ZVVA 4OUKX 3SEFA 4S2EA 1H42A 1XZFA 4KQIA 2Z56A 4ZU6X 3HABA 1KSGA 1M3SA 3QENA 1DIAA 4E4TA 2QX9A 4EHIA 3DZHA 3VYUB 1PX2A 1QKIA 4B48A 2X86A 4LVCA 5B2ZA 1E8DA 1GIAA 4WY5A 4R9NA 3RLIA 5KINB 3EZ2A 1AZWA 1MDFA 1YR8A 4Q03A 2HQSA 4UAVA 1YJBA 2Q1XA 3UFXB 1HR0B 3THWB 2RHOA 4FONA 4DDUA 1QFXA 4C3UA 3D64A 4GBGA 4XR9A 1USVA 5KYVA 1I1HA 3W1WA 1JFFB 2IUFA 1OC4A 2ESRA 5BV2P 4GPD1 3ZWAA 1E3WA 3SSOA 4EVRA 4KLCA 2E4UA 5L9AA 3IP5A 4H1HA 3DFMA 3JSXA 4NMMA 2BUBA 1UINA 3BRSA 3G6KA 3TFQA 1MEJA 1M1XB 2YN2A 2J5XA 2CDAA 3I9NA 1LDEA 2C8JA 5H4HA 5THKA 5LU9A 4PHFA 3WGTA 3UCEA 1GXSA 3A1TA 4YAUA 1NY5A 4RF5A 3ZWYA 1WSDA 4X65B 3C6XA 5D84A 2M1ZA 2NSJA 4HAYA 2FKNA 4QLOA 5TMBA 2R8ZA 2GA9A 1I4TD 4EAQA 4PRKA 1Y9DA 1EG7A 2VP2A 1P77A 1Q3HA 4YRGA 5AI9A 2DFPA 5TQJA 2Q2QA 3G0BA 2GUWA 3SFVA 1O6FA 4MV5A 1KSHA 1N8SA 5AVVA 1WLSA 3FWKA 5I7SA 2Z5LA 2HOQA 2JZNA 3W9SA 3S81A 2XUIA 4NENA 4B33A 4BKMA 4FGUA 4YI5A 5LZ7A 2H1FA 2O7VA 4OU4A 2QT1A 3AK4A 3WYGA 3I6ZA 2XBUA 3MCUA 3UWMA 5A5FA 2E4AA 2DCUA 1LW7A 4PHTA 2WLTA 3SKXA 1KI2A 4IVQA 4XJSA 2RJOA 1P45A 4XB2A 1Z4KA 2GZ2A 2VK1A 2ZDQA 3EB9A 1LUAA 4MVJA 4ARZA 5KU1A 2VXBA 1DJOA 3W3AA 2DLCX 1T9DA 1XVVA 3ONEA 1OAAA 4B6JA 4JI4B 5EJMA 3GDHA 2C57A 1BYUA 1G8JA 3H2HA 3REOA 4F56A 4YQZA 4OJTA 4YRJA 5K09A 4Z4QA 3DFZA 3WGMA 4CR6A 1SZDA 2PPVA 3EOBI 1E79D 3I04M 4B7ZA 3SS8A 5IXJA 5T8KC 2J33A 2Y4OA 4WL0A 3KZVA 1RRPA 4Y1EA 3LY9A 3KSDO 4O63O 2DBYA 5EXTA 5FXMA 2IPLA 1CE8A 3Q6IA 1R6DA 2V7WA 1D09A 2Q1SA 3QWIA 5FNZA 2YWEA 2XXAB 3IJRA 1S96A 2R6DA 3HJBA 1FYDA 2ID8A 3RVNA 1JB1A 2GJ8A 3JQ7B 1KI1A 2ZBUA 3VZBA 1J20A 1GQYA 4DCJA 1VC2A 3M5WA 4FUQA 4O1MA 1KGDA 2V98A 4K3VA 5HHTA 2YYYA 3AP3A 5FD8A 2RAVA 4NDAA 5KSYA 5FOXA 5CR9A 4LNUB 5EKTA 2PZGA 3L0BA 3BB3A 3MFYA 3ZU5A 2VVTA 4LXYA 3LBIA 4RANA 1Z08A 4B17A 2Q8QA 4HZIA 5U1PA 4MAAA 3LGSA 3KXLA 1Q1AA 4NYMR 4OXIA 4BO0A 5CXSA 4LHXA 1YQXA 3AFIA 1Z34A 4RU1A 1Z5ZA 1CU1A 2I4TA 1G5QA 1IHXA 4XDZA 4CCAA 1SKUA 1CD5A 1XKXA 3PL5A 2BGIA 1CDOA 4RZSA 3LM8A 4AFNA 4OQDA 3IUJA 1ISIA 1VMDA 4AKHA 3R7FA 3FNFA 1VMIA 3QEAZ 3AXSA 3NT5A 3L1KA 3PDHA 4D2IA 2QSZA 1CRZA 1K2WA 1Y6RA 4D79A 3VH1A 1ZUD1 1ZYUA 3TD2A 4CT4B 2QD1A 3I64A 2O14A 3N6XA 3R8XA 2VDJA 1VI6A 3QJ5A 1Q7GA 3JVEA 3P0RA 4CLRA 1QR6A 1UBEA 1TF5A 4E03A 1NBMA 3N76A 1V39A 4C05A 1ZXLA 2HK9A 4TMXA 3VPGA 3RFXA 1MFPA 1JTEA 1SU4A 1E1YA 3EGDB 2PFGA 3GFRA 3PQEA 1C1DA 5I8ZA 5IHPA 3L79A 4LJLA 4PY2A 1NL3A 2XE7A 3AINA 3S2EA 3G49A 1ZD3A 4C78A 1I80A 2GCGA 3CN9A 3DBLB 1O89A 3M6FA 1FC0A 3D6TB 4CM7A 4X7MA 1R5NA 3UMVA 3LY7A 2I7DA 2QN8A 2VSNA 2XYQA 1N3LA 4QYIB 5FUYA 1EQAA 4INZA 5CEEA 2GRUA 2BTOA 1DNPA 3MJ4A 5FIUA 2R6AA 4QULA 3GWZA 3LW8A 2COKA 3SZMA 1ECBA 4FLEA 2NUAB 4BNWA 1PQPA 1UXIA 4BN5A 3HPRA 1OXVA 1L7AA 3E23A 3TXAA 2H3EA 4U02A 2XCOA 3TRKA 2EATA 4YBZA 3JQ8A 4C20A 1RAFA 2YX1A 4R68A 1PS9A 2H59A 3P9SA 1JHDA 3OT1B 5DV9A 1XZPA 4BMCA 1IBKB 5IW8A 1B23P 5AVTA 1RPTA 4MPJA 3IBGA 1SOMA 1YBVA 2RD2A 3R4VA 1B93A 4OATA 1RJEA 3N5KA 4YV1A 5HBRA 2GAAA 1GZDA 3BG5A 3NEPX 4LXIA 5DNEA 1Y6ZA 4TTSA 4BVLA 1JILA 1OH8A 2IUEA 3T4EA 3E3LA 3H8SA 