5HLFA

Structure of hiv-1 reverse transcriptase in complex with a 38-mer hairpin template-primer dna aptamer and an alpha-carboxyphosphonate inhibitor
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Exploring the role of the alpha-carboxyphosphonate moiety in the HIV-RT activity of alpha-carboxy nucleoside phosphonates.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/inhibitor/dna
total genus 143
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hlfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hlfA05
5C24B 4RNFA 2BANB 1ASWA 3PUFA 5C24A 3D28A 2BANA 4ECRA 4CEEA 2R8GA 1SKRA 4I9LA 5EUHA 1ASUA 2VWKA 2HWHA 2HHVA 4IR1A 5J2PB 2R2TA 3AO4A 1KLNA 4Q45A 5J2PA 1BCMA 4BDZA 3MF5A 4IQXA 5KFRA 4KB0A 1TP7A 4TY8B 1NJYA 3ICLA 3HPHA 2OA8A 3SUPA 5FDLB 4TY8A 1RBVA 1R0AB 5FDLA 4ID5B 5DG8A 4ID5A 1BI4B 4CEZA 3AA4A 1BI4A 5T14A 3DOLB 3UQSA 4IKFA 3DOLA 4CEDA 2BRKA 3KJVB 3PV8A 3KJVA 1RDCA 3KMSA 1SH2A 3L8BA 3PY8A 1GOBA 1S0MA 3CVKA 3RR7A 3THVA 5KFFA 2QXFA 2JEFA 2GC8A 3LWLA 3AA3A 3TANA 4ECVA 3EZUA 2Z1GA 1WNSA 1S10A 3O3GA 2UUTA 4N5SA 4KPYA 3P1GA 5KFVA 1WSFA 3D0PA 4CJSA 2XO7A 4DQIA 3RR8A 2HMIA 2FVQA 4EO8A 2UVVA 5KG5A 3L2VA 1YTUA 1S6PA 1X9WA 2B4JA 4AHTA 4IG0B 4F4ZA 3HJFA 3CQ8A 4IG0A 4OVLA 3LALA 4DFMA 1HPZB 2KTQA 4FM1A 4Z4HA 2F96A 1HPZA 3TWHA 1D1UA 4J9QA 3EPIA 1RBTA 2WB4A 3AV9A 3GILA 2XY7A 1XC9A 4KAIA 3DYAB 3G6VA 4CF9A 4NZ0A 3DYAA 2BRLA 4IFVB 2G8IA 4CF2A 5KG7A 2X6NA 4IFVA 4LSLB 4ED8A 3V9WA 4LSLA 1RDRA 4KTQA 2Q3SA 4FJNA 2OPRB 3KHHA 2IAJA 3I8DA 1KHVA 2OPRA 1TK5A 2KW4A 1RYRA 4OL8A 4O55A 4WYLA 2JGUA 3N6LA 2IJNA 1L3UA 3MECA 1BQNB 3H59A 4Z4GA 4R0EA 1BQNA 1LAWA 4XIUA 2R8HA 4FCYA 3G86A 4DTNA 4WZMA 4CHOA 4ED0A 3H08A 1IG9A 1W0HA 3AVCA 2O4GA 4IOBA 4AHRA 4O3PA 1NK9A 4DTOA 3WNHA 4CEBA 4C8OA 3LP0B 3OSNA 3KHLA 1C6VA 3LP0A 2DPJA 1JXBA 2IM3A 4FK0A 4QWCA 4O4RA 2HB5A 1IH7A 1VSEA 4AH9A 4CHPA 1W9HA 4OLBA 3FQKA 4GVMA 4QWEA 1RTIB 1VSKA 4CEQA 4DTSA 4K4SA 3PW7A 1RTIA 1IKXB 1LW2B 5J1EB 3SI6A 4WZQA 2HVIA 1J53A 1L3SA 1IKXA 1LW2A 5J1EA 4EBEA 5KGWA 4FZYA 3WNEA 5KFEA 4KTZA 5KFKA 4CHQA 4QWAA 4I7FB 3M9MB 4ZTFA 4MK7A 4N76A 1LWEB 4I7FA 1QAJA 2I5JB 2IM0A 4C8LA 1NHVA 2I5JA 3V1RA 2FVCA 4OKEA 2PYLA 4LY7A 4DF4A 3V1QA 1VK0A 4OKJA 5HRPA 4QOZB 4DTJA 2ATLA 1F21A 4PWDB 3OL8A 4PWDA 2HNYB 2XWYA 3S3OA 2HHXA 2HNYA 4URQU 2IS3A 4J2EA 1TAUA 3DM2B 2WOMB 4DSKA 3DM2A 2WOMA 3ALYA 3BGRB 4OPKA 3G0ZA 2F8TA 2HHSA 1BCOA 3BGRA 4U6PA 4FJMA 4FJLA 4XPEA 5KT5A 4CFDA 5KT7A 4KSEB 4F2RA 3ZT3A 4ZVEA 3V6JA 4CERA 1NK7A 1S1XB 3DRPB 3CFRA 4G3IA 4B8CA 4KV8B 1S1XA 3DRPA 4MQ3A 2J6UA 4IRKA 3SJJA 4DS4A 4Q8EA 1KFSA 3L2UA 4N41A 2FVSA 3F73A 1ASVA 3V6DB 4J2BA 4RNOA 3D45A 2FJVA 3V6DA 1OS5A 4FXDA 1S1UB 1IKYB 3SUOA 3U3YA 4M3XA 4O3OA 1S1UA 1IKYA 1RT2B 3OYCA 4J9PA 1RT2A 3NAEA 3V9UA 3AVLA 3AVIA 2YKMB 1J5OB 2YKMA 3BJYA 3LZJA 4CCHA 4I9QA 3RMBA 1SV5B 4NLQA 1SV5A 2C28A 1RDDA 3AVHA 3I5CA 3UDLA 4O3RA 2IMWP 3NH2A 1CXUA 4FYDA 3C6UB 2RPIA 1T94A 3C6UA 4L8RB 1UAXA 2HHTA 1HRHA 4DSIA 3M9NB 4BE1A 3H40A 4YR3A 3ZSRA 2JC0A 3VQSA 4CIEA 2HW3A 3VQ6A 5KFAA 1S1VB 3ZSYA 3QO9B 2ITGA 1S1VA 3QO9A 4OKKA 4ECWA 3UR0A 1EETB 4Z4EA 4ECZA 4RU9A 4R5PB 1EETA 1IKWB 4R5PA 1IKWA 4ECYA 3VQQA 1VSHA 4EP5A 4J9NA 2G8KA 1JIHA 3OVNA 3AO2A 4JRQA 5KFOA 4NCBA 1JLFB 5KG6A 1NK5A 3KTQA 4CJTA 3OYLA 3AVMA 1JLFA 3N6MA 4ED1A 3IRXB 3QZ8A 3B6OA 4RUCA 3KIOA 3FSIA 3IRXA 4KB7A 4K4ZA 1RYSA 1XHZA 2WK4A 3HL8A 4KAZA 4YQWA 4CF1A 1TK8A 2W8KA 4O3NA 2HAIA 2RKIB 1SUQB 1TVRB 3NGYA 5T7BA 2RKIA 1SUQA 1TVRA 4LSNB 1WSJA 3KD5E 4LSNA 2QKBA 3MEEB 1IKVB 4Q8FA 1XR5A 4QWBA 5KFZA 4RNHA 3OY9A 1IKVA 4JUZA 2VG6B 1LW0B 1U47A 4GC7A 1LW0A 3K58A 1ZBFA 2R2UA 3FQLA 4M94A 3KLEB 3VQBA 1JLCA 3KLEA 4AHVA 4NLDA 4N47A 4M95A 1TV6A 1BHLA 3PW4A 1D9DA 3AVBA 4B9TA 3QEIA 4FZZA 3CDUA 4M3ZA 4JV0A 3EZ5A 4CEOA 4CEFA 2AGPA 3A2FA 4FJXA 1S9GB 4FJ8A 1RT4B 4NLWA 5EWEA 1S9GA 4H54A 3OYBA 3RBDA 1RT4A 1NKBA 4KTWA 3AO3A 4QW8A 4CJPA 3V9XA 5KFCA 3RMCA 1IO2A 4YP3A 2AU0A 4FJ7A 2IC3B 4B9LA 2HHWA 2FJWA 2IC3A 3SUNA 2P5OA 1C2PA 5FRNA 4CECA 3CM5A 3QETA 3I0RB 1RT3B 2O4IA 3I0SB 1XR7A 4ZVGA 4ZP7A 1RT3A 2ASLA 4KHRA 2W9BB 2OH2A 3QNNA 3I0SA 4DF8A 3ZSZA 2W9BA 4K4VA 1HMVB 1CZBA 2RDIA 2NUBA 4HUGA 1RT6B 1HMVA 1RTJB 3G6YA 4E7JA 1RT6A 2J6TA 1RTJA 3CJ4A 3OYGA 4RUAA 4BACA 2UVRA 2GIRA 4K4YA 1A5VA 4ELVA 3VQAA 4YR0A 2AGOA 3OL7A 1T05B 3K57A 4ID1A 3G6XA 4DMNA 1HYZA 5KT2A 5L1KA 3GYNA 3Q8QB 4FJKA 4KHYA 3EYZA 4FLZA 4H4OB 4NYNA 4H4OA 3H4BA 4TN2A 1KRPA 5D3GB 5KT6A 4NCAA 2ASDA 1C0MA 4HUFA 4TY9A 4CGGA 5D3GA 1S1TB 5KFQA 1K1QA 5KFTA 1S1TA 3MEDB 3MEDA 5F8HA 1CZ9A 2FC0A 3LANA 3LAKA 1SH0A 4CGIA 2FBVA 4QPXA 4NLUA 1ZTTA 1K6YA 3HPGA 3VQ9A 3KNAA 3TAEA 3QEPA 4FVMA 1QAIA 5HLFB 2QV6A 3GV5B 4J2DA 3CDEA 5HLFA 3QNOA 4J9LA 4JS4A 3GIMA 1D5AA 1X1PA 5HRSA 3QERA 3HVRA 4IH6A 2XY6A 4KHQA 4M42A 2IOCA 3L2QA 4CHZA 2IDOA 4DTRA 2GIQA 3DRRA 4DWIA 4RW4B 1SH3A 1S0OA 3SPZA 4RW4A 1WN7A 5HP1A 4LQ9A 2A1SA 2BE2B 3K5MA 2V4RA 2BE2A 2W7OA 1UA0A 4LH5A 4DTXA 2B43A 2OPQB 5KT3A 5DG7A 2R8JA 1HYSB 3WNGA 2OPQA 1S9EB 4CHYA 4NCGB 1HYSA 2GUIA 3V9ZA 1S9EA 1Z25A 4NCGA 3QZ7A 5EWFA 4GW6A 4TSXA 4F4KA 4DG1B 3CFOA 