5HLFA

Structure of hiv-1 reverse transcriptase in complex with a 38-mer hairpin template-primer dna aptamer and an alpha-carboxyphosphonate inhibitor
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the role of the alpha-carboxyphosphonate moiety in the HIV-RT activity of alpha-carboxy nucleoside phosphonates.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/inhibitor/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 143
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hlfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hlfA05
3IG1A 1A5XA 2KTQA 4IH6A 2C2RA 4NRUA 4IR9A 3Q8RB 1JLGA 1T05B 4M3RA 1S1VB 2J6TA 2V4QA 1B9FA 3AVJA 3ZSWA 4NLGA 3PY8A 1RT2B 5KG4A 4B3OA 3ZT4A 1OS5A 2DPIA 3EY1A 3THVA 1U47A 4KHNA 3NMAA 4E19A 3N6NA 2BE2A 2I1RA 2AU0A 3NH2A 3H08A 3VQ9A 3U3YA 1VSEA 1C2PA 2F8TA 3QEVA 1R0AB 3CYMA 4HYKA 3PR4A 4CIEA 1NK0A 1IKWA 2QK9A 3V9UA 1S1XB 4CECA 3NL0A 4CJSA 1VSMA 1BGXT 4HHTA 3CJ2A 3CG7A 3LZIA 4NLVA 1RTHA 5HBMA 4E1MA 3SUOA 4M41A 1F21A 1TV6B 1ZBUA 3IRXB 3D5MA 5KG7A 3HPGA 3TAPA 3K58A 4DFJA 3TAEA 1L3SA 1GX5A 3U3GA 4W5OA 5KFTA 1JLGB 1XC9A 5KFYA 4Q8EA 1EXQA 4ECZA 3HP9A 4NYFA 3OYNA 4DF4A 5L1LA 4AH9A 1S1UA 1S9GA 4B8AB 5KFDA 3AO1A 1L3TA 2IM2A 4ECXA 4RW7B 2ATLA 4CEFA 4FJ9A 2QE5A 2PZSA 2QKKA 3GIJA 3V6DA 1UAXA 3D45A 1R0AA 1JLAB 2KZMA 5HROB 1BQMB 1JLFA 5EDWA 3VQ5A 3NCIA 3HHKA 3CJ0A 2XY6A 3AO3A 4FLTA 3VA3A 5HP1B 5EUHA 3AVCA 2XWYA 4TY8B 4K4XA 1ZBFA 3HYFA 3WNFA 5DG8A 1MU2B 4AHCA 5KG0A 4CJLA 3M8PA 3NGZA 3S3MA 4PWDB 4TY9A 2HHXA 3WNEA 3QETA 1CXQA 1EP4A 3PR5B 1QS4A 4ED1A 4CHZA 3AVFA 5EWEA 3OYIA 3PW5A 4NLWA 1GOBA 4CHOA 4DTRA 2HMIB 4ZP8A 4H4MB 4ZVGA 4FJKA 3CJ5A 1WSIA 4YMEA 3MXIA 5J2QA 3BQ1A 1RT1A 3OL9A 2B5JA 4NLUA 3SPZA 4CJFA 1SV5A 4K4WA 1TK8A 4J9KA 2HNYB 4EBEA 3LP1A 5F8IA 4O55A 3OY9A 4BWJA 3G6YA 3O4NA 1T03B 4NYZA 4TLRA 3WNGA 4IBNA 3JYTB 1GOCA 5KFUA 3H4DA 3PJXA 3LP3A 2ASDA 1ASVA 3DDKA 4Z4EA 2R2SA 3NGDA 4FXDA 4B9SA 3BQ2A 3MEEA 1XI1A 3N6MA 3DI6A 2HHVA 1BQNA 3LPUA 4IQXA 3V9WA 4W5NA 2FVSA 4ED2A 1GX6A 2ZQBA 4ID5B 1N6QB 4FJJA 3BDPA 3DRRA 2HWIA 4DL5A 1T94A 1LWCA 3HVWA 1TL3A 1BCOA 4IH5A 5F8JA 1FKOB 2X74A 3OS0A 3ISND 5DGBA 1YT3A 3MTKA 1WNEA 4TYAA 1RYRA 2FBYA 3VQCA 4O3QA 3SNNA 2G8HA 3BSCA 3AV9A 1U4BA 4DU3A 4QWBA 3TAGA 1IKXA 2IGIA 1S97A 4Z4CA 5L1JA 1RAJA 3NF7A 3M9OB 1S9FA 4JV1A 4DTUA 3K2PA 1FK9B 4FZZA 2YKMA 1KRPA 4LSLA 2Y1IA 3RRHA 3OYBA 2W9CA 4J2AA 4HUGA 4OKEA 1BQNB 4OGEA 1CLQA 3NH0A 3E01A 5J2PB 3N6LA 3I8DA 5I42B 3HVAA 4ED8A 4FJHA 2XCPA 3GYNA 4GMJB 3KLFA 3SJJA 4O4GB 1WAJA 5KFIA 3NBPA 5KTQA 3CO9A 3DOLB 1D9FA 4KO0A 4FK4A 3O3GA 4ED7A 1D9DA 2OPQA 2C2EA 3IAYA 3V4IA 4NLTA 1BHLA 5CYQB 1HYZA 4RNFA 1NK6A 4FJ5A 4O0JA 2RDJA 1S6QA 3VQAA 4Q5VA 2IC3B 2WCXA 2KFNA 3RRGA 3VQDA 2BGGA 5E41A 3P5JA 3QGGA 4CIFA 3I0RB 1ZYQA 4IFVA 3VQ7A 4E0DA 4F3OA 1L3UA 4HUEA 1WAFA 2ZD1A 4KREA 4Y2AA 3QEIA 3H5SA 4DTXA 5KT4A 2YNFA 1N5YB 5DQGA 4CHQA 3L8BA 4K4YA 4I2PA 2HHQA 3PHEA 4Y3CA 5J2PA 4K4UA 3PJWA 1JLQA 5K14A 2BANB 3OVNA 3AA4A 4M3YA 4CF1A 1SL2A 2OPSA 5C5JA 5EWGA 4M3TA 5DLFA 4E1NA 3DOKB 4CEEA 3I5BA 1T7PA 2G8WA 1NJYA 2KFZA 3UDLA 4NCAA 3KLGA 4K4VA 4J9PA 2E9ZA 1I39A 2G8IA 4NLXA 4CJQA 2BRLA 4CJVA 3KD1E 4FJLA 3T5LA 3ZSZA 5KT3A 1SUQA 4DQPA 4OLBA 4FM0A 1N4LA 4N76A 3C94A 2RKIB 3VQSA 3MXJA 3H98A 3LPTA 1S1WB 2QXFA 4WZMA 2FJWA 4CE9A 3LAKA 2ILYA 2FJXA 2UVVA 4DSFA 2W7OA 1TAUA 1IKVB 1UA1A 1C1BB 3QEWA 2DY4A 4DU4A 1S9EA 1NOZA 4Y1DA 3MFHA 5KG3A 4CEAA 4JS5A 3OSPA 1IKYB 3ZSRA 3DLKB 3FFIB 4CEDA 4R8UB 3I0RA 4IDKB 5L1KA 4FBTA 2F96A 1RA6A 3ZSYA 1RT1B 3WNHA 2IBKA 3IRXA 4JV0A 1ZBLA 2YNFB 1YTAA 3SV3A 1S1VA 3HVTA 5SZTA 4O3OA 3V1QA 5KT2A 4CGHA 2C22A 2W7PA 1DTQB 1I3AA 4DS5A 5KFBA 2WONB 2YKNA 4BACA 1VSFA 