5HLFA

Structure of hiv-1 reverse transcriptase in complex with a 38-mer hairpin template-primer dna aptamer and an alpha-carboxyphosphonate inhibitor
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Exploring the role of the alpha-carboxyphosphonate moiety in the HIV-RT activity of alpha-carboxy nucleoside phosphonates.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/inhibitor/dna
total genus 143
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hlfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hlfA05
5KGWA 2YHAA 3UR0A 1QUVA 1ZBHA 4CEAA 1QSSA 3KLGB 4DS5A 3OYAA 4G3IA 4J9MA 4QPXA 3NE6A 1HYZA 1YT3A 1RT7B 5CYQA 4M3WA 3T3FA 2BQUA 3T1AA 4ECTA 4J9OA 4ZVHA 4C8MA 2Y1JA 3QYYA 1QTMA 5KFFA 4CF2A 4CJKA 1TKZB 2QE5A 3CJ2A 2DPJA 3BGRB 2ILYA 1NJYA 4ZPAA 5HRPA 3B6OA 4NLVA 1S1VA 4FLWA 1WSEA 5K14B 4YNQA 3N6LA 3PW5A 4KPYA 4I9LA 4J9KA 4KRFA 5KFPA 3CVKA 1CZ9A 4NLSA 4ED0A 1L3SA 3LP2A 4CEBA 1UA1A 2X74A 4TYAA 1T8EA 3H40A 5KG2A 4AILC 2UVWA 3MFHA 3ZSRA 4DF8A 3RR7A 4CGDA 2V0NA 3HJFA 1SL0A 5DK5A 3HT3A 3K5NA 1R0AB 1RT5B 2A1RA 4DTXA 2G8KA 3HSTB 1BCOA 4OL8A 3Q8RB 1DTTB 3NFAA 4GMJB 2B43A 2IJNA 5DQIA 4DSKA 4KO0B 2VG6B 2OPQB 3PW2A 4F8RA 1ITGA 4XO0A 5KFXA 1S6QB 4EBDA 3OSNA 3ISND 1SH3A 2B6AB 2R8JA 4ZVEA 4DSEA 4W5NA 4HYKA 4WYLA 2AJQA 2WB4A 3LZIA 3LWLA 1JLGB 4DSFA 4FJXA 3T19A 4W5RA 4TY8A 4BE2A 4O4RA 3KJVA 3L3UA 3MR2A 4FJKA 3IRXB 3HVRA 2RF2A 3MEGA 5HP1B 1W25A 1K1QA 3M8RA 4NRUA 3OJUA 2UUWA 1JXEA 4FM0A 5CYQB 1BGXT 2IC3A 1G15A 1U09A 4MKBA 2KZZA 3NL0A 4B08A 4RG8A 4ZP7A 4EBEA 4FJHA 1L3TA 1TK5A 5F8NA 3ICLA 2IOCA 3FQKA 1T3NA 4AH9A 4Q0BA 1S1VB 2W8LA 2DFHA 2Z1GA 2OPPA 4OLBA 1NKBA 5KG7A 4BACA 1JLBA 3VQPA 2OZSA 4FLVA 1I3AA 4AHRA 1OS5A 1S9EB 1TKTA 1S1WB 3BDPA 3HVTB 1LW2A 3H5XA 4U7CA 4DTUA 2VG7A 2B5JB 1S49A 1D9FA 1A5VA 4IOBA 5KGXA 3KHGA 3K58A 3TAEA 1C0MA 1TL1B 4GW6A 3SQ0A 4ED2A 1FKPA 3PV8A 2AGPA 2GC8A 4FW1A 3SJJA 3HXMA 2ASDA 3KOAA 3T5LA 4F4XA 1FXXA 3HP9A 3PO4A 1EKEA 3DRSA 1IKXA 2GV9A 3C94A 2OYQA 3AA2A 1IKVA 1DLOA 3V9XA 1BI4A 4CJ4A 3PX0A 1T05B 3ZSZA 5KFBA 4JV2A 4URQU 1RA6A 2HB5A 3GILA 5EU7A 4TY8B 3KLFB 4KFBA 1GOCA 2C2DA 3KJVB 3NHGA 3GIIA 3OL6A 2X78A 1ZETA 1S1TA 2EC0A 3MEDA 1ZTTA 2XCPA 4IBNA 1HQUA 1VSIA 3L2VA 2ZKUA 3O3GA 4F4ZA 4DLEA 5KT3A 4HUFA 1WAFA 1N4LA 3LANA 1J5OA 4B9VA 3KIOA 2HNZB 2HNDB 1S0NA 4I7FA 4EBCA 1VSFA 3RAQA 5J1EA 1EETB 5C25B 3CFRA 4ED8A 4DS4A 4ZTFA 2E6MA 3QERA 1ZBUA 3ISNC 3EZUA 4HHTA 4IFVA 2ZQBA 3QEWA 2ASJA 1JLBB 3DOLB 2YNHB 2V9WA 4CFAA 1C1BB 2YNGB 1TKTB 4B9MA 3QNNA 4IDKB 4DTOA 4CIFA 3AA4A 3V6KA 2XWYA 4FJJA 3OY9A 3KD5E 4ICLA 4CHPA 3KK1B 5KFOA 2Y1IA 3DRPA 1C2PA 3RAXA 4CEZA 2XI2A 3PR5B 1C0UA 2X6NA 1SV5B 1BQMB 3MECA 4K4ZA 1UWBB 4PUOB 1TP7A 3ZT2A 3AVNA 4LSNA 1UOCA 3HPHA 3OYLA 4TLRA 2OPRA 5EWFA 3UIQA 1VRTB 2JEFA 4CJUA 1RT3B 2C22A 2Q3SA 4ED3A 4DTNA 4DWIA 3KK3B 3SI8A 4OKEA 1IKVB 4DU4A 2JEIA 2F8SA 1MMLA 3DDKA 3SQ1A 1XI1A 4ECRA 3S3MA 5FRNA 1BQNA 3V9SA 1QE1A 4NLGA 2GIRA 1SKSA 1S4FA 2I5JA 4IRCA 4KHUA 4IG3A 1B9DA 4PWDA 4IFYB 2KW4A 2IJFA 2IM1A 3D28A 5C24A 4O4GA 2WK4A 2W8KA 2FBYA 3T5JA 1S1TB 4DG1B 3AVHA 1JLCA 4CGJA 3UPFA 1RBVA 3FRZA 1TVRB 2C28A 4KB1A 1LW0A 1TGOA 3CFOA 4J2AA 4WFZA 4QW8A 5KFTA 4RNOA 4EYIB 2W9AA 4CJWA 2VWJA 1J9AA 4KTZA 4Z0UA 2W9CA 4E3SA 2KQ2A 3DLGA 1FK9B 4FJNA 3AVJA 1S10A 4ID5A 5HBMB 4HVJA 2ETJA 5HRNA 1LWEB 3P5JA 4B9SA 4ICLB 4J2EA 4Y2AA 4O3NA 3DLEB 4KBIA 2D0AA 5KFAA 4Z4HA 3EY1A 4FBTA 4E89A 1C0UB 3QIPA 1T03A 1RT4A 3THVA 4AHVA 3GV8B 4O44A 2XC9A 5KT6A 4N76A 4O5BA 4HTUA 3CIZA 2OPRB 1QS4A 4NLDA 1BCMA 4CIGA 4FW2A 2HHUA 1EP4A 5CYMB 4NLXA 4ZHRB 4WYWA 4KE5A 5KFIA 4E1NA 3LPTA 2YKNA 1Q9XA 4M41A 3C6TB 3U3YA 1T94A 1S1XA 4ECQA 1QE1B 4CGIA 4J9PA 3TVKA 5KFWA 5J2QB 2R8GA 2WRMA 4FJ9A 2FBXA 4ECSA 3AO3A 1JLQB 2ZE2A 3MR6A 2W42A 5C24B 3SQ4A 2V4RA 1SL2A 4RW9A 3MF5A 1D8YA 3KHRA 5F8MA 2HHSA 4PQUB 2CKWA 5L1IA 2BDPA 1QAIA 3MR5A 3TAFA 3PW0A 4IH5A 1SH2A 4E7LA 2BANA 3IS9B 2DTUA 1RDRA 2KTQA 4CJEA 4WE1A 3NH1A 3KLHA 5SZTA 2V4QA 5F8IA 1SKRA 3KLVA 5KG3A 2W9CB 1QQCA 4M94A 4EEYA 4DTPA 4JRQA 4ID1A 4EYHB 1Z25A 2HHVA 4Y1DA 5EDWA 1UAXA 1U04A 2IDOA 4DU1A 3V9WA 4K4UA 4LD0A 3DLKB 3FDSA 4NYZA 3M9MB 3CM5A 1N6QB 1C1CA 1RTDA 3MEEA 1XHXA 2E9RX 1ASWA 1T03B 1S0OA 4JS5A 4I2QA 3BREA 4CGFA 2WONA 4DTMA 3JYTA 3RBDA 1RDDA 4WZQA 4Q43A 3ZT0A 5L9XA 4PY5A 4FJ5A 1S1UA 3ASMA 1TL3A 4J2DA 4B3OB 2P51A 4B9NA 5KG5A 1TKXA 5KFMA 3AA5X 3AVGA 4K4YA 3VQCA 5F9LA 1S1XB 2YNFA 4RUAA 2R8KA 1D1UA 3MXJA 3L8BA 3V81A 2DFEA 1BHLA 1SKWA 3BSNA 3DOKA 1RT6B 5J2MA 1SUQA 2ZE2B 2FJWA 1S5JA 3DYAA 5HLFB 2QV6A 3SFGA 1Q8IA 3V1RA 1REVA 1S9FA 3BQ2A 3TI0A 3C6UA 3LPUA 3KKSA 4CF1A 3I5AA 3P1GA 4FLYA 1HQEA 3ZSVA 3HP6A 3KLIA 1JKHA 2ZD1A 4IR9A 3NAIA 3SFUA 4URGA 4B8AB 2IAJA 1FKOA 1WNSA 3OL9A 4RW8A 3HPGA 3RRHA 3HM9A 4YP3A 4Y3CA 3CG7A 1C1CB 3NDKA 4URSA 3SUPA 4CERA 3ULDA 3QESA 4M3YA 4OKKA 1VRUA 3PR4A 1IKWA 1DTQA 4IG0A 5J2NA 1J53A 2YKMA 3BSAA 3SUOA 5L1LA 3KKRA 2G8IA 4R5PB 2RDIA 5KFQA 3KMQA 1TL3B 4O55A 1S9GA 3KK2A 4CJRA 1TKDA 1TKXB 3UQSA 2AX1A 1RBSA 4CEEA 4F2RA 4QW9A 1KHVA 5F8LA 2FC0A 3DI6A 2OPSB 2VWKA 2XGPA 1KVCA 3C95A 3OYIA 2UVVA 4NCGB 