1L3VA 4DG1A 4CJEA 3SUQA 2YKNB 2YHAA 3V4IB 2YKNA 3ZSWA 2AJQA 4IFYB 3V4IA 4E7HA 2HMIB 4IFYA 3OLBA 4B9UA 4FLXA 3LP1B 1S6PB 2EX3A 2IA6A 4NLTA 3HVWA 4EZ6A 2YNIB 4B3OB 3LP1A 4ED6A 1KVCA 4O4GB 3BR9A 2YNIA 4B3OA 1I3AA 4CE9A 4O4GA 2GV9A 2RF2A 2HHQA 4F4XA 3HYFA 1HNIB 4DFPA 4EYHB 3TQ1A 1HNIA 4JV1A 4F50A 3OYJA 2DY4A 2XHBA 4FS2A 3GIJA 3HO1A 4CIFA 4K4TA 4DSFA 4RW9B 4ZPBA 4H4MA 4FJHA 4RW9A 4Z4IA 4ZP8A 1BL3A 3CJ2A 4CJ3A 5KFXA 2G8UA 2IGIA 3H2LA 1T8EA 3JYTA 3M8RA 2IAJB 2PZSA 1C1CB 4MIBA 3L2WA 1C1CA 4I2PB 4CK3A 2UUWA 4OGCA 4I2PA 3NH1A 5KFUA 3RAXA 2ZQBA 3MECB 2X78A 1ZBHA 1N6QB 1FKPB 3DLBA 1N6QA 3BREA 3K2PA 5JUMA 1FKPA 3DRSB 2IJFA 4KO0B 3DRSA 3SQ0A 4U7CA 4KB1A 4KO0A 4GC6A 4KHWA 4KE5A 3OYHA 1QSSA 2OPPB 5HBMB 4WYWA 3HT3A 2Z1JA 2OPPA 3EY1A 1NK8A 5HBMA 5CYMB 3PO5A 3O3HA 2V4QA 5CYMA 3VA0A 3ZT0A 2HNZB 4Y3CA 4KHNA 2JEJA 2HNZA 1JL1A 1WSIA 3ZT2A 4OPJA 3H5YA 2WTFA 1U49A 3B6PA 4NYFA 2D3ZA 5DLGA 1RT1B 1RT1A 4EYIB 3KHRA 4DSEA 4W5TA 1U04A 5KFNA 2B5JB 2HVHA 4WXWA 2KZZA 3IG1B 2B5JA 4N56A 1YTAA 4BWMA 2HNDB 3IG1A 4CF8A 2HNDA 3LAMA 3D5MA 4O0IA 2C2RA 4W5OA 2XY8A 2AWZA 4M45A 3S3NA 1VSJA 1GOCA 5EWGA 4YMEA 5KFMA 3M8QA 2ASJA 4TYAA 1QS4A 1A5XA 3KMQA 1TK0A 3NGDA 2PY5A 3H5UA 5KI6A 1TGOA 2O5DA 4PUOB 3NGIA 4PUOA 2KZMA 4NLGA 5F9NA 4CGDA 2RDJA 1NKEA 3QEWA 3O4NA 4LH4A 4E89A 4E1NA 4ZPAA 4B9SA 4AHCA 4HHTA 4CF0A 2R2RA 2A1RA 2C2EA 1Q9XA 2ZE2B 3NL0A 1HQEB 2ZE2A 1T3NA 1J9AA 1HQEA 3PW0A 3RB3A 4RW7B 1WSEA 4FW2A 4RW7A 3AO5A 3M9OB 4PA1A 1GX6A 5KFHA 3OLAA 4J9OA 3T5LA 1RCHA 1YVFA 5DQHA 5KFYA 2FVPA 3PW2A 2JEIA 3AVGA 3KK1B 1VSDA 3KK1A 2AGQA 3TAFA 1C1AA 4C8MA 3VQDA 4URSA 1S4FA 1QQCA 4FLVA 3S3MA 3NFAA 3K59A 3VN5A 1LV5A 4DSJA 4QAGA 1RA6A 3RRHA 5KRTA 2PYJA 3E51A 2IM2A 3Q8RB 5E41A 1C0TB 2VG7B 4CJFA 5F8JA 1C0TA 2VG7A 5KG0A 4O44B 3QINA 4ZP9A 4O44A 3KKRA 4RNNA 2E9TA 5KFIA 3ISNC 4E1MA 1KVAA 3OSPA 2VA2A 1WAFA 4ZMMA 1NK0A 4ELUA 1EP4B 2WCXA 4CJWA 1EP4A 3TARA 1XR6A 3VQ5A 1DTTA 4IR9A 2EHGA 1JLEB 1X9SA 4M3TA 3OHAA 4FJIA 4QW9A 1JLEA 4HUEA 1RBSA 1HARA 1RILA 3O3FA 3HK2A 4NLVA 4FLYA 2G8HA 4O5BA 5J2NB 3FDSA 3BSNA 5J2NA 3NF9A 4NLXA 2YNGA 3OYIA 1FXXA 1ZBUA 1T7PA 4HCCA 3Q8SB 1HYVA 4J9KA 5KG3A 5FRMA 4DL3A 3LPUA 3KLFA 5C25B 5KG4A 2FLPA 1L3TA 1RTDB 3T5KA 2BGGA 5C25A 5DGBA 3LP3A 1RTDA 3G10A 3AA5X 4Y1DA 3F9KA 4HCBA 3PO4A 3OYAA 4DFJA 4CJUA 4HVJA 2XCAA 2DPIA 4ECQA 4LQ3A 3AA2A 4IKAA 1RBUA 3SV3A 2JLEA 2R7YA 3SV4A 4FM0A 1HJRA 4OGEA 4C8NA 1LWCB 1YVUA 1C0UB 1BIZA 1Z26A 1TL3B 4DEZA 3RB4A 1LWCA 3SZ2A 1C0UA 3PW5A 1TL3A 2AQ4A 3RB0A 3TAQA 1TKTB 4KFBB 1RAJA 4PY5A 1TKTA 4KFBA 4KHMA 1JLCB 5F8IA 2GBZA 5DQIA 3I5BA 4I2QB 1G15A 3MR2A 4WE1B 4JLHA 1VSLA 1TV6B 4I2QA 4WE1A 3OYEA 1B9FA 5KG2A 1RTHB 1QUVA 3I5AA 1RDAA 3NGZA 1RTHA 3NAIA 1KTQA 3PX4A 4J9MA 2WONA 1REVB 4F3OA 1UA1A 1REVA 4CJQA 4G1QB 1T03B 3RAQA 3SFUA 3RRGA 3BSCA 2QKKA 4G1QA 1T03A 4Q0BA 5EU7A 4CJRA 4LD0A 4QWDA 2WHOA 5F8MA 4W5QA 4YR2A 1YT3A 2OZSA 5KFLA 3NF8A 4FBUA 3IGNA 1Q9YA 4CJVA 1WLJA 3RBEA 3V6KA 3LZIA 5CY4A 1D0EA 1JXEA 5CZ1A 4CIGA 4CGFA 1I6JA 2FBTA 1A5WA 4KBIA 3MXJA 3DLGA 1XWLA 4K50A 3GIIA 4Y34A 3SQ4A 5KGXA 4DL5A 1VSMA 1S6QB 2KFZA 1RDBA 3PX0A 4CHNA 5DQGA 4Q44A 1S6QA 2G8FA 5KRSA 3CJ5A 5DMRA 4FK2A 1C1BB 1NJZA 1GX5A 3C94A 4NRTA 1C1BA 4CGHA 3NE6A 1N5YA 4B08A 4GMJB 1ZYQA 4DLGA 2CJQA 4K4WA 3L3VA 4YFUA 2ETJA 2YHBA 5HROB 1U45A 3L2RA 3ZSXA 5HROA 2OPSB 4ZHRB 2OPSA 4EEYA 4ZHRA 4FS1A 3OL9A 3KKSA 4BE2A 3KLVA 3HVTB 2D0BA 4FBTA 3HVTA 5JXSA 3NDKA 3ZT4A 4FLTA 3GV7B 4F3TA 1JLBB 5KFWA 2BQ3A 3GV8B 1TKDA 1N4LA 1JLBA 1KVBA 4JS5A 3ASMA 4RW8B 4CJLA 1RT5B 5CYQA 2BDPA 5I42A 1Y97A 4RW8A 4K4UA 1RT5A 3CJ3A 3AVNA 3KD1E 3HSTB 4Y1CA 3OS2A 4DU1A 2FLLA 2LSNA 4DSLA 4F8RA 4FJGA 1S5JA 3PJXA 3T19A 2E6MA 3PX6A 3BSOA 4NLOA 5DK5A 3PR4A 4ED3A 3RWUA 4ZVHA 3ZSQA 2XCPA 1TKZB 1W25A 3M8PB 3IGVA 3NHGA 4KHUA 1TKZA 4MKBA 3M8PA 4DL4A 4BDYA 2XY5A 4EBCA 4Q43A 2E9ZA 3CG7A 4ZPDA 1D9FA 4DU4A 3DOKB 4MH8A 1UWBB 3DOKA 1QTMA 4DL7A 4FLWA 4F2SA 1UWBA 3TVKA 3C6TB 3E01B 1J54A 3DRRB 1UOCA 3C6TA 3E01A 1HQUB 3VQ4A 3RMAA 1RNHA 3SFGA 1HQUA 5KTQA 3DDKA 5L1JA 3MR6A 5HP1B 3LP2B 4DTUA 3JSMB 3EPGA 4M3WA 4IBNA 3LP2A 3JSMA 2FBYA 1R0AA 4K4XA 3QIPB 5F8NA 3ULDA 3FRZA 2D41A 4UQGA 3QIPA 3MAQA 3PZPA 4ZTJA 4FLUA 3NF7A 3OJUA 5KG1A 4EBDA 1S48A 1B9DA 1SL1A 1RA7A 3WNFA 3RB6A 4TYBA 4NLRA 1S9FA 1TL1B 3BQ2A 4OJRA 4CK2A 1TL1A 2D7SA 2G8VA 3SYZA 3CWJA 3OS0A 3QGIA 1I39A 3QGHA 1K1SA 1WAJA 5KFJA 1SL0A 4HYKA 1VRTB 5J2QB 4M41A 1QHTA 1VRTA 1U48A 5J2QA 3HPOA 3H98A 2RF2B 4J2AA 4HKQA 3OS1A 4CJ5A 1RBRA 2E9RX 2OYQA 3LDSA 3TR8A 4JV2A 1Z4UA 4X2BA 1XI1A 1VRUB 2XI3A 4H4MB 1VRUA 4EP4A 4CFAA 1S0NA 3QIDA 2HWIA 2F8EX 2DFEA 4ED7A 4XO0A 1JKHB 4MIAA 2UVWA 4KKOB 3OYDA 3PJWA 1QE1B 1JKHA 3KK3B 4KKOA 4O0JA 4M3RA 3JYTB 1QE1A 3U6FA 3KK3A 4KREA 1EX4A 1BIUA 3TI0A 3T1AA 2W8LA 3OYFA 5SZTA 2CKWA 2J6SA 3DMJB 3QYYA 1U4BA 3DMJA 4HTUA 1BGXT 4B8AB 1B92A 2EC0A 5KFGA 3HXMA 3BQ1A 3K5LA 3T5HA 1EKEA 4TQSA 4Z4CA 3QLHB 4Y2CA 3QLHA 2WRMA 3UIQA 4WFXA 3LPTA 1KHWA 1NKCA 3AVFA 4DU3A 4E19A 4IRDA 4DL6A 3MXIA 3K5NA 2FJXA 3VQ7A 3SCXA 1X9MA 1JLAB 4K8XA 5L1LA 1JLAA 3CJ0A 1NOZA 3CFPA 4E7LA 2QK9A 3RTVA 4C8KA 4J9RA 