5KFGA 1S49A 2ZKUA 5DMRA 3C6UA 2WHOA 2KQ2A 4H54A 3OLBA 3FQLA 2VG5B 4BDZA 4M94A 4CGFA 2EC0A 3DLRA 5DG9A 1HYSA 5C25A 3D28A 3I0SB 1JKHA 4KKOB 4WYWA 4DG1B 2FLPA 4B9NA 4DFMA 5KFXA 1C1CB 4B9LA 4E7LA 1RBVA 1L5UA 1TV6A 3C95A 3KLHB 3PW0A 4ZP7A 2HB5A 1RTJB 1FKPB 3HT3A 4KHRA 4KTWA 2D7SA 4EBDA 4Y2CA 5JUMA 3QGHA 4CCHA 5KRSA 4F50A 2FBXA 2IJFA 4M42A 1TKTA 4R5PB 3LP0A 3OYCA 4CJPA 3I5CA 4H4OB 4NZ0A 3K5NA 3AVKA 1JXBA 1IKYA 4UQGA 3PV8A 4IR1A 1X9WA 4CJWA 4ELUA 2BQ3A 1QE1A 5KI6A 4Q8FA 1RT4B 4F8RA 1HMVA 2IM1A 3NFAA 2RN2A 1QSLA 4CGIA 4Z4FA 5FRNA 1JLAA 3LZJA 3QIPA 3DYAB 4H8KA 2ILZA 3KLVA 4FLYA 3BGRA 4KKOA 3LP2B 1RTDB 4F4XA 2DPJA 3HVTB 4ELTA 3MFIA 5HLFA 4DSJA 3MXMA 2CKWA 4N5SA 3GV5B 1X9MA 4FLWA 5KRTA 2G8KA 1U09A 3KLEB 4RW9B 1HNIA 3ZT2A 5CY4A 1XR7A 4O4RA 1BISA 4KTZA 4KB0A 3TABA 1S6QB 3FQKA 4URSA 4ZPCA 3MECA 1ITGA 2O5DA 3HKWA 2XC9A 3NE6A 4C8LA 2XI2A 2BQUA 1LW0A 3OYEA 3HP6A 3RAXA 2IOCA 4DU1A 1QE1B 3K59A 4M3UA 4YQWA 3QIPB 2R2RA 5KG6A 4C8KA 1SH2A 1S0OA 2OZMA 2RKIA 4XO0A 4EZ6A 1S1TB 4B9TA 5CZ2A 4ZPBA 4WE1B 1SKSA 4NLYA 4MIAA 2R8GA 2HAIA 1C0MA 2FVQA 5KFWA 4DTMA 2VG6B 1XR6A 2E4LA 4CF0A 5KFZA 1VRUB 1WSHA 3RTVA 3P83D 1RT3B 3OHAA 5J1EB 2KW4A 4EYHB 4RW7A 2XY8A 4M45A 4RW6B 3B6OA 3VQ8A 1ASWA 4YR3A 4NCGB 2GIRA 4F4YA 2YNHB 2WK4A 3PUFA 4QWAA 2HVIA 2HNDB 2I5JA 4DTPA 3HPHA 1SL1A 4YR2A 2OYQA 1RT5B 3M8RA 2WONA 1LW2A 5D3GA 1CZ9A 1LAVA 3LAMA 5KFHA 3AA2A 3TARA 4KSEB 1SH0A 3TQ1A 4FS1A 3OL7A 3MR5A 3K57A 3RMAA 4IOBA 4B9VA 3KHLA 4KTQA 3OS2A 3OJSA 4MK9A 4MQ3A 4EO8A 3O3FA 4E7KA 4DTOA 2O4IA 1TKXB 1EETA 4FZXC 2D0BA 3KLHA 3CDUA 2IAJB 4WFXA 4ECTA 4IH7A 4FM2A 2IS3A 3EZUA 4NRTA 3SCXA 3KK1A 1KLMA 4KFBA 4K4SA 2OPPB 1N5YA 3GV7B 2HNDA 4E3SA 1TK5A 1TKTB 1REVB 3TAMA 2OPSB 2YV0X 4ECRA 4FCYA 4FW2A 3OLAA 3VQ4A 4ZHRA 2DFFA 1EX4A 2BRKA 4ED3A 4CGGA 4WYLA 2R8JA 4OPJA 4ID1A 3QYYA 3MEGB 3KK3A 4MKBA 5KFEA 4FJMA 2FBVA 1JIHA 3OL8A 4JS4A 4M3XA 4ZPAA 5KFRA 4AILC 3V6KA 3RWUA 3M8PB 2FC0A 4J2BA 1WSJA 2R8IA 3ISNC 4RNOA 1RTHB 4URQU 1JLFB 4AHUA 1QSSA 3RBEA 4JLHA 3DLEA 3HSTB 4K4TA 4I9QA 3Q8SB 4KRFA 4OL8A 3RB3A 1TP7A 4DQSA 5KGWA 2JEGA 2BR0A 4J9OA 2VA3A 5KG5A 4CGJA 4DS4A 2B6AA 2V9WA 4DF8A 4KV8A 5C42A 1T8EA 1ZTTA 4B08A 1WSEA 2JEIA 3TAMB 3O4QA 4IG3B 4CIGA 3DOKA 1HQEB 4E7IA 4NCBA 5FROA 4KAZA 1QAIA 4R0EA 4Z4HA 1NJZA 4CK1A 1KFDA 4W5TA 3ULDA 1RDDA 4CF2A 1XWLA 4CHPA 4QWDA 4JUZA 3KHGA 2YNGA 3QESA 4CJ3A 4CK3A 4ECUA 5CZ1A 4N47A 2UVWA 1UA0A 1DLOA 4KHWA 2Z1GA 3NDKA 2VG7B 3QNNA 2JLEA 2FJVA 3L2RA 3AO5A 4OJRA 4B9UA 5J2NB 3QO9A 1RYSA 1WNSA 1NNDA 2J6SA 1IO2A 5JS1A 1BI4B 4N56A 4F4WA 4RNNA 3V9SA 1JLBA 4DL6A 1XHZA 3L2WA 1HNVA 1CZBA 1FXXA 1U04A 3D0PA 3RMCA 2ZE2A 1TQLA 4Z4GA 1W25A 2DTUA 3VQBA 1YVFA 1EP4B 3QEPA 3NGIA 1VSHA 1ZBIA 1JKHB 4ECQA 3DLEB 1UWBA 2IMWP 4RW8B 1RT6B 3KJVB 3PX6A 2GBZA 1TVRB 1FKPA 4CFAA 3ICLA 4C8OA 4O5BA 1QAJA 1TL3B 3ZSQA 4DEZA 2ASJA 4ECWA 4ZMMA 4KHQA 4OKKA 1BQMA 3CM5A 4Q45A 2OH2A 1S0MA 4Q0BA 3CWJA 3AA3A 4MFBA 1W0HA 3RR7A 2V4RA 4CF8A 3ZT3A 2D3UA 1RBUA 3U6FA 2V0NA 3HVRA 3QIDA 2JC1A 4YNQA 1KLNA 4AHVA 1RT7B 3C6TB 4FM1A 1IG9A 4QWEA 1Q8IA 3OYFA 1RILA 2NUBA 4WZQA 4FLVA 1NK8A 1O1WA 4Z0UA 4PY5A 4MK7A 3A2FA 3GV8B 4YR0A 3L3VA 3HPOA 1Q9XA 5J2MA 3VA0A 3DLGB 3OYGA 4CF9A 3SZ2A 5HP1A 4AHRA 5DG7A 1LWEB 1X9SA 1RBRA 1BIUA 3NF9A 2W42A 4EYIB 2ASLA 5F8NA 2A1SA 3G86A 3SFUA 5L1IA 1BIZA 2PYJA 3DLBA 1NK5A 3MEGA 3AVIA 2AX1A 3V1OA 4DQIA 3VQPA 4Q0BB 1S9EB 4CJEA 3SQ2A 4CJUA 4WFZA 4MK8A 1KVCA 2YKMB 4EZ9A 2CJQA 4G1QB 4FZYA 5T14A 4ZTJA 4NLOA 5KFCA 4MH8A 5F9NA 5HROA 5EU7A 3HO1A 2GUIA 5DLGA 3CFRA 4CEOA 1DTTA 5HRRA 3CJ3A 5I3UA 2FLNA 2AQ4A 4U7CA 4CJTA 3CIZA 4K50A 1ZETA 3TR8A 2WOMB 4I7FA 1RT3A 4O44B 4KHUA 3QGIA 3SUNA 3DRSB 3K5MA 4HCBA 2YHBA 4C8NA 3MECB 3BQ0A 