2Z5VA 2VJOA 1PR3A 3IESA 1XZGA 3IAS1 4Z9YA 1QQ5A 3DBVO 2V5UA 4HH3C 1X42A 5H9VA 1FNBA 4B4VA 4MAMA 5AHXA 5ECWA 1ILWA 2UXBB 1E58A 1AZSC 2VYND 4DRXB 2IYFA 3MCVA 3D81A 3TR0A 3TLMA 3AEQA 1YHNA 4UTVA 4MVXA 1Y5MA 2BGJA 2HUNA 2OO7A 4DHWA 4UTZA 2EWMA 4KVAA 3VV2A 2E4XA 1UBRS 1L1QA 3ILHA 3TOSA 3U49A 1IVNA 1MKYA 2KMLA 2R4UA 2CXPA 3CTPA 1FDVA 1QG4A 1ID8A 2B1IA 1E2PA 3F6SA 2Y0CA 1TZKA 5K2OA 1Y5NA 1F2VA 1RP1A 3FMPB 1GRQA 1ZEMA 4R0MA 2VJKA 1AHPA 4XYGA 4BNUA 4C0HA 4B3IA 1O95C 2ZDGA 1JLSA 1RQPA 3KSRA 1B8NA 4NOKA 3PNBA 4V0RA 3AFOA 2JLBA 3HUTA 3CE9A 2M6RA 3OP4A 3CBGA 2BIFA 2CFSA 1N34B 1XA0A 4XQEA 1S89A 3IX7A 1HWYA 3U31A 2XB8A 4L72A 4R9VA 3PQFA 4LBVA 1DHTA 1OI4A 1P5ZB 2KLBA 1D6NA 4RA9A 5DX1A 1H4TA 2VF7A 1WV1A 4MUBA 1NGSA 1P39A 4RJTA 1XZAA 2GYVA 4HRVA 4B81A 2JAOA 4TLLB 1KU0A 2UYOA 1KR5A 3RAFC 4LF5B 4AUKA 3UB4A 4DL9A 2YV4A 3EXIB 4MS1A 4PU0A 4AY5A 2B6NA 3MK31 4YALA 1M1YA 1XP8A 1G5RA 2DM6A 2EV9A 5CYFA 5HPYB 4F6RA 4X6LA 1U0RA 3OLYA 3L7MA 2CSUA 4RE6A 2XMRA 5DYGA 2PUCA 2ZANA 1DU4A 1N6OA 2YZMA 4HPJB 3UMGA 2J6IA 1EFRD 3BJMA 1TZCA 2E5LB 3RFUA 2ODTX 3C6KA 2ORYA 4V0KA 1D2AA 1S2LA 2HO5A 3PEVA 2LDXA 4Y7CA 1Z68A 3EUEA 5G1OA 4B2LA 1J1UA 2Y1EA 4RIIA 2J7PA 3O1HB 1P62B 2HO4A 4K1LA 1I7LA 2P9YA 3EMKA 1BE0A 1R50A 4BVJA 2OYRA 1BXZA 4AVYA 4COKA 5TMEA 4ECEA 5A9TA 1JFSA 1Z2NX 5JDCA 1AUVA 3HJFA 1BKSB 1L7EA 2BJHA 3PUXA 3ACBA 4K9KA 1YZFA 4RD0A 1WL8A 4PSUA 4Y1FA 1E2MA 1I4OA 3VC1A 2J41A 4B35A 4C7JA 3BTVA 2EIXA 1ZW1A 2QMEA 3E35A 4YONB 2FN3A 2O2SA 3VV3A 4MTCA 1DQSA 4XOUA 3X1JA 2ZRAA 4WXYB 1SG9A 2WF6A 4RHXA 1CDDA 4PSAA 3KDSE 3W05A 1HGXA 3FUWA 2PKQO 3B3FA 3MCAA 1P2VA 4FDTA 4C7OB 3KDAA 1JEOA 1SG6A 3WDSA 1KTVA 3V7NA 4HJRA 4A8PA 2DEUA 3F6RA 1SOAA 1QO0D 3G23A 1II8B 4XIFA 5B1SA 5SZJA 3WKEA 1KWKA 3U39A 2O4CA 1ZU5A 3ZU4A 4CGZA 1USUA 1QMPA 3RRMA 1ZRSA 4EKGA 2YV1A 5EHXA 3MD0A 5ENDA 2EJVA 4B9AA 4N41A 2QW8A 2NO1A 3GELA 3C3PA 4DVJA 1NQWA 3ZI4A 2IQ5A 1YHYA 4K6KA 5EHQA 3W5CA 3AVVA 5F1OA 3VKHA 1CIVA 5CBPB 3Q7SA 1T2VA 4WN9A 1XTZA 1YS6A 4HZUB 5F33A 5TGTA 5AICA 5LD2C 3E82A 4TQUS 5LQCA 1T5IA 2AN1A 4O2AB 3HHPA 3LKBA 3A6HA 3NKFA 1E0AA 2JCBA 1QPZA 4MDEA 4ER0A 3T5CA 4BIIA 4NXNB 4W4TA 5M3BA 1DKUA 3PJDA 2IZOA 4MYCA 4LY3A 4FDUA 5JVDA 4HEA6 4UMEA 5EP4A 3EZLA 2XCSB 2FG5A 4N0EA 4I19A 4TV9B 3UG6A 2IS6A 4ZKEA 5JSHA 2J4DA 3Q3HA 3U17A 2JH3A 3I32A 5IM5A 3HB7A 3G68A 4TWIA 3OJXA 3KE9A 4I5FA 1NBAA 4P31A 4K0KB 4LZZA 4ZOLB 5GGYA 4CMKA 1A8PA 1I2ZA 1YQGA 3C6MA 2ZUDA 2HK8A 5KOHA 5IRCD 1OQAA 3L77A 3KR1A 3QFTA 1YAHA 2G67A 2QM0A 3E3AA 4QQKA 5DTEA 3SXUA 4W1PA 5HM8A 1QK4A 1JFTA 2JI7A 1OBHA 3R5KA 4MUMA 3KL2A 4TL8A 3N0RA 3LT2A 2IYNA 2EBWA 4J1TC 3HJRA 3WBKA 4YCDA 1KJIA 1ZZGA 2C2OA 4TRRA 4ZV4A 4GGMX 4XVHA 3HO1A 3EVDA 4XI9A 3GFTA 2WYVA 1EFKA 5ALPA 1IRIA 3ZS9A 3A26A 1M54A 4KGVA 1QIMA 4AMUA 1NF3A 4ZZ1A 4G84A 5LA6F 1X15A 2J9ZB 5CDUA 4R71A 2V6MA 1QTQA 2Q4EA 4FZRA 1U9CA 1ZUWA 3PSAA 1TJ4A 1I10A 3HCNA 3F90A 1KMIY 1PQWA 3IHWA 4YA6A 1PWXA 2WKPA 4JASB 1AURA 2HSGA 1T2UA 3JYOA 3E61A 1U8YA 3KK0A 3R7AA 4DMLA 2VHZA 4OX9B 2AH5A 3F5DA 5HF8A 2JDIA 3KFVA 