4ZP6A 2BQRA 4EO6A 2ATQA 4BDPA 2ILYA 3PHEA 3IS9B 1ZBIA 4XPCA 3IS9A 2C22A 5C5JA 5KT4A 3SQ1A 2R2SA 4FZXC 1N48A 3KHGA 3M8QB 4DQQA 1EXQA 3QIOA 4PQUB 3OYKA 4B9NA 3IAYA 1IM4A 2VA3A 4PQUA 3DLKB 3PVXA 3OL6A 1TAQA 3DLKA 2ILZA 4F4WA 1DLOB 2ZKUA 2W7PA 1DLOA 3MFIA 2D3UA 3DLEB 1LWEA 2KFNA 3MFHA 2B6AB 3DLEA 3SQ2A 2B6AA 3AO1A 2Y1JA 1RT7B 2W9CB 1SKSA 1RT7A 2W9CA 1NNDA 4TXSA 5JS2A 4FM2A 2XC9A 4ZVFA 2D0CA 1ITGA 4AILC 2XGPA 4IH5A 4E7KA 1MU2B 4E3SA 3MTKA 1MU2A 4DQRA 1XHXA 2QE5A 1KLMB 4WXOA 4O3QA 4JRPA 4EZ9A 1KLMA 1S97A 3K5OA 2DTUA 4Y2AA 3LWMA 2HHUA 1NOYA 5KFDA 3P5JA 3BSAA 1QSLA 2UVUA 4WFYA 3ZCMA 3BQ0A 5I3UB 5KFSA 1TKXB 5I3UA 3HP6A 3H5SA 4ZPCA 3CM6A 1TKXA 4MK9A 3CDWA 2C2DA 5HRRA 4DQSA 5SWMA 4FK4A 3T3FA 4KV8A 2BQUA 3TAMB 4WFZA 2YV0X 3QEVA 3TAMA 5F9LA 3P83D 1NK4A 3NF6A 2FBXA 3NMAA 3VQEA 4NLPA 3VA3A 2D5RA 3MR3A 4NYZA 1O1WA 4MFBB 3AVJA 4MFBA 1SKWA 4DTMA 4CFBA 4DQPA 1J5OA 4DL2A 2W9AA 1WSHA 1DTTB 3NBPB 3QGGA 1NJWA 3ZSVA 1WNEA 3NKYA 3NBPA 4E7IA 1MMLA 4DFKA 1S49A 1NJXA 2AX0A 3TAGA 2D0AA 2IM1A 3GIKA 3NH0A 4QCLA 3HP9A 2KQ2A 2X74A 4B9VA 3O4QA 4OLAA 2V9WA 2YNGB 3KLGB 4IH7A 4ICLB 2ZD1B 4FJ5A 3KLGA 2JEGA 2XRIA 4ICLA 2ZD1A 1ZBLA 3KLFB 4CEAA 4Z4FA 5L9XA 2E6LA 3H5XA 3FFIB 4BWJA 4ECSA 2P5GA 4TQRA 1HNVB 4IG3B 3FFIA 3SI8A 1HNVA 4IG3A 4KRFA 3CIZA 3AVKA 2P51A 3PR5B 3H4DA 3V1OA 1JLGB 1ZETA 1LWFB 1JLGA 4ECUA 1LWFA 3U3GA 5KFBA 1JX4A 5DLFA 4F4YA 4RNMA 4Z0UA 3VQ8A 1NK6A 4BE0A 4O3SA 2R8IA 4NLYA 1D8YA 4M3UA 4CJ4A 4ED2A 2E4LA 5C42B 5C42A 4Q5VA 1U09A 3DLRA 3HVAA 4RG8A 3L3UA 3MEEA 4B9MA 2WONB 3RMDA 4E0DA 4AHUA 2Z1IA 3OJSA 1TQLA 3GQCA 2OZMA 2VG6A 4RZRA 1BISA 4CGJA 2JC1A 1VSIA 5J2MB 4Q0BB 2V0NA 4M3YA 4IDKB 5J2MA 4CJKA 4MK8A 3ITHB 4IDKA 5F8GA 1N56A 3KLIB 3ITHA 5FROA 4KI6A 3KLIA 2I1RA 3TABA 2F8SA 3M8SA 3ZT1A 5F8LA 2X6SA 3V81B 1JLQB 1S1WB 4J9SA 3V81A 1JLQA 1S1WA 1CXQA 3BDPA 3VQCA 2P1JA 3HHKA 4TLRA 4FJ9A 1KCFA 3DLGB 3VQPA 3UPFA 3MXMA 3ISND 3OHBA 1GOAA 5DGAA 3IN5A 4W5RA 4NRUA 3T5JA 3S9HA 3HKWA 4H8KA 3NCIA 3MR5A 4DLEA 5DG9A 1N5YB 3KK2B 3CO9A 1KFDA 1BQMB 3KK2A 4DS5A 3CYMA 4ELTA 1BQMA 2XGQA 5HRNA 2W42A 1KSPA 3I0RA 3QESA 4KI4A 4AHSA 4NLSA 3KOAA 4IRCA 4KHSA 4CFCA 1FK9B 1FK9A 4ECXA 4W5NA 4ECTA 2VG5B 5JS1A 5K14B 5L1IA 2VG5A 5K14A 2RN2A 2Y1IA 1QSYA 4R8UB 1T05A 3TAPA 4R8UA 3N6NA 4DTPA 4URGA 5EDWA 2ALZA 2AX1A 3V9SA 4RW6B 3SPYA 1L5UA 3DI6B 2DFHA 4RW6A 4CESA 3DI6A 1SL2A 4K8ZA 2G8WA 1CSJA 1CLQA 2XI2A 5CYQB 5I42B 1JL2A 3C95A 1FKOB 2IBKA 1DTQB 3DLHA 4FJJA 1FKOA 2YNFB 5KFPA 1DTQA 1WSGA 3QEXA 3OYMA 4MKAA 2YNFA 3NAHA 4YNQA 4FW1A 2BR0A 1VSFA 3Q8PB 2DFFA 3AVAA 3HM9A 1NHUA 2Z1HA 2FVRA 2R8KA 2YNHB 3V6HA 3SNNA 3ZSOA 1JXLA 2YNHA 1LAVA 3OYNA 3MEGB 2VWJA 3KLHB 2FLNA 3MEGA 1Q8IA 3KLHA 1ZTWA 4CK1A 5CZ2A
chains in the Genus database with same CATH superfamily
5C24B 2QWRA 4NX9A 4LF6F 3W7BA 4GVEA 3LDOA 2IPOB 2YX4A 3CCLS 2BANA 4WP9A 5ADXA 2APOA 4CEEA 2JL9A 2KM8C 1QJHA 3IO1A 3VF0B 2VONA 2FYXA 1BDGA 5J2PB 2YPYA 1KLNA 3PCOB 4Q45A 3CJ8A 2FHOB 5KFRA 4KB0A 2DR5A 1TP7A 2N7CA 3ICLA 4HDHA 5KOXA 1R0AB 4WU2A 1IN0A 1R8HA 4QR1A 3NG8A 3M6UA 5DG8A 4CEZA 1OY6A 3AA4A 2GW8A 3DOLB 2BA9A 3SCJE 1RWXB 4NXNK 1T9TA 5E5NA 2DRBA 4BGBA 4CEDA 1QUPA 2HS3A 5HVFA 3R1XA 3KJVB 1RAOA 1RDCA 3L8BA 5GADP 5E0OA 1P1LA 4FWSA 3PY8A 2FZCB 2CQIA 5A6WA 4BY9C 2N3OA 2QXFA 3PRDA 1WD6A 3AA3A 1KC8O 4M5JA 4IOAL 2NXNA 1S10A 2HRTA 1F9HA 4B02A 2UUTA 4D3GA 2P9KB 4WP8A 1VQMN 5ETRA 2A41A 4MYTA 4UOFA 4P6QA 2WVCA 2XZDB 1QLNA 2FVQA 4LFCF 5KG5A 4RTFD 3L2VA 3CD0A 2AEFA 1GMVA 4CD1A 1DZ5A 5AQOA 2RQCA 1AFIA 3UWTA 3EX7B 4DFMA 3AQPA 1HPZB 5ETLA 2KTQA 4MJKA 4FM1A 2F96A 4WFNL 2V5HG 3BBFA 2B4UA 3EPIA 1RBTA 3THXA 1WF0A 2WB4A 5AQFA 3AV9A 3FKBA 1X4HA 1H2VZ 4DV0J 3MAAA 3DYAB 3BF3A 4FOIA 5MLCV 1Q81T 3I33A 4IFVA 3VEXA 4OJ3A 4LSLA 2OLWA 2B9WA 2J0XA 2FJBB 4FJNA 2J7KA 1KHVA 1SJFA 4I6AA 1TK5A 5HMYA 5M1FA 4OL8A 1B7YB 1Q79A 3MECA 1UW4A 1B0TA 1LOUA 1R8AA 4R0EA 3VOVA 1BQNA 4XIUA 2CJXB 4DR5F 2VV5A 4K5RA 4DV5K 4A46A 1Q7YO 1IG9A 3KUHA 4AQYK 1FDBA 3AVCA 2O4GA 4IOBA 2L3MA 4DR4J 4AHRA 1REGX 3CETA 1EQ0A 5J1NA 1HQ2A 4CEBA 5IC6B 3LP0B 4J9UE 2DPJA 1JXBA 2IM3A 2H1YA 4F3QA 5KOWA 2B4PA 2KG0A 4O4RA 3O6QA 1VSEA 4OLBA 1W9HA 9ATCB 3PG9A 5CE3A 4DPUA 4ZK7M 1RTIB 2BJ7A 3TJ8A 1EHWA 5J1EB 3SI6A 5B7WA 4WZQA 4JBCA 4FWNA 1L3SA 1IKXA 4FZYA 4NXMF 3ZYYX 5KFEA 4KTZA 4CHQA 1Y0HA 4BC5A 4QWAA 4I7FB 2NRRA 4N76A 2HGMA 1LWEB 2WVFA 2BW7A 4OZ5A 2U1AA 2Y0SD 1GK8A 4EGLA 2PYLA 3TP2A 2ITMA 2CPHA 2ASYA 1X5TA 4UOCA 2HFOA 3PTWA 5ETMA 1VAZA 4BCAA 2ZZNA 4PPZA 2HNYA 4DV2F 4USIA 4YY3F 3DM2B 4DSKA 4ZLLA 2WOMA 2MKSA 3G0ZA 2F8TA 3MUVP 2HHSA 3O9TA 1RE1B 4ZN3A 4KSEB 1ACMB 2DPNA 5LJ3Y 5BR8K 3CFRA 4G3IA 4WF9L 3D6RA 4Q8EA 2E20A 4X62K 2ABYA 2C3MA 1ASVA 4DUYJ 4JV5J 4RNOA 2F3JA 1SS6A 1S1UB 5IWAK 2MTLA 4M3XA 4KJIA 4JK9A 3AH6A 3OYCA 4QBUA 4JD2B 2IRUA 4M5MA 2V51B 3AVIA 3GFYA 1J5OB 3ET6A 3RU0A 2MZRA 4NA1A 3LZJA 2O8EB 1R3NA 3RMBA 1SV5B 2FY8A 3DWLA 2JZ5A 1X60A 3ELHA 4HR2A 1RAIB 3O8WA 3UDLA 4L75A 2IMWP 4LSZB 4LF8K 2VOOA 2VKRA 1CXUA 5ETOA 1U24A 1FF2A 2EBGA 4DDFA 4C9DA 1T94A 4HACA 4CLYA 3I32A 4RL1A 2FDNA 2XYPB 4DSIA 3M9NB 2XEXA 2ACYA 2KB2A 1LFWA 