1LWCB 5KFVA 1B92A 3H59A 3VQ6A 4K4ZA 1J5OA 3T5KA 4IRDA 4RW4A 2JEFA 2UVRA 2VG7A 2HW3A 5HBMB 2AGQA 3NGYA 4IG0B 4LSNB 1KTQA 2RDIA 4FW1A 1RTJA 1CSJA 1K1SA 3CJ4A 2GV9A 2E6LA 3OJUA 3UIQA 1J54A 2VWKA 4QAGA 3VQQA 4BE2A 1HPZA 1JLEA 3NHGA 2FLLA 5K14B 3MEDA 2B5JB 3EPGA 1JLQB 3CQ8A 3KLIA 4HTUA 4IG3A 3SUPA 1I6JA 4BDYA 4EP4A 1T05A 2C2DA 5JXSA 4FJIA 4G3IA 3MF5A 1JXLA 4FJGA 1YVUA 4IFYB 2YNGB 3JYTA 3NBPB 1Z26A 1VRTB 2C28A 1XHXA 4KHYA 3DYAA 3DRPB 3T3FA 3G0ZA 2XY5A 1C0UB 2BDPA 3RMDA 3H5XA 3NF8A 4J9MA 2D0AA 3UPFA 4FVMA 3ITHB 1SKRA 2HHUA 3TANA 1BI4A 2AWZA 2FVCA 4ZPDA 4CFDA 3DOLA 5KFPA 4BWMA 3PW2A 1NJXA 1LAWA 4DTNA 4K8ZA 5FDLB 1SKWA 3KLEA 2VG5A 4KHMA 3F9KA 1U49A 4KI6A 4PUOA 1C0TB 4HUFA 3GILA 3QIOA 5C25B 4YP3A 3TI0A 1EETB 3RB0A 4YFUA 1UWBB 3AVHA 2D41A 3AVAA 3H4BA 1C1CA 4J9SA 1EKEA 1RT6A 2R8HA 4LSLB 4Y34A 4CGDA 4IG0A 1RA7A 3TAFA 1QUVA 3IS9B 4ECYA 1KCFA 3AVMA 4F4KA 2ZD1B 3P1GA 4QWCA 1LWFB 3ASMA 2ETJA 3NF6A 3PVXA 4DLEA 3H5UA 2F8SA 1IKWB 3IGVA 2YKNB 3KLFB 1YTUA 1Z4UA 1NKCA 4DL4A 2R8KA 3G6XA 3OS1A 3PO4A 1HQEA 4BE0A 3H2LA 4O0IA 1U48A 3V9XA 3OYLA 2X78A 3RB4A 2YHAA 3SPYA 4ICLB 5CYQA 4J9QA 2RPIA 1HQUA 4ZTFA 2R2UA 1U45A 4Y1CA 4KO0B 1MU2A 3L2VA 1N56A 1HNIB 3EZ5A 1JL2A 3IGNA 3SUQA 3CDEA 4JV2A 3QO9B 1NHVA 1S1UB 1S9GB 4URGA 1LWEA 3DMJB 3CDWA 1JLBB 4FK0A 4EEYA 2HMIA 3L3UA 3TAQA 3SFGA 1RBTA 5C42B 1J53A 5F8HA 1L3VA 1A5WA 4DLGA 2JEJA 4RNHA 1HARA 4ELVA 3QLHA 4Q44A 3T19A 2ZE2B 2XO7A 1NJWA 3NAEA 3AVGA 3T5JA 3E01B 1J5OB 3BR9A 4LH4A 1NK7A 1TGOA 3ALYA 3AO4A 3F73A 3CVKA 4NLQA 1LW0B 2GIQA 5KFQA 3OL6A 1TKZB 1RT4A 4RG8A 5DK5A 1C6VA 1S10A 1HRHA 3KMQA 4JRPA 3IS9A 4CK2A 4HCCA 4U6PA 4DFKA 4RNMA 3RAQA 1NHUA 1X1PA 2IDOA 1S6PA 2BE2B 2Q3SA 4M3WA 2VWJA 2UUTA 4BDPA 5C24B 4DSEA 3KD5E 3M8QA 3ZT1A 3KK2A 3DI6B 4E7HA 4CEQA 4MKAA 4MFBB 5KFLA 3L2UA 2OPRA 1SUQB 4Z4IA 4EP5A 4W5RA 4MIBA 3DRRB 1QTMA 4WFYA 4J9LA 3BSAA 3NKYA 3PO5A 1RT7A 4QW9A 1RDCA 4TN2A 4CFCA 3BREA 4ZVFA 5F8MA 1QQCA 1TAQA 4O3PA 3V6HA 4TQSA 4CERA 4IKFA 3Q8QB 5CYMB 2XY7A 2BANA 1ASUA 1C0UA 2ATQA 3OHBA 4C8MA 4GW6A 1RT5A 3OSNA 5HRSA 3PW7A 4LQ9A 4QW8A 1SL0A 3KNAA 1TL1B 1SV5B 1JXEA 3BSNA 3JSMB 4FJ7A 4ZVHA 1HMVB 4DL2A 1S6PB 2RF2A 3I5AA 4IDKA 5T7BA 4ED0A 4Q43A 3HXMA 2R7YA 3K5LA 4M3ZA 4AHSA 4KV8B 2Z1JA 3KK1B 4AHTA 1T3NA 3KK2B 1S0NA 1TK0A 3DM2B 2E6MA 3OYAA 3V9ZA 3S9HA 4DL3A 1VSLA 3T5HA 4CFBA 2OZSA 3FDSA 1UOCA 1HYVA 2UVUA 2QKBA 2YNHA 1VSIA 4CJ4A 3NH1A 4DSKA 2FVRA 2D5RA 5L9XA 4NYNA 2X6NA 2F8EX 3OYMA 4DQRA 4O3RA 1S4FA 4KHSA 4F3TA 1IKVA 5CYMA 1Y97A 1KLMB 4KFBB 2UUWA 1S5JA 1WSFA 3QERA 3KK3B 4TQRA 4CESA 3M8QB 4ID5A 5KFKA 2XCAA 5EWFA 4N41A 4XIUA 2WRMA 5I3UB 3I0SA 4WXWA 3EYZA 3KMSA 1RBSA 1SH3A 4GC6A 2P51A 2IC3A 3VQEA 4PQUA 2OPRB 3PZPA 3DRSA 4ZP6A 2WOMA 4EO6A 2W9CB 2DFHA 4IFVB 4RW9A 2W8KA 2EHGA 3RBDA 4PUOB 2HNYA 4XPCA 1B9DA 5KG2A 3IG1B 1VK0A 2HNZA 4HVJA 4FK2A 5KFOA 2IAJA 3FRZA 4QPXA 4J2EA 4LSNA 1RT2A 2Y1JA 3S3OA 2E9RX 3KJVA 2OA8A 4FLUA 3C6UB 2OPPA 3JSMA 3OYKA 3BGRB 5KGXA 1QHTA 5KFMA 4LY7A 3GIIA 3CM6A 3S3NA 3SYZA 2D0CA 5DQHA 3B6PA 5I42A 3GQCA 3KLIB 5SWMA 2XHBA 5KFFA 3PX0A 3ZT0A 1S1XA 3LANA 4I2QA 1BL3A 3T1AA 4KB7A 4CJRA 3AVBA 1N6QA 1D5AA 2PY5A 2GC8A 3MR6A 5HRNA 4NLSA 5F8LA 4OGCA 4NLPA 3KHHA 4CJKA 3OYHA 4OKJA 4NLRA 1RDRA 1VRTA 4DFPA 1NOYA 3H5YA 4IFYA 1S1WA 3K5OA 2IA6A 4ECVA 3DRPA 1HYSB 4I2PB 2HWHA 4KAIA 4QOZB 4F2SA 1RCHA 4ZVEA 3PX4A 1BCMA 5KT5A 4RUCA 4ECSA 2EX3A 5KFJA 5J2MB 4DMNA 2B6AB 4F2RA 1RTIB 3FSIA 1LV5A 4KPYA 1JLEB 4OPKA 4CEZA 2ALZA 3Q8PB 1FK9A 3MEDB 1G15A 3V6DB 2WTFA 4OLAA 4H4MA 1WSGA 4NLDA 4DTSA 1CXUA 3HL8A 2B43A 1KHVA 1HNVB 2QV6A 2HHSA 2VG6A 5J2QB 3BSOA 3GIKA 2A1RA 4IRKA 2IJNA 3M9MB 1C0TA 2HNZB 4DL7A 4B9MA 2IM0A 4RW6A 3KHRA 2HVHA 3V81B 5KFSA 