5J2PB 3V9UA 3G86A 5I3UB 3DOKB 3VQQA 1WSJA 3SPYA 4CGGA 1SUQB 2UVRA 4CJPA 2BRLA 1VSLA 1Q9YA 5HROB 2HNYB 1TV6A 3QEVA 4OJRA 3RMAA 1MU2A 4TSXA 5C42B 1KRPA 1XR5A 4F4YA 2HHQA 3TAPA 3QEPA 4GVMA 5KG4A 5F8JA 4FLXA 4FBUA 4E7HA 2RKIB 4IKAA 3O3HA 3M9NB 5KFUA 4J2BA 4Z4FA 2E9TA 1KLNA 2F8EX 3TARA 3IN5A 3AVLA 1NK0A 5KTQA 2ZD1B 3H4BA 1Y97A 4JUZA 2WHOA 1B92A 1B9FA 1RBTA 3VQ6A 4CJLA 4RNFA 4MKAA 3H08A 3M9OB 4KSEB 1GOBA 4CEOA 3KLEA 4E0DA 1RT2A 1NHVA 1BIUA 1C6VA 3SUQA 3OS0A 4KTWA 4M3UA 2IMWP 2GIQA 4KHRA 2W7PA 3ZSWA 4RUCA 1VRUB 3DLRA 3NAEA 4DEZA 4M3RA 4J9RA 1VK0A 1IO2A 5J2NB 2FLLA 2NUBA 2YKMB 2D41A 1BL3A 3OYCA 3L2WA 4DTRA 4RW6A 2XY5A 1ZTWA 3IAYA 2E9ZA 2OA8A 4KV8A 2D0CA 3KK2B 3LP2B 3RR8A 2VA3A 3OYJA 3SI6A 4ED1A 4MK9A 5C5JA 1KLMA 3OYGA 5T7BA 3VA3A 1EX4A 4Q44A 3VQ4A 1VSMA 4O3PA 2RN2A 4YFUA 3NMAA 1X9MA 2IS3A 5KFRA 5L1KA 2XY7A 3T5KA 4YR2A 4EP4A 1NKEA 3PUFA 4O3SA 3RRGA 2FJXA 4BWJA 4ZPDA 4TQSA 3K59A 1JIHA 2P1JA 1K1SA 4QAGA 4F50A 4DF4A 4WXWA 2FVCA 3ZSQA 3KMSA 4ED7A 1L3VA 3H4DA 1JX4A 3PJXA 5I42A 3I0SA 4ED6A 4O0JA 1GOAA 1HJRA 2DY4A 1ZBLA 4Q8EA 2RF2B 3MEGB 3GQCA 4ELUA 1JL1A 4WFYA 3PW4A 4FZXC 4Q45A 2BQRA 2IC3B 5CY4A 4DQSA 2IBKA 3ZT3A 3Q8PB 5KFKA 5KFLA 1C0TA 2JLEA 3V6DA 3I8DA 3QIOA 4YR0A 5JS1A 1NK6A 4IKFA 3D45A 3NGYA 4LQ9A 4Q0BB 1HARA 2OPPB 1GX6A 3DMJA 2WTFA 2KFNA 5CZ2A 4DL5A 3OJSA 1N5YA 2QKBA 4N56A 3P83D 4KV8B 3D5MA 4FZZA 1IG9A 5DQGA 1LW2B 2VG7B 1HNVA 3ZSXA 4R8UA 4J9NA 4CESA 4H54A 1RDBA 4CEDA 3ALYA 4NCBA 3OL8A 2BGGA 1NHUA 3QNOA 1FKPB 3DM2A 3VQEA 3TAMA 2HAIA 2F96A 2FLNA 1RCHA 3O4NA 3GYNA 4TQRA 3K5MA 3AO1A 2RDJA 3DRSB 1IKXB 4DFPA 1CLQA 2O4IA 4CHQA 1DLOB 1ZYQA 1BI4B 3NCIA 4KAZA 1U4BA 4CF8A 2IA6A 3RB6A 4E7IA 4PA1A 4MH8A 3GIMA 4JRPA 5KT2A 1NKCA 1U45A 3NF9A 4KFBB 1RTHA 4CECA 4BE1A 4NLYA 2ATLA 1QSYA 4OPKA 4TYBA 2FJVA 4I2PA 3S3NA 4KB7A 4CFCA 3EPIA 1WNEA 3MEDB 1S0MA 4FM2A 2J6TA 3LP1A 4ECZA 1HQUB 4CIEA 1HYSA 1S6PA 3OSPA 3VQAA 2ALZA 1J5OB 2XCAA 4CFDA 1X9SA 5KFDA 4FYDA 2XRIA 4BDYA 3V4IA 4I7FB 2D7SA 1WN7A 5J1EB 2IM2A 4Z4GA 4EZ6A 3ZSYA 3QEXA 4ZVGA 3TANA 1TK8A 5FRMA 1RT1A 4IFVB 4JLHA 3DMJB 2VG5A 3NH2A 2FBVA 3RWUA 1RTJA 4O3QA 3Q8SB 3IG1A 2JC1A 1N5YB 5DGAA 1J54A 4KI4A 4RU9A 3GV5B 3CQ8A 3DLBA 4NYNA 4Q5VA 4K8ZA 1NNDA 3V6HA 2I1RA 3RBEA 4FJGA 4R8UB 4Y1CA 4CJ5A 4KHYA 4OVLA 3DRPB 4ECWA 4CEFA 3S3OA 3HVWA 2JEJA 2YHBA 1KFSA 1IKYA 4GC7A 1QHTA 1ASVA 3MECB 3K2PA 4ZVFA 4CJFA 1SH0A 4LSNB 1S48A 1SL1A 4TY9A 3RMCA 5D3GA 4J9QA 3K5LA 2KFZA 2W9BA 3OHBA 3QGGA 4FJMA 3SQ2A 1KVBA 1Z26A 4CF9A 3BQ1A 1KSPA 4ZP9A 1NJZA 1BQNB 3PO5A 1NK5A 2I5JB 3O4QA 3M8PA 4IG3B 4PWDB 4MIBA 4KHMA 5DG7A 1RTHB 3MXIA 5L1JA 1CSJA 3AVIA 2JC0A 4HUGA 2W7OA 4RNHA 4F4WA 4O4GB 1VSEA 4CHNA 4I2PB 4MIAA 1JLCB 2BQ3A 2DFFA 1TK0A 1HYSB 1U48A 4FJ7A 1S6PB 5DQHA 5KFVA 5T14A 5KT5A 1LW0B 2C2EA 4LY7A 5FDLA 3E01A 1LWFA 3FFIA 4LH5A 4AHUA 3HYFA 5HRRA 2HVIA 4CFBA 3AVBA 5DLGA 5JS2A 1QAJA 3HO1A 1HPZA 3CDUA 1D9DA 5KT7A 1TAUA 3DLGB 4FJ8A 3AVKA 3MAQA 4HCBA 2FVQA 1NK9A 4B9UA 1GX5A 4WXOA 5EWEA 4FK0A 4ID5B 4DTSA 3QINA 3DRRA 4OLAA 3ZT1A 4MQ3A 3RTVA 3M8QA 3SCXA 2AGQA 1LV5A 2FBTA 1LWCA 4WZMA 4R0EA 4QWDA 3SV4A 4DL7A 4LH4A 3OYMA 3QIPB 4FLUA 1RT4B 4YMEA 3VQ8A 4KHWA 3G6XA 5F8HA 4O44B 2VA2A 4H4MA 1RT7A 1D5AA 3SUNA 4F3TA 5D3GB 2C2RA 5KG0A 1EP4B 3HKWA 3VA0A 3I0RA 4B9LA 4B8CA 4TN2A 2W9BB 4NZ0A 4DSJA 4C8OA 3NGDA 2HWHA 1D0EA 2YKNB 1EXQA 1TKZA 2HHXA 2B4JA 1X1PA 4FK2A 3BGRA 1Z4UA 3V6JA 5DMRA 2R2RA 4YR3A 5KFYA 4RW7A 5K14A 2CJQA 2YV0X 4NCAA 3ZSOA 2UVUA 4RW9B 5KFZA 4N47A 3OYDA 4J9LA 4Z4EA 2PZSA 4NLQA 2R7YA 2J6UA 1HYVA 4NRTA 3Q8QB 2BANB 4DL4A 1YTAA 5EUHA 3OYKA 1XR6A 2AX0A 4NLOA 4WE1B 3MXMA 3FFIB 4CJ3A 3KLHB 2O5DA 4FXDA 1XHZA 2FVRA 3G0ZA 2R2TA 1NOZA 1S97A 4DFJA 4QWCA 3FQLA 4XIUA 2D0BA 1S6QA 2BE2A 3CJ0A 4B9TA 2B6AA 4BDPA 3KHLA 4EP5A 3DRRB 1JLGA 3M8QB 1A5XA 3BSOA 3NGIA 4HCCA 4AHTA 1CZBA 3AVFA 4DL6A 3QLHA 4QWAA 3EPGA 3VN5A 1RTDB 3MEEB 3I5BA 4XPEA 3L2RA 3WNGA 4EO8A 2EHGA 3IRXA 3A2FA 4I2QB 5HP1A 4OGCA 3I5CA 2WONB 1A5WA 3JYTB 3PW7A 2GUIA 4H4MB 4HKQA 4BDZA 3DLHA 4CEQA 3I0RB 3SZ2A 1S1UB 4K50A 1WSIA 4K4TA 3VQ5A 5KT4A 2J6SA 4W5OA 5KFSA 4FVMA 3LP3A 4FS2A 2ATQA 3U6FA 1RDCA 3L3VA 2YNFB 3AO4A 3BR9A 4CHYA 2HW3A 3WNEA 3V81B 4RW7B 2XGQA 3RMBA 5J2MB 4U6PA 3OYBA 3QGIA 4ECVA 1JL2A 4Q8FA 3NGZA 1S9EA 3K57A 1S1WA 4RW4A 1I6JA 3RB3A 3HVTA 3H5YA 3CDWA 3DYAB 2B5JA 3HK2A 2Z1JA 2G8UA 3AVAA 1NK7A 3ITHA 3BSCA 4FJIA 2FVSA 1TL1A 1REVB 4CCHA 2YNIA 5KFHA 3C6UB 4OKJA 4DL3A 1NK4A 1YTUA 3OLBA 2ASLA 4FS1A 3WNHA 4KKOA 4H8KA 2HHTA 3OYHA 4N5SA 3BQ0A 2OZMA 1KHWA 1HQEB 5KFGA 1F21A 1XWLA 3F9KA 1NK8A 3KLIB 1JKHB 3V1OA 2BE2B 4NLTA 1T05A 5KFCA 2IAJB 1FKOB 4E7JA 4RW8B 3QZ8A 3OL7A 3QLHB 3KLFA 3PVXA 2FVPA 2D5RA 5KI6A 1CXUA 3S9HA 1IKWB 1DTQB 1RYRA 4IG0B 2IM0A 4M3ZA 4Z4CA 1W0HA 4DQIA 4BWMA 4DTJA 3E51A 4E1MA 2BRKA 2HNZA 3N6NA 2JGUA 3EZ5A 2HNDA 1S9GB 2D3ZA 1NJWA 1XR7A 3T5HA 1EETA 2BR0A 5C25A 3DI6B 5E41A 3RB0A 1I39A 2PYLA 2XY6A 4RNMA 1RBUA 1WSHA 3DOLA 2YNHA 3CDEA 2EX3A 5DG9A 1VSKA 4DQQA 1C1BA 2YNGA 4FK4A 3NF7A 3V9ZA 4RW4B 4FCYA 2HWIA 3AO2A 3QETA 1TV6B 4IDKA 1JXLA 4ZTJA 3JSMA 2OH2A 4ELTA 3TABA 1MU2B 3KK1A 1W9HA 3ITHB 