4CIEA 2J0SD 3VQ6A 5KFAA 4K2JA 3QO9B 1BUPA 2PT0A 5B08A 1WOQA 1ZA1B 3HSGA 4O8KA 1FWKA 3VMFB 4R5PB 1EETA 3CT9A 1IKWB 3OUYB 1XQIA 3WC0A 2OEJA 3AJ2A 5LJVA 1D4XA 3OVNA 3AO2A 1FO1A 4QJVA 1SB6A 5KFOA 2IVOA 5KG6A 3UDCA 1JLFA 2E1YA 3IBCB 2I7NA 3R3LA 3FSIA 3F9MA 4LVNP 3HX9A 1UZHA 4KAZA 4YQWA 4OZ3A 2YX1A 2VPZB 2ZUAA 1SUQB 1TVRB 3O9RA 4KIAA 3JAMY 5T7BA 1YJVA 2RKIA 3JQJA 1PC4A 2VQEK 5K9FA 4NI2A 3QMQA 3T6JA 4JKAA 2CPJA 3P45B 3MEEB 4ANDA 4WTOB 4I6YA 2C2NA 4GC7A 4FYWB 3K58A 3SAFA 1Y5IB 1V9OA 2Q43A 4A4JA 5BYQA 2I9SA 1JLCA 1T11A 1WF2A 8RUCA 4JYAJ 4NLDA 4N47A 1TV6A 3PW4A 1I94J 1VQ6S 1VQKN 1ICEB 5CH7B 2ZBIA 3LM9A 4ZS6A 2CIMA 2DYAA 2P9CA 4JV0A 1YXQA 3NCQA 2GS8A 3EZ5A 2RQ4A 4CEOA 3SBTA 3QT7A 4PL7A 1E6YB 4FJXA 1RB0A 2VWBA 3E9PA 1RT4B 1S9GA 3OYBA 3RBDA 3FC9A 1NKBA 2NRWA 5IFMA 4QW8A 3V9XA 2QA4S 3L4BC 5KFCA 3RMCA 2EFQA 4YP3A 2IC3B 3Q86A 3R6LB 4B9LA 3LDNA 3JS6A 1KR4A 3ZTOA 1AW0A 4JI4J 1RABB 3UE2A 1J5EF 4PRFA 3GFXA 3CM5A 3GE9A 4DV6F 3BO4A 4ZVGA 2OI2A 2KXFA 4IEIA 3QNNA 1D09B 2K2PA 1HMVA 3UNGC 3NXZA 2J6TA 4BG8A 3WX8A 2IYIA 2EI5A 1MN9A 3A3NB 1DHMA 4OZJA 3OL7A 5HL7L 5F0WA 3K57A 3U4LA 4OX7A 2WVEA 2IYGA 2JWLA 1UWAA 2YQ3A 3T1YK 3V2UC 1PBAA 3AXKA 2YX6A 1PSDA 1NGFA 1WKKA 3SJHA 4FLZA 2K7JA 1L3KA 4CRJA 2F7TA 4PAAA 4RWXA 3CULA 3VF2A 4A8QA 2AP1A 3H20A 3S1TA 2KKZA 3H4BA 2GVZA 1WG1A 5D3GB 3T6BA 2P9UB 3I9V9 1C0MA 4H03B 3N28A 4BRHA 3DHXA 2X1BA 1CQMA 4DU7A 5THWA 5DS7A 4H5TA 2XMTA 1U02A 1YITS 1FT8A 5M2UA 2FC0A 5AQJA 2FC8A 2UUAJ 4QPXA 3EUNA 2VD3A 2ZJRL 4HHHA 4KHPK 4X66K 1IXKA 3C66A 2CNLB 2ZVSA 3TSPA 2DGUA 3I31A 4FVMA 4J2DA 3QNOA 4J9LA 1N5TA 2AP6A 4ENOA 4RLEA 4J37A 3M2VA 4YUDA 1S7IA 1HNZK 5DZ7A 1IJEB 4CHZA 2IDOA 3QFWA 4HWIA 1SH3A 1S0OA 2H3GX 2DR8A 5HP1A 2V7ZA 2RS2A 1KONA 1NZ8A 4DV1K 2BE2B 4QIVA 3KFWX 1SQGA 2W7OA 3QT5A 1YG0A 5KT3A 2R8JA 1A7GE 1HR0J 3CJRA 1B64A 2OPQA 1RCXB 4CHYA 4NCGB 1HYSA 2YHWA 1S9EA 1Z25A 4IJAA 4LF5K 3QZ7A 5ETVA 4GW6A 4TSXA 3S41A 4F4KA 2HZVA 3CFOA 4CJEA 3GL1A 2DR7A 3ZSWA 2YKNA 1HBOB 3ZX2A 4FF2A 2DNMA 4FLXA 2FTRA 2IA6A 2YNIB 2EBEA 3PFEA 1TR0A 2GX9A 4O4GA 3BH6B 2HHQA 4CYUA 4F4XA 3B8AX 2AW0A 4GVLA 4RR5A 3TQ1A 4JV1A 2BUNA 4F50A 1TMMA 2DY4A 3IFRA 2B9XA 3GIJA 3HO1A 3O3LA 3HF5A 4K4TA 4YB6A 4C23A 2FIUA 3CCRS 1OH8A 2W2OP 4BVOA 4MMOA 2PSZA 3CJ2A 4CJ3A 5KFXA 2G8UA 3MPDA 3B6BA 1D3WA 4M5IA 1T8EA 3SMSA 1FJGK 2O8FA 1XMOK 3MX2A 1C1CA 2AKWB 5DDOC 4OGCA 4MAKA 4I2PA 3OV7A 5U47A 4OX6A 1FKPB 1HHSA 2EKNA 3BREA 5JUMA 4LR7A 3DRSB 4NEYA 1HJOA 3D1QA 4U7CA 2LYVA 1WACA 2OPPB 1IR2A 1N33K 4WYWA 1P8ZA 1EZZB 5CYMA 2YKPA 3VA0A 2JEJA 4LBPA 2GUPA 3A3OB 3EDRB 3H5YA 2P2CB 1U49A 5C10A 4UZBA 2JVRA 5DLGA 3RVCA 1JJ2M 4YOYA 3K89A 4DV4K 1RT1A 4OYIA 4UOGA 3IBFB 3O1BA 3MMCB 5BPLA 4W5TA 5KFNA 5AQHA 1V3SA 4CO3A 2B5JA 1YTAA 2HNDB 1FEHA 1JNRB 3TZWA 3D5MA 4CLFA 4W5OA 2ADBA 2C2RA 1VQ9N 4W98A 4AT1B 2AWZA 5CCLA 5EWGA 4YMEA 1Z1ZA 4OHXA 4NB4A 3KMQA 4J8FA 4WJBA 2CPDA 3NGDA 3H5UA 5KI6A 2PE8A 4UZCA 3D4JA 4PUOB 1KC8T 1RXOB 5CABA 2AYGA 1IBLK 5FIIA 1DT9A 1GLBG 2KZMA 4NLGA 2XMAA 1VQMS 1NKEA 4ZPAA 3GFHA 4CF0A 3W5YA 2ZE2B 4LC9B 1N36K 1J9AA 1S3XA 1EB0A 3W61A 5E26A 2NUHA 5E84A 3I9ZA 3H3OB 1WSEA 4K43A 1GNKA 1M5HA 5CHIA 3CXCM 3LDPA 3CPWM 3HDSA 1MWZA 2DNHA 3M9OB 1BXNA 2ZM6K 1P8GA 4J9OA 3T5LA 1XNQJ 1KVKA 2FVPA 4B3MK 3KK1B 1PBUA 1VSDA 2AGQA 4CM2A 4C8MA 1C1AA 3VQDA 3S3MA 3BYRA 4DSJA 3S8SA 4QAGA 4JI3J 1RA6A 3RRHA 5KRTA 4B3RK 1CJKB 4WFBL 1C0TB 3MPVA 4CJFA 1W2IA 2OIHA 3ULHA 3CMQA 4O44A 3KKRA 2RJZA 3KUEA 4NEZA 2EG1A 2Z58B 4ILMA 3HSZA 1WAFA 1CULA 3O6WA 1Q7YT 1J27A 3TARA 1T95A 4KY3A 3VQ5A 2FUG9 3AA8A 1X9SA 3OHAA 4ZCLA 2MHNA 4WFAL 4FJIA 1JLEA 4FF1A 1Q1KA 3DDIA 2OELA 3KZBA 1RILA 4FLYA 5J2NB 3BSNA 2D3OR 4IOCL 1S72N 2OTLS 4NLXA 3VEYA 3OYIA 1C0GA 1ZBUA 4A8KA 2DY1A 5KG3A 1N52B 4QPTA 2FLPA 5C25B 2QWOA 2BGGA 1RTDA 4IXCA 2E5LJ 4Y1DA 3F9KA 3C14B 3PM9A 3W60A 1XNRJ 3MAHA 2PDAA 2GAHC 2DPIA 3JXOA 2B7BB 2AJFE 4F4AA 1U8WA 4ZVPB 4ZN1A 5AQLA 2B9YA 5GMEA 3V4MA 5BJRA 3HOSA 1XIQA 2L41A 4OGEA 4C8NA 2YWEA 3OFEA 4F3MA 1YVUA 1C0UB 1Z26A 7FDRA 3EEQA 3SZ2A 2HEKA 4H0OA 1WWHA 3ZX0A 3TAQA 4BRCA 4P2SA 4HL9A 5F8IA 2DISA 4UW2A 5A8KB 4M63C 1AXQA 3TWZA 1YRUA 3VAJA 3NGZA 2WONA 1DFDA 2KG1A 2E8AA 4G1QB 1X4FA 5I3PA 3RRGA 1Y7PA 3ENOA 3RG6A 2UUCK 4CJRA 3LDLA 4LD0A 4LF6K 5F8MA 2FSNA 4W5QA 4X64F 4YR2A 1YT3A 4FBUA 3IGNA 1Q9YA 3BUZB 4U8YA 3KJNB 1D0EA 2EK6A 1YQHA 4CIGA 4A8MP 4I6MA 3DLGA 3TPQA 1JNZB 1LWXA 5HK4A 1Q0NA 3A5LC 1RLDA 3GIIA 4JK8A 5GAHP 3CJ1A 1WC1A 3PX0A 2WB1D 3DC2A 1VC5A 3CJ5A 2E2NA 5DMRA 2ERRA 1NJZA 1NO8A 2C2KB 1IBMJ 4ID8A 4LF9F 2UUBJ 1H98A 3N4PA 4DLGA 1CJUB 2ETJA 5HROB 1U45A 2KJWA 1P9YA 3ZSXA 2HGNA 1NGCA 1FD8A 2ZH1A 8AT1B 4ZHRB 4HT5A 4EEYA 4H0YB 4M8LA 4FS1A 1SJ4P 3KKSA 4A5BA 4U7UK 4A59A 1KXPA 4DUTA 5JXSA 2HFSA 3PSIA 2ZKTA 1UJ4A 4FLTA 2FGOA 3GV8B 4IO1A 1JXVA 4A2BA 2UXBF 4RW8B 4CJLA 1B7FA 4P71A 4PYAA 5GAGU 2VZ9A 4FWKA 4ILJA 2VOPA 3AVNA 3HSTB 4Y1CA 3OS2A 2B8PA 1OPIA 3CD6N 2ZHBA 4PKIA 2W7AA 4FJGA 4R25A 2RHKA 4DV3F 3E2EA 1NMDA 1KQKA 3AY9A 1VR6A 3ZTRA 2VH7A 1HKGA 2XCPA 2Y3YA 3IGVA 3M8PA 2HQGA 2FF6A 1UWBB 3VV2B 1QTMA 4DL7A 3TVKA 3PHTA 4M5DB 3FBCA 2GCFA 