4KB1A 3KLGB 1Q9YA 1Z25A 1DTQA 4RUAA 4CHYA 4G1QA 4ED6A 5J1EA 1DLOB 3EPIA 1TVRA 3RMBA 3QZ8A 3LP2A 2RF2B 4NCGA 4TXSA 5C24A 3VN5A 3MR2A 3OYJA 1KFSA 5KT7A 1JLCB 2YNIB 1ZBHA 4IKAA 4O3NA 4DG1A 5J2NA 2Z1HA 3M8SA 4XPEA 3DM2A 4R8UA 2I5JB 3QINA 2G8UA 4ZHRB 4KI4A 1W9HA 4I9LA 2ITGA 4EBCA 4L8RB 3O3HA 4ICLA 5D3GB 3LP1B 1KSPA 4F4ZA 4M95A 4HKQA 2AX0A 3C6TA 1KVAA 1C1AA 1FKOA 3GIMA 2VA2A 3V1RA 2FBTA 3DLKA 3FFIA 3TWHA 2PYLA 4OVLA 3OYDA 3QNOA 4CHNA 4DSIA 4H4OA 3V81A 3LP0B 1K6YA 4RW8A 4J9NA 2DFEA 1QSYA 1ZTWA 3DLGA 4RZRA 3PW4A 1IH7A 4IRCA 3DMJA 3KOAA 2AGOA 3MAQA 2HHWA 3KKSA 4LD0A 4ZP9A 1XR5A 2XGPA 3LDSA 2E9TA 3SQ0A 4B8CA 1RNHA 2JGUA 1IM4A 2AJQA 1RTDA 1VRUA 1J9AA 2XGQA 4FS2A 5F9LA 4CEBA 3LALA 2O4GA 1DTTB 4FBUA 2R2TA 3UR0A 4PA1A 1JL1A 3RB6A 4KE5A 1VSJA 5HLFB 3ZSXA 3QEXA 3RR8A 2G8FA 3AVNA 4O4GA 4TY8A 1RDAA 4I7FB 4O44A 4TYBA 3ZSVA 4FJ8A 2OPQB 1A5VA 1C1BA 2FVPA 3ITHA 4DWIA 2XI3A 2P5GA 1KVBA 2G8VA 3SQ1A 1NK9A 3BJYA 4DTJA 2B4JA 3L2QA 5KFAA 3DLHA 4GC7A 4O3SA 5FDLA 3CFPA 3QLHB 1JX4A 3SI8A 1S48A 2J6UA 3SV4A 1NKEA 1HPZB 5F8GA 2BQRA 1NK4A 3NAHA 1K1QA 1VSKA 5KT6A 3E51A 2HHTA 4WE1A 4DSLA 1TKXA 1TKZA 4FLXA 2W9BB 1T03A 2LSNA 3AA5X 4TSXA 5DGAA 2JC0A 1D8YA 1WN7A 3G6VA 5DQIA 3KIOA 1RTIA 4K8XA 3KKRA 4J2DA 3UQSA 3V4IB 3H40A 3AVLA 4PWDA 3NAIA 1LWFA 1GOAA 4BE1A 3KTQA 4LH5A 1REVA 4I2QB 4GVMA 3MEEB 3G10A 1WLJA 2X6SA 4QCLA 3CFOA 3ZCMA 4X2BA 1N48A 3QZ7A 4DQQA 1MMLA 2D3ZA 1TKDA 2AGPA 5JS2A 1HQUB 3M9NB 4FLZA 4B3OB 1LW2B 2P1JA 4LQ3A 3LWLA 4FYDA 4KBIA 1RDBA 2XRIA 4RU9A 1D1UA 5HRPA 4FJNA 3LWMA 2KZZA 1NKBA 3MR3A 2W8LA 4RW4B 3V6JA 3HM9A 2W9BA 3ZSOA 4JRQA 2IM3A 4R5PA 5KG1A 2W9AA 3HK2A 3HJFA 4W5QA 3SQ4A 1JLCA 2YNIA 2Z1IA 1TL1A 4WXOA 2P5OA 2WB4A 4E89A 4E7JA 1D0EA 4FJXA 1VSDA 1IKXB 1S1TA 4J9RA 5FRMA 3IN5A 4PQUB 1HJRA 3AO2A 3TVKA 3SI6A 4CJ5A 1KHWA 5KFNA
chains in the Genus database with same CATH superfamily
2KTQA 1VK8A 4IR9A 1NBEB 1APSA 4YEAA 5KG4A 4LF4J 5DDRC 3OR1A 1PBAA 4M5KA 1U47A 4KHNA 2JVOA 1SB6A 1TUVA 4E19A 4JI5F 2BE2A 5JLHA 2AU0A 2OGUA 1NMEB 3MWBA 4WK3A 3VQ9A 3FFKB 1MNEA 1C2PA 4KY3A 1NK0A 4DV4K 1VQ4N 1AUDA 1HLUA 3CTRA 3LZIA 4E1MA 1F21A 4H0PA 1ZBUA 3J81Y 3T1HF 3HPGA 4X62F 4ANEA 3DFEA 1GMWD 1O5JA 2K2PA 3C6HA 2DY9A 5KFTA 1JLGB 1XC9A 2LP4A 3GJRB 3NCRA 3OYNA 2AYMA 3LTOA 1S7IA 2P9PA 3UKUA 3SDEB 4ECXA 3MM6A 1E4GT 1VBKA 3R5BA 4OLPA 3ENWA 2OKQA 2QKKA 2CH6A 1YJUA 1UAXA 2XBPA 3M2UB 1R0AA 1JLAB 3HHEA 1BQMB 5EDWA 1YJ9S 1M5KC 3MPUB 3MUVP 1P8ZA 1O8BA 4DKWA 5M2PA 2YWKA 3AVCA 3O1LA 2YWGA 4TY8B 1CEZA 4YORA 4DR6K 5DG8A 1MU2B 4HVZA 3ET6B 2WVBA 2GVZA 1X8DA 1FKAF 4ZITA 1O0PA 5DDOC 1QHAA 3WNEA 1D9AA 3QETA 1CXQA 3DXKA 5EWEA 1XMBA 1DGKN 3PW5A 4CO0A 2LEAA 3P6YC 1YHQS 2DNQA 4DTRA 4ZVRB 4H4MB 3HD2A 4ZVGA 2C2OB 2CPDA 3BQ1A 1NDPA 5BYQA 4CJFA 2YXLA 3I4PA 4K4WA 1TK8A 4I6YA 4UW2A 5F8IA 3MMVA 3C16B 4NA2A 1VOMA 3G6YA 4DPYA 3RUBL 1FDBA 2ZJPQ 1IJEB 1UWAA 4OYWA 1SVDA 4TLRA 2AMCB 3JYTB 1GOCA 3SBTA 3O44A 5KFUA 2UUCK 1TZ0A 3LP3A 1IBKF 2DIUA 3A5LC 1HW9A 2R2SA 1ZZFA 4C1NK 2DGXA 4P73A 1KC8T 2I7PA 4ZVSB 2BBEA 2DHGA 2AKWB 5HANA 2PA8D 4AE5A 4ZIVA 3LPUA 3DXMA 3M6VA 2ZH8A 3T1YF 3JAMO 1GMVA 4WWSA 1FVQA 1SZ2A 2AYBA 4QU6A 4YOEA 1LWCA 2QX0A 2VICA 2WVEA 3KKFA 3TVZA 1YT3A 3MTKA 1RZMA 1RYRA 1XMOJ 2IJRA 4A2AA 4PQAA 4X84A 2YHXA 4ZN1A 2G8HA 1AZSB 3BSCA 1XNRJ 3L9ZA 1U4BA 4GKJJ 4B3MK 1CJTA 2L9NA 1IKXA 1RQ0A 1RAJA 1XBWA 1VQLN 2J7KA 3NF7A 5L9NA 2P9IA 4CLZA 1KRPA 4LSLA 4YUDA 2V8VA 3VZHA 2FHJD 4QIEA 1TL5A 1IBKK 2KM8B 1Q8KA 4KC5A 4OKEA 4OGEA 4X64F 4DCPB 3E01A 1MROA 2ZH4A 2DITA 4ED8A 2XTJP 2KKZA 3TPQA 4GMJB 2MEWA 2F4VF 1ATNA 4X4VA 1D9FA 1UVNA 3FVYA 2NLWA 4NLTA 1BHLA 1HYZA 3AY9A 2NXNA 2C1EB 4IXCA 5K8NA 1VQON 1S6QA 3VQAA 3PEJA 4DX6A 1E4FT 3IC1A 