4DL2A 3OHAA 2YNIB 4NLWA 1SV5A 4M95A 5DGBA 2RPIA 1BQMA 4TXSA 1U49A 3TQ1A 3N6MA 4IRKA 1UWBA 4KKOB 4PUOA 4XPCA 2G8VA 1QSLA 2AGOA 4ZP6A 5SWMA 3PZPA 3KHHA 3NAHA 4K4SA 4HUEA 4DU3A 1VRTA 1RT3A 4O0IA 3KK3A 4ZPCA 3LWMA 3IGVA 3AA3A 3NKYA 4CJVA 4NLUA 4DFMA 3RMDA 2Z1IA 4IFYA 1N48A 3CO9A 3H5SA 4K8XA 3KLEB 2E4LA 1RT2B 3PX4A 3OLAA 4IH6A 4LSLA 4H4OA 3OS2A 2O4GA 3AVMA 3HVAA 4DG1A 3L2QA 4DLGA 3D0PA 3OYNA 4QCLA 2G8HA 3LP0A 4FLZA 1TVRA 3CJ5A 5DG8A 4RW6B 1L3UA 4UQGA 1ZBIA 1JLAA 3LDSA 3KTQA 4M45A 1KLMB 4CK2A 3CJ3A 2LSNA 4KTQA 4M3XA 4NLPA 1TAQA 1T7PA 3TR8A 2UUTA 3MFIA 3PJWA 2IGIA 2ILZA 4RNNA 1FK9A 3K5OA 1L5UA 3TAQA 1JLEA 4ECUA 4ECXA 3VQDA 5HBMA 3JSMB 5KFNA 1LWEA 3SYZA 4DSLA 4CGHA 1IH7A 5KFEA 3DLEA 1LAWA 2G8WA 3MTKA 4CHZA 4FJLA 4J9SA 1XC9A 3IGNA 4AHSA 3V1QA 4DQRA 3G6VA 5I42B 4K4VA 2XI3A 2AU0A 3I0SB 2F8TA 2IM3A 4ECYA 5CYMA 4ZHRA 2R8IA 1X9WA 3MR3A 4FM1A 2QK9A 4OGEA 3CM6A 5KG6A 2E6LA 1HMVA 3C6TA 2R2UA 2JEGA 1CXQA 3QIDA 1ASUA 2XO7A 4FLTA 2R2SA 5J2QA 3QO9A 1C0TB 3V6DB 4Y34A 4CF0A 1JLQA 4ELVA 3LAKA 1RA7A 3L2UA 4LSLB 4H4OB 4CJSA 3QZ7A 1RTIA 3VQ7A 1RBRA 3M8SA 4PQUA 4C8KA 4O3OA 3G6YA 4KI6A 1JLFA 2X6SA 4C8NA 2WOMA 3AV9A 4OPJA 2HMIA 3LP0B 1YVFA 5FROA 2AQ4A 3IS9A 1BIZA 4CHOA 1JLAB 3OVNA 1UA0A 1HNIA 1HNVB 4N41A 3TAGA 4IQXA 1KFDA 3HL8A 4JS4A 4YQWA 3G10A 5JXSA 3BJYA 3H98A 4F3OA 3DM2B 5KG1A 3TAMB 3SPZA 4QOZB 2D3UA 3PHEA 1JLEB 4X2BA 3NF8A 3QGHA 3WNFA 2ITGA 1RNHA 3DLKA 3VQSA 4IRDA 4K4XA 1N6QA 3SNNA 3OYEA 4QWEA 3NH0A 2A1SA 1LAVA 1NOYA 3KNAA 1O1WA 1K6YA 4BE0A 3NBPA 3KD1E 2P5GA 4E19A 3GIKA 5EWGA 5KRTA 4DFKA 4RZRA 4KHQA 3OS1A 4CE9A 4K4WA 1WAJA 1BISA 2XHBA 4F2SA 1RAJA 4MK7A 4LQ3A 3CWJA 3CYMA 4B3OA 4ZMMA 1N56A 1JXBA 2XY8A 3EYZA 1HMVB 3ZCMA 1RILA 3LP1B 4M3TA 2DPIA 5JUMA 4IH7A 4JV1A 2QKKA 3QEIA 3U3GA 4MFBA 1KTQA 2PYJA 3QO9B 1RT6A 1RDAA 3V4IB 2QXFA 3O3FA 2HHWA 5F8GA 1RTIB 1KVAA 3SV3A 2WCXA 4KHNA 1RYSA 2FLPA 3H2LA 4CK3A 4QWBA 4W5QA 5HLFA 1RT1B 1JLFB 3OYFA 3GIJA 2VG5B 2WOMB 1RTJB 2HMIB 1C1AA 4CJQA 1NJXA 3IG1B 4L8RB 3LZJA 4KHSA 3CFPA 3PX6A 4KB0A 3NF6A 3F73A 4KREA 4ZPBA 1HNIB 5KFJA 1U47A 4G1QA 1WLJA 4O3RA 1KCFA 4IR1A 1IKYB 3KLGA 1TQLA 4GC6A 2KZMA 2HVHA 3FSIA 4JV0A 4CK1A 4M42A 1IM4A 3VQBA 4EO6A 4WFXA 4DSIA 5KRSA 3NBPB 1YVUA 1WSGA 4NYFA 4Z4IA 3AVCA 2GBZA 3ZT4A 3HHKA 3GV7B 3M8PB 3LALA 5DLFA 4F4KA 2Z1HA 5HRSA 4R5PA 1VSDA 4I9QA 1WSFA 1ZBFA 3UDLA 4Y2CA 4EZ9A 2G8FA 4W5TA 4DQPA 2OPSA 2AWZA 3H5UA 4MFBB 4NCGA 5J2PA 5I3UA 1R0AA 1RT5A 3B6PA 3LAMA 1HRHA 4NLRA 3HPOA 5FDLB 3E01B 1DTTA 1LWFB 4CJTA 3VQ9A 5HROA 4ZP8A 2HNYA 5CZ1A 4DMNA 2R8HA 4KO0A 2VG6A 4AHCA 2OPQA 4MK8A 3CJ4A 3TWHA 1HPZB 5C42A 4C8LA 2PY5A 1VSHA 5F9NA 4FZYA 3PY8A 4E7KA 3AO5A 2RKIA 4KAIA 2P5OA 3RB4A 3H59A 4G1QB 1LWCB 1VSJA
chains in the Genus database with same CATH superfamily
3LM2A 1IJFB 1QUVA 3M8WA 3IUCA 3AODA 5M1FA 2NXEA 1YT3A 5BRFA 4YDUA 2BQUA 1ROFA 1UFLA 2HRUA 4IEEA 4ZDNA 3D7EO 2QE5A 5D78A 2DPJA 1VIOA 4OIXA 3BF1A 1N32J 5BPNA 4Q7AA 4FLWA 1WSEA 2F40A 4QZVB 4J9KA 2IDLA 3NEKA 4CJ7A 3CJ9A 2X74A 1T8EA 3J81j 1VQPN 1HNXJ 3TJ9A 1XMBA 2J0XA 3T7ZA 2Z4PA 4CGDA 2V0NA 1WDDA 3HJFA 1X4AA 1KBRA 1SL0A 5DK5A 2A1RA 1ZAVA 3QT7A 4DTXA 3FSYA 4A8YA 1ZM4A 2E5GA 1RHUB 3SSSA 4RKUC 2YPYA 4DSKA 4KO0B 4JI8K 3KK7A 1ITGA 9ATCB 5KFXA 3W60A 1S6QB 1WWHA 4FPAA 1H38A 4ZCIA 3CE8A 2B6AB 2R8JA 4ZVEA 1K47A 4NZ6A 1WHYA 4HYKA 4TVAB 1T3OA 2HS4A 3LZIA 1JLGB 2PD1A 1WEYA 1SVDA 4X65K 5A2QU 2A0FB 4DSFA 4FJXA 3T19A 2GO9A 3O5BA 4K5SA 1I3OB 5HVGA 4BE2A 3B8AX 2NS1B 5A8WB 4OYBA 5HP1B 1W25A 1KKHA 1H2VZ 3M8RA 1APSA 1TFWA 2UUWA 3PRDA 3MMVA 4FM0A 5CYQB 2F9DA 4LF4K 1VQMS 1Y9OA 5J1NA 3M6WA 4LJMA 3O08A 4RG8A 3I55S 2FZCB 1L3TA 3L7OA 4LF6F 1BU6O 4CLUA 4BRCA 4WQ4A 1SJFA 1AA1B 1M1KO 1NKBA 5KG7A 2DR5A 1JLBA 2RE2A 3VGMA 1I3AA 4AHRA 1BLUA 2A6OA 3P31A 1URRA 1B7FA 4DPTA 5JVHQ 1I94J 4DTUA 1A5VA 5DS7A 3FR0A 4CLLA 5BRHA 1WKLA 5AJ3K 2BACA 1TL1B 3F56A 1JNZB 2ZH9A 1FKPA 3PV8A 3N4PA 5IV3A 2AGPA 3ZTQA 3UN2A 3HXMA 4YOVA 2VBXA 2ASDA 5KQDA 3SIPB 4LF7K 3AJ1A 2ZKTA 5AXMA 4F0KA 2YHXA 4TU9A 2GV9A 1P27B 4ZLLA 3J7YP 5KFBA 1NMEB 4E2FB 2LQ5A 2P9UB 2B4VA 5GAGI 4TY8B 2D3O1 1X4HA 2W1BA 3R5AA 3NHGA 1XUPO 3OL6A 3EXYA 2X78A 1S1TA 1Z6RA 2Z2ZA 1ZTTA 2JJ4D 4LBIA 1U1QA 3M6VA 3BPSP 3ZFVA 3AQPA 3ENHA 2YBVA 1WTBA 4B9VA 3CCVN 4WFNL 1VIXA 4DV1K 4I7FA 4EBCA 1NXIA 4NLCA 2BW2A 3CHWA 1EETB 3BDEA 5C25B 1Q78A 4AFFA 4OLPA 3W64A 2DNHA 4J5OA 1EX8A 2L9NA 2ZQBA 1FJGK 4MDAA 4GRSA 2KG0A 3D6FB 1AYEA 3HF5A 3ZX0A 4JK9A 1C1BB 2YNGB 3R6MA 1TKTB 3VPZA 2LMIA 2ZVSA 5ETRA 1RUSA 3H45C 3V6KA 2P9IA 3KD5E 1OSDA 4CHPA 3L4BC 4CLTA 5GADI 4B1UB 1C0UA 2D4WA 4CIOA 3TA1A 2HBZB 1NGCA 2YI1A 3C65A 3VGTA 2E2OA 1JMTA 3OYLA 4TLRA 2A18A 2OPRA 3UIQA 3CD0A 2ZM6J 1FI4A 4AL7A 4CJUA 4LF8J 1RT3B 2XNRA 3EM1A 4DWIA 4DV4J 1IKVB 2JEIA 2DIVA 3MOJB 1MMLA 1RTZA 3SQ1A 4ECRA 1U1LA 3S3MA 3ZX2A 1BQNA 1NO8A 2GIRA 1S4FA 2I5JA 4IRCA 4KHUA 4ED4A 3FE1A 4OZ3A 4NMLA 5THWA 3CCMN 3M4XA 3F41A 3D28A 3OBYA 5C24A 4O4GA 2FBYA 3T5JA 4X4TA 4DG1B 1JLCA 2Q79A 1D3WA 2B4OA 1JJ2R 2FD2A 1TVRB 3HFZB 3HT0A 1XNQJ 1SC6A 1TGOA 3IR7B 3ENAA 3BYRA 3ZZYA 5HVHA 3CFOA 1UVLA 5KFTA 2R7WA 1FRKA 5EX5A 