3FZFA 4DR2J 2XQCA 1HQUB 1RNHA 2RIJA 4JI6J 3FCWA 4OYOA 3FGVA 4K0KF 4IBNA 4JI1K 4IYQA 1R0AA 4K4XA 3CJQA 4DR5K 3QIPA 1MMDA 3DLLL 4FLUA 3NF7A 1VBYA 5KG1A 5LSRA 2R7UA 1S6OA 1B9DA 1KBRA 1TYQA 5L9NA 1WEXA 2KHCA 2GELA 1S9FA 1TL1B 2G0CA 1CC8A 3BQ2A 4IO9L 4CK2A 5B0AA 1K1SA 2UV8G 2ZZTA 1PYOB 1HKAA 3CCUN 2XB2D 1VRTB 1U1PA 1U48A 2YKOA 4ANEA 3UFCX 1G6BA 3H98A 2RF2B 4J2AA 4HKQA 2V69A 1NLVA 1U1QA 2LMIA 1RBRA 2VBWA 4NXMK 2ASMA 4OZ0A 1ZM2A 4RU2A 4JV2A 2FQQB 1MROA 1VJQA 4I64A 3TNVA 1SZ2A 1YJUA 3UN3A 2BVZA 2AT1B 4ED7A 4XO0A 3TA0A 2A2DA 1WEZA 2RT3A 3OYDA 3PJWA 1QE1B 1PJ6A 4KKOA 3JYTB 2MLYA 3QRPA 1BIUA 3TI0A 1PAUB 3MMAA 4GVBB 2W8LA 1FXRA 4LRCA 3P49B 3I8BA 3OYFA 4YY3K 5D78A 4YHHF 1N8RO 2FHKA 2ZJPQ 3DMJA 1BGXT 3AAWB 1GXTA 4C1NK 3T5HA 4JI2J 2CPEA 2CQ1A 3QLHA 3MM6B 5JLHA 1U1MA 2P9IB 2W4PA 7AT1B 3AVFA 3Q7BA 2YY3A 2I0XA 3H46O 1JCFA 1QM9A 2F1FA 2MQ8A 1GQEA 4YDXA 5LMNF 1R59O 2P9SA 3VQ7A 1JLAB 5L1LA 2KDOA 3CJ0A 1NOZA 2YCHA 4E7LA 2QK9A 3RTVA 5AQKA 2B9EA 5EXWA 4EO6A 4P2MA 1MLAA 3IS9B 4Y0FA 2KXHA 2BV3A 4F0MA 3D1OA 3FE1A 2R2SA 3SQ1A 2AJ4A 2DITA 3W2WA 3KHGA 1EXQA 4PQUB 1Y5NB 4NO7A 2HQIA 1IM4A 2JVOA 5IT0A 2MLXA 3O2IA 2CFXA 1F5CA 4J90A 5HSPA 3DLKA 3IMXA 2A3JA 2W7PA 1DLOA 1NB2A 5ETKA 2QM1A 2Q79A 2I2YA 3CEDA 2A5XA 1Q16B 1LWEA 3MFHA 3VVTA 4HDGA 1NH7A 6FD1A 1SKSA 1RT7A 2W9CA 4FM2A 3OR1B 2KHDA 4ZVFA 1ITGA 3MPUB 2DY9A 2GJ2A 2CUYA 2E1AA 2CADA 3HULA 1ZZNA 4IOXA 1XHXA 3HT0A 1KLMB 3LTOA 4O3QA 4JRPA 2B7CB 2M2BA 2F8MA 3K5OA 1PCAA 3IP0A 4B3TF 2OTJS 1NOYA 5KFDA 1BD6A 1QSLA 2V8GA 1FXLA 4FNHA 4DR7J 5I3UA 2XM3A 4DQSA 5AZIB 2YV0X 3R8YA 3QEVA 3SBMA 2CPZA 5F9LA 4FWPA 2FBXA 5AQZA 1K44A 5D0EA 2HLTA 4NLPA 3IKMA 1P90A 3C6HA 3UD3P 5CXTA 3R5AA 3MR3A 4JD2A 3CW2C 3P6YC 4MFBB 3KK7A 1FRJA 1RI7A 3CC2N 3Q8YA 3MXHP 4H5WA 4C1NI 2KYZA 2NLXA 4DQPA 2OMOA 1J5OA 5HQLA 2W9AA 1WSHA 3QRRA 1DTTB 4ZJOA 3NBPA 5BRFA 1S49A 4CZEA 3ZZRA 3BP8A 5AE2A 2RB7A 4HT7A 4B9VA 3GE1A 3ID8A 2GMHA 3GWCA 1K8AO 2V9WA 1NUEA 1BA0A 3FZ2A 4EWTA 3IAM9 1J5EK 2ZD1A 3IWNC 1C0FA 4DV6K 1RZMA 2GTDA 4CLWA 2MMYA 2RDDA 6AT1B 2CG4A 4NXNJ 3W3SA 2HBZB 4ZOSA 4BWJA 2P5GA 2YBVA 4TQRA 1HNVB 2PI4A 2CWKA 2V9KA 4IG3A 4KRFA 3AD9C 2DO4A 2NRXA 4BHQA 1UVNA 3GYGA 3NNAA 1Z2LA 4AM7A 1LWFA 1JX4A 3KKFA 4F4YA 3AQOA 3VETA 2Z2MA 2KN4A 3VQ8A 3UCGA 1U2RA 1YRTA 2AEMA 4GV6A 3D2FA 1D8YA 4OI1A 4M3UA 2GEMA 1RDUA 3RBXA 4DXLA 2QW9A 3JAMU 5C42A 1IG8A 1CPZA 3DLRA 3UCUP 3G71N 2DVIA 2DXEA 2DJWA 1CZAN 3MEEA 2XSFA 4E0DA 2Z1IA 4RWWA 1WC3A 4RZRA 2JC1A 1QAXA 4X65J 2V0NA 4M3YA 5D8HB 4BRFA 3ITHB 5F8GA 3HTVA 4LJMA 3KLIA 2I1RA 3VGSA 1UVLA 5F8LA 4LRAA 2B0GA 3V81B 1JLQB 4E2FB 2J4RA 2P1JA 4TLRA 2HBMA 4CWBA 1N5VA 3UPFA 2GVDA 4QU7A 2XMUA 2M9KA 2P9PA 4W5RA 4U7UD 4BR7A 2DHAA 3FMWA 5A8WA 4D3HA 3HKWA 1W7AA 3NCIA 2LQ5A 4DV5J 4DLEA 5DG9A 1N5YB 2LU1A 4DS5A 3CYMA 4AQYJ 3OBYA 2XGQA 3W64A 5HRNA 3TVYA 5E3PA 2QLJB 4JHDB 4AHSA 1YK9A 3LF0A 3VGUA 2CPIA 3CCMS 4WBFA 4ECXA 4IOAQ 4ECTA 2DNZA 1YLXA 2RN2A 3CO0P 4K25A 2Y1IA 3X1LB 2POKA 3THWA 4HH1A 3O4WA 1OH7A 4R8UA 3N6NA 2XYGB 1AZSA 4WK1A 4JKBA 1VIOA 2ALZA 1YJWS 1NSAA 4OX8A 3JTNA 2GA7A 1CSJA 2E2QA 5I42B 3PACA 2VGNA 1FKOB 3GOIA 2JOQA 3DLHA 1HBUA 3DGPB 1X4GA 3NAHA 4YNQA 3TUPA 4FW1A 2HQCA 3Q8PB 3SLCA 4DPYA 2W2QP 4DR4F 2ZOGA 2CZ4A 3A5NC 2YNHB 3V6HA 4WFNQ 3SNNA 1JXLA 1U2CA 1UJ5A 1TMJA 4TKTA 2CH6A 1LAVA 3O08A 3OYNA 3KLHB 1Q8IA 2FLNA 1ZTWA 3SEOA 1KVIA 3J7YU 3K9JA 2BANB 1ASWA 5LSLA 3PUFA 3GIRA 3OBIA 1SKRA 3MTJA 5HATA 2VFSA 3QGPA 3WQTA 2DNNA 4X4UA 4XDCA 2ZH2A 4DBQA 1ASUA 4IR1A 1QVGM 1WHVA 5BR8J 2QX0A 3FNNA 4CO2A 2MPUA 2DNYA 3A5OC 3QWUA 1V6HA 2HQDA 2E5JA 3SUPA 4CT8A 1RBVA 3M05A 4X62J 2IVYA 3QICA 3O9QA 3J8AA 2H4YB 1FRLA 5IWAJ 1M5VC 3WC2A 5T14A 3Q23A 2CJBA 4CLZA 4WQ4A 3UQSA 4OIXA 2BUPA 4PWWA 2BRKA 4XTTA 3PV8A 2VF3A 2CNNB 2RMLA 3MN7A 3RR7A 4CNZA 2GC8A 1X7VA 5I3QA 2Z1GA 1XUPO 5D4PA 4KYZA 1GLAG 1ZBSA 3UKUA 2GNKA 4DR6F 2QC3A 3D2WA 5ADXH 4OX9K 4LF8J 4N5SA 4KPYA 4ES1A 5LJ5Y 3P1GA 1BY9A 3QFHA 4CJSA 3MCAB 4DQIA 3G6ES 3T7ZA 3FEZA 2UVVA 2MEWA 4USMA 3OTOF 4RPFA 1DEJA 2OSRA 1MDUB 4H4KA 3PSFA 4IG0A 1YX2A 1YKWA 1FRIA 3AOAA 4M63A 3L7UA 3THXB 3BY5A 4JYAK 4J9QA 1VFJA 2A40A 5GAEP 2G2OA 2HBYB 3MAAB 4U95A 3GILA 3W66A 5G4DA 3ZNUA 4IFVB 2G8IA 4LSLB 4WF9Q 5ETQA 4GV3A 3CD6S 4KTQA 2QGFB 1S7HA 1N0VC 2OPRA 2KW4A 1RYRA 2JGUA 3CI5A 2COLA 3N6LA 2PGCA 3CQYA 1BQNB 3L7PA 3A3PB 1CS4A 2BW2A 1DRZA 3T69A 2PA8D 1HBMA 4CHOA 4ED0A 3MM9A 2AMCB 2HBKA 5AQPA 3J81j 5IV3A 4WTYA 4O3PA 1NK9A 4DTOA 1BMQB 2ROGA 3NRBA 4FPAA 1C6VA 4KGXB 5AQXA 1QZ6A 2DGQA 1URRA 3TUJC 4CTAA 2QWNA 4JK7A 1RBAA 3PIOL 4CHPA 2C42A 1Y9OA 4GVMA 5RUBA 1U1RA 4GKKJ 5L8RC 1PIEA 4DTSA 4CEQA 3MUTP 1IKXB 2ASOA 2HVIA 5G0RA 1LW2A 4EBEA 5KGWA 3P38A 1UTAA 3WXMB 3M9MB 2PBDA 4U67L 4MK7A 5HO4A 2I8EA 4C8LA 3F56A 2I5JA 5MLCQ 1Y3JA 1RAEB 4OKEA 4LY7A 4DF4A 3MM5A 4LIRA 2F9JA 4QOZB 4DTJA 2ATLA 5IT9U 1F21A 1R8CA 5F0XA 1ELOA 2FF3B 2HNYB 3S3OA 2GHVC 2XO6A 4URQU 4JI5K 4J2EA 2WOMB 4UTGA 4C11A 3Q83A 2Z0GA 1I1GA 2LQBA 3T1YJ 3BGRA 3HCXA 4U6PA 4FJMA 1SQEA 3WX4A 5KT5A 4F2RA 3IMQJ 2DEIA 3DGVA 1NK7A 4Q7AA 2X1GA 4FPBA 2V2QA 4B8CA 1S1XA 1S77D 4GMKA 3SJJA 1VK3A 2D4WA 