1EP1B 4EHNA 4Z4GA 2REQB 2OB2A 4JC0A 4U6QA 4TMFA 2H1RA 3C3EA 3DQPA 2ZSKA 3OQ1A 5BRAA 1PG0A 2BUCA 3CUKA 1F12A 1GZ5A 4G1EB 4HAIA 4MJXA 4PLWA 1PT5A 3TZQA 1M1NA 2HU5A 3DUFB 1DKRA 2J3LA 4ZQIA 2NWQA 2XDAA 4QM6A 2A6PA 2PX2A 3L0SA 5TEWA 3GQBB 1J97A 3CUEF 1SRRA 4DANA 2IFTA 2VJQA 3HCBA 5IBRA 3KWFA 1GA4A 2CK3A 4A6DA 1R3UA 4DF3A 1A9XA 1N2ZA 1N3BA 1W44A 2PY6A 4LHYA 3FSRA 4NRDA 1NTRA 1Y5IA 2O2IA 4IIJA 4UDYX 3OCJA 4QXAA 4E11A 4JJKA 2PVPA 5I3ZA 1JLKA 1J70A 4IWYA 3UF0A 5JZMA 1B73A 1QRRA 1XFAA 3MPOA 1OSNA 4BLOA 3G9QA 3G9XA 3QOYA 4HAUA 3JYLA 2PEYA 5BRJA 4AKIA 1RPNA 1R9JA 4HADA 1ZK4A 3LBNA 1FVXA 3QWHA 5G3ZA 2QTMA 4GMDA 3TTWA 2OXRA 2OQIA 1JR3E 5HZGA 4RXTA 1L1FA 2IEAA 5FWXA 3DXFA 6REQA 3Q87B 2Q8NA 4D9JA 5JAIA 4RFSA 3AUAA 4H0FA 5K5EA 4ZN6A 5KEIA 4ML3A 3NNNA 1N5MA 3GJXC 4JCOA 1TVKA 4F7DA 4PPFA 5COAA 1K4YA 5TV2A 5FJJA 3SC3A 1RR6A 1AGYA 1OFIA 2OL4A 1VYUA 1YJQA 4H7HA 4X20B 4BLWA 4CETA 2G76A 3MS2A 4XUGB 2PL3A 2Y1XA 2OFXA 1ZM7A 3H17A 4I4NA 5ETJA 1IWPB 2XMSA 3DV0A 1SQ5A 1TYAE 3GUZA 1Y3BE 4B79A 2G9QA 1XRSB 5B64A 1EWRA 1DWPA 2ZU6A 4MUKA 4A1OA 2WT4A 3BE8A 1CY2A 3BQMB 4K8RB 4UC0A 1X7YB 1AA9A 1F5SA 1U2GC 3PJEA 4PTZA 1WMDA 4RD1A 4DQVA 5J58A 5JUWA 1WQ3A 4V1CB 5CA0A 2ODAA 3DAGA 3LHIA 4J7XA 5K1ZA 2P6PA 2O7QA 3LU1A 3FFTA 3PDJA 2IY8A 4C22A 1UFOA 1FK8A 1VECA 1WNFA 2CXQA 1HMYA 2G09A 3TQOA 4G36A 5CX1B 4R2MA 1SKYE 3FOAA 3HXKA 1I3KA 5CCBA 4KLNA 1GKKA 4D7AA 3DE1X 3UK1A 3ICOA 5B1EA 4OHMA 1Z7BA 4KWIA 3D8HA 2R8PA 4BNFA 1KJQA 1KE1A 5TQVA 2X2OA 5AKGA 4OY3A 1Z6YA 4HEA1 3OLCX 4B09A 2Q2VA 3O7WA 1PJZA 3LUFA 1JA0A 1C4XA 2ET6A 3LP6A 1ETUA 4OHCA 2QXYA 4MQFB 5KTKA 3DUWA 3PVCA 1WVIA 1RJGA 3G2KA 1JEAA 2QD3A 4J2HA 4YJGA 4G5XA 4I50B 4NBLA 1Q11A 5DM0A 5F7JA 3VUFA 3W4IA 4EKYA 2MSDB 4JXJA 4L9SA 4CGYA 3QJGA 3V1TC 3PTLA 1RIFA 3E1KA 5AXBA 3DYIA 3WMGA 2TMYA 1O4WA 3THYA 1QV7A 1QIKA 3O75A 3EXAA 2Q0HA 1MQ9A 2IYPA 2VS1A 3FYUB 1KFKB 1VPVA 1EA5A 1MX5A 2AJCA 3BRCA 3GROA 3HA5A 3L6EA 4QOIA 3FMOB 4MW6A 4EJSB 3GG2A 2XRZA 1L7MA 3HKDB 4QJIA 1R4NB 1ZUIA 2AR7A 5LYYA 3UJ3X 4XGIA 4ZQEA 3LL4A 3C7KA 2G71A 3JPWA 2O1SA 2CXNA 3ZVRA 4N7BA 3BT7A 3R9WA 3LPLA 2YMLA 1ICEA 4K1XA 3UK2A 3BFXA 4C43A 2AXQA 2ZRJA 3D6AA 4WJZA 3E53A 5B4UA 2Q5CA 5LIRA 3BMCA 2OWEA 5C1BA 4V1CA 4XJXA 3HJHA 3KL4A 1DRJA 2AZXA 4MX8A 4OSEA 4UVEA 1MN6A 1YRLA 1C3XA 1H94A 4NCHA 4PZYA 1JEYB 3L0IB 3IPXA 3R7SA 3ZV3A 1DMRA 5CLGA 3VNBA 4DC9A 1KEVA 5BWBA 4OJNA 1RHMA 2ZTVA 3KC2A 2IZ0A 1Q0RA 4YMSA 1T5OA 2I4NA 4NX2A 4LSMA 3TZLA 1QX3A 2HREA 3D3WA 3V2GA 1T0PA 3BXZA 1JLLB 2W4IA 2HJGA 4YMLA 3RARA 4DJTA 5A4JA 1DFHA 5GTDA 2Q7OE 4TLCA 4PR3A 1EFCA 5DDIP 3A4NA 4X90A 521PA 3LHKA 1Y5RA 2J3JA 5BUQA 4AN0A 4KQKA 3S40A 2K6GA 4D26A 3MINB 2OZLA 5AJTA 3T5TA 4UOEA 2QU7A 1H3EA 2XY4A 3NHFA 2EQBA 2OEPA 4D6XA 1P7YA 4RHCA 2V8BA 1Y37A 4FHGA 5BSMA 2PE5A 1G8MA 4HEHA 4YYZA 2BEVA 4N0PA 1BXGB 1D8AA 1Z47A 1F38A 3N9IA 3RIEA 4OV6B 2YV3A 1JR2A 4BV9A 4POOA 4UOZA 1TF7A 3ZE6A 3HXQA 3DKPA 2FXVA 4LPSA 4O1IA 4EVQA 3O1IC 2PIAA 4NZYA 5L6LB 3NTVA 3RSCA 3CLTD 3A27A 1GNLA 3NH6A 1NLZA 5D3MB 1ZAYA 1H1LA 3CH7A 