1Y3KA 3A4TA 4P75A 2DPNA 4H5VA 3IP0A 4EYIB 3AGKA 4L73A 2JHEA 2WBRA 1FWPA 2VWJA 1T9YA 1M1GA 4HHJA 4Z0UA 1X0PA 3QPIA 2W9CA 5E3RA 1TFYA 2ZF5O 3W0LA 1FK9B 1BDGA 3QICA 1FRHA 4P2SA 4HT7A 3PYEA 2HHHJ 5HBMB 4LFBJ 5I3QA 5HRNA 4JYAJ 1PG5B 4J2EA 3QBCA 1PJ7A 3ET6A 4KBIA 1RWUA 2DCLA 5KFAA 4Z4HA 3EY1A 1IBMJ 2QW9A 3QIPA 3GV8B 1F1BB 1Q82O 4O44A 3E9LA 5KT6A 4IJNA 1QS4A 4NLDA 2DVIA 4CIGA 3OW2M 1Y11A 1IV0A 3NLCA 1UW9A 2M7SA 5A6PA 1HBNB 2G2ZA 3EKSA 1B7YB 1Q9XA 4M41A 2DH8A 3U3YA 2HG4A 1QE1B 1F3VA 5HJYA 3F0NA 2ZJPL 3BPDA 3TVKA 5KFWA 5AXLA 2R8GA 3MCPA 1I94K 2ZE2A 3MR6A 2DEJA 2KT3A 4FDFA 2V4RA 1Y3JA 3H25A 3MF5A 5F8MA 2HHSA 3C15A 3R6GB 2V4JA 3MR5A 3VEXA 1SH2A 4DR2K 1BC6A 1X5PA 1RDRA 4CJEA 4A47A 4WE1A 1WSRA 2YJEA 5B08A 4MT1A 1FCAA 2W24A 1VRQC 2W01A 5F8IA 2QL9B 2PDAA 4OZJA 5IT9O 4DTPA 1VQYA 2LDIA 1Z25A 3TEGA 4PWWA 3CSKA 3MPYA 2Z57B 2E8AA 3IM8A 4ES2A 2HK3A 4DPXA 4DU1A 2FC8A 1ZBSA 4CO4A 2QN6B 4DX6A 1UVMA 1S22A 3QFHA 2N3LA 1NPRA 5CD4A 3W2VA 1XHXA 1T03B 2HPUA 2AJFE 3BBBA 3JYTA 4YHHF 3C6AA 2CGKA 4A8KA 3E66A 2GGPB 1S1UA 2DNOA 1EQ0A 3CC2N 2VDHA 2NSCA 1QLNA 4B9NA 5KG5A 1TKXA 5KFMA 3AA5X 3VQCA 4BROA 4OHWA 1D1UA 3V5RA 3MXJA 3V81A 4P2FA 4BRIA 2VONA 1B4SA 3BSNA 3VF2A 1RT6B 1AXQA 4K8RA 4CTAB 2B51A 3GOIA 3B4DA 3E9OA 1S5JA 3ETMA 2VCPA 4BR7A 2OAUA 3DRYA 3UN3A 3O9UA 3OFFA 3G71N 2XEXA 1S9FA 2KVIA 2UXDK 2MQNA 2BJ9A 3OXFA 3QJJA 4GKJJ 3LPUA 4DV4K 2HBRB 2G9OA 3MXHP 1Y7PA 3SBGA 4EAHD 3P1GA 1HQEA 3M2RB 4ZPVR 1RWMB 3HP6A 2ZD1A 4IR9A 4URGA 5IXUA 4WFNQ 2XMTA 1NGEA 4B8AB 2IAJA 5ELZA 3OL9A 4LSZB 3KWGA 4Y3CA 1C1CB 3WXIA 3NDKA 4PG4A 4CERA 5LM7E 4BR2A 1DTQA 1XNQK 2QMXA 1J5EJ 4NEYA 5J2NA 3EGNA 1J53A 1RABB 2UUAK 2YKMA 3BSAA 5ADXA 2YKQA 3KKFA 3UQSA 3TVYA 2FB0A 2FC0A 4IJAA 2HS0A 1BHNA 3OYIA 1JJHA 2ROPA 1OH6A 2VWBA 3DOKB 2A3JA 4DZDA 2L9WA 4CGGA 1SUQB 2NXNA 4LFBK 2BRLA 3QMQA 4JYAK 3R7SB 5HROB 2HNYB 2FTRA 1Z2ZA 1N32F 4N8NA 3UDEA 4TSXA 3NS7B 4LRFA 4USWA 1SJ1A 2QTWA 2MJNA 4F4YA 3AD9C 2HHQA 4TLQA 3TAPA 3CCEN 2HYIB 3CMAN 5F8JA 2RILA 5MLCV 2YQ0A 4OV6A 4E7HA 1HNXF 3OTDA 1E4FT 4NXMK 1OIAA 5CAAA 1NSKL 6FD1A 3TARA 2X1AA 3IAM9 1T9VA 4AL6A 3DXMA 3OA9A 1NCLA 3R5JB 4USUA 4RNFA 5C7PA 3BF3A 4MKAA 1N5TA 1PBUA 4AXIA 4CEOA 4F0HA 1AFIA 3A0IX 3SUQA 4KTWA 2GIQA 5CZXA 4UTGA 4RUCA 1VRUB 3A8EA 4X4SA 3THYB 3VAKA 3MZIA 1IO2A 1NGHA 2FLLA 1D09B 2AZ1A 3UD4P 3R8EA 4WTYA 1DFDA 5ETSA 1KWMA 4LF5J 4NMXA 2OA8A 2D0CA 4IUFA 1UEVA 1FKAF 2KKHA 4ED1A 1FWLA 4K2XA 4MK9A 1RDUA 4Y0FA 1FXRA 1NZ8A 4I68A 3VAJA 4HR2A 4JI5J 4B1XB 3CTRA 3FEXB 4YFUA 1X9MA 3OHRA 1UPPA 5KFRA 1J6ZA 4X4VA 1NKEA 1JQGA 1IBKJ 2FJXA 2P1JA 4DCOB 1GXUA 4QAGA 1KQFB 1Z05A 1NJIO 1FD8A 3ZSQA 1L3VA 3H4DA 1RCOB 4Y2KA 2VH7A 3FMBA 2Z2LA 1G99A 1R59O 2GEMA 1CS4B 1KD1T 4FVCA 3T69A 3D6RA 1M5PC 2J76E 4JI7J 1OPZA 4Q45A 1OO0B 2HMPA 5CY4A 4DQSA 2IBKA 3ZT3A 2A6AA 3GB0A 5KFKA 1WKKA 4DCPB 3I8DA 4YDUC 3QIOA 5A0YA 5C15A 2QX0A 3NGYA 4PXEA 4Q0BB 2G13A 4DPWA 1HARA 3DMJA 5CZ2A 3MX2A 3TO8A 1N5YA 2E1CA 2QKBA 3P83D 4S0MA 4GKJK 2O3DA 3W66A 1U8WA 3CJ7A 1LFPA 2DNZA 5DQGA 1WB9A 1NEEA 5AXNA 1LW2B 1VQ9N 1MWZA 3ZSXA 3CCUS 3LDLA 3DKDA 3MK6A 4H54A 4RR5A 2LU1A 2Y8WA 5AQVA 3ALYA 4CW7B 2BGGA 3Q22A 2IVNA 4P2MA 3O4NA 2RT3A 2RDJA 1PSDA 1EQYA 3W8PA 1VQNN 1RWVB 1UKUA 2CG8A 2EEYA 4IDHA 3K9JA 2BJ7A 1BI4B 3M30A 4MH8A 3VGUA 1N0VC 3I96A 2KRBA 2C2MB 1U45A 1YJ7A 3RUBL 3NF9A 3OTOJ 3MEKA 3VWSA 4K7QA 4BE1A 2LDYA 1VLYA 5GAHP 2CGJA 1KXPA 4GNIA 1FT8A 4I2PA 3S3NA 4A8SA 5D77A 1UVNA 3EPIA 5BR9A 3IC1A 7FDRA 3LP1A 3VQAA 3AA8A 3FK4A 2G4BA 2DR9A 4FYDA 3A3PB 1NDLA 3H0PA 3QJPA 1Y4ZB 1DURA 4C98A 4DV5J 2LXIA 4EZ6A 3ZSYA 3TANA 1TK8A 1R7IA 5E3AA 3CPWM 1WOOA 1RBLA 1C0FA 2FBVA 1RTJA 4WQ4C 3IG1A 2JC1A 3W5ZA 1J54A 1WEZA 3Q89A 1UWAA 4BC2A 4C0BA 4DJBA 4KI4A 1NM2A 3DLBA 2CNOB 3V6HA 4FWOA 1KAZA 3SJHA 4R8UB 1VQPS 3NGUA 1WBDA 3DRPB 3X3UA 3WUHA 4CEFA 2A5XA 4DV7K 2WW4A 3W5XA 1XMQF 1SJ4P 3N4WA 1F0XA 4ZVFA 2U1AA 1N34F 1SH0A 1S48A 4OYPA 3PSFA 4ZLNA 3EE8A 1HD0A 4FF2A 5T7LA 4FJMA 3IA0A 5LXRA 2P9KA 1WD6A 1FXDA 4LF5K 1Q81T 2Q0RA 2O66A 1UAWA 2EFPA 4IG3B 4MIBA 2VJUA 2JC0A 1FE0A 2J8SA 3PACA 1C4CA 1IBMF 4NYOA 4CHNA 1GMUA 5B0FA 4RWTA 2M9KA 1JK9B 3VENA 3PIOQ 1RGVA 4DV0F 3EZWA 5DQHA 2JFKA 3VAMA 2C2EA 3IDHA 1IBKK 3E01A 3G82A 1VBXA 2CJBA 3QAUA 3HYFA 2BVZA 2NR0A 2XQCA 2OFHX 3CXCM 2QWLA 3HO1A 2CQBA 1TAUA 3MAQA 3AVKA 4B9UA 4FK0A 4ID5B 4OV1A 3E9PA 1FRIA 1JXVA 2L41A 1LV5A 4JN4A 3PIPL 2LQ8A 4R0EA 4DL7A 1QQMA 4GV3A 1ZS6A 4JI7K 4FLUA 1RT4B 4YMEA 3VQ8A 3D6TB 1H3DA 4H4MA 4QOTA 1A7GE 3SUNA 4YOTA 2AV5A 4KQZA 2MKKA 3H3NO 4B8CA 2W9BB 3NGDA 1D0EA 3R97A 1A0OB 1X1PA 4FK2A 1Z4UA 1HNZF 4DV6F 1TL4A 5H1SV 1YIJN 4BG8A 4PPZA 1R27B 3CC4S 3EDQB 1FERA 1H2UX 2HBKA 2CJQA 3WBZA 4GVBB 1OVYA 5G0RB 1HWUA 1KS2A 4FXWA 1LWXA 4RW9B 2WAQD 1ZA2B 4R79A 4DUZJ 3R9LA 1IR1A 5E33A 2DYAA 4FWRA 1GMWA 3IRWP 2OO4A 1UZHA 3KUEA 4X66K 2BANB 3OYKA 3W5YA 4CJ3A 2QWMA 4B1YB 4HI1A 1NOZA 4ILHA 5LMUF 3A8KA 4QWCA 3FQLA 2DNYA 2VFSA 4DCJB 1WG5A 1X4DA 2PA3A 2DNKA 3MMJA 3CJ0A 1XIQA 3WC0A 3KHLA 4OX8A 3BSOA 3MN7A 3NGIA 4HCCA 2ZH6A 1CZBA 2EFVA 2NRTA 4IOXA 5D4NA 3TNVA 3G8TA 4XPEA 1UVKA 3L2RA 4AT1B 4EO8A 2QXLA 