2KFNA 1O51A 1NCLA 1F3FA 3MM7A 2PFDA 3P5JA 2VBXA 1ZYQA 3VQ7A 3PM9A 4F3OA 3R3TA 2ZD1A 4Y2AA 4YHHK 4KBOA 5B8HA 1OPIA 2MY7A 2DB1A 1G99A 2YNFA 1N5YB 2KB2A 4CHQA 4DPUA 2N4DA 1FT8A 4Y3CA 5D6GA 5K14A 2FSKA 3MCSA 3DGPA 3UB5A 2OPSA 4PG6A 5HO4A 4CEEA 1U0SA 2CADA 2IRUA 1KQFB 1T9XA 1VI7A 3KLGA 3LGMA 3M6WA 4DHVA 4J9PA 2EFGA 2IMOA 2MGZB 4NLXA 4CJQA 1AFJA 5K8OA 2KRBA 2MYFA 3QRPA 4FJLA 3ZSZA 1XEZA 2D74B 3D6MB 4DX7A 1T0TV 4FM0A 2GJIA 2B9EA 4MIWA 4A8WA 1TMMA 3E8OA 3LPTA 2QXFA 3VEOA 1O6XA 3M8YA 2FJXA 4Y0WA 5BR8J 1KEKA 4F7VA 3CJ9A 2W7OA 1TAUA 1IKVB 2CQ4A 2H48B 5IT4A 4LRDA 1NOZA 3MFHA 4CEAA 2CPXA 3FFIB 2VGMA 1SC1B 3GCXP 4DV2J 3IR7B 5ETQA 1YSJA 4EAHD 4U7UD 4NYPA 1XERA 3ZC4A 2Q0UA 3BGLA 4CZMA 1VQMN 3SV3A 1YTAA 2XB2D 2CJAA 4O3OA 4V19X 1T9WA 4R0JA 4CGHA 1H2UX 2C22A 2W7PA 2XZWA 3CF5L 4FWPA 1AZSA 5A8WB 5B0EA 5KFBA 4FKYA 2IFXA 4OYAA 2ZKUA 2KQ2A 4H54A 3OLBA 3FQLA 1URRA 2GMJA 5DZ6A 2F8MA 2M7SA 2OO4A 2V4JA 1C4CA 3EGWB 4KKOB 2BVZA 3JTNA 3J7YU 1C1CB 4JHDB 3DGVA 3PW0A 1F1BB 4K8RA 1P9QC 1RKIA 2HHHK 5AFUA 2VKRA 3HT3A 1X5SA 4FWLA 4OJ1A 4CD1A 3A5NC 3QICA 3UCUP 4Y2CA 4FPRA 2HBLA 3F41A 3EMTA 4ETZA 2W40A 1K47A 3K9KA 3K5NA 3Q22A 4NX9A 4HACA 3ZZOA 1IKYA 2N7YA 3M4XA 4UQGA 2HHHF 4ELUA 4F8RA 4CGIA 1JLAA 3QIPA 5GVQA 2OUGA 1NRKA 3H2VE 3ENVA 1H7WA 1NU4A 4H8KA 2ILZA 3BGRA 4KKOA 4F4XA 1NH7A 2LMIA 2M4MA 4ELTA 3OA9A 2M0GB 3CCRN 1YJNS 1JQGA 4N5SA 3FCWA 1HR0K 1H1VA 3NWRA 3JAMU 3QFWA 4RW9B 3CJTA 3PTWA 1HKAA 3X3UA 2D1CA 4PWWA 3MX5A 2O5DA 2XC9A 2XI2A 1UFLA 2BQUA 2IOCA 4X4QA 4M3UA 1WEYA 2QM1A 4KGZB 2R2RA 2WB1D 1SC3B 4C8KA 1SH2A 5BPMA 4EZ6A 5LMUK 1Y3JA 4B9TA 4A61A 3MPVA 1OPZA 3NG8A 4ZPBA 1SKSA 3SXLA 2HAIA 2NYHA 4CH7A 2MZ1A 1RLDA 2B0GA 4CF0A 1IV0A 3NGSA 3VOVA 4M45A 3DC2A 3HJVA 3VQ8A 1VC0A 1ASWA 4YR3A 3VALA 1R6VA 4M63A 1EAYC 1S4EA 2WK4A 1X5PA 3CJKA 1NB7A 5D4OA 3MDQA 2HGNA 4WF9Q 4G1IA 1WKKA 4A8XA 4DTPA 3HPHA 1MWZA 3WIUA 1Q18A 3CJSA 4OYZA 1OY6A 1SS6A 3T9NA 2GX8A 1KN6A 1CZ9A 1LAVA 2UUBJ 5KFHA 4WQ4A 1MN9A 3K57A 2KJVA 4YOWA 3MX2A 2UUCF 2HBYB 1XQSC 5ETPA 3KHLA 3DU5A 3MWTA 2ZJPL 2AW0A 4CI6A 4FVCA 2GAGC 1NDCA 1TKXB 2HHPA 3SBGA 4JKHA 4B1VA 5CXTA 4FZXC 3EX7B 3CDUA 3HD1A 2IAJB 1U6BA 4WFXA 2IS3A 3EZUA 2QG9B 2QIFA 1S6OA 2O67A 2V8DA 3HSJA 2OPPB 1ICEB 1N5YA 2HNDA 4QR1A 1TKTB 2DGQA 4F4AA 2YV0X 2I8EA 4CZKA 5T7LB 4DV5K 4P2SA 4C3MA 4WYLA 4OPJA 2RNEA 3KK3A 1HD0A 3VHQA 2FBVA 1Q5YA 4M3XA 1OKJA 3TZWA 1B4SA 3M8PB 3HZEA 3ISNC 1RTHB 4URQU 3DLEA 4F3MA 4I9QA 2NR0A 3Q8SB 4KRFA 3RB3A 1F9FA 3BR8A 2P9LA 2Q43A 5KAKA 2VA3A 2QWRA 4ANCA 2B6AA 4DUZF 1N34K 2V9WA 3SSQA 3EVWA 1WACA 4EIAA 1EWQA 1TL4A 4NYOA 1JJCB 1NBWA 4PPZA 4QS7A 3A4TA 4DR7F 1HQEB 3EE9A 1QAIA 4R0EA 1S0VA 4CF2A 3CMES 1H6KX 4OZLA 5L39A 5CHCB 3GE9A 4CLTA 4GV6A 3GWCA 3DRXA 2UVWA 3LPYA 2FJAB 2K1RB 3MZIA 2Z1GA 2VG7B 5AQJA 3VEZA 2MMYA 1WHVA 4BBYA 4OJRA 5J2NB 5B09A 2AJ2A 1HWIA 1IO2A 2DNZA 3SAGA 2PFUA 4K42A 1FO1A 1K9MT 3RMCA 3AQOA 2V2KA 5IWAJ 2ZE2A 2HIQA 1TQLA 4Z4GA 2EWSA 1PYOB 2P9UB 4ERDA 2RHQB 1RISA 3H42A 3PJ9A 2Q2RA 3JB9k 3V4MA 4JD2A 3WXJA 3A1YG 3FE1A 1I3OB 1RT6B 3PX6A 3T41A 3MD1A 1DHMA 2R9LA 2QGFB 2F9DA 5KOWA 4O5BA 1QAJA 2NUUG 1TL3B 1VQNN 1P6TA 2LYVA 4KHQA 3E3XA 2PIIA 2NXEA 3TTFA 1S0MA 4Q0BA 1WUUA 2QFIA 4MFBA 3VAFA 2E1YA 1W0HA 1RBUA 1HKGA 5K20B 3HVRA 4GVLA 5HK4A 2PC6A 4K59A 2CRLA 1KLNA 4AHVA 1RAOA 1K73T 2OAUA 2E7XA 4YOUA 1RILA 2AHOB 3TSPA 4WZQA 1NAQA 1FJGF 3H3NO 2VQFK 1VQYA 3A2FA 4YR0A 3HPOA 2E7WA 1Q9XA 3M8WA 2OTLS 3DLGB 2B3TB 4AHRA 4OLOA 1VC5A 3CQXA 3NF9A 2W42A 4DV6F 4EYIB 2A1SA 1ZS6A 3G86A 1V4TA 3FZLA 3BP8A 2ZHBA 3W63A 2O1PA 3EZWA 4Q0BB 4LFCJ 4UY8T 4CZEA 2ZNYA 1KVCA 1J2VA 4PXCA 2YTCA 4NL5A 2DGVA 2F1FA 4MT1A 1B0VA 3U27A 4FZYA 3ZX3A 4ZTJA 4NLOA 5KFCA 5AQZA 2VV5A 2CQ1A 