3H1AA 5CYGA 1U8XX 3L8MA 1E9AA 3NASA 3CX3A 1BQEA 3KZ1E 3T7RA 1B14A 4REQA 2Y67A 1Y5LA 4HUJA 5F4BA 2QTWB 4X1KA 3H9JA 4QAJA 2P67A 3G0IA 3CXUA 4MINA 1CERA 4PRYA 1QTIA 4ZT5A 1E2GA 1XTRA 1CVIA 2I6UA 5IVPA 1ZQ1A 1IH8A 2FGKA 2NVOA 4J91A 4F1JA 5JSFA 4PLYA 1V7CA 5C7LO 4MIEA 5DHTA 5HKAA 3UT0A 3RS3A 1W6RA 1BNCA 2QJRA 1M2JA 1EFLA 4RJKA 3S7TA 3SPXA 4YO8A 1EFRA 5G02A 3S2SA 1XNJA 5LDGA 2FAXA 1Q7CA 3AUKA 3E22B 3L9XA 3DE5X 3QE3A 2D4HA 4CTJA 4AZ0A 1U3TA 1NQAO 1ZO8A 2XUZA 1SCUA 4J6EA 2J7PD 5DT9A 5JZOA 4V03A 1HZZA 3T5GA 3QVWA 3AR7A 3EIFA 1JHQA 1X14A 4OI1A 4AURA 1AIPA 1SO8A 2C9ZA 4RE5A 2WWTA 3HZHA 4U9UA 1ORRA 3VA7A 2ICAA 3RBZA 1IJFA 3ZDFA 1AXEA 2CNWA 4RAOA 2HPAA 3MMSA 4P36A 5DNAA 3WQQA 5MFPA 5BYBA 3NORA 2E6UX 4KIWA 1KEEA 3NV7A 1JBEA 2A9KA 2BAGA 2JGKA 2ZYHA 4NHOA 5CURA 4YMWA 3WO0A 4MUGA 3V4LA 1F06A 5GOZA 2XUJA 3CC8A 3T7SA 4YJDA 5E95A 2VWGA 5BV8A 1KZGB 4EVSA 4YLYA 3K70D 2AJ8A 3GLFE 2A2ZA 4YMGA 4GKBA 2LD4A 1AGPA 2XD4A 1C14A 2YRXA 1KJ9A 3DNMA 2MCFA 3P96A 1TCCA 4RBNA 3BFPA 2HB6A 1K86A 1W0JA 2O3UA 2OE2A 3QKRA 1XN4A 4I8XA 4MR8A 4C4YA 1ZUHA 4QODA 1Y82A 1UDXA 3WLIA 1ZJ4A 5AM5A 2Z4SA 2WWRA 5EJEA 1C8VB 4BVBA 1B6RA 1DRKA 1PEAA 1X1RA 3HDTA 3FHJA 4M9UA 2PN1A 4MV3A 4BZWA 1UMBA 2BJWA 3V4FA 5FLXA 4IZIA 4M1MA 2WU0A 2E5FA 3HEBA 3Q15C 4KO4S 4AKGA 3DE7X 5B6IA 5KTTA 1BD3A 4RD6A 2C2MA 3EWIA 3GNSA 1E4VA 2QL6A 3HR7A 4FYVA 4UFNA 4E0BA 4KPEC 1NPTO 3KOYA 2CNOA 3SMVA 1EEXB 2POCA 2XRYA 1FNSA 1J24A 1U4OA 2W93A 3LBFA 4GXRA 4KE6A 2IY7A 4WESA 4TROA 3RVKA 1U80A 2IT1A 2QTVB 3QKUA 1SC1A 1U2PA 2IDMA 5TPWB 1RBZA 3FE2A 2VK8A 3FHOA 4H2DA 4PWZA 3EEYA 1TQ8A 4CDGA 4LZLA 2VF5X 3S1LA 4X8HA 1U8TA 1E6WA 4DSAA 2PKRA 1ZN8A 4WJKB 4EFMA 2CLSA 2GRJA 2WWXA 4FC6A 1VHWA 4MEAA 4NATA 1RW4A 2WU1A 3IQDB 3I5YA 4L5AA 5EUQB 1G98A 1XELA 2C4HA 3ZV6A 1Y8AA 4TZTA 4TLEA 4OU5A 3V4OA 3H86A 2QRLA 3IEXA 2XW6A 4UHHA 1R0ZA 2O4UX 2AX4A 2Y9MB 4YQEA 4ASUD 4NCBA 1MCZA 3PC2A 1ZBDA 1O8CA 2IDKA 4HLDA 2ZJ1A 3AESA 1J56A 3KLMX 5IMBA 2FP4A 4BLQA 5IG2A 3ZK9A 2QTCA 4GZMA 3VZPA 1XEXA 4FFBB 2AF4C 3KYCA 2O2YA 2HAEA 3T5BA 4EUHA 3ZE0B 2OCAA 1VLVA 2X4GA 2AKYA 2B4YA 2G08A 2XUHA 3IHLA 1YR7A 2KB0A 5ILQA 1L4UA 3TIIA 4EENA 3UMRA 1RC0A 1TZJA 2GXUA 1W5EA 3VPDA 2A78A 4QXMA 4BKPA 4ZGBA 2AK3A 3IV9A 2JH8A 4TN1A 1SHTX 1XMJA 3SYKA 1TKBA 3KT0A 1NG9A 1K6JA 4IAOA 1D6MA 4UPVA 3LQ1A 2BMJA 1Z4NA 2PFSA 1UAAA 1MC1A 2EF0A 3AU9A 3P52A 4R3UC 5C8YA 1P4RA 2VWPA 1ZD4A 4ZGWA 2N1MA 4E5SA 5AW4A 4WZBB 1IY0A 4C6RA 1PJCA 4BLTA 4B2YA 2HMWA 4EAAA 4ENPA 1DXYA 4QPCA 5LDDC 4YBRA 2ZIWB 4D45A 4RTMA 3GL9A 4DB4A 5FEUA 3ANTA 5TT1A 1QDEA 3RF7A 1SKAA 3IUNA 1PKXA 5GVRA 2J3MA 4DSOA 4C14A 2HXYA 2B20A 2H1WA 4NFYA 1YA8A 5ELXA 2GAJA 2MYTA 3EVEA 1PFVA 1XTTA 2FSUA 1ZKDA 4IHJA 4JC4A 4US0R 5E2AA 4EG3A 1O54A 1AKRA 3FYSA 3MTQA 2GDZA 1UKZA 2FSPA 4H0NA 1EFAA 5FBHA 4Q01A 4P58A 3NTLA 5D3ZA 1L7BA 1U8EA 3OLVA 5GV8A 4QJ3A 1CJBA 3AHIA 3WVNA 5K2MA 4KR7A 1CE8B 1JE0A 2CVPA 1I7PA 3IQWA 2JVIA 1C3VA 3KYJB 3RHFA 1VGVA 3KR0A 1J1IA 5EGNA 4F9EA 4R2JA 4RUKA 4TLAA 2MINA 4HLUC 1V8BA 1RT9A 1PZNA 1LV8A 5EWJA 5KHOC 4P0PB 