3SCJE 2FJBB 2MZJA 2ACYA 2MQPA 4OGCA 3POTA 1SKUB 4WQ5A 1LCUA 3PW7A 3EDRB 5FLXY 4BDZA 3BBCA 1QAXA 2OANA 4DV5K 1T11A 3W2WA 2ZHAA 3VQ5A 3HSGA 3CJRA 2BE7D 4FS2A 4CQ1A 1RDCA 3KVGA 3L3VA 3AO4A 4MO4A 3BR9A 2P9LB 4USVA 1FDDA 3EGWB 1LQ9A 4GKKF 4U6PA 3BKFA 3QGIA 3CDAA 2ZH3A 1XK8A 4U95A 1S1WA 1FEEA 3RB3A 3MMCA 1TUVA 3CDWA 3MN5A 3F5TA 1HW9A 2B5JA 1J5EF 3HK2A 4X4NA 2G8UA 4CM2A 2G0JA 1VQ6N 2ROGA 2Y9HA 3CMEN 1REVB 4CCHA 1WF1A 5KFHA 4M5GA 1N33J 4DL3A 4FS1A 2Y8YA 1VHFA 4KKOA 2BJ8A 4NA3A 2XYPB 2KYXA 3SCLE 3MWPA 2KYZA 5JVGL 3M5RA 1NK8A 3DJCA 1XWLA 1JKHB 3V1OA 3W65A 4FNHA 1T05A 2N7YA 1FKOB 2M8DB 3KLFA 3CJTA 2W40A 3FBCA 3PVXA 3JQMA 2D5RA 3T41A 4JV5J 3S9HA 1RYRA 2IM0A 4M3ZA 3TR5A 4CO5A 5ETKA 1NB2A 4MYUA 3HHLA 2HNDA 3JSRA 1YITN 5IT9U 2FHJD 3T5HA 3OFHA 3DI6B 3RU0A 3BGFA 3FUYA 2VPZB 1HUXA 3GJQB 3TEHB 3CCJS 4B3SJ 2VHGA 3TU5A 5EGYA 3DOLA 2YNHA 3CDEA 2EX3A 5DG9A 3NF7A 5T41A 4KHPF 4RW4B 2QM1A 4FCYA 2HWIA 4XTTA 3WHIA 4ZTJA 2V6AA 4C6AA 2CJKA 2C2KB 2XZWA 1MU2B 2QA4S 1W9HA 2GIFA 4R0JA 4F3QA 2UV8A 3CDBA 4R25A 1H1VA 3UCZP 4PQAA 3RYLA 4NLWA 4JI3J 5DGBA 1NU0A 5H9EK 3R5GA 2XWXA 3N6MA 3D2WA 4IRKA 1QSLA 2M3DA 2JOQA 2OTJS 2RRNA 4BGBA 3PZPA 2DGTA 3KHHA 4I6YA 1N36J 4HUEA 4RCHA 1R8BA 3I87A 4ZPCA 1RWNB 2M8HA 3AA3A 3GP9A 3MR7A 3NKYA 4OPAA 4CJVA 3PYDA 2Z1IA 5AQHA 3VEWA 4IFYA 2VKZG 4DR1F 3CO9A 5AQIA 2IYIA 3TA0A 3UWTA 2E4LA 5D15A 2F8MA 4PKDB 1FFGB 4KH1B 5ETVA 4NXNF 4M5HA 3H1VX 3MCAB 4QCLA 2HFSA 1LEOA 4QYZJ 3KZBA 4EK2A 4IO8A 2G8HA 2FYXA 3BM7A 3CJ5A 5DG8A 3T1YK 2BZ2A 1L3UA 3HSJA 2OMOA 5DM6Q 4ANDA 3O44A 1WG4A 2NPIA 2NNWA 3PIPQ 3OVSA 1KLMB 1UETA 3A8JA 3UKUA 2DJWA 4M3XA 2C2ZB 1T7PA 3R5CA 3CNQP 3TR8A 2UUTA 1MROB 4GVEA 3ZZ0A 2ILZA 2DGUA 3VHQA 1YJWN 1FJEB 1FE4A 1LWEA 3QJLA 4DSLA 1UZDA 3DLEA 3Q23A 3BEGB 4HDHA 3A12A 3IGNA 1VQLN 1UEUA 3CEDA 3G6VA 5I42B 2VQEK 2B0GA 3QWUA 2RHQB 2KVQE 4P71A 3I0SB 3MPVA 2CH5A 4A8MP 3J80Y 1W7AA 2D74B 2L08A 4FM1A 1NAQA 3ID8A 4CNYA 1RWOB 3ZZRA 4J8FA 4OLOA 3US5A 4BR0A 3FGUA 3ULEA 5KPRA 4FLTA 3ZZPA 2FY1A 3UW1A 2VQFJ 3V6DB 1WC3A 4Y34A 5KPZA 2R3VA 5HI7A 1WSVA 1VS3A 2F4VJ 3ZXWA 1HBMB 2CWKA 3QZ7A 1RTIA 3BV8A 2R7VA 4C8KA 3WEEA 2I8EA 3AV9A 4LFCF 2F1FA 4JI4K 3LP0B 1SC1B 3OTOF 3DXKA 2GHVC 2AQ4A 3RJMB 4JI0K 4CHOA 1U6FA 4OYIA 4WU3A 3OW2R 1K8KB 4DV3J 5ETTA 4IQXA 4JS4A 3TTDA 2BYCA 3R7NB 3L7PA 2GMHA 4ZVUB 3H98A 3ADAC 1TUUA 2P9NA 2HF3A 2NRVA 2VC1A 2BUPA 3PHEA 4X2BA 1XC3A 2KT5A 4JV5K 3DLKA 4Y65A 5TKYA 2EG2A 2XSJA 3J7ZT 3QAEA 3OYEA 3NH0A 2A1SA 3M05A 3CCES 2P5GA 4LC9B 1FRLA 3CMAS 3CJ8A 1CULB 1RB0A 5KRTA 2RQMA 1RAJA 4MK7A 4LQ3A 2WSFC 3D1OA 4ZMMA 1YVNA 2XY8A 1KDNA 2YXLA 3FEYB 4B3SK 4I69A 2DPIA 1ULRA 2NCKL 2XSFA 1GLEG 4JV1A 1VJQA 4P74A 4MFBA 3BBFA 3QO9B 3NWRA 1H74A 4OX6A 5F8GA 1HFEL 1RHMB 5JVGQ 4U8VA 1YJRA 4KHNA 1RYSA 4ANEA 4RPFA 3H2LA 4QWBA 4ZOSA 5HLFA 1OQ3A 2ZBRA 4CJQA 1FDNA 1EQMA 5AQLA 3LZJA 1R43A 5SUHA 3PX6A 3CFPA 3QBWA 3UB5A 4C97A 3L0QA 3NF6A 2EK1A 1N36K 4KREA 2WC9A 1UCNA 2QWNA 4ZPBA 1HNIB 2AJ4A 3C16B 4OI1A 2CQGA 1Q16B 2YWGA 4G1QA 1U47A 1U2VA 4NZ7A 2V51B 1U25A 1U1MA 5IS2A 2QWOA 1RE1B 2G1HA 1Q86O 2PN6A 1KTVA 2Q66A 2J7UA 1NH8A 3TQEA 2M0GB 1IM4A 4QYZK 5AQMA 2CPJA 2PMWA 5KRSA 4L75A 2KKZA 2KH9A 4CBXA 3VTIA 3AVCA 3DNCA 4FO0A 5DLFA 4F4KA 3VCDA 2IFXA 3A5LC 4R5PA 4JKBA 2UXCJ 1ZBFA 1N5SA 3UDLA 4Y2CA 4EZ9A 1MWKA 2CG4A 2G8FA 5HL7Q 5JLHA 2OPSA 2V69A 2AWZA 2KDOA 3VF0B 5U47A 5L38A 1O5JA 3LA0A 2J9EA 1F9FA 4NCGA 5I9EB 1SQEA 2D69A 1HRHA 4NLRA 1NGIA 3R3LA 2NRRA 2Y1LB 3D0IE 4KO0A 3DN9A 4AHCA 4MK8A 4A8WA 2PIIA 3GG4A 2RUSA 4C8LA 2FPHX 4EFHA 3RSEA 3FSXA 4ZITA 2EC2A 1YKWA 3FRYA 5F9NA 2P5OA 3H59A 1VSJA 4A8OA 5KGWA 2YHAA 1QSSA 2QA2A 3KLGB 3EVOA 4ZVTB 5A2QY 2AYMA 5A8WA 1FJGF 3OYAA 4USJC 6FDRA 3P5BP 1XMOF 5AQRA 1RT7B 4O8UA 5CYQA 4QPTA 2F4VK 2K7KA 1NU4A 2QFJA 2BKNA 4AM7A 1TKZB 4PYDA 3CJ2A 1Q5YA 3O9TA 1FTRA 1SC4B 2ILYA 5RUBA 4H0OA 1K73O 3B6OA 5L39A 2CQ0A 3W7BA 4M63A 4LT6A 5K14B 3N6LA 1T6CA 1V4TA 4I9LA 5A8KA 1CZ9A 4NLSA 4DV3K 1GMVA 4ED0A 3F2KA 3JTOA 4WBFA 3H40A 1SC3B 3TJ8A 1E6YB 3ZSRA 4DF8A 4JD2B 1E6VA 2AJ1A 3T6JA 2BABA 2LEPA 4ZLPA 2B8PA 4LR8A 2G8KA 3HSTB 1BCOA 3PEJA 3Q8RB 2MQQA 1SQKA 2BH1A 1S57A 4LIWA 5DQIA 1LOUA 4U67L 2VG6B 3EMTA 5L9NA 1M5SA 2H1YA 1IQZA 2PC6A 2VFUA 3OSNA 2DITA 4DPYA 2GAHC 2DGSA 3AB4B 4DSEA 1RAOA 1GAOA 4W5NA 4WYLA 3WIUA 5JMNA 2FHJA 2C3OA 2WB4A 5MAOA 2CA9A 4CBWA 3FVYA 4Z7CA 3UCUP 4TY8A 5E2QA 3IRXB 1HI8A 3ZNJ1 5GAEP 1N33F 1ZM3A 1JXEA 3ZO7A 4OYZA 2YTCA 1BGXT 1SQFA 1G15A 2HQ3A 1W97L 1NNEA 3ZETA 4CZIA 4B3TK 1TK5A 4FPRA 3D0GE 3FQKA 1T3NA 4CH0S 2DFHA 2P9PB 3JSBA 4EU0A 4OLBA 4NA2A 3THXA 1YJ9N 4BGAA 4BACA 1LFWA 3Q7BA 2H5EA 1S9EB 1TKTA 1HKAA 3M1VA 3HVTB 2I7PA 3IMXA 4U7CA 2VG7A 2K8GA 1D9FA 1QZ6A 2HURA 3GFYA 4IOBA 4OI4A 3P8BB 1RAFB 3K58A 2H65B 4WK1A 4GW6A 1WF0A 2IRUA 2RU9A 4FW1A 3VETA 3SJJA 3KOAA 3T5LA 2V2QA 2VB6A 3EVWA 2MKJA 2OFGX 2OYQA 1IKVA 4CJ4A 3ZSZA 4A2BA 4LVOP 4URQU 4DR2F 2Q31A 2IA0A 4FOEA 3EL2A 3PKMA 2DNRA 5EU7A 3I32A 3UVJA 3MM5A 1GOCA 2NXJA 3KJVB 2F9TA 2GVDA 1YF5L 3MUTP 4JI3F 1ZETA 2UUBJ 3LDOA 3P6YC 2B56A 4IBNA 1K9MT 1HQUA 1VSIA 4DR5K 1IN0A 4F4ZA 4DLEA 5KT3A 4WQ5C 3Q2TC 2HNZB 