4LF1A 1AXQA 2I38A 2GUIA 4DJBA 4X4TA 5DLGA 3CFRA 4OZ5A 1IBCB 5HRRA 3Q8UA 1JJ2M 3GP9A 3CJ3A 5I3UA 1AYEA 3ENBA 3OTBA 2Q36A 4CDIA 3L6QA 4DR7K 4U7CA 1HI1A 4RUBA 4CJTA 4K50A 2NRRA 3THTA 4I7FA 4LF7K 3ZX0A 4FWNA 1BQXA 4NLCA 4C8NA 3BQ0A 4YOVA 2DGSA 1B92A 4IJNA 4P75A 1J5OA 1WG1A 1KP6A 3GG1A 2VG7A 3TEHB 3WX4A 2IY5B 1WC5A 1YAGA 3BB5A 4LVOP 4U7UK 1NU0A 3WQUA 3QRRA 1K1SA 3UIQA 1GLBG 4BE2A 1HPZA 4B3SF 5AQPA 2BUPA 4OPAA 2CG4A 2FLLA 4UUWA 3Q8YA 3AFGA 4AUKA 1JLQB 3KLIA 3G25A 4IG3A 2LQ5A 1ZAVA 3SUPA 1I6JA 1N33K 5BREA 1T05A 2N3LA 2YX6A 2C2DA 3VMFB 5JXSA 1BMQB 4ZLPA 6AT1B 4FJIA 4LFAF 3C6AA 2E5GA 3MF5A 4JI3F 4FJGA 1R27B 4GY2B 2X51A 2KYXA 3NBPB 2YX1A 1RAAB 5GAEP 3N9UC 2VPZB 3QAEA 2JZ5A 1VHIA 2P9SA 4CTAB 1HNZF 1JK9B 2AP6A 1C0UB 2BDPA 3RMDA 3UFCX 4HL9A 3GFZA 2ITMA 3DXKB 5HMXA 2ZVIA 4WU3A 5DDPC 4L74A 1BI4A 2FVCA 4UF4A 2QI2A 4CFDA 2G0CA 3DOLA 5KFPA 4BWMA 3ILJA 4M1KA 2QLBB 1U6FA 2KXNB 1BE4A 2M88A 1FRXA 2BE7D 1U49A 4BHQA 2Z2YB 3GILA 4YP3A 4TU8A 3FZBA 3TI0A 3RB0A 4YFUA 4HH1A 3FGUA 2LQBA 1EKEA 2E1RA 4CGDA 2DNPA 4LSLB 4Y34A 2MTLA 3FRYA 3G6EN 1NG9A 1E6VB 5FPDA 4C11B 4F4KA 2D1KA 3G71S 1RGVA 4WFAQ 4QWCA 2Q3PA 4LREA 4LF5F 2A41A 1R8AA 4H5VA 4O5FA 4IJAA 1NGBA 3LOUA 1SKUB 2A42A 2YKNB 2LDIA 2EI5A 3KLFB 3GDQA 3PCOB 1F60B 4CZHA 3W1YC 3VAGA 5ELZA 5J1PA 2KU7A 2W2NP 2DPNA 1U48A 1X3NA 3P4UB 2YHAA 4YOXA 2RPIA 2UP1A 4OI3A 2R2UA 4Y1CA 4KO0B 3K9JA 3BZCA 4XH1A 1N56A 2Y0BB 3GLJA 2G4BA 2VF3A 2AJ0A 4BR7A 2AA4A 2LU1A 4NPOA 2AZ1A 1CS4A 2QYGA 2CNNB 1RWMB 1X60A 3L3UA 2HMIA 1RBTA 3ZTSA 5F8HA 1BOTO 4I4BA 1YXQA 4DLGA 2ZJQQ 2YBVA 2JEJA 4EFAC 1HARA 1VQ8N 2DHSA 4ZVUB 1GFWB 1BDGA 1NJWA 3NAEA 4D3GA 1NK7A 4LH4A 4YS2A 5BXIA 2GEMA 3AO4A 3Q86A 3F0NA 5KFQA 3OL6A 1PJ7A 2LXUA 1TKZB 3L4BC 4DUYK 1C6VA 4JRPA 5D4NA 2ZBIA 5HN0A 2L3MA 4CK2A 1HIYA 3GR0A 5BN8A 2R7UA 2JLGA 4RNMA 2ZOGA 2BE2B 2Q3SA 1P9YA 1XMQK 5C24B 1OQ3A 3LDPA 5AQLA 3M32B 1X4DA 3Q89A 3MXHP 3DI6B 4DR7J 2V34A 1YQHA 4MFBB 5LSRA 3QMQA 1ELOA 4G1PA 3CC7S 2VDHA 4KRWA 2RJZA 4Z4IA 3QFPA 4EP5A 4RBTA 2D0OA 4DN0A 4X65J 4WFYA 3BSAA 4DR6J 1RDCA 2P9UA 4TN2A 2Q6BA 2PAVA 3BREA 2EWHA 3RSEA 3IFRA 4TQSA 1FDAA 5CYMB 2W41A 1F9EB 2BANA 1C0UA 4RWWA 2N7CA 5AQWA 2YX7A 3R97A 4WJBA 2LEBA 1CJKA 5E26A 2N3OA 2HVZA 2QFJA 2JRSA 1R8PA 4CLPA 4LQ9A 4QW8A 3M5RA 4UT4A 4C0OC 1S6PB 3I5AA 1N33F 5K8MA 4ED0A 1M90T 4KV8B 3NMRA 1T3NA 3BYRA 1S0NA 2E1AA 5EN1A 2ACYA 1MWYA 4MYTA 1ZH5A 3OYAA 1VBYA 3VAHA 1WWHA 4WFNL 1UPMB 2SXLA 1H38A 1VSLA 2GS8A 1PIEA 1UOCA 3J7AP 3BV8A 2YNHA 2QKBA 4CJ4A 3W62A 3SCKE 2FVRA 4IOCQ 4DSKA 5L9XA 2F8EX 1H98A 3OYMA 2VODA 2PFFB 1Q78A 5JVHL 1Y97A 2UUWA 1WSFA 4AYBD 3EKUA 2VFVA 3VGLA 4JKGA 2FSJA 4CESA 2QW9A 5EWFA 4XIUA 2WRMA 4FYVB 2YJFA 2LQJA 2P51A 1FE4A 3R5GA 3H45C 3Q24A 1Q82O 3VQEA 3PZPA 3CCSN 2WOMA 4DU7A 3PNIA 2VYPA 1GTEA 2DFHA 4IFVB 4LSZB 1YZ7A 3THPA 3RBDA 5A2QU 4PUOB 2OMOA 2GWKA 1B9DA 4ENOA 2DBBA 2WSFC 3AT1B 4QPXA 2GVDB 4J2EA 2A2DA 3SSSA 3S3OA 1T9UA 2Q6CA 4CZLA 4YB6A 4ZLLA 5K9FA 1VJQA 2GW8A 5KFMA 2HFZA 4CVNE 2PMZD 3L3CA 1KC8O 3T69A 3TA2A 3B6PA 3G71N 3UVJA 3KLIB 1MN7A 2XHBA 3NMUA 2VPWB 3EGZA 3NWGA 3NY0A 4ZLNA 4KB7A 3JQKA 1U1NA 3DXMB 2EG1A 1HBOA 2BJ1A 4NLSA 2OEMA 5B7WA 4OKJA 1RDRA 4DFPA 2J0WA 3HSZA 1S1WA 3K5OA 5H9EK 2XZDB 3DRPA 4I2PB 5F1XA 3M3ZA 5M1FA 4F2SA 1VIXA 1XC3A 2PD1A 3T6BA 1CLFA 1M90O 4RUCA 2HBZB 5A8KA 2MLZA 2FUG9 1HUXA 1AA1B 1W7AA 4F2RA 2H3GX 4MAKA 2MXYA 2R7WA 4YB7A 2C3OA 2QEXS 4CEZA 3VVTA 3F5TA 1ILYA 3BKTA 4DV4F 2QLXA 4OLAA 1BUXA 3BUZB 4E8UA 3Q8VA 5J2QB 3CCRS 3GIKA 1VQ7N 2L41A 5E2QA 2A1RA 1CC7A 2VASA 2HNZB 4B1ZA 2IM0A 1GTHA 3KHRA 1Y5IB 4P71A 3TA0A 1Z25A 2I9SA 4CHYA 4I56A 4UOHA 4ED6A 5KQDA 5J1EA 3TX0A 1QM9A 3CJQA 5DM7Q 3CJKB 3QZ8A 2FZKB 3BH7B 4TXSA 4I6AA 