2CMDA 4PINA 4HWKA 2GSWA 4HX2A 4N8SA 7MDHA 3JTEA 2PKQP 4D42A 3NKLA 1WHSB 4XUEA 3Q7EA 4YJKA 4Z8XA 4EQ6B 5JFOA 3KUCA 4RULA 3CLSD 4UBIA 4CL3A 4LGCA 1XCGB 5DM2A 5BWMA 5H0IA 1DV1A 2DQKA 4IW3B 1B0PA 5FV7A 2GJ4A 4EPYA 1RXYA 3BCUA 3F3SA 2G7MC 2JF0A 4AG6A 3WNVA 2IBMA 5KTSA 1QIGA 5KYUB 1EX6A 3CPSA 3EC7A 3UICA 3WWEA 1TC1A 4X5OA 5JS7A 4LDJA 2VPWA 5CT8A 4FNOA 5HILA 5IZCA 3QELB 4UZSA 4ID3A 1E89A 1YOVB 2QN9A 4R2HA 4AX8A 1WCYA 5CT5A 4B46A 4OMUA 1NI3A 6YASA 2HRCA 2A9QA 4JT2A 3EOZA 4AM8A 1ADYA 1H3NA 3C3DA 3N8HA 2C0QA 3B2QA 4QT4A 4ZYVA 5GZ1A 4WFJA 4JI5B 5JLJA 2QMOA 4HVLA 4PR0A 4P0QB 1JSLA 3SLGA 1A2OA 2QAGB 3B2NA 3MOIA 1VL0A 3SNHA 4A6XA 2AJBA 3L1VA 3BX1A 1CYEA 3CQ9A 1FUIA 2R00A 4L3VA 3A4LA 2FG7C 2QVBA 4MMZB 4JVLA 2HA2A 4CQMD 4XSHA 2F1HA 1DBRA 1EINA 1KDTA 1ABBA 2FZCA 1Q50A 1UZLA 3ER8A 1H1TA 3FJYA 2FSSA 1I1QB 4XWGA 2ZJFA 3JS5A 3SZRA 1PRYA 2C96A 5AKKA 2HQBA 4P5EA 5F21A 1QORA 5I4IA 2XVYA 3C1OA 2A9FA 3QVLA 4MUNA 4V0LA 3U60B 2IP2A 1QK3A 2JLVA 1AD2A 1RM3A 3W04A 2PSJA 2CBZA 2X14A 4AX4A 2P68A 2PGJA 1UP6A 4DIKA 3GDOA 1UXKA 4OIFA 3W8FA 3HG7A 1FTYA 2GVZC 4DJ5X 5K7SA 1N8NA 1OU0A 2ACWA 2G70A 3P5BA 1U8FO 3L7LA 5DVZA 4BRUA 1YC2A 3WLJA 4PO1A 3IBTA 1ZD5A 3T1YB 1U7TA 1Y8QA 2OD2A 3LUHA 4OXRA 4ZOBA 3WV4A 5K8UA 4LV8B 2YASA 1GTVA 3PXCX 3GLQA 1D7OA 3LOQA 2W2XA 2R79A 3FTPA 5DNCA 2HMAA 2HIMA 3JD4A 4F38A 3PZRA 1XPRA 4R1UA 5EHNA 2NTNA 3PT9A 5DB4A 2ZM5A 1BMFD 2CNKA 2OC4A 1O3YA 4EP1A 3A6ZA 3TEMA 4LRQA 4HWGA 3FOCA 5FL7A 1W2WB 3NETA 4C4XA 1T8RA 2PZMA 4L5CA 3I2YX 1SC6A 3TVTA 4LZOA 4UHCA 2O3TA 3COVA 4OAQA 4BE7B 1ZOLA 5K3OA 2RBEA 1X9HA 3JQQA 3DDNA 3FI9A 3P9RA 3JQDA 2X1HA 2KPOA 3Q9UA 3JD3A 2XSZD 3SHWA 1E79A 4U0KA 4C76A 4ZHQB 4MWZA 5LLDA 1V0JA 1N0WA 2XKJE 4G4GA 1JIXA 3VR3A 3ZLJA 3N2KB 1XRJA 4MRMA 3U3KA 1RMQA 3HY3A 2KM1A 5AKIA 4BFXA 1WB5A 1FSFA 2PFKA 2R6CA 4WI1A 2ZGVA 3P94A 3TXXA 5LMCA 2QRJA 2IOFA 3FYUA 3RT1A 2OP1A 4XGRA 1QUFA 3HU2A 4D5EA 2ZSDA 5CNJA 3G7UA 4NZ9A 1XJWA 2YR0A 3O9MA 1WDMA 1HRDA 1OGYA 1X87A 2GK7A 4NEHB 1GL3A 5IULC 4S05A 1PGNA 3CISA 3E0QA 3HSYA 3QEOA 4QQFA 4ONEA 5DGTA 3ZZTA 2V4UA 4N3NA 3EH1A 3N2GB 1NQTA 4OHWA 3IB3A 4G63A 4ALMA 1WU7A 4K9OA 4DLAA 4ZO4A 5FI5A 5EJ6A 3U44A 1KOJA 4Z9XA 2HDNB 4FFRA 1QIJA 1XHEA 4MQMA 2A9OA 4JQCA 4HLQB 1MO6A 3R5SA 1P1JA 1L4BA 5JVDB 3TD9A 1T8PA 4W5OA 3FWHA 4RH1A 3NHPA 1XTBA 2PGAA 1NONA 4IDPA 1LTKA 2IUYA 3EQ9A 1A9YA 2NXJA 4J0DA 2JHFA 4PZPA 3AHCA 2HMSA 4FNAA 2AKAB 4EX7A 1OILA 1T1RA 1U1IA 4I55B 2ZWPA 4YPFA 2VBCA 4QXQA 4B2PA 5LQKA 2C1ZA 4ZI7A 1K6XA 2Y6VA 2PH1A 1M2OB 5A4DA 1DAIA 1Z29A 4IFBA 4TV9F 4QTXA 4PN7A 3EFHA 1RHKA 3WY9A 4M0FA 2B5VA 4Y2HA 3DTVD 1U2RA 3H2IA 4WRRA 2CLFB 1GXSB 3L46A 2Z1NA 1PR9A 2C42A 2NP7A 3AL0C 4M1KA 4RMHA 2WTEA 4O2AF 1CY8A 1ZESA 2M2IA 2OFWA 5ALQA 1NT4A 3AI1A 3G0CA 3U62A 4E09A 4Z7NB 4QGBA 1GQ2A 1SBQA 1H1LB 3LCMA 4QOEA 4QO7A 4YREA 1L5QA 1XSEA 2IF0A 2IZ6A 2GHTA 1UFVA 1NI4B 2OLEA 2X6QA 4BL5A 1GPLA 1Z6PA 4EL5A 5AUOB 1O6CA 2ZB4A 1OIVA 1KDRA 3DUFA 4WJLA 4AZ3A 2X0JA 4CEJB 5F9FA 1JFVA 2XCIA 3BXGA 1UJCA 2X13A 4ZT6A 2ZSEA 2FB9A 1WRBA 2FFBA 3B1JA 