2P9SA 1VSFA 5CH7B 4ZVOB 3RAQA 5J1EA 4H0TB 2PMZD 3FCHA 2X1GA 4BC3A 2PFUA 3ISNC 3EZUA 1YIJS 1WUAA 4HHTA 3QEWA 1EARA 2ASJA 3NGSA 5M1OA 2RJZA 2V9WA 1RWPB 2BXJA 1Q7LB 4IDKB 1WF2A 1S72S 4DTOA 3AA4A 4YOUA 2P9EA 3LOUA 5JLFA 3KK1B 2BKPA 2DGQA 2PI5A 3J7AN 2XI2A 3MAAB 5D0EA 1SV5B 3MM9B 2Q6BA 2YX7A 1BQMB 3MECA 1UWBB 4PUOB 3FLCO 3AVNA 4LSNA 3HPHA 1WEXA 1VRTB 1UMJA 2Q3SA 4HACB 4Z2XA 4DL0C 3KK3B 2DISA 4DMZA 3CPWR 2F8SA 3D54A 1DT9A 1HKGA 1XI1A 1QE1A 4RWWA 4NLGA 3LPEA 1SKSA 1CJVA 4P9SA 3OTCA 1B9DA 4U8YA 2R4FA 2KW4A 2YVSA 4DPOA 2LQJA 1KVKA 5HMWA 5D4LA 3AVHA 2E5JA 5ETNA 4DR4J 1K0VA 1NGAA 4MDBA 3AJ2A 2XBPA 1RBVA 2VF3A 2V5HG 1WOPA 1FJCA 2MMYA 1LW0A 2NUHA 4TU7A 2GNKA 4QW8A 2CPYA 4ALZA 3R2CJ 3HHLC 2YH1A 1GQEA 5IOLA 3AAWB 1VJWA 3VZHA 2DH9A 1U26A 3FMWA 4E3SA 2VQFF 2KQ2A 4WFBL 3DLGA 2YX1A 1GT8A 3OUYA 2P6SA 3O6QA 3O1BA 2ETJA 3CPEA 3P5JA 4AL5A 4F9OA 3MMAA 4O3NA 2DCUB 4DX5A 4QQBA 4BS2A 3KJNB 4FBTA 1T03A 1S77D 3NS5A 1VMBA 4AHVA 3H8YA 3CIZA 4HTUA 3NGTA 2BUNA 1BCMA 4UZBA 2AIRB 4DU7A 2HHUA 2VGNA 1EP4A 5CYMB 2GGPA 4ZHRB 4NLXA 4KE5A 3I55N 2YKNA 3OPKA 3CXCR 4D3HA 3C6TB 2OMLA 3OV7A 4RJVA 1UFWA 1RLCL 1RAEB 3GTYX 3QRQA 4J9PA 3G8QA 3CT9A 2MQMA 5J2QB 4ZVSB 3TUZC 4ECSA 3AO3A 1JLQB 4OJHA 3SQ4A 1SL2A 2OHDA 3KHRA 1LKZA 1XERA 5L1IA 3WX4A 1VDHA 1R8CA 2MLYA 1QHAA 3R8YA 1IJJA 2PA8D 3N5FA 4P10A 3IS9B 2VIHA 2KTQA 3EKUA 4IO9L 4ZN3A 2WVDA 3CCSS 3KLVA 5KG3A 1QQCA 4EEYA 1FTCA 4ID1A 4Y1DA 4W98A 5EDWA 4WJBA 3GSDA 4JKFA 2R7TA 3UNGC 2DNGA 4NYZA 1T9WA 2UUBK 3OR2B 1N6QB 1C1CA 1RTDA 3MEEA 2E9RX 4ZJQA 4JS5A 2W41A 4CGFA 4DTMA 4DR3F 4CI6A 3E3XA 2ROEA 4Q43A 2RQKA 4CP5A 3THWA 4FJ5A 4HTJA 1RU2A 2Q3PA 4B3OB 1ZC6A 4BREA 1T95A 1YK9A 2XULA 3VEYA 4K4YA 2BTFA 2LXUA 2R8KA 4QBUA 1WOQA 1CZAN 5AQJA 3DOKA 3DDIA 1SUQA 2Q6CA 1FF2A 4CYUA 3JS9A 1UP1A 3DGVA 2YKOA 2FJWA 4FPIA 2EK6A 4N7TA 2C3PA 2RAQA 3RRKA 2LA6A 3DYAA 1M1HA 2QV6A 1Q8IA 3ZYYX 2XMJA 4IOCQ 1HNWF 4LRAA 4B9QA 2LYVA 4HH0A 2B7CB 3TI0A 2UUCJ 1YJUA 2E7WA 1U1NA 3I33A 5TKWA 4Y6IA 3ZZZA 4B3RJ 2MKHA 1GH8A 1M5KC 3IBFB 5ADZA 3KKSA 4CF1A 2E44A 3IR5B 3L09A 4G1PA 4FLYA 4ZS6A 3VZIA 2B3TB 1YJWS 3GBTA 3OBWA 3HPGA 1KQGB 2PO4A 3AGRA 1QTNB 2OI2A 5GMDA 4DOZA 2PFDA 3QT8A 3QESA 3JXUA 2RIJA 3CERA 1VRUA 1IKWA 3THYA 4AXJA 5G4DA 3QDKA 4LFAJ 5LL6d 3KKRA 2RDIA 5KFQA 2V34A 2QEXN 4I6MA 5KOWA 4O55A 3J81U 4H0PA 4F2RA 4QW9A 1QVFM 5HMXA 2BW7A 1FNXH 2VWKA 2XGPA 3O5TB 5BYSA 1KVCA 1VHXA 3D2FA 3C95A 3D66A 2UVVA 3V9UA 2LQ9A 4FWQA 3UNYA 1TV6A 4OJRA 1BQXA 5C42B 2ZH7A 2ZHOA 1D9AA 1XR5A 1KRPA 1ZH5A 4X64K 2B9EA 4ZVRB 5C0YA 2KHOA 4NI2A 3E2EA 2CQHA 4GVMA 2C1EB 1RU1A 2RKIB 3O3HA 4BG9A 4Z4FA 2GHWA 2E9TA 1TTHB 5AE1A 3IN5A 3AVLA 5KTQA 2ASMA 4LF6J 1Y97A 1BO5O 4CO0A 1B92A 3VQ6A 4ZJLA 4CJLA 1VC0A 2MGZA 2R7SA 5ETLA 3H08A 4KGMA 2KO1A 4LUBA 1SZ2A 2Y1RI 4UY8T 3KLEA 1BIUA 1C6VA 2MZTA 5LT5A 4M3UA 4KHRA 1CC7A 3A8IA 4DV7F 1VK0A 4WFBQ 1ZAXA 2NUBA 3OYCA 4RW6A 2XY5A 4LRCA 7FD1A 3RR8A 2VA3A 3OYJA 2UU9F 5KQ8A 3OYGA 2F8HA 3VA3A 1EX4A 3EE3A 1S5ZA 2NYHA 3JQKA 4Q44A 2ZZNA 4P6QA 4O3PA 2IS3A 2FZGB 2XY7A 5AQXA 3T5KA 4EP4A 5AE2A 3ZLJA 3PUFA 4UZCA 4TQSA 1JIHA 1LNQA 2MZSA 1K1SA 3PKYA 2BMBA 5IC4B 3L6QA 4CZMA 2FVCA 3M6XA 2E66A 3KMSA 1JX4A 4B1WB 5DETA 3THTA 1KP6A 3DC2A 2E29A 5C2CA 3ZNUA 2KG1A 1S7HA 1HJRA 3CJCA 2IVFB 3DWLA 1ZBLA 4Q8EA 2IIRA 1DBDA 3Q8VA 8ATCB 3QT5A 3KNGA 3PW4A 4FZXC 5BR8J 3P39A 1A6LA 4JI6K 5KFLA 2A2CA 5AZJB 1C0TA 4F4AA 2MHNA 3FZHA 2GO8A 4ES3A 4I1TA 3D45A 5AFUH 4LQ9A 4MJKA 3C14A 1DJ0A 1XNRJ 1U1KA 3PDNA 2R42A 1BWFO 4N56A 4WKRA 4M63C 1IG9A 3JB9k 2QIFA 3UE2A 1HNVA 1R8AA 4R8UA 4J9NA 1F6TA 2HIQA 4CEDA 4NCBA 3OL8A 3QFUA 4U7BA 2W2QP 1M0SA 3O1WA 1H98A 1FKPB 3VQEA 3TAMA 1SPBP 2V67A 3I9ZA 3GYNA 2O8EA 4PG5A 4TQRA 3K5MA 1ESVA 3AO1A 1DHMA 5IM0A 2ZNZA 3QMLA 2OELA 4LRDA 4YB7A 4O0NA 3MWBA 3HMJG 4NYPA 3GCWP 1FVSA 4PA1A 2FC9A 1EKRA 1KONA 2V9KA 4BRPA 4JRPA 2LVWA 5B0DA 3ENVA 1YRTA 1IWAA 1CJTA 2W2NP 1QSYA 4OPKA 3LUYA 1R3NA 1V3ZA 4UY8O 4KB7A 5GAHU 1WNEA 3WZ0A 1S0MA 1T0TV 4FM2A 4Y2IA 4ECZA 4C0HA 4CIEA 3CJKA 2ALZA 4ZCLA 2XCAA 1SIZA 4CFDA 1OY8A 1X9SA 4BDYA 4I7FB 2DRDA 1WN7A 3HI0A 4Z4GA 1F60B 2LEAA 4RUBA 4ZVGA 4CO1A 3IAS9 5FRMA 1N5VA 4JLHA 4AE5A 3NH2A 5M2PA 3Q8SB 4CH1A 2A1BA 2UXBJ 4USMA 1J27A 2GVZA 4NYNA 4K8ZA 3VAFA 1NNDA 2GZOA 4F25A 5LJVA 2P9IB 4Y1CA 4UY85 1SCJB 5E7OB 4DR4F 4IEIA 4LF6K 1OY6A 2QLJB 1X4GA 1ATSA 1P90A 3Q83A 5AXKA 3AAQA 1DGKN 1Q8KA 1EJ7L 4LREA 3HOTA 4BRAA 3PG9A 1G3OA 2JWLA 1U1PA 4K59A 2NSBA 3ID6A 2AP6A 3VV2B 4DB3A 1WELA 1YRXA 3K5LA 2W9BA 2AW0A 2WVCA 2KU7A 3QGGA 4CLFA 1Z26A 3QFWA 1FNOA 1NJZA 1BQNB 3PO5A 2WFBA 3CQXA 1NK5A 2I5JB 3O4QA 3M8PA 4KHMA 5DG7A 3VQTA 3AVIA 1CSJA 5E3CA 4CZGA 2XHWA 4HUGA 2W7OA 4RNHA 4F4WA 4O4GB 1K8AO 4QIGA 2UZAA 2HGMA 4YY3F 3VTHA 3G6ES 2F9WA 1JLCB 2BQ3A 2QLFB 2HBJA 3SAFA 1YJNS 1PC5A 2F7VA 1EKSA 3MDQA 1TMMA 5FLXO 1HYSB 3TRGA 5KFVA 5T14A 3GLJA 2BOPA 5E26A 3G87A 4WFAQ 2CQCA 3TZWA 1LWFA 4F04B 4LH5A 1GEHA 2YCHA 2HVIA 1RWWB 2ZC3A 3T1HF 2ZBCA 1QAJA 3CDUA 3IWLA 3TWZA 4FJ8A 2H3GX 4X84A 2O8BA 4DTSA 3JTNA 4YHHJ 3FNNA 4OLAA 1V5IB 2V8PA 2VGMA 5HN0A 1VQKN 3DLLQ 3ET6B 4FP9A 2FBTA 1LWCA 4WZMA 1EIYB 4QWDA 