3EN9A 3RW7A 1J27A 3RBZA 3BH6B 3IBFB 4DG1A 5J2NA 5KQ8A 3W2VB 2ZKTA 3EUNA 2G8UA 3MCPA 1Y9OA 2RAQA 4PKDB 4J91A 3H2UB 1M1GA 1YG0A 4F4ZA 2ZZMA 2AX0A 3EEQA 3DCAA 1VHFA 4ZCMA 3FFIA 3MR7A 3QNOA 2HVEA 3LP0B 1XN9A 1BG3A 3J8AA 5EVZA 4RW8A 3OQ2A 1QSYA 2DFEA 1Q53A 3DLGA 4KH5A 1H73A 1IH7A 3DMJA 3EVMA 2CWKA 4BY9C 2D0PA 2MKHA 3CUNA 4J37A 2YWWA 1R0CB 4ZP9A 3OVSA 4XH4A 3LDSA 1RNHA 2OTJN 2AJQA 2QC3A 1VRUA 4USIA 1J9AA 5F9LA 1SQEA 2ROGA 3HZ6A 3NCPA 2O4GA 1DTTB 2R2TA 1JL1A 2CJKA 1WG5A 3TOQA 2NZ4A 1FRLA 3RJMB 3RR8A 1GLJO 2G8FA 1HPMA 4O4GA 2V67A 4O0NA 3ZSVA 4DR4J 1C1BA 3BKFA 2L48A 2BACA 1A6LA 2XI3A 1KVBA 2BW7A 1RJJA 2G8VA 2FC9A 2Z30B 1NK9A 5BYRA 1W2BR 4DPXA 1OMSA 3GOIA 4C97A 3NXZA 4ES3A 4GC7A 3QWPA 5FDLA 3CFPA 3O9RA 3K5PA 2XSFA 4BREA 2AEFA 4PKIA 4ZCIA 4OFZA 2DY1A 1VSKA 2XMMA 3CETA 4JI8J 4WE1A 3QJJA 2LSNA 1T03A 2NPIA 4XDDA 4DX8H 4NZ6A 3TU5A 5DGAA 1WN7A 1PKUA 2CNOB 3KFWX 2IBOA 4CYUA 5AZIA 2LDYA 2HZCA 4J2DA 3N5BA 3NAIA 2OFHX 3TEGA 3M05A 3KTQA 1BA0A 4OZJA 2V4JB 1REVA 3MEEB 3G10A 1WLJA 1OJ4A 4QCLA 5THWA 3N4PA 1NXIA 2M5YA 2PEHA 1W7WA 4DQQA 3N4WA 1WTBA 4H4KC 1OH5A 5JS2A 1HQUB 1RB0A 1JB0C 4KBIA 1RDBA 2VZ9A 4FZVA 4FJNA 2GO9A 3LWMA 2P9CA 3MR3A 5BRFA 3HM9A 3V6JA 1RCOB 3O80A 2XEXA 4A59A 3CPEA 2FSNA 2W9AA 3PKMA 2Z1IA 5A0YA 4JI7K 2WB4A 4EUVA 1KQKA 2VHGA 5ETSA 1VDHA 3QWUA 5HL7Q 4J9RA 5LXYA 1RK8A 4PQUB 5JVGQ 3CIPA 3I87A 3TVKA 1R59O 1N5QA 3UKRA 1UCNA 3GFXA 5KFNA 3WC2A 4CNYA 4AXIA 1A5XA 2IIHA 4NRUA 3Q8RB 3IM8A 1T05B 1S1VB 2J6TA 4FWSA 1B9FA 4AM6A 3ZSWA 4NLGA 3PY8A 2KM8C 2I2YA 2MB0B 2YCHA 1OS5A 3EY1A 1E6YA 4PRFA 3NMAA 3TZYA 2FHKA 3N6NA 5IT9O 5D8HB 2I1RA 2RS8A 2E5LJ 3NH2A 4BR5A 3TX8A 4E98A 2D9OA 3KXDA 1X0PA 2KL8A 3PR4A 1XMQJ 4RPFA 2QK9A 1KDNA 4CJSA 3NL0A 3W61A 1BGXT 1HWUA 1MMDA 3CJ2A 4ILHA 4A5AA 2JVRA 5HBMA 5GAHP 2RVJA 2GO8A 3FZMA 4IUFA 4GVBA 1G2EA 3K58A 3MMAA 3TUZC 4DFJA 3MEKA 2CPHA 2HRYA 1L3SA 4O23A 3CC4S 2PGCA 3D6HB 1FFWB 4AQYF 2EG2A 4QJVA 4EI2A 4Q8EA 4ECZA 1EXQA 1U0HA 2VQEJ 4KGVB 4A57A 4DR5J 2NRWA 4DF4A 5L1LA 1SI9A 1TUWA 2QSFA 4B8AB 1RHJB 3C14A 1UZDA 3ZXWA 3JXOA 4FJ9A 2QE5A 3TO8A 2CUYA 4JOUA 2PSZA 4OHZA 4USWA 1H0HB 3D45A 3S7RA 5ETOA 2M8DB 2KZMA 5HROB 2EPIA 2RQKA 4GKKK 1JLFA 4NXMK 3DRYA 4KHPK 1TL7A 3BPSP 3CJ0A 2JJ4D 1RAHB 3AO3A 2D4WA 1HD1A 4DR5K 3DN9A 3VA3A 4A8YA 5LL6Z 1IWAA 1YF5L 3HYFA 4AHCA 5KG0A 1HNXK 4W4MA 3OR2A 3M8PA 3NGZA 3S3MA 4J9UE 4L6V3 2HF4A 5A8KB 1Q86T 4DCHA 2H5JB 4FYWB 4C8ZA 1B0PA 4BR2A 3QJLA 4ED1A 3O4WA 2FC8A 1LOTB 3OYIA 3WQTA 4MTPA 2VH7A 2V63A 1WOPA 3MXIA 3GTYX 2VQFF 2E2OA 2QMXA 1RI7A 1SV5A 5DO2A 4IOAL 5AQIA 2K06A 4R79A 3LP1A 2JFDA 3W7BA 2GHVC 3FCHA 3OY9A 2F8HA 3CCSS 3BO4A 2VFTA 2KO1A 3THXB 5AQYA 3KJNB 4HHUA 3UCZP 4LJMA 1LK5A 2ZZTA 3R9LA 3KUHA 4PXDA 3PJXA 2ALYB 3DDKA 4NA3A 1VQ6S 3NGDA 1M5HA 5DM6Q 1IQZA 4B9SA 2JOQA 3I6PA 4OI6A 1XI1A 2OELA 4X62K 3GB0A 3ZZYA 4MDAA 1BQNA 3HHLA 2ACMA 1RADB 4DV6J 3VV2B 4JI0F 2FVSA 4FJJA 4LF4K 4ID5B 1N6QB 2FHJA 3H20A 1DQ8A 3DRRA 2KG0A 1VQMS 4DL5A 1FFSB 1CJVA 1TL3A 4ZJQA 3AOCA 3H1QA 5F8JA 3AJDA 1HNWF 3ISND 3FBBA 1WNEA 3ZTRA 4TYAA 4WK1A 2KG1A 1XNRK 5K8PA 4GKJK 4BRPA 3FMBA 3CCLS 1S97A 3DLLL 3M9OB 1S9FA 4JV1A 5DZ7A 4DTUA 2JH3A 2DGOA 1YJ7A 3CPWM 4OIXA 3EO3A 2BJ9A 4AL6A 1BQNB 4YOTA 1CLQA 2GELA 2CJXB 4KGKA 2ASMA 1O13A 5BPLA 4FJHA 2MQLA 2XCPA 3KLFA 5I4MA 4OYIA 4O4GB 4P2XA 5KFIA 4OI2A 3CO9A 3DOLB 4F04B 4QIFA 4HHHA 4KO0A 4ED7A 1ZXOA 3IAYA 3V4IA 2NRVA 3FZFA 1HI8A 5FLXU 4LR8A 2RDJA 4P7VA 4Q5VA 3BF1A 1OYDA 4ITSA 3VQDA 3SJHA 4HHJA 5E41A 3HHNB 5C7PA 4C8YA 1S79A 3QGGA 2XG8A 4CIFA 1F6TA 2IRXA 4WP8A 4E0DA 1MLAA 4KREA 1I1GA 3H5SA 3BY5A 5DQGA 3S6EA 4USMA 4I2PA 3C15A 2HHQA 2XYHB 3UNGC 3UD4P 1QZ5A 1FRKA 3RU0A 5C5JA 3GFYA 2V6AA 5EWGA 4M3TA 5E3QA 