3L2UA 2WW4A 4N41A 2FVSA 4TNOA 1FA0A 4J2BA 5DM7L 2FJVA 3V6DA 5A6PA 2R7VA 1N8RT 3V9UA 1G99A 3UO0A 3ET6B 2YKMA 4KHPJ 4X66J 1PO6A 3QPIA 1OY9A 4CCHA 2HURA 5AFUH 4I9QA 2BJ1A 2ZEJA 4X64K 1QTNB 1GTEA 3JSRA 1HWJA 2E1MC 1S76D 4Y28C 4JKEA 2QZ8A 3HJVA 2QYGA 3I5CA 5KQDA 2RQKA 4EK2A 3NH2A 3E8OA 2GHPA 4OHZA 4BRGA 2RPIA 5K8NA 1UAXA 1FE4A 1FNXH 2HHTA 3C0BA 1HNZJ 3OVSA 1UJ6A 1YBAA 4NMXA 5HMXA 3VQSA 5B0DA 1T6DA 2O66A 1N32F 4QYZK 2JH3A 2Y0BB 3ZSYA 2HZAA 3LM2A 2FSJA 3BGFA 4ECWA 3BKFA 4DV1J 1EETB 3OPKA 3M6VA 1VOMA 2XS5A 4Z4EA 4ECZA 4DQ8A 3MHYA 5HL7Q 2FZKB 2WSFC 4LF9K 4ECYA 2DH7A 4EP5A 1V3RA 4CT9A 5AQSA 1GFWB 4JRQA 5HMWA 3J7Z5 4CZCA 3CXCR 3O9SA 1JLFB 3CPWR 4CJTA 2ZBPA 3N6MA 3C14A 4OI4A 1S79A 4DN9A 3D2EB 3ZETA 2K7KA 3WEEA 3G87A 4RUCA 3ILOA 3FCVA 1XHZA 3HL8A 1RISA 4CF1A 2MKKA 1QQMA 2B4VA 4ZLNA 2RKIB 3T1HF 3NGYA 2MZJA 1BHNA 4NI2B 2Z8QA 4LSNA 3FR0A 4IZ9A 3VQTA 2QKBA 1XR5A 4KH1B 3OY9A 2BM0A 1IKVA 4ZCIA 5LY3A 2UXBK 4IQMA 2DGSA 1ZBFA 1FWPA 2R2UA 1U6FA 4M94A 4JKGB 5AQWA 4C98A 3QSYB 4PR6A 2ZJRQ 2V4JA 4A61A 2AZ3A 1F9FA 2MY7A 2G4BA 2CQ0A 3WXIA 4DV3K 3QEIA 3CDUA 5AQUA 4AE5A 3WZ0A 1FJGJ 3A2FA 5EN1A 1S9GB 1XMOJ 2MHEA 1VHFA 1Q8KA 1RKJA 5LM7E 4NLWA 4H54A 2MKHA 3MM7A 2W41A 4CJPA 3GLJA 1FVSA 2JSXA 4MLEA 4FJ7A 2HHWA 2FJWA 3D9BA 1MN7A 3LO3A 3SUNA 1LNQA 2P5OA 3QFUA 3W8GA 4CECA 3CCVS 3I0RB 5ETNA 1BWEA 4K0KK 1ULRA 2MSSA 2ASLA 5F1XA 3I0SA 4DF8A 3IWLA 1HMVB 2RDIA 3HOTA 4PXDA 4YB5A 1RT6A 4I68A 1RTJA 3ILJA 2YVSA 1Y4ZB 2VPXB 3LUYA 3W9JA 2GIRA 4K4YA 5HANA 5CR4A 4YR0A 2AGOA 1T05B 1K8AT 2Q0RA 1CJUA 4ID1A 3G6XA 4I4BA 3SSQA 4DV4J 3CMAN 2FHMA 1HI0P 2I7PA 5KT2A 1GLCG 1N88A 1RWMB 3GYNA 4KHYA 4PKGA 2VQFK 4X4PA 3EYZA 4WKRA 1CVJA 5FLXU 2F4VJ 1KAZA 5IC4B 3MD3A 1YJ9S 3GJSB 5JICA 1KRPA 1T0TV 4HUFA 2W2MP 1WOSA 4WYBA 1IBLJ 1RU1A 4BROA 2ZC3A 4DR3J 3MEDA 5F8HA 4JKDA 4PQAA 3O44A 4ZVTB 3LANA 2LCWA 4ILRA 1GTHA 1H1VA 4NLUA 1ZTTA 4QS8A 4JKHA 1K6YA 1M1KO 1X4BA 2DD8S 3OXFA 2KHOA 3MURP 2M0GB 1Q82O 1JB0C 1RWWB 3BM7A 3CERA 3QEPA 2KT2A 3EVOA 3MMBA 1QAIA 3R97A 3GV5B 5B0EA 2ZM6J 5HLFA 1O8BA 1D5AA 4B3MJ 3MCSA 1X1PA 4K7QA 2B51A 1FJCA 3M2VB 4IH6A 4MDAA 1FX2A 1XN9A 1U25A 3OTCA 4DWIA 3EZWA 3SPZA 2XZTB 4B3RJ 4YDUC 1LXJA 1HFEL 1Q86O 5A8RA 2V4RA 3LL3A 5LMNK 2VC1A 2CPFA 2QEXN 2V8PA 2OPQB 2VPYB 1HYSB 3WNGA 1NLKL 1S9EB 3V9ZA 4RKUC 2CNKB 3DDNA 2F9TA 3BEXA 1VQ4N 3AGRA 4KBOA 1U0HA 1VLYA 3GMGA 3I55S 4DG1A 4OZ1A 1XNQF 2YKNB 4F36A 1KOOA 2BTFA 3R2CJ 1YIJS 3V4IA 4LVOP 4IFYA 3CJTA 1S4EA 3W2VA 2VJUA 4BRNA 3HVWA 2HS4A 4O4GB 1CJVA 1KS2A 4CIOA 4YOEA 5ADZA 2RF2A 4NLBA 1MNEA 5AQIA 4NOHA 4Y00A 2GFFA 2QMXA 2J7UA 1FRKA 3R7NB 2PA3A 4PKDB 4LFBK 2OO4A 1IR1A 4FS2A 3RRKA 4RBTA 3CCWA 2SXLA 3FRYA 5HAOA 1XK8A 4ZP8A 1BLUA 1BL3A 1O0PA 1UW9A 2HK2A 5AE3A 2CH5A 2O8FB 3JYTA 3M8RA 2PZSA 5DJBA 1C1CB 3A12A 4I2PB 1HKCA 3W0LA 5A2QY 3DXSX 5KFUA 3RAXA 1KQSR 4B3TK 1ZBHA 1VQNS 3HHEA 3DLBA 3K2PA 2CJYB 4KO0A 2MJUA 4CH1A 4GC6A 2CJAA 4LF7J 4WFBQ 4QS7A 4YN3B 1ZS6A 5CYMB 2K8GA 2E5LF 2AJ2A 3H1VX 3SK3A 3VGVA 4YORA 3BV8A 1EWRA 2HNZA 2MLZA 1WSIA 2UUCJ 2DGTA 4LF6J 4NYFA 1FW6A 1RT1B 1J2VA 2L9NA 4DSEA 3UI3A 2B5JB 4WFAQ 4K5SA 4WXWA 3EDQB 4MO4A 3ENQA 4F26A 4BWMA 3IG1A 4NPOA 3LAMA 1T3VA 3AARA 4IOCQ 2YWKA 3I96A 1R0BG 2DCUB 3MR7A 4A8SA 2M7SA 4H5RA 1GOCA 3VTHA 5KFMA 2MQNA 1KQGB 4DU8A 1WHXA 2PY5A 2NXCA 2F5GA 2OKQA 3OVBA 4J7CA 1R6YA 3NGIA 4WQ5C 5C0YA 4C0OC 3CTRA 4E89A 4ZVRB 4B9SA 4A48A 4HHTA 1HW8A 2R2RA 2A1RA 1Q9XA 1UFKA 1WTFA 3VPZA 1JJCB 4N8OA 1Q18A 1T3NA 1Z6RA 3L3CA 4USHA 3PW0A 3RB3A 1KNZA 4FL9A 2HVZA 1P27B 3M32A 3AO5A 2QWLA 1XQSC 4PA1A 1GX6A 4AL5A 4FWQA 4LFAF 2ZFHA 4OQJA 5DQHA 1UETA 5HMZA 2QO3A 2EXUA 2JEIA 5LXYA 1EJ7L 3TAFA 4URSA 1S4FA 1QQCA 4FLVA 2DXFA 3VN5A 3BPDA 1LV5A 1GLLO 1NH8A 4JI6K 4JN4A 5E41A 2HHHK 1Z2ZA 4CJ7A 2VG7A 3PKYA 4O44B 1FDAA 2E9TA 3ISNC 4E1MA 3OSPA 4CBXA 1NK0A 1CULB 2VDHA 1IBKF 2WCXA 4CJWA 3TTDA 1EP4A 2C1EB 3TUZC 2JHEA 2YI1A 1LOTB 1TUYA 4GKJK 1JK9B 1DTTA 3FK4A 1A9NB 2ACMA 2FLOA 2Q6CA 1JLEB 3OTBA 1NDCA 3IC1A 1RBSA 3EE8A 3QJJA 3W5XA 1HARA 3O3FA 3HK2A 1BU6O 4O5BA 1YJRA 5BXIA 3QDKA 4NE9C 4DR5J 3NF9A 4Z2XA 1NJIO 4HCCA 2Q97A 3QAEA 1APSA 4M5LA 1RTDB 3T5KA 2ZH5A 5DGBA 7FD1A 4ISFA 3AA5X 1TTHB 2XS2A 3PO4A 2MGZA 1VS3A 4DFJA 2HBQB 4CJUA 4HVJA 1TL4A 1UPMB 4QIGA 4ECQA 4LQ3A 1QZ5A 4YOWA 4OMFG 3NMUA 2HFVA 3SV3A 2D0PA 2OD4A 2O3DA 5T7LA 3L09A 2R7YA 1U1KA 1VQ5N 4C7QA 2UYTA 4DR2F 2VFRA 5BYRA 1BIZA 4DEZA 3OW2R 4PL8A 3PW5A 1RCOB 1TL3A 2AQ4A 3RB0A 4NXMJ 1TUUA 2YHXA 3G2XA 3G8TA 2MZTA 1TKTA 4KFBA 2GBZA 2RHQB 1RHRB 2F65A 3MR2A 3S6EA 5I4MA 1W97L 4I2QA 3O5TB 1RDAA 1RTHA 1KTQA 3NAIA 4CH7A 3PX4A 2YKAA 5BRDA 4F3OA 3CC7N 3RGIA 3O1LA 3RAQA 2VYPA 3VEVA 1VIXA 3KYLA 3MUMP 3QQCD 1VMBA 3C6AA 4YY3J 1XC3A 2OZSA 2U2FA 5KFLA 4ZIVA 3NF8A 2GIFA 1R8BA 4CJVA 5DDPC 5C15A 4MKYA 3V6KA 1QVFR 3LZIA 5CY4A 5CZ1A 4PXBA 2UZAA 4KBIA 4I6MB 4HEA9 4FSVA 3H1QA 1X3MA 3OVAA 2NYIA 2V2ZA 4Y34A 5KGXA 4CZJA 3DLLQ 3R3TA 1W2BM 2V7YA 1WC0A 4Y2KA 1TL7B 4CO0A 1S6QA 2HF3A 2YWHA 2V8VA 3TZYA 3N01A 2YH1A 2G0JA 1Y00A 3HHLC 4NRTA 1NSQA 3NE6A 2GQ2A 1N5YA 5AQNA 1EWQA 2EVZA 2CJQA 2HRYA 3NWRA 4IO9Q 3PFOA 2D9OA 1UZDA 3GJTB 