4ZLJA 2GFFA 3OYMA 3QIPB 4OZ1A 1YHQN 1WDTA 3H3OB 3EXCX 4O44B 5C2FA 3MAHA 4F36A 3HKWA 2MLZA 4NA1A 1N8RT 1X3NA 4BRMA 3EJMA 1EXQA 2KXHA 2B4JA 3BGRA 2YWKA 5BXIA 1OWXA 5KFYA 2H3EB 4JI2F 1ZBTA 1GLAG 2XZDB 2CADA 2YV0X 2HQFA 2GV1A 2J0QD 1VYAA 5KFZA 4N47A 3BP8A 4J9LA 3CCUN 1IM6A 2V4JB 4NLQA 2FDNA 5F0WA 4NRTA 2CVIA 1IWGA 2JSXA 3L95X 2MHEA 1F2HA 1YTAA 3FBBA 2AX0A 4WP9A 4WE1B 1U0HA 3I9V9 1VOMA 4U96A 4FXDA 2FVRA 2R2TA 4FF1A 4DFJA 1B70B 4BY9C 4UOFA 3MD3A 4BDPA 4Y0WA 4EP5A 3T1YF 2BOAA 3DRRB 3TP2A 3M8QB 4K25A 2FJDB 1W2IA 4HH1A 3K0JA 5LJWA 5K8PA 2EXUA 3VN5A 4BRNA 2VUGA 3I5BA 3W2VB 2E1AA 2P6TA 2EHGA 2UUCF 1WUUA 1MWMA 4B3MF 3ZEUA 2KL8A 3I5CA 3VGKA 3JYTB 3CCRN 1HIYA 2KJVA 4DZ6A 4B3RF 2WSEC 4HKQA 3GFXA 2O8FA 1ZOTA 3I0RB 1S1UB 1WSIA 2BV3A 3LTOA 4PL8A 5KT4A 2VV5A 3AOAA 3O8MA 5KFSA 1LK7A 3U6FA 3LGHA 5DM7L 2AYBA 1RZMA 2HW3A 3V81B 5IT9Y 4USTA 2VQEF 1JL2A 3R9PA 1HBOA 2MZ1A 3K57A 1UJ6A 4RW4A 1I6JA 2ZITA 3OTBA 3H5YA 3PTWA 4WCEQ 1VAZA 2P5VA 2ZDOA 3LGNA 3GZ7A 1M5HA 4FN5A 3AVAA 2I6WA 2CDQA 1BA0A 4LFAF 3ILOA 4FJIA 4BR5A 1H0HB 2E5HA 2FVSA 5AQPA 3OBIA 1TELA 2RS2A 2JDJA 2V2KA 1YTUA 2OUGA 5IC6B 1SBRA 1FFSB 3OYHA 2EWSA 2OZMA 3U1LA 3VGSA 2ZJQQ 3BKTA 1HQEB 5KFGA 1F21A 3F9KA 5LMNJ 1REGX 4M7YA 2BE2B 2IJRA 4ILMA 2E5IA 2IAJB 2HKEA 4IOAQ 1PYTA 1VI7A 3OL7A 2EFOA 2K1RA 1PAEX 2Q0UA 5EX0A 3NY0A 1QQNA 3F9MA 2YQ1A 3I6PA 1RFQA 2YPZA 1DTQB 3NG8A 1W0HA 3LDPA 2IMOA 4DQIA 2YWEA 4BWMA 1KOOA 1FA0A 2J5AA 4G1IA 3G96A 2JGUA 3AQOA 2D3ZA 2G2YA 2DNQA 1M90T 1DAXA 4XH5A 3VMFB 1VLOA 5E41A 2IYGA 1FX4A 2PI4A 3QSIA 4YHHK 2J7KA 1OH7A 4DQQA 2XLKA 3Q8UA 3V9ZA 3MCNA 2AKWB 3EEQA 3AO2A 1DQ8A 4L3QA 1JXLA 4UOCA 2XMMA 3KWIA 4J37A 3CJ1A 2F9JA 4OQJA 1AROP 4DL2A 2K3KA 3KFWX 4OZNA 1WKJA 4P7VA 1F5AA 2YNIB 4XK8C 1LXJA 5B0EA 2GQ2A 1NZAA 4G9ZA 4TXSA 2HLUA 2C3MA 1DRZA 3R5BA 4ZP6A 5SWMA 4FNIA 1YX2A 3NAHA 4JKEA 1GK8A 1FNMA 4PYAA 4F7VA 2KM8C 3DXMB 3IWXA 5CXTA 3IGVA 3SEOA 1F9EB 5D4OA 3CC4N 1DEJA 4DFMA 4WF9L 4FYVB 4O8KA 3P96A 3PX4A 3M8YA 4EUVA 3OS2A 2O4GA 1TUWA 3FZMA 1RWKB 1HLWA 5EVZA 3LP0A 2MB0B 3KUGA 5BRDA 2VD3A 4WKYA 5C2GA 3T9NA 3CJ3A 5BR8F 3H2UB 4KTQA 3O80A 3MWTA 1VBYA 1TAQA 3MFIA 3PJWA 4P52A 3OFEA 4LVNP 2W4DA 3GG1A 4ZIVA 3K5OA 1L5UA 5LXYA 1UVJA 3D1QA 4ECUA 4ECXA 3BGLA 2Q36A 1IR0A 3OT9A 2FGCA 1XNRF 5AQGA 1KNZA 4CHZA 4M1KA 4FJLA 3K7RA 5AZIA 4XH4A 1XC9A 1BWEA 4TKTA 1NMDA 3DXBA 3SBTA 4LBHA 1PYSB 3V1QA 4DQRA 3DHWC 3L7UA 3CCLS 2DB1A 1GNKA 2F8TA 1WI8A 4ECYA 4RL1A 1N32K 1NGGA 3MR3A 4E98A 3IKMA 3VEZA 3CM6A 2QC3A 1T3VA 4CI0B 5AR0A 4PCQA 4KR0B 1CXQA 3QIDA 2WB1D 4PAAA 3U02A 1EWRA 2XO7A 3AAPA 2R2SA 2RH3A 4BRKA 2ZH8A 3QO9A 4CF0A 1MN9A 3D7SB 2VBWA 5A0YB 4X62J 1HNXK 2AF6A 3L2UA 3ENWA 3D67A 5GAHI 4P2XA 2CQDA 4M5KA 5LSLA 4DR7J 3VQ7A 4ETZA 1RBRA 4PQUA 3EWGA 3DCAA 1M90O 3U1NA 2X6SA 1HD1A 2BX6A 1XMQJ 1AZSA 2IDEA 2OD6A 1JLAB 2QEXS 5CD4H 1IBCB 1N34J 1HNIA 3NGRA 2P9CA 2CJXB 3HL8A 1XBWA 2O67A 4U7UK 5KG1A 2NXCA 2HSTA 1JLEB 5EOYA 3QQCD 2PE8A 4M5DA 1VFJA 3RW6A 3WNFA 2JWKA 3LDNA 3VQSA 3RVCA 4IRDA 3S8SA 4QWEA 2UXBF 3BO4A 1F3FA 3M30B 4DV0J 3P5TL 4PZVA 4DFKA 1IXKA 4RZRA 4KHQA 4EWTA 3OS1A 3C7NA 1WAJA 4F2SA 4ZPTR 3CWJA 4LBPA 2J8AA 5A2QO 4MKVA 2CPFA 1N56A 1JXBA 4ITSA 2EFNA 3EYZA 3LP1B 4M3TA 3CCJN 4LF2A 3O9QA 2QKKA 3U3GA 2ZVIA 1KTQA 3GE9A 1HKBA 3O3FA 2E1RA 1GLBG 1BD6A 2EWHA 3HD2A 5CYJA 2CYYA 4CK3A 2KT2A 4UOHA 2QA4N 1E4GT 3GIJA 2WOMB 1RTJB 2HMIB 1HI0P 2VBZA 3IG1B 4L8RB 4CVNE 1OJ4A 1VQ5N 2V7ZA 1JCFA 3VAHA 1FESA 3F73A 2XMVA 2OTJN 4C9DA 4JHDA 2DY1A 1HR0J 4B3TF 1WLJA 5JJBA 3NVMA 2ATCB 2GCFA 4F26A 3ETOA 3KLGA 1TQLA 1D4XA 5ADXH 3BS9A 1HNZJ 4DV6J 3KJQB 4RLEA 4KGKA 2HVHA 2ZOGA 2HFVA 3FSIA 3ELHA 4DU8A 3BEXA 2A6MA 4CK1A 2PMHA 2XS7A 4H0VB 1GLFO 3VQBA 4EO6A 3MI7X 2P9KB 3NBPB 2EBEA 1YVUA 1WSGA 4NYFA 4KYZA 4JKGA 3R5DA 3GV7B 3LALA 4K0KJ 1UJ4A 3OR1A 3W62A 4I9QA 3MX5A 1G2EA 4DUYF 2W6KA 1I5OB 2O8CB 4DQPA 2XTJP 2R9LA 1E6YA 3CW2C 1ZXOA 5F3ZA 3H5UA 4JD2A 3F44A 5LMUJ 4V19J 5I4MA 5IWAF 4LF9J 5J2PA 5I3UA 3SMZA 3BGUA 3ZX3A 3LL3A 5AE3A 3E01B 3G82B 4CJTA 4I0WA 3VQ9A 1W2BM 4ZP8A 2G1DA 4WK3A 2R7RA 2V7YA 2LA4A 2VG6A 2J9DE 2G0CA 3TWHA 3BF4A 2V52B 4J7CA 2ABYA 4WF9Q 4FYXB 2PEHA 3PY8A 5D0HA 2ZM6K 3CO0P 1UJ5A 4LF8K 2K06A 2OEJA 1BUXA 4KAIA 3RB4A 1V4SA 2O8DA 2NZCA 1ZBHA 4CEAA 3M32A 3RBZA 2BJDA 4G3IA 5E5NA 4QPXA 1HYZA 1TR0A 2QWQA 4WIIA 1WACA 1GMWD 1NLKL 1WOSA 2IHR1 3MM8A 4J9OA 1GTEA 4C8MA 2JLGA 2Y1JA 4GKKJ 1TYQA 3QYYA 4ZCMA 1QTMA 5KFFA 4CJKA 3A8YA 4NASA 4PR6A 3I56N 2LCWA 4UUXA 3K2YA 4ZPAA 2CQ2A 5HRPA 4NLVA 1P9YA 1XMQK 2P9PA 2QWPA 2ZNYA 4KPYA 3HRGA 1IBLJ 5KFPA 3Q7CA 3HI9A 3LP2A 3K8WA 5KG2A 3NCQA 2XB2D 4AILC 3MFHA 2XMUA 4LMZA 3RR7A 2ZBPA 2QA4G 1NWKA 5DZ6A 3HT3A 1R0AB 1RT5B 2HHHK 1IQTA 3HFVA 4A48A 1DTTB 3DGPA 4EI2A 3NFAA 4GMJB 3EUNA 3N4QA 3GSIA 2D3OR 1IBMK 2KJWA 3HZEA 2XG8A 2F65A 4F8RA 5AQFA 2HWTA 1Y00A 2WSCC 1CPZA 3ISND 4DV0K 1LK5A 2Q2RA 2QWRA 3LWLA 1MN7A 4W5RA 3KJVA 3L3UA 3MR2A 2YHWA 2E5LF 3KWMA 3HVRA 2MYFA 5AQNA 2RF2A 3MEGA 1K1QA 3POTB 4NRUA 2K2PA 3OJUA 2Y0SD 4PXDA 5CZVA 5GAEU 3KG4A 2IC3A 1U09A 4MKBA 4YDDB 3D2EA 1Q7YT 2X3DA 5LMNF 4KHPJ 2RMLA 2J0WA 1GXTA 4KH5A 5HQ8A 