5HL7E

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
157
structure length
157
Chain Sequence
TFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPSDSKEDRTNHGTTRALLNNMVQGVSQGYVKVLELVGVGYRAQMQGKDLILNVGYSHPVEIKAEENITFSVEKNTVVKVEGISKEQVGALASNIRSVRPPEPYKGKGIRYQGEYVRRKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title A novel pleuromutilin antibacterial compound, its binding mode and selectivity mechanism.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 5hl7E02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 5hl7E01
5AN9B 3CCEE 3CXCE 2ZJRE 4IO9E 2QEXE 1VQOE 1M90G 5MLCH 4WFAE 4WF9E 4WFBE 3CC4E 3CCUE 1NJIG 1VQ4E 2OTLE 1M1KG 5DM7E 5GAGG 3I56E 1VQ5E 1VQ6E 3CCME 2ZJQE 2OTJE 1YHQE 3G6EE 1K8AG 1Q81G 3CD6E 3PIPE 3DLLE 1QVGE 3CCQE 5GAEG 1YJWE 3I55E 5JVGE 3PIOE 3CCSE 1KD1G 1VQME 1K9MG 1VQ8E 3CPWE 3OW2E 1VQKE 5JVHE 4IOAE 3CCVE 1YJNE 5DM6E 1W2BE 4UY8G 1RL6A 5H1SI 5GADG 5GAHG 1K73G 1Q86G 1Q82G 3J7ZG 3G71E 1YIJE 1VQNE 1VQ7E 4WCEE 1VQLE 1Q7YG 1QVFE 3CCLE 3CC7E 3CF5E 3CC2E 1VQ9E 3CCJE 1VQPE 2CQLA 1JJ2E 3CMAE 2QA4E 2ZJPE 1S72E 1KC8G 3CCRE 1YI2E 1YJ9E 1N8RG 3CMEE 1KQSE 3G4SE 4IOCE 1YITE 5HL7E 4U67E 4WFNE
chains in the Genus database with same CATH superfamily
5AN9B 3CCEE 3IG9A 2AF5A 3CXCE 2ZJRE 4IO9E 2QEXE 5B11O 2OY1O 1VQOE 3EC5A 1M90G 5MLCH 4WFAE 4WF9E 4WFBE 3CC4E 3CCUE 1NJIG 1VQ4E 2OTLE 1M1KG 5DM7E 5GAGG 3I56E 2OY8A 1VQ5E 1VQ6E 2FKGA 3CCME 2ZJQE 2OTJE 1YHQE 3G6EE 1K8AG 1Q81G 3CD6E 3PIPE 1P4PA 3CKFA 3DLLE 1QVGE 3CCQE 5GAEG 1FJ1E 1YJWE 3I55E 5JVGE 2OL7A 3PIOE 3CCSE 1KD1G 5B10O 1VQME 1K9MG 1VQ8E 3CPWE 3OW2E 1VQKE 5JVHE 4IOAE 3CCVE 1YJNE 5DM6E 2OL8O 1W2BE 4UY8G 1RL6A 3AUMO 5H1SI 2OY5O 5GADG 5GAHG 1K73G 1Q86G 1Q82G 3J7ZG 3G71E 1YIJE 2I5ZO 3CKGA 2OYBO 1VQNE 3IGEA 2I5VO 1VQ7E 4WCEE 1VQLE 1Q7YG 5B3MO 2OY7A 1QVFE 1RJLC 3CCLE 3CC7E 3CF5E 3CC2E 1VQ9E 3CCJE 1VQPE 2CQLA 1JJ2E 3CMAE 2QA4E 2ZJPE 1S72E 1KC8G 3CCRE 2HKDA 2OL6O 5B2AO 1YI2E 1YJ9E 1N8RG 2PI3O 2G8CO 3CMEE 1KQSE 3G4SE 4IOCE 1YITE 1OSPO 2FKJA 5HL7E 4U67E 4WFNE
chains in the Genus database with same CATH topology
5AN9B 3CCEE 3CXCE 2ZJRE 4IO9E 2QEXE 1VQOE 1M90G 5MLCH 4WFAE 4WF9E 4WFBE 3CC4E 3CCUE 1NJIG 1VQ4E 2OTLE 1M1KG 5DM7E 5GAGG 3I56E 1VQ5E 1VQ6E 3CCME 2ZJQE 2OTJE 1YHQE 3G6EE 1K8AG 1Q81G 3CD6E 3PIPE 3DLLE 1QVGE 3CCQE 5GAEG 1YJWE 3I55E 5JVGE 3PIOE 3CCSE 1KD1G 1VQME 1K9MG 1VQ8E 3CPWE 3OW2E 1VQKE 5JVHE 4IOAE 3CCVE 1YJNE 5DM6E 1W2BE 4UY8G 1RL6A 5H1SI 5GADG 5GAHG 1K73G 1Q86G 1Q82G 3J7ZG 3G71E 1YIJE 1VQNE 1VQ7E 4WCEE 1VQLE 1Q7YG 1QVFE 3CCLE 3CC7E 3CF5E 3CC2E 1VQ9E 3CCJE 1VQPE 2CQLA 1JJ2E 3CMAE 2QA4E 2ZJPE 1S72E 1KC8G 3CCRE 1YI2E 1YJ9E 1N8RG 3CMEE 1KQSE 3G4SE 4IOCE 1YITE 5HL7E 4U67E 4WFNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN9 B;  3CCE E;  3CXC E;  2ZJR E;  4IO9 E;  2QEX E;  1VQO E;  1M90 G;  5MLC H;  4WFA E;  4WF9 E;  4WFB E;  3CC4 E;  3CCU E;  1NJI G;  1VQ4 E;  2OTL E;  1M1K G;  5DM7 E;  5GAG G;  3I56 E;  1VQ5 E;  1VQ6 E;  3CCM