2C4KA 3LW7A 4LTMA 5GONB 1DZ3A 3T1QA 4B9EA 1E63A 3SBDA 3HP4A 4R5HA 4ZI5A 3K30A 1V6CA 3TNYA 3WLPA 4EGFA 3EXEB 3TSCA 3A7DA 1ST3A 4N3AA 4WE3A 4KOEC 1XYVA 1QZZA 1OAOC 2GPYA 3BM5A 3QVMA 1HDIA 4INPA 3QPAA 5DSZA 2C9DA 5CT9A 1VDZA 3O26A 1WOYA 3PC3A 4OI2A 4Q37A 4AF8A 1V3TA 2VDNB 3EIXA 4D56A 1JG1A 2C98A 1G21B 3I4CA 4IF4A 2JGLA 3M2TA 4EG8A 3OEHA 1O2DA 1M34E 2VPZA 2WM2A 2VAWA 4Q12A 1AS2A 5FFFA 5TB5A 2VJBA 2IEYA 2ZRMA 1JLLA 8GPBA 5FQOA 5IUJC 2GEBA 5DNWA 4ILKA 5EZ5A 3VX4A 3YASA 2IH2A 2NO5A 1XTSA 4X93A 1FSSA 5EVJA 4BQFA 2V7PA 4LBYA 4YECA 2B1RA 2V45A 3HXTA 3JQ6A 1RNLA 5F4ZA 5A71A 4WZBE 2ZITA 1NMZA 4HDOB 4HQ0A 3ADBA 3ZBPA 3QF4B 4Q4LA 3RVBA 1MENA 3RS9A 2WINI 4PYJA 4F5WA 1V16B 1S7CA 1SQGA 4Z0HO 4PBSA 3OM0A 4B76A 3PEFA 2BFEB 3DLHA 4N48A 1XZMA 2WPNA 3HUFA 1WXFA 2FEPA 4RHEA 3UUGA 1KMMA 4OHVA 1MQ8B 1PTJC 3DWEX 1YJ5A 4FJ1A 3ELYA 4XTRA 5BN3B 4I6EA 4O3FA 3I5XA 1VG8A 2D0IA 4O4JA 4REMA 1POXA 4AJPA 1CEEA 5KYXB 5JSKA 3CSDA 1N7HA 2Z6VA 4XX0A 4KX5A 1KK0A 3QBVA 4QDKA 2J0UB 4R5MA 3RPEA 4NJMB 5GPBA 2C2KA 4L2IA 5BOVA 1OA0A 3JQAA 3DAYA 3IPRA 1EFTA 2I2XB 5GZ6A 3IILA 4JX8A 3LOUA 1OV6A 2XF2A 4OQPA 1KJZA 2GHIA 2R25B 2V55B 4FP9A 2O48X 4IVRA 2B2XA 4WFQA 5H5JA 1PLKA 3VYWA 3W5VA 4AULA 2B1QA 4FKMA 2OAEA 2GSDA 3EBLA 2IZ7A 2WUEA 3QZUA 3IUBA 3GXBA 4YRLA 3TL3A 4CDNA 4JC8A 4E1BA 2W2LD 2ZIXA 3C70A 3GDFA 4MIOA 1NVDA 4LRUA 4O0LA 2PX3A 4YRMA 2UXCB 1BWSA 1V1MA 2R7AA 3N7TA 3KDPA 3NOXA 1L5LA 3RODA 4ZO6A 4D0RA 4QXPA 4RDHA 4YJ2A 1N33B 1Q84A 3ZBTA 3FPHA 2BVNA 1Z88A 4GUAA 4LHWA 1K8QA 4MMXB 4UCFA 4GMXA 1R6XA 1RTTA 2NUTA 3V2HA 1LPBB 2BZ1A 4MGEA 1KA9H 3OFND 4D4HA 5CA1F 1KXZA 1QZ3A 1FNDA 1YQQA 2AFIB 2DHRA 3NOVA 4JVOA 1WY5A 3ZJYA 3L6UA 5KTOA 1HDOA 1V5EA 2OVBA 1GG8A 5E7MA 3G2JA 4MVCA 3ZWWA 5EJ5A 3S1SA 4LDNA 1M6EX 2DFLA 3GEDA 1PL0A 1U5AA 3C39A 4KK3A 5CDTA 5C8DA 1EWQA 5FHQA 2QGZA 3V42A 1E94E 2VCHA 4EZEA 1NUSA 1UBKS 3OG9A 1PT6A 1UJNA 1N1MA 2ZP1A 1H8ED 1LEHA 5DLYA 2J8ZA 5BV1A 3SVTA 1RJFA 2AC4A 2EGHA 1UJMA 1XL0A 4R1LA 3OKCA 4ZREA 3O74A 4UAUA 4PSKA 1OBCA 2RGEA 1R9NA 2FPXA 2VYFA 3QF4A 5ANRB 1QH8B 3IAM1 4NBWA 3KPYA 4BMXA 2RARA 3FLMA 5DXAA 1QHHA 2R1ZA 3IAXA 1TEHA 5ICSA 5JBNA 1LWNA 3QXHA 1BCSA 3RCBA 1SC9A 3VR1A 1FJXA 3RGGA 3E03A 1V4VA 3EF0A 3OPQA 5D5HA 4RTJA 4JV5B 2GEUA 4JQYA 4RJIA 5TMPA 4C07A 4PC7A 2DTDA 1L0BA 2F62A 4M88A 4MWDA 1ETHA 2MJLA 2QVCA 3L6BA 4UEOA 5J43A 4MUIA 1VJ0A 4WGFA 1ZNXA 3IOBA 2PDAA 5KKCA 5FA5A 3MWGA 4P4UA 1IPFA 1BJRE 3IMGA 4DNOA 5BURA 2PNFA 5TJHA 5DPMA 4Y6RA 1M72A 2RJ3A 2IXDA 2R6R1 2QN2A 2VUHB 3OI7A 3AI2A 5ESXA 5G41A 3VPFA 4BLRA 5HKBA 2IGTA 4CIBA 1HX7A 2HQRA 4F60A 4P92A 4Q7EA 4ZGGA 3V34A 2Q99A 1N1DA 3K2EA 4P6VF 2RGDA 2DB3A 2WJZB 3SJZA 1RJ9B 1YOBA 2JIZA 3DM5A 3D8UA 3TE7A 5HFJA 2I8AA 2J9RA 2H5EA 5FO0A 5HKKD 1JW9B 1RFLA 3O6VA 5IKXA 5TNXA 5JARA 1Z4QA 3JWJA 4BQRA 1TU4A 1XRRA 2HU2A 4MZDA 5G1PA 2VHUA 2C9YA 4HNSA 1KJJA 3I76A 4EQ6A 4UUOA 5BWLA 2Z2ZA 2Z6QA 5GJBA 2PAFA 2PJDA 5KO2A 1M1NB 3HC7A 3EIUA 2YMQA 3QYFA 4OB8A 4AAYA 1IZ0A 1BQ3A 4HGYA 4DCGA 4EITA 3NHLA 1GILA 1Z62A 4PC1A 3IXMA 3O83A 4WEOA 