4PRFA 2BM1A 3OTEA 4GY2B 2QYGA 1RKIA 5ETOA 1S1VB 3D6MB 4C11A 2Z1GA 3AD7C 2OPPA 3UKRA 1KVJA 4RBUA 1S1WB 1H7WA 3OXGA 3MMCB 3H7HB 2MKYA 2B5JB 1S49A 4C3KA 3SCKE 1FO1A 2H4WB 1HNZK 5CCLA 3KHGA 3ONQA 4DV6K 4CT8A 1C0MA 1PILA 3MAAA 3SQ0A 3MM9A 2VZ9A 2F4FA 3THPA 4M5MA 1RJJA 3PO4A 4DR1J 3DRSA 1IKXA 3HHLD 2MQLA 3C94A 3AA2A 1DLOA 3V9XA 4NXNJ 2ZJPQ 3PX0A 1T05B 2CPEA 2FF6A 4JV2A 3B6BA 2VL1A 1WC5A 3B82A 1FD2A 3KLFB 2QLBB 4KFBA 4ISFA 1C4AA 1VQKS 1CJKB 3MM6A 3A5OC 4OZLA 4FXVA 4GMKA 2EC0A 4K42A 2ZH2A 3MEDA 2XCPA 2KXFA 1YHQS 3L2VA 2ZKUA 3GONA 1WC4A 4HUFA 1WAFA 1N4LA 1J5OA 3DRXA 3ZTRA 3HHLB 3KIOA 2HNDB 3CCZA 1S0NA 3WC2A 2WVBA 3CIMA 1NPKA 4EHUA 1ILYA 3CFRA 4ED8A 4DS4A 4ZTFA 2E6MA 3QERA 3P3DA 4IFVA 3O4WA 3HHEA 1CBKA 3DOLB 2YNHB 2BJEA 4MTPA 4B9MA 3QNNA 3HTVA 4DV2F 4YB1P 4CIFA 4DX7A 5D8HB 2XWYA 2BBEA 1KAYA 5KFOA 4CZCA 2Y1IA 2B9XA 3LGMA 2X6NA 4FZVA 4GKKK 1GLDG 1TP7A 3ZT2A 2C42A 1UOCA 5CR4A 5EWFA 2IVMA 4AQYJ 2P2CB 2JEFA 4WWSA 2XZTB 4ED3A 3KDNA 1J5EK 4KPCA 4YB6A 3SI8A 4OKEA 3VF6A 4DU4A 2B4UA 2CQPA 3HBTA 3V9SA 4DR6F 4LFCJ 1HPMA 4PWDA 3PCOB 4IFYB 4OI2A 2VICA 3W8GA 2EFGA 2MKSA 4JP8A 4RBTA 4CGJA 2V2ZA 1N52B 2DNMA 5M1PA 3CCRS 2C28A 4CH7A 2AEFA 4GV6A 2JNJA 2E2NA 2GHPA 3TSQA 3WDOA 1Q95G 3M2VA 3ATUA 4FWKA 4RNOA 5IFMA 2W9AA 3UKUB 4CJWA 1X9JA 1J9AA 1HWIA 4KTZA 5DZ7A 2B9WA 4X62F 3K89A 5B8HA 3AVJA 1H73A 4DR7F 1WC0A 4HVJA 3R6LB 1LWEB 4ICLB 2VYPA 4Y2AA 3DLEB 5JVHL 5DRKA 4KJIA 2D0AA 1XEZA 3FFKB 3HSDA 2JZ5A 1QD1A 3AA9A 3THVA 2GELA 1O6XA 2IVPA 2XC9A 2RRAA 2CIMA 2E88A 4O5BA 5IT4A 4KHPK 4FW2A 2DR7A 2HBYB 1YGYA 4E1NA 2ADCA 3LPTA 3MM7A 3HZ6A 3A3NB 3B4MA 3UD3P 1T94A 2DGOA 4EGLA 3MUVP 1KD1O 4X64F 5ETMA 4CGIA 3ULEB 2MEWA 3MD1A 2WRMA 4GO5X 4WP3A 4FJ9A 3PJ9A 3AJDA 4YOXA 1JWWA 4LF4J 1VQ7N 1S4EA 4JI5K 2BDPA 1QAIA 3WEEB 1U2RA 1OSCA 1NSAA 3G9CA 2HGNA 1RADB 3PW0A 3TAFA 2RUGA 3DXKB 1SJRA 2ZFHA 4E7LA 1QVGM 2DTUA 3NH1A 1RHQB 3KLHA 3IFRA 2V4QA 1Q79A 4NXNK 2NREA 3DFEA 1OY9A 2AJ2A 4AD6A 1AB8A 2Z58B 3PYGA 4EYHB 1U2FA 2HHVA 2P9NB 2E20A 2R7OA 1Q1KA 1U04A 2IDOA 3BZCA 4HHHA 4LD0A 2M4MA 3DLKB 2MKCA 3FDSA 2XSJB 3M2UA 3CM5A 1FDAA 1ASWA 3SXLA 1S0OA 4CZEA 4I2QA 5HO4A 2WONA 3QWPA 1RDDA 3CCQN 1HR0F 3ZT0A 2QL5B 5L9XA 4ILLA 4PY5A 3SQGA 5HQLA 4O5FA 4PKGA 2I0XA 4NWBA 1M1KT 1TL7B 2HF4A 1S1XB 1G4CA 2YNFA 3RG6A 1YLXA 2DHXA 3J81Y 3L8BA 1BHLA 3FBFA 3MPDA 1SKWA 5J2MA 1FRXA 3AT1B 5FPMA 4V19S 1S72N 2KB2A 4TU8A 2N3OA 4DV1J 5HLFB 3M6UA 1PYOB 2KLAA 3V1RA 3PFEA 3P38A 3UDCA 4K0KF 3MCMA 1RBOB 1IG8A 4OHXA 1FJGJ 3R27A 3C6UA 4P7TA 1XMOJ 2D1KA 3CI5A 4PABA 5ETPA 1R31A 1YBUA 1EAYC 5FPEA 2QT7A 4OYMA 2CNNB 3EO3A 3I5AA 4LF9F 3KLIA 4DHYA 4I4BA 2DEIA 4ANCA 1FWKA 3SFUA 4LFCK 2WVEA 2CAJA 3OTOK 4GVLA 2Q1LA 3KDOA 1WNSA 2H54B 3HOSA 4RW8A 2MY8A 1RAAB 2Y3YA 3HM9A 4ZPWR 1CJUB 4YP3A 3CG7A 1YG0A 3SUPA 4URSA 3CMQA 2Q97A 4M3YA 4OKKA 2B7BB 3PR4A 1RGIA 4IG0A 2CH6A 4WIQA 4DKWA 1BA1A 5B0GA 3SUOA 1P1TA 4X4RA 5L1LA 1Q81O 2G8IA 4R5PB 3KMQA 3A1YG 3MN6A 1TL3B 4HLBA 5LL6Z 2A10A 1S9GA 4CJRA 1TKDA 3R1XA 2ZH1A 5F8LA 4BVOA 2OPSB 3D1HA 1U6ZA 1HBUA 1OYEA 4NCGB 3TA2A 4IQMA 1WSJA 2DXDA 4QIFA 3FKBA 3W3DA 1PBAA 1Q9YA 4USIA 4PKHA 3AOBA 3NCPA 3NNAA 3FZLA 2W4PA 4ZJOA 4RUHA 2CPZA 3RSEB 1IBLF 4A8FA 3HJVA 3U9DA 2NYIA 3QEPA 2HVEA 2QG9B 1WORA 2B9YA 4FLXA 3QB0A 1GTHA 2LXFA 5KFUA 3G4SN 3VESA 2F8EX 2HFZA 1PAUB 1NK0A 4I6WA 4DUTA 3H4BA 2ZH5A 2E1MC 2VPWB 3RGIA 4JUZA 4WYBA 2WHOA 2V8DA 1VBKA 3FZKA 1PO6A 3FBEA 3M9OB 4K41A 4OFZA 2OP5A 1GOBA 2HOEA 5AZJA 2DGXA 1RT2A 4ZVPB 3OS0A 1YUWA 2IMWP 3TVZA 3NAEA 4DEZA 5GAEI 2YX4A 5HVFA 1I1GA 2XS5A 3FZFA 2LEBA 3L2WA 2W2MP 5CABA 5A8KB 3IAYA 1WTFA 3SDEA 1TUYA 3KK2B 4CD3A 1PJ6A 1FRMA 4C1NI 3SI6A 3CCSN 1EHWA 1X0FA 3NCRA 1E6VB 4C2MA 1VSMA 4BC9A 3CC7S 5L1KA 3DOMB 4DR2J 4YR2A 1S79A 4O3SA 3RRGA 1GLLO 4FL9A 3JXOA 4BWJA 3EZOA 3H20A 1XJWB 1QAYA 2N82B 4HT5A 1HHTP 4F50A 1Q82T 4KT0C 4NX9A 3S7RA 3CUNA 1KAXA 2HRYA 4WXWA 4QYRA 1VQ5S 3GDQA 3PJXA 4OYXA 1X8DA 1CEZA 1WBBA 1GOAA 1NGFA 3TOQA 2EVZA 3GQCA 2G2OA 4ELUA 2NQPA 1ZPWX 1JL1A 1O13A 4ETXA 3ULHA 3KYLA 5BN8A 4JAXA 3Q8PB 2H4YB 3ZETB 3OVBA 4DUZK 2OIHA 4IKFA 2RS8A 2DGVA 4KH6A 2H9ZA 3SCIE 5IZHA 3THXB 4JI1F 1XMOK 4DL5A 1IR2A 2AHOB 4KV8B 3T6BA 3M1VB 2N4CA 3N0VA 2VG7B 4AF1A 4CESA 1X7VA 4NL5A 3C0BA 2VDIA 1WC1A 2RVJA 2X1BA 2CJYB 2QGFB 3DM2A 3UO0A 2HAIA 2F96A 1SQGA 1KQSM 4OX9F 2FLNA 1RCHA 2CPHA 4QS9A 2UXDJ 4H5WA 5IV4A 3VR1A 4DFPA 1CLQA 1P9QC 2O4IA 3GYGA 4Q2LA 1ZYQA 4FF4A 4KAZA 1U4BA 3S01A 2IA6A 4OX7A 4E7IA 1UPMB 3KG1A 2HZCA 1YZ7A 2Z56B 2AJ0A 2Z0GA 3UVJB 3MM5B 1NDKA 2QRRA 2V8GA 3GJTB 2GVDB 4NLYA 2C3YA 4TYBA 2FJVA 3N01A 5H9FJ 4ENOA 4CFCA 3H2VE 2J6TA 3I4HX 1HQUB 3I82A 1VQ8S 1HYSA 1XTZA 2QMUB 3ILIA 3NXZA 1WJ9A 4AQYF 1Z2LA 3R1LA 2XRIA 2P9SB 3JQJA 2UUAJ 3V4IA 1ZAWA 3M8ZA 5J1EB 2IM2A 3I56S 2DXEA 3S6EA 1RT1A 3HKZD 2VG5A 3RWUA 1N33K 5DGAA 5B0BA 5ITHA 4RU9A 1NH7A 3CQ8A 2NZTA 2I1RA 2EFQA 4CJ5A 4C0OC 4OYWA 3CCWA 1NPPA 4KHYA 1WHXA 4OVLA 1GLJO 1R6VA 4ILGB 3HVWA 2JEJA 2YHBA 3RZAA 1IKYA 3D3BJ 3FZ2A 4GC7A 3MECB 5C12A 1G1XA 3K2PA 4QU6A 4LSNB 1V3SA 2NUUG 4J9QA 2ZGZA 5LJ3Y 2KFZA 2CNKB 3W61A 4NXMJ 3C2PA 2DT9A 3SQ2A 1KVBA 2WBMA