E;  2ZJQ E;  2OTJ E;  1YHQ E;  3G6E E;  1K8A G;  1Q81 G;  3CD6 E;  3PIP E;  3DLL E;  1QVG E;  3CCQ E;  5GAE G;  1YJW E;  3I55 E;  5JVG E;  3PIO E;  3CCS E;  1KD1 G;  1VQM E;  1K9M G;  1VQ8 E;  3CPW E;  3OW2 E;  1VQK E;  5JVH E;  4IOA E;  3CCV E;  1YJN E;  5DM6 E;  1W2B E;  4UY8 G;  1RL6 A;  5H1S I;  5GAD G;  5GAH G;  1K73 G;  1Q86 G;  1Q82 G;  3J7Z G;  3G71 E;  1YIJ E;  1VQN E;  1VQ7 E;  4WCE E;  1VQL E;  1Q7Y G;  1QVF E;  3CCL E;  3CC7 E;  3CF5 E;  3CC2 E;  1VQ9 E;  3CCJ E;  1VQP E;  2CQL A;  1JJ2 E;  3CMA E;  2QA4 E;  2ZJP E;  1S72 E;  1KC8 G;  3CCR E;  1YI2 E;  1YJ9 E;  1N8R G;  3CME E;  1KQS E;  3G4S E;  4IOC E;  1YIT E;  5HL7 E;  4U67 E;  4WFN E; 
#chains in the Genus database with same CATH topology
 5AN9 B;  3CCE E;  3IG9 A;  2AF5 A;  3CXC E;  2ZJR E;  4IO9 E;  2QEX E;  5B11 O;  2OY1 O;  1VQO E;  3EC5 A;  1M90 G;  5MLC H;  4WFA E;  4WF9 E;  4WFB E;  3CC4 E;  3CCU E;  1NJI G;  1VQ4 E;  2OTL E;  1M1K G;  5DM7 E;  5GAG G;  3I56 E;  2OY8 A;  1VQ5 E;  1VQ6 E;  2FKG A;  3CCM E;  2ZJQ E;  2OTJ E;  1YHQ E;  3G6E E;  1K8A G;  1Q81 G;  3CD6 E;  3PIP E;  1P4P A;  3CKF A;  3DLL E;  1QVG E;  3CCQ E;  5GAE G;  1FJ1 E;  1YJW E;  3I55 E;  5JVG E;  2OL7 A;  3PIO E;  3CCS E;  1KD1 G;  5B10 O;  1VQM E;  1K9M G;  1VQ8 E;  3CPW E;  3OW2 E;  1VQK E;  5JVH E;  4IOA E;  3CCV E;  1YJN E;  5DM6 E;  2OL8 O;  1W2B E;  4UY8 G;  1RL6 A;  3AUM O;  5H1S I;  2OY5 O;  5GAD G;  5GAH G;  1K73 G;  1Q86 G;  1Q82 G;  3J7Z G;  3G71 E;  1YIJ E;  2I5Z O;  3CKG A;  2OYB O;  1VQN E;  3IGE A;  2I5V O;  1VQ7 E;  4WCE E;  1VQL E;  1Q7Y G;  5B3M O;  2OY7 A;  1QVF E;  1RJL C;  3CCL E;  3CC7 E;  3CF5 E;  3CC2 E;  1VQ9 E;  3CCJ E;  1VQP E;  2CQL A;  1JJ2 E;  3CMA E;  2QA4 E;  2ZJP E;  1S72 E;  1KC8 G;  3CCR E;  2HKD A;  2OL6 O;  5B2A O;  1YI2 E;  1YJ9 E;  1N8R G;  2PI3 O;  2G8C O;  3CME E;  1KQS E;  3G4S E;  4IOC E;  1YIT E;  1OSP O;  2FKJ A;  5HL7 E;  4U67 E;  4WFN E; 
#chains in the Genus database with same CATH homology
 5AN9 B;  3CCE E;  3CXC E;  2ZJR E;  4IO9 E;  2QEX E;  1VQO E;  1M90 G;  5MLC H;  4WFA E;  4WF9 E;  4WFB E;  3CC4 E;  3CCU E;  1NJI G;  1VQ4 E;  2OTL E;  1M1K G;  5DM7 E;  5GAG G;  3I56 E;  1VQ5 E;  1VQ6 E;  3CCM E;  2ZJQ E;  2OTJ E;  1YHQ E;  3G6E E;  1K8A G;  1Q81 G;  3CD6 E;  3PIP E;  3DLL E;  1QVG E;  3CCQ E;  5GAE G;  1YJW E;  3I55 E;  5JVG E;  3PIO E;  3CCS E;  1KD1 G;  1VQM E;  1K9M G;  1VQ8 E;  3CPW E;  3OW2 E;  1VQK E;  5JVH E;  4IOA E;  3CCV E;  1YJN E;  5DM6 E;  1W2B E;  4UY8 G;  1RL6 A;  5H1S I;  5GAD G;  5GAH G;  1K73 G;  1Q86 G;  1Q82 G;  3J7Z G;  3G71 E;  1YIJ E;  1VQN E;  1VQ7 E;  4WCE E;  1VQL E;  1Q7Y G;  1QVF E;  3CCL E;  3CC7 E;  3CF5 E;  3CC2 E;  1VQ9 E;  3CCJ E;  1VQP E;  2CQL A;  1JJ2 E;  3CMA E;  2QA4 E;  2ZJP E;  1S72 E;  1KC8 G;  3CCR E;  1YI2 E;  1YJ9 E;  1N8R G;  3CME E;  1KQS E;  3G4S E;  4IOC E;  1YIT E;  5HL7 E;  4U67 E;  4WFN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...