5JQGB 4GMFA 5LU8A 1K3TA 2AX3A 3LDFA 1NBME 1OI2A 2IV2X 3VKUA 5LYJA 1NIPA 4JN6B 4IJ5A 2H4ZA 2QV7A 4HWOA 3DEHA 5JCJD 1EVLA 5LWQA 2JAHA 4F91B 4H15A 3E5MA 1GRCA 1V5GA 4NV1A 2BKVA 1S1CA 3KYDA 5AJVB 5IWCA 2QDXA 4DQUA 1P61B 1Q3KA 2QP3A 2X6TA 3PGVA 4G4JA 3X2EA 1H93A 3I5UA 3FPGA 2DUJA 2Z43A 3DZ8A 4IDFA 4IUYA 4NPCA 5L3SB 5DI3B 3VR4A 1OPXA 3NYRA 2MMCA 4OQFA 1DAHA 1E2KA 4AUNA 1POWA 5EJGA 3AHJA 4QG7A 2QUJA 2WIDA 4OH7A 1RI5A 3LH5A 3TLJA 3DOFA 2PA3A 1LLUA 2VP5A 3IVGA 4I6GA 2QORA 2Z3VA 1MABA 4YUWA 4MYDA 1ATIA 5AJUA 1KEPA 1GKIA 4PIPA 5NLLA 3UO8B 3HGQA 2ATXA 4KNVA 4P81A 2VYQA 5BQ3A 1LF5A 1PWEA 5AUPB 1O9HA 1M1ZA 4M1WA 2V0NA 4G9EA 1ZGBA 1R0CA 2J4FA 2F8TA 5CLHA 1VSUA 3D54D 4H77A 1P18A 5K0TA 1YZHA 1F48A 3KS9A 4YP9A 5BV7A 4IBOA 4KG7A 3WMWA 3UXHA 2EG9A 1BEUB 3BQ9A 2GPWA 3A31A 3KQQA 2EJCA 2W6PA 1GU1A 1Y1LA 2WNHA 2QL9A 4GPIB 5AVWA 1WQ1R 1N2SA 3KJEA 1TQ2A 1QZXA 5FO1A 3F6BX 4I5GA 3MQFA 4XIGS 1NMSA 3IVRA 1XEXB 2ADMA 1LFAA 2Y71A 1F2TB 3RK1A 4QPJC 5GIOE 1ZGHA 2Z0MA 2ZPUA 2GEVA 1KI3A 1RLJA 2GEJA 2QR5A 2RFLA 1E6KA 3D7LA 3AVUA 1ZNYA 1K4MA 1RM4A 2CL7X 2QMZA 4BJ5A 4E4YA 3H2BA 1SUBA 4QOHA 4RSGA 3ETEA 3VU8A 5C3MA 1ZNQO 1KDYA 1UC9A 2AOXA 4F5DA 5ESDA 1LPAB 2D7CA 3QW4B 5EPOA 4NC9A 4XPIB 1IN5A 1ZP6A 5ENVA 3UGJA 1Y9ZA 3CLRD 2WKQA 3C87A 3LA6A 5HEKA 4B84A 4AZWA 1QO0A 2H1HA 4X97A 3LUDA 2PSDA 1XMVA 1XKLA 1HT2E 4OQNA 1JG7A 1KK3A 1A8SA 4R51A 4MYTA 5C5DA 2VDWB 3SEZA 4AJLA 5F7XA 1D2CA 2G1AA 3PEWA 2ACKA 1IEQA 3F7TA 4ROTA 5A7HA 4DE5A 1RMTA 2RKBA 3UHFA 4ZCRA 2XGMA 1IZ9A 5A2GA 1FIUA 2GKGA 2CJWB 3OT5A 4FYHA 4PRLA 2IZ1A 1LDNA 4ALNA 1ZOOA 4EY7A 4R4JA 2R0QC 1Z75A 4TM8A 1Z0SA 4JP5A 4ZRNA 4DCUA 5DX8A 2LKCA 2GDJA 4DBVO 4WKNA 5AQEA 1E2FA 2W6NA 4QA9A 2XTNA 2WG2A 4QICA 3OBBA 4TMYA 5BVGB 4NCXA 4HNAB 3LUCA 3ROKA 4C21A 1YTUA 4AJIA 3L2OB 2VHCA 4YCNA 2XE4A 1IHUA 5TR9A 3RRXA 1QU3A 5K3DA 4BNKA 1JDVA 2P9FA 4TOIA 1QVZA 3DPUA 4QTYA 4EEZA 1VPDA 3BEOA 4H7DA 3W06A 3VVBA 4WNAB 2OV4A 5KPJA 1G7SA 5JH7F 1M1YB 2H08A 3G8AA 4ZQCB 1NP7A 1V9LA 2CLCX 2IYXA 2AE2A 2XB6A 4KI0A 3UV3A 3PHLA 1DC6A 1AX9A 5CNKA 3G1WA 4BGDA 4DFDA 4NU5A 3FFXA 3OZUA 1V37A 1AXRA 2IZ5A 4HNQA 4QTZA 3W79A 5KX5B 3BGIA 1C4KA 1DOHA 1NWHA 3AOEA 3MAGA 2B4QA 1X7WA 3MMZA 5BXQC 3RF6A 2AFIE 4RKFA 4UVDA 5EKXA 5KSPA 3KZNA 3W6OA 1M67A 4IICA 5JJLA 1A82A 5GONF 3SU8A 2JBAB 2YXBA 1Q0QA 5IKMA 4AZSA 4MYUA 4DC0A 2D5AA 2EBUA 3HN6A 5FWNA 1GLGA 4BP3A 2E1PA 3EGOA 4D98A 4H3SA 3FUCA 5IBQA 4BWVA 1HNZB 3DEFA 2YDYA 1Z18A 1VSQA 1NXTA 3CF4A 4LXGA 2O0HA 4MP3A 2P2DA 4O4LB 1NP6A 5FTJA 4DLVA 2COEA 3M8KA 1WXGA 3I5MA 3ZWCA 4CFSA 2YY6A 4KPYA 1W35A 2BGMA 4DN6A 4XWKA 2B37A 1GUZA 1PFQA 2A1IA 3UGTA 1LVUA 4IDOA 2BSAA 5DTJA 4BMZA 1S2GA 4QNRA 1E1NA 1W5TA 2ODBA 2H31A 1X2EA 1OZ0A 2PZEA 4KXXA 1G8SA 1T5TA 3FKQA 1I2AA 5LQAA 3BWVA 3SZOA 3F74A 2BM8A 1B8UA 3QXJA 1L5HA 4U5XA 4I36A 4LGYA 1NJ8A 2F3QA 3WJ2A 4OYYA 3QLVC 4J3JA 2WHRA 1HE1C 3KVNA 4F6LA 1KYIA 1RZVA 3H4IA 1HNNA 2Q3CA 2W8BB 1SY7A 3NRJA 3TR6A 5CB4A 3VDRA 4MCHA 2DLDA 5BWOA 2FZKA 3A9WA 1PEYA 2P2CA 3CT6A 4FSDA 1ORTA 5F51A 5DGCA 5ICEA 4D99A 2JKZA 