3LOUA 1VJWA 3CCTA 3QB0A 2W2PP 2F63A 3ZEUA 1S59A 2OPSA 5FPMA 4I6WA 1ITPA 2M88A 4BE2A 4BC4A 1WC5A 3HZ6A 1OO0B 4F04B 2XLIA 4OI0A 3HVTA 1CQNA 1UFWA 1XMQF 4C4WA 1SCJB 3A8JA 3EGZA 1N4LA 4ZKAA 1JLBA 1KVBA 3GCXP 3ASMA 2BDPA 2IMOA 5I42A 2B3TB 4C0BA 4DU1A 2XBPA 1FX4A 3K0JA 3DLJA 4DSLA 4F8RA 5TKYA 1LCUA 2EWHA 4Q2MA 3LGNA 3PJXA 1WELA 1URNA 1SC4B 2E6MA 3PX6A 1NGDA 5H9EK 2OGUA 4ED3A 4ZVHA 3ZSQA 1W25A 2BKNA 3M8PB 1TKZA 2NS1B 4DL4A 3FZLA 4BDYA 2VBXA 4EBCA 2LXIA 4MH8A 5E7OB 3DOKA 3J7A1 3IM8A 2FPHX 2CQDA 1J54A 3DRRB 3J81U 3NVMA 3C6TA 3VQ4A 3NLCA 5KTQA 3DDKA 1UEKA 3NNCA 4DTUA 3EPGA 2FJDB 1K73O 3TJAA 1IQZA 3D6FB 3QIPB 3ULDA 2J0QD 1V3ZA 3FRZA 1WDDA 4ZTJA 3OJUA 4BC3A 3MGJA 1TYQB 2ZBRA 5KAKA 2M70A 4ZVOB 1ESVA 3FVYA 2Q6BA 4YOUA 3K8VA 3FJ2A 1N0UA 4A8YA 5D4LA 2YJFA 2H5JB 1I39A 5M1KA 1WAJA 5KFJA 4OYAA 4HYKA 1VBZA 3HZEA 4N8NA 4QIWD 4OHWA 3HKZD 2LEBA 4FO0A 1J5EJ 2JWNA 3MCPA 4DV6J 1MROB 2LLZA 4X2BA 1YBUA 2XI3A 4ZLPA 1VRUA 4CFAA 1S0NA 3CMES 1RJJA 1PKUA 3EJMA 4CO4A 4MIAA 2XMMA 4KKOB 3ATVA 4O0JA 4M3RA 3U6FA 4X65K 3MMAB 4DV7K 1NXIA 2Z57B 1SC1B 2NRHA 1WSVA 2CKWA 3DMJB 4DJBA 4B3SF 2E2PA 4HTUA 2HS0A 3EL2A 1OY8A 3W62A 2RSQA 2EC2A 5GIPA 4CZIA 1EKEA 3ISZA 2QWMA 3QLHB 4LBIA 4A62A 3K7RA 1M1KT 2WRMA 1RWNB 2UXDK 1Q82T 1KHWA 2PD1A 2A10A 4E19A 3PEJA 2P9SB 4DL6A 3WT0A 3MXIA 4JI8K 2YKQA 2XMKA 3SCXA 5AJ3F 1NEEA 4DI6A 5IQ6A 3R5BA 1DAXA 2GGPA 3GG0A 1RAFB 2BQRA 2ATQA 3ENVA 3IUCA 2IIRA 3NS5A 1PJ5A 4XPCA 2FZGB 2ZGYA 3W2WB 1Q86T 4W4MA 2LXUA 5KPZA 5GADI 4DPWA 4FWLA 3B4MA 3OYKA 4B9NA 2LP4A 3DLKB 3PVXA 1TAQA 4FF4A 4LMZA 2ILZA 5IV4A 2IJRA 3A8KA 3THTA 2O8BA 1DLOB 1N32K 4L73A 1FXDA 1VQ4S 2R7SA 1HKBA 2CQ2A 2G9OA 3ZZPA 3SQ2A 2Y1JA 1RT7B 2W9CB 5JS2A 4BR0A 2D0CA 1HBNA 4ISGA 4X4VA 2XGPA 2QN6B 5AFUA 4E7KA 4E3SA 3MTKA 1MU2A 2IA0A 4DQRA 3BEGB 4BR9A 1VI7A 4WXOA 3C2PA 1R43A 2PMHA 2LA6A 4Y2AA 3QMLA 2HHUA 2MKYA 2MQLA 1UMJA 3T1HK 1RSCA 4OZ2A 1JCGA 3ZCMA 5I3UB 2D9PA 2DNKA 4F7VA 5KFSA 2A0FB 4UF4A 3THYB 3CM6A 1TKXA 5HRRA 5SWMA 2F9WA 2FJAB 2BQUA 4AQYF 2UU9K 4B1XB 2UXCK 1HI1A 3TAMA 4PEOA 4PABA 5IOLA 1RWPB 4AL7A 1B70B 3OXLA 3KG0A 4ZCMA 3FLCO 1K0TA 2R7TA 5CAAA 3CCEN 3M5RA 1T44A 2C2OB 2DXDA 3FBBA 5LL6Z 4DL2A 4CZKA 1CG2A 3NBPB 1HNWF 1NJWA 1RKIA 4EFHA 1WNEA 3NKYA 1MMLA 3OXGA 2RD5C 4DFKA 4DB3A 2IM1A 3GIKA 3QBXA 5D4NA 4QCLA 2QWQA 2J76E 3HP9A 2KQ2A 2ROEA 1HHTP 5BPMA 2YNGB 1OQ3A 4RBVA 4IH7A 4H5NA 2V2KA 2ZD1B 3CCSN 3KLGA 2CZVC 4ICLA 1MWYA 3KLFB 4USWA 2V8DA 3QNWB 1FJ7A 3R5GA 5M2RA 1B4SA 2ZZMA 1ATSA 2Y1RI 2G1HA 2MKIA 4NASA 4ECSA 4PCQA 4IG3B 3AVKA 2N7YA 3PR5B 1ZETA 3VERA 1LWFB 1HIYA 2V63A 1P9QC 1ATNA 5KFBA 5DLFA 2X7IA 2EW9A 4Z0UA 2E7WA 5E33A 2LXFA 3C16A 1VQON 4OX9J 3D2EA 1NK6A 3D2FB 4O3SA 1BOTO 1F3VA 3GJQB 2RRAA 1ZAWA 3N5FA 2D74B 3G8SA 2VBZA 4CJ4A 4USJC 3CCLN 3IDHA 2K3KA 1HWKA 4ITSA 1CEZA 4Y0WA 5C42B 4K41A 4Q5VA 2MJNA 2EPIA 3L3UA 1ZH5A 4AHUA 2E7VA 3OJSA 3GTYX 1TQLA 4NMLA 3OBWA 4OYMA 3BKUA 4CZHA 4O5FA 1VHIA 1WDTA 1BE4A 3A8EA 1BA1A 4Q0BB 4BRMA 4JKGA 3KWMA 5J2MA 2L9DA 3D0IE 4MK8A 4CNYA 2F9DA 3KLIB 4EI2A 2CZ9A 3TABA 4TVAB 3ZT1A 5F2RA 3K8WA 4J9SA 3MI7X 1S1WA 4M5GA 4FJ9A 1IQTA 2CQ3A 2VBYA 2GVDB 3ISND 3OHBA 5AQYA 2P9PB 3FSYA 4OYPA 4PG8A 1X0FA 3VGMA 1H38A 4NRUA 5A8WB 3VAFA 3EVWA 1LK7A 2VFTA 4GKKK 2Z2ZA 1HNXK 2CVIA 4ZVUB 3SAHA 5JLFA 1IV0A 2VASA 1NGJA 1KTVA 1KFDA 2W6KA 3HRGA 1KSPA 3I0RA 1SXLA 3QESA 2KYXA 4KRWA 4IRCA 2W1BA 3MOZA 1FK9A 1RAAB 4UT4A 2NZTA 4RJVA 1NMNA 3THWB 2J9DA 3HMJG 1YJNS 4R8UB 1NJIT 1T05A 1AZSB 3OQ2A 2VQEF 1M5PC 5HJYA 4A8FA 2P6SA 3V9SA 1L5UA 4CLPA 2OFGX 3VAHA 2QL5B 3DI6A 4K8ZA 1FERA 5CYQB 2XI2A 2VGMA 2C3YA 3KVGA 3UVJA 1HBUB 5LXRA 1DTQA 2XLKA 3WXKA 3MOJB 2YNFA 5EX3A 2BR0A 4WU3A 3AVAA 2PFDA 2FVRA 4MKVA 3OFFA 3MN6A 3P4IA 1SJ1A 4H0VB 5IXUA 4U96A 1VBXA 3DOMA 2XMJA 4L74A 4OHVA 3CDBA 2N4CA 5AZJB 4JI5J 4NL5A 1GH8A 3WQUA 3D67A 3IRWP 4A8OA 3D0HE 2R8GA 4ZCKA 2HBJA 4CM0A 2YX7A 4I9LA 3MPWA 1YVNA 2VWKA 2HWHA 2HHVA 4JOUA 1XTZA 5BRHA 3R9PA 2R2TA 2V50A 4BDZA 2A42A 2R7QA 2BBEA 3HPHA 1ZPVA 4TY8A 4JNEA 2R3VA 4FYXB 5FDLA 5BN8A 2AJ1A 3N79A 2YWFA 4X4SA 3ZFVA 1WG4A 4UOHA 3ETOA 5F41A 4ID5A 2KO1A 1BI4A 4M7XA 4PG5A 4MO5A 2RUSA 2IVFB 4IKFA 4NYOA 2FC9A 5AXMA 2P9GA 1OSCA 3P5TL 3EGWB 3GR0A 3A5MC 2A2CA 3KMSA 1SH2A 3HHLD 1W26A 2M4MA 1GOBA 3PIOQ 1X4CA 5KFFA 4X64J 2Y1LB 3UDVA 3MWBA 3UKUB 2FHJD 1RWOB 3O3GA 3UN5A 3ATUA 2IRYA 1VQ7S 4U67Q 4RX6A 3P96A 3F5TA 3HI0A 2H54B 3F41A 5BR9A 2Q3PA 1B99A 3VAIA 4EO8A 4QYZJ 1NU4A 5J1PA 4FZVA 2B4JA 2B8QA 1GLJO 1YTYA 2M3DA 4IG0B 4F4ZA 3CQ8A 2L48A 3AAPA 4LF9J 3LALA 1N34K 1VDHA 1WI6A 4KHPF 4X66F 4Z4HA 1HL6A 5LOQA 3TWHA 3BGLA 3KXDA 3JAMO 1F5AA 4P2FA 5CZXA 3HHDA 4H0XB 2XY7A 1XC9A 3G6VA 4OPAA 3TTCA 1K8KA 2X1AA 3LDQA 3M2UA 4NZ0A 1AUDA 4ED8A 2D1CA 4CLKA 4PXCA 1RDRA 4CO1A 5A0YA 2Q3SA 2OPRB 2HBRB 2RU3A 1HNZF 2CAJA 1N54B 3M1VB 4OLOA 2DNGA 4LFAK 2CXEA 4O55A 4OI2A 5DM7Q 4FNIA 2IJNA 5A2QU 1CS4B 1DURA 2UXBJ 3BPSP 4Z4GA 5DM6L 1HBMB 4DV1F 3AGKA 4DTNA 1EQYA 2I38A 3MM9B 2LEPA 2HSEB 4DUZF 3H08A 1W0HA 1UPPA 2ZH7A 1T9WA 3POTA 5TKWA 1O5JA 3MWTA 4LF5F 4DV3J 3ZZYA 2HVEA 3HHLA 1YJ7A 3VGTA 4HTIA 2QLXA 3LPEA 1WSRA 2FHJA 