4AC9A 1NOKA 3L7BA 3ES9A 5DT2A 2XT9A 2DT8A 3W4KA 4JROA 5KX5A 2V1XA 4ZD6A 3ZHOA 2EP7A 5HQTA 1JR4A 1MTZA 2DQ4A 3H9GA 3VQTA 4WCDA 1QLHA 1QHYA 1XLUA 2FPKA 3EQ2A 1YU9A 3OZSA 3P9IA 4I1YA 1OF1A 4RGYA 1QVWA 5JDCC 3E9YA 4I46A 1Z12A 3HY6A 1PKEA 3KP1A 4F2WA 3GVIA 2RGXA 4ZZ0A 2ZI6A 4WKCA 2H7VA 4U9HS 2H51A 4R7GA 2YFKA 3FR8A 1NX6A 2NQTA 2BFOA 2Y6UA 3A9TA 3FBGA 4TPKA 5E7JA 3TMAA 3UHOA 3VU9B 1GKUB 4TTTS 4CKEA 3F0TA 5CG1A 3RBAA 3STUA 4B3TB 1ULZA 2C04A 3BGSA 3L8YA 3MILA 4MB6A 3VO9A 3WWCA 4WXEA 3HI6A 4E7PA 1MO4A 4GE3A 5A5VA 1RD4A 1C2TA 1SKBA 1OJ7A 1GPKA 2WSSA 1PJ4A 3H7AA 3FPBA 3SVZA 3W6ZA 4AJOA 5DWDA 4DMGA 1KEWA 1UWCA 3LWBA 5F1KA 2P9CA 3K73O 4FMCB 5HIJA 1IC6A 4B4OA 3E8XA 1A98A 2G88A 4RX1A 2J9FB 1UZMA 2V7BA 2V0CA 2RKWA 3ZWVA 3BRWD 4Z4HA 2IS2A 4AMZA 3SSMA 2O8DA 5DASA 3VR4D 1DS6A 4CTOA 4ETNA 2GZ1A 3UGQA 1B16A 3FKSA 3VTAA 5C7IO 3E9QA 4EG4A 1P5JA 3B52X 3H2YA 2FKAA 2QMQA 1KI8A 3QRWA 5AM3A 3L4BA 3UWPA 1IBMB 2CE7A 2Y8EA 3T12A 1QQBA 3UY4A 2AOUB 1Y1SA 1C8LA 5E6SB 3L1UA 3V4PB 1BSVA 1MXHA 4Q7LA 1REQB 3ZGYA 3KXDA 2II6A 4V2IA 4EMTA 2GK6A 1M34B 1N1EA 4M38A 4JLDA 3NR2A 1ONPA 2FPPA 2Q07A 3T0IA 4DLZA 1CJVC 5J2TA 1E69A 4YRZA 5CAEA 2BFPA 3SR0A 2VP3A 4HXEB 4DXDA 5K3FA 2J6CA 2AZTA 3CUVA 4UUAA 2HFJA 2Y05A 3AM4A 1JPVA 3NIBA 4MWOA 1BVUA 4MCIA 4J1QA 2XVMA 5K3SA 4CEHA 1V8DA 5EYPA 5IJ0B 1X1AA 4CEIA 1BMTA 2XJ9A 4KSYA 4BX2A 3BWEA 3T34A 4P35A 3G17A 2BP7A 3NDIA 1VTKA 1HLDA 1CUBA 1JEEA 1R5OA 4LZPA 1P0PA 4P93A 4Y2UA 1GAJA 3CPJB 3K4QA 5I5GA 4FWBA 1Z6TA 1ZLXA 4QFBA 5HK9A 1YV9A 4C0WA 2CT8A 4RDXA 3FCEA 1H9AA 1X92A 4KGDA 4CFYA 2YZ7A 3HS3A 3QHAA 4FOOA 4I4TA 1J2EA 2ON6A 1ADBA 4XEHA 3T1OA 1KMCA 3KT3A 1J90A 2NU6A 1OE0A 3PQ2A 1G8GA 3Q9SA 2A5FA 3NBYC 2PRSA 1RWWA 3ZQ6A 2AQHA 2ODPA 4DKJA 3DEZA 2WVGA 4DDWA 2XQKA 1UWLA 2VT2A 4Q1FA 5C0OE 3K9BA 1YNSA 1G291 4G24A 5AI4A 3QA9A 5IU6A 1W75A 1YSCA 2YRFA 3R6LA 1LQUA 4KE8A 2F17A 1P9WA 3AKCA 4TQAA 3QX7A 2WIKA 3TTSA 4BAZA 3TIFA 3UHPA 3H5IA 4NV3A 4MVJD 5BN5A 1CUWA 1RI3A 5D3QA 3WWDA 4XWYA 1GOTA 4L8LA 4ARZB 1U2SA 3PTAA 4M9QA 5MN6A 4B6PA 4ICIA 1V71A 1SRQA 5JH7A 5KHAA 1ZJJA 1XKQA 3PE3A 3VR2A 3ZBUA 2WSLA 3A1WA 4IV8A 3ABZA 3WNQA 1YA4A 2YRWA 4E3ZA 2F3TA 3DO8A 5ALUA 1VG1A 3O4RA 4C03A 4DIMA 3WGNA 1FFYA 1QCYA 1UPCA 3NWOA 3EDRA 3NBXX 2WOJA 3OLQA 3WIVA 4ZK2A 3TLEA 5A4MS 1FRZA 1U3GA 5JMWA 5AVZA 1KQOA 3DNFA 3WHKA 2BFBA 1Z0IA 4G0OA 6GPBA 2CXSA 2VAXA 4JHLA 3VGJA 4R8SA 2FWJA 2ZTSA 2B8NA 2CVZA 2JVKA 2PQ6A 5JAZA 1T36A 3HKEA 3M2PA 3V5NA 1FQOA 1XJ0A 5T6BA 4DMCA 1UBHS 5EHGA 5I9BA 3O21A 2ENUA 3IUQA 4ITRC 2SKEA 2N1BA 3D3KA 3H0EA 1CT9A 4FE4A 1RRFA 5IJWA 3ZKWA 1WXXA 5D00A 2G4VA 3VR5H 421PA 3HACA 1NQUA 1VRCA 1JHZA 4YJ3B 5E6RB 1N7JA 1TJ3A 2H2FA 3PYMA 4NJEB 1WTCA 4R0VA 4URWR 1EXDA 2VA9A 4C5AA 5D3MA 5MN5A 1CUVA 5ALKA 3GPLA 1L7XA 1NVWQ 3NRBA 2NO4A 1PQ4A 4Q3LA 1J06A 5KNCA 5LXTF 2ZSJA 4QXRA 1H2XA 5ADUS 1R6AA 2WQ7A 2N3ZA 3KLNA 1HT0A 1H2BA 4LRSB 1XDGA 4LCEA 4IO1A 4IX1A 4YDQA 2VH2A 3GLRA 4CHGA 1NN5A 3PGMA 5T4HA 3PG5A 2W42A 1DJLA 2F64A 1CUDA 3SHOA 1E2DA 3G89A 3AXTA 1Z56C 4TUYA 4U8HA 2G40A 3KU4A