1K73T 4P74A 4CTAB 2ZNZA 2ZOFA 3DNCA 1QQNA 4AH9A 3MD1A 3FQKA 5AT1B 3KJFB 4QWEA 5AQQA 1VSKA 4J5OA 3PW7A 5G0RB 1LW2B 3EN9A 2OJ3A 3D68A 4IDHA 3WNEA 5KFKA 4ZTFA 2F4VK 2XSJA 3TX0A 5C12A 2I5JB 2IM0A 4K0KJ 2K1RA 4DOZA 2CA9A 3O9UA 3V1RA 2FVCA 3ZZZA 1R8PA 3MM5B 2ZBQA 4GNIA 3IM9A 4LF4K 4ZVSB 5LL6d 5IT9Y 4Z7CA 4YOVA 3UCZP 5H9FK 1M1HA 4CZGA 1GT8A 3ETMA 1KQFB 4DR3K 4PWDA 3G82B 1G3OA 2HHXA 4JI0F 4C11B 1XMOF 2XS7A 1KD1O 1U0SA 1OVQA 4AF1A 3ALYA 3BGRB 4OPKA 4TLQA 4I56A 1BCOA 3D66A 4XPEA 2VQFJ 4CFDA 3ZT3A 4ZVEA 1VQ6N 2HQ3A 3VGLA 4NWBA 4CERA 1S1XB 1OPZA 3DRPA 4MQ3A 2KXNB 2VDIA 2M8DB 3G9CA 1N33F 4DZ6A 3UE5A 1NPRA 4G1PA 2MQQA 3F73A 2BABA 3V6DB 1RDWX 4FXDA 4BG9A 2XNQA 4QR2A 4O3OA 2QA4N 1IKYA 1AUSL 1RT2A 2UP1A 4DL0C 1CJTA 2V2VA 2PN6A 3AVLA 4CZLA 2YKMB 3NGTA 3R5CA 1I5OB 1RP5A 2GMJA 2VJVA 3BJYA 3GCWP 4DR1F 2BM1A 4IEEA 2ZJQL 1FDNA 1NDKA 1NAQA 2IHR1 3Q2SC 3FSXA 2F7VA 4YHHJ 2OAUA 2C28A 4MLHA 3AVHA 2HRUA 4O3RA 4HTJA 5HVGA 3JQMA 3C6UA 3FEYB 4L8RB 3CJSA 4BE1A 4YOXA 2H48B 3FZMA 3TUIC 3H40A 4YR3A 3ZSRA 2JC0A 4KQZA 1IBLF 2HW3A 2ZGZA 1S1VA 4MT1A 5DDQC 4BRKA 3L7OA 2EWSA 4OYWA 5LMNJ 1GMWD 1SI9A 1N36F 3VQQA 1VSHA 1Q53A 3WBZA 1WC4A 4NCBA 4KGMA 1OH5A 4AXIA 1NK5A 2C3UA 3TRGA 9RUBA 3ZETB 3WEEB 3U8XA 4WWSA 3VAGA 5LSOA 4ED1A 3QZ8A 3B6OA 3D6TB 5CQGA 3IRXA 3K0SA 2ZM6F 1YITN 2V34A 4KB7A 1RYSA 2RUGA 2WK4A 4ISEA 4B3MF 3E3XA 2HAIA 4B1YB 2F40A 3UB5A 2H5IB 2VB6A 4JAXA 1EARA 2PO4A 5MAOA 4LSNB 3JXUA 1WSJA 1XEZA 2E5IA 3EKUA 4LRDA 1IKVB 3C19A 3DFEA 1X8DA 3TA2A 4YDDB 3F0NA 1LW0A 2AD9A 4A8WA 1M5OC 1WB9A 4LFBJ 5HOOA 3KLEA 3O5BA 1M90O 4LF7K 4ZPWR 2V4JB 4KGZB 1HW9A 3TZZA 4AHVA 3GBTA 5T41A 2NRTA 5FJ4A 2PAVA 2DH8A 4B9TA 2DNQA 5DO2A 1EO1A 1VQPN 2XWXA 5FPDA 3FFKB 3W1YC 2O67A 2R42A 4CEFA 2AGPA 4BRDA 2L9WA 3NOGA 1GXLA 1PILA 3NGKA 2NYHA 3HD2A 3KNGA 1NMEB 3MM7B 1NSKL 4HI2A 5JMVA 4B3TJ 4P2XA 4BR5A 1IO2A 3KG4A 2AU0A 3D7EO 2LKZA 1C2PA 3CCES 3AODA 4A5AA 1NCLA 3QETA 2NZ4A 2DGVA 3I0SB 1XR7A 1FRHA 4ZP7A 1RT3A 2MDAA 3ZSZA 2W9BA 1TL7A 4HUGA 1RT6B 2X1FA 2HBLA 2DIUA 1RTJB 3G6YA 1NRKA 1NDPA 3VR1A 4C97A 2CG8A 3CJ4A 3OYGA 5LMUF 4RUAA 3I56N 3RUBL 4ELVA 3KJQB 3CCSS 5JVHL 1SC6A 3CPEA 2V68A 1WG5A 1HYZA 5L1KA 2C3OA 2VHGA 4ERDA 4FJKA 1DBDA 5M1OA 4BGAA 3CCRN 2GQQA 5FLXY 5IT9O 2KL8A 3M2RA 5CZVA 2ZH6A 4NYNA 4H4OA 1NG9A 5F3TA 3M6WA 1H74A 5KT6A 4NCAA 1YJTA 3PKMA 5K8OA 1Q8BA 4CGGA 5KFQA 1S1TA 3ENAA 3GSIA 2DO0A 4LFCK 3MEDB 4E98A 1VQOS 1LXNA 2DHXA 5KPTA 2GJFA 1CZ9A 3LAKA 3MPYA 1SH0A 4DPOA 2ZVIA 5C2GA 2DT9A 3CGIA 5GAGP 5AQRA 2CQCA 3HPGA 3VQ9A 1FFWB 3KNAA 3TAEA 4UY85 3MMBB 1V4TA 1NGBA 4B3SK 3M8ZA 5HLFB 3CDEA 1W2BR 2ROPA 3PYDA 1UAWA 3WIVA 3SBGA 4C0HA 3HVRA 4M42A 3K2YA 1VQKS 4FWMA 5EY4A 3R5JB 2IDLA 3DRRA 2FB0A 4BRPA 4K42A 5GADU 4RW4A 3EVMA 1IWAA 2HHHJ 4TU8A 4QS9A 4LQ9A 5A8RB 2A1SA 4BR4A 1D9AA 2FGCA 1UA0A 5AJ3K 5GAHI 3VAKA 2B43A 5DG7A 2XULA 2PI5A 3RBZA 5EWFA 4JB8B 2O8CA 2Y8YA 1U0HB 4DG1B 3E9OA 3QFPA 4GKJJ 1QQOA 2PEBA 2YHAA 3V4IB 1F60B 1S0VA 1XMBA 4IFYB 3W2VB 2HMIB 1VQSA 2FXUA 2DEJA 3BGUA 2QSFA 4B9UA 4NA2A 3OA9A 2HOEA 4N7TA 1S6PB 2EX3A 4NLTA 1XBWA 4CH0S 4EZ6A 1CJVB 2DTJA 3AJDA 3LP1A 4ED6A 1KVCA 3W9IA 3ILIA 4I69A 4B3OA 1I3AA 1UCNA 3U02A 3HSCA 3J7ZO 3CNQP 1S5ZA 4KPCA 3HYFA 1HNIA 2ADCA 2XHBA 4EAHD 4CIFA 4DSFA 2N82B 4ZPBA 1Y10A 4FJHA 3BBBA 4RW9A 2QYCA 3H8YA 2QT7A 3VESA 3GPAA 2IGIA 2O8DA 4ZVQB 1Q95G 3H2LA 1Q4RA 4OZLA 4DV2K 2IAJB 1NHKL 1ZA2B 2L08A 5GAGI 3OHRA 5LJWA 1SJQA 3L2WA 2Z56B 3BF4A 5E3RA 4PG7A 3NH1A 2MZQA 4LRBA 4GV9A 1N6QA 4JI1F 3R2DJ 1WBDA 2IJFA 4Z37A 4KO0B 4WIIA 3SQ0A 4KB1A 1GLFO 4F02A 4KHWA 4JI7F 3HT3A 2XHWA 3EY1A 2KVQE 5HBMA 2QTWA 1ZBTA 2FY1A 2ZHAA 3O3HA 2V4QA 1K9MO 5F0UA 3ZT0A 2HNZB 2KRRA 4KHNA 1YUWA 3B8HA 2ZH8A 2LEAA 4BC7A 3ZT2A 5D0RA 2MXYA 3NEKA 2WTFA 2OTLN 1FCAA 3R6GB 2D3ZA 2J9CA 2AHOB 3S01A 1Z05A 5FD1A 2MQPA 4E8UA 3KHRA 3Q89A 1U04A 3CCQN 1HNWK 3IG1B 4N56A 1PGZA 1VBKA 2FJEB 3VEZA 5AQMA 2HSTA 3B54A 5IS2A 4LR8A 2XY8A 4M45A 2KFYA 1VSJA 2YTCA 3PYFA 4OJHA 2E44A 5GVQA 1RHQB 1TGOA 5GMDA 1H2UX 4CGDA 3TSUA 3GG4A 5FLXO 3O4NA 4LH4A 1NWKA 4AHCA 2OANA 2C2EA 2M5YA 3NL0A 3C7NA 2AYBA 1F2HA 1HQEA 3UKRA 3VF6A 2GX8A 1C4CA 2H5EA 4FDFA 1V5IB 1K0VA 3M32B 4J9VA 4RW7A 2CDQA 4DR6J 3OLAA 3ULEA 1RCHA 3PW2A 3JTOA 1RAGB 2R7OA 3T41A 2CQ4A 3AVGA 2P6TA 2UV8A 3VALA 5JVGL 3OTOJ 1IM6A 3W3DA 1DQ9A 1X5OA 3K59A 1G1XA 3NFAA 3THYA 2EEYA 2PYJA 1KOHA 4G6VB 1ZZFA 4ES2A 2OUGA 3NS6A 2VG7B 2RH3A 4B1WB 1AA1B 5H9EJ 5M2PA 3QINA 5B0CA 4X4TA 2Q0UA 1G7CB 4RNNA 1T9YA 5KFIA 1KVAA 1F6TA 2CVEA 6FDRA 2GJIA 2H65B 1EP4B 1Q78A 4BS2A 4EHUA 2PC6A 4IWVA 4TU7A 1DY3A 3BKTA 2EHGA 2MY8A 5E2QA 4WCEL 2WVBA 4BC2A 3FEXB 2GV1A 5JMNA 4QW9A 4PPDA 3ZLJA 4U7BA 2E1RA 2G8HA 2WBNA 2BOAA 2YNGA 1X0PA 3IA0A 2C3PA 3Q8SB 3CIPA 2XMWA 4DL3A 3KLFA 5KG4A 1L3TA 1ZAVA 5E3QA 3LP3A 1IR0A 2MGZB 1HD0A 4CZMA 3C46A 1QHAA 1VQ9S 2XCAA 1JCEA 1F9EB 2WFBA 1X3NA 1IUJA 3AA2A 3VWSA 4IKAA 3JQKA 1RBUA 4C6AA 5T7LB 2RRNA 3CJBA 2JFDA 2JLEA 3G4SN 1E4FT 4XEIA 1HJRA 4FM0A 3GSDA 1DJ0A 2AA4A 4YS2A 4QU6A 2YHYA 1TL3B 1LWCA 2E2OA 2DCLA 1TKTB 4KFBB 1R89A 4NYPA 3M30A 1U7LA 1RAJA 4PZVA 4PY5A 2Q31A 4KHMA 1KD1T 3DHWC 3KUGA