4ED4A 3VF4A 4DDFA 1NJYA 2H9ZA 3IRWP 1TMJA 2XWXA 2O8FA 2MQOA 4K4VA 5JVGL 2G8IA 2MQQA 2ZUGA 5GAHI 2FF6A 2HPUA 5HQ8A 2BRLA 3TRGA 4FF4A 3O9TA 1FEEA 2HG4A 1N32K 5MAOA 3M1FA 5DDQC 2B8PA 2OEKA 1SUQA 4ER8A 1EQMA 1HX1A 1IBLF 2W2PP 2Q97A 2RKIB 1XK8A 3H98A 4XEIA 1YJWS 1U1LA 4WZMA 4GV9A 4JI5K 4WCEQ 2CXEA 2ILYA 2XYGB 4C0HA 1YJRA 1UVMA 2UVVA 2JHEA 4LIWA 1UA1A 1IJJA 3QEWA 2DY4A 3R7NB 5LMUF 4DU4A 3F2KA 4G65A 1IKYB 4CEDA 3HHDA 1RWPB 1VQOS 3I0RA 3WT0A 3JS9A 1URNA 3OTDA 3BPDA 2F96A 2XMUA 3MURP 3ZSYA 2IBKA 1RSCA 3IRXA 3C7NA 3Q7BA 1NJIT 1DRZA 3HVTA 2E8AA 3AGRA 1FEHA 1SJ1A 2WONB 4BACA 1E6YB 1FXRA 1VSFA 4LF2A 2X1GA 1JCFA 1N0UA 3C6UA 4I6MA 1FNOA 5IT9U 1XMOF 3I32A 4CGFA 3A0IX 5ETTA 1RWUA 3DLRA 1HYSA 2KXFA 3GONA 3I0SB 1JKHA 1QLNA 4DFMA 5KFXA 3MWPA 1RBVA 3C95A 3KLHB 2B7BB 3D9BA 1NM2A 1Q16B 2EVZA 2F3JA 4ZP7A 1GT8A 1FKPB 5IV4A 5GAHU 4DPOA 4YDUA 1UL3A 4KHRA 5HJYA 1V3SA 2GZOA 3QGHA 2UUAF 3I9ZA 4UZBA 4M42A 4R5PB 3HKZD 3AB2B 4NZ0A 3UDEA 4MYUA 2B4UA 5E5NA 1JXBA 3A3PB 2FYXA 2Y1LB 1AROP 1X9WA 4N77A 1T44A 2G13A 2K7KA 3UR3C 4CJWA 4OI4A 4LF7J 2R7VA 1QE1A 5KI6A 4Q8FA 1RT4B 1HMVA 2Z57B 2RN2A 5FRNA 5CE3A 1Q7LB 4FLYA 3J7A1 4DV2F 1MWQA 4ZCLA 2DPJA 5L8RC 3MMCA 5HLFA 1PC5A 1GLCG 3MXMA 2LXIA 2CKWA 3VF2A 1WC4A 3ATVA 1X9MA 2DR6A 4EK2A 3QNWB 5KRTA 8ATCB 4PZVA 1CZAN 5CY4A 3ZT2A 1XR7A 3D6RA 2RQCA 1WEXA 4ZCKA 1BISA 5B0GA 4ZPCA 1Y5NB 3MECA 1YITS 4CZGA 4FWOA 5BRDA 5AQKA 3VEVA 4AT1B 2DKOB 4DU1A 1QE1B 3K59A 1CJUB 1AUSL 4YQWA 3QIPB 3CW2C 5F0WA 1U2VA 2OZMA 1B7YB 4GMKA 2GX9A 1ATSA 4RBVA 3ENAA 1VQNS 1SQKA 2OCEA 4ZIWA 4NLYA 1NM1A 2R8GA 2QSWA 1XJWB 1JJ2R 5KFZA 2HRUA 3RTVA 1WSHA 4HLBA 1LWXA 1JWWA 4QIGA 1RT3B 3G4SN 3OHAA 5J1EB 2KW4A 4RX6A 1VK3A 2YQ3A 2IVYA 2UUAK 1OWXA 3VQTA 3J7YI 4NCGB 1RHQB 4DV7F 3CD6S 1RXOB 3RSEB 4BC3A 1HWKA 5B0DA 1NNEA 4YY3F 4BRFA 2I5JA 4Z7CA 2B51A 2VBYA 1WF0A 4UTGA 4YR2A 4CT9A 2V8HA 5TKWA 3R5CA 4OYOA 4ZLJA 2WONA 2EXUA 4IFEA 4USUA 3LAMA 2VKZG 4IOAQ 9ATCB 3TARA 2HFSA 1SH0A 5AXMA 3MR5A 3RMAA 2KVQE 2Z58B 4DL0C 2MLYA 4DV1F 3LGHA 3OJSA 2FGCA 5IV3A 4MQ3A 3M30A 3OPKA 4KHPJ 2NQPA 1BC6A 4DTOA 1NGCA 4LF8K 3CD0A 5F2RA 1EETA 5DS7A 3KLHA 2ZHOA 4E2FB 4OV1A 4ECTA 2H65B 1FESA 3VTIA 1M5VC 4FSVA 3SCXA 2KN4A 4DR1K 2P9SB 4KFBA 2H5IB 3R27A 2UXCF 4IWVA 1ZM9A 1HBNB 5E84A 1U1KA 3TAMA 2GGPB 2KYZA 4FNHA 2G1DA 3CIMA 4FW2A 3VQ4A 2P9GA 4PPDA 5EXWA 2DCLA 2BRKA 4DR1F 1VHXA 2HHHJ 2BA9A 2CPYA 2HQIA 4ID1A 1UEKA 3QYYA 1NDKA 5KFEA 3VESA 1VQLS 1VJWA 4DR4K 2ADCA 3G6ES 1VRQC 3RWUA 2GNKA 1WSJA 3IBWA 1B70B 5AFUH 4RNOA 1JLFB 2MJUA 2CNKB 3HSTB 4K4TA 4ANDA 1UJ5A 3MMCB 4H0XB 5KOXA 4DUYJ 2CYYA 2MY8A 1OH8A 2VC0A 4OL8A 2JEGA 3LM2A 2Q1LA 4DS4A 5E7OB 1GMWA 2WC9A 2UV8G 2GUPA 4BRQA 2F63A 5C42A 2J5AA 2KFYA 1ZTTA 1HBNA 2LEPA 2ZWOA 1YKWA 3HT0A 1NEEA 1WSEA 3OV7A 3TAMB 2BTFA 4E7IA 1Q8LA 3I55S 5FROA 2GJFA 4KAZA 3BM7A 1NJZA 4CK1A 4W5TA 2EW9A 2P8IA 1CJUA 4QWDA 4JUZA 4K25A 2YNGA 3H1VX 3QESA 4CK3A 1X4AA 4N47A 4ECUA 4LR9A 1DLOA 2Z2MA 2VQFJ 1QJHA 3DU6A 3I4HX 1QD1A 3NDKA 2M70A 4V19S 2FJVA 1G3OA 2PE8A 4ZDNA 1NNDA 4LF9F 4B3RF 4YDXA 4DR3F 2FHMA 4F4WA 1FXLA 3LGNA 1HNZJ 1HI0P 3V9SA 3R8YA 5C15A 3J81U 4DL6A 4K7QA 4JKBA 4DN9A 1C0GA 5IQ6A 1YBAA 1H2VZ 3KJFB 3NGIA 4X4PA 1VSHA 4AL7A 4DV0F 1FW6A 2OIHA 3C65A 3CJ8A 2IMWP 1TYQB 4U8YA 3KJVB 2L9DA 2GBZA 1FKPA 4CFAA 3ICLA 3MM6B 4C8OA 4AF1A 3KUEA 3VVUA 2VJUA 3E1YA 3ZSQA 4ILGB 2ASJA 4ECWA 2WFBA 4LT6A 4F02A 5C10A 3CM5A 2MKJA 4DUZJ 2OH2A 4DMZA 4M5MA 4BGAA 1DEJA 1TU0B 2V4RA 5LMNK 2BABA 3O08A 4BVPA 4F3QA 3FEZA 2RRBA 3DDIA 4YNQA 1AB8A 2WSCC 1RT7B 4HTIA 1T11A 2XS5A 3OYFA 1Z6RA 3D1HA 4Z2XA 1TUUA 3CB4A 5G4DA 2RDDA 4FLVA 1NK8A 4Z0UA 2DNNA 3FZKA 3PIPQ 5J2MA 4A5BA 5HP1A 3P96A 2WVFA 5LMNJ 3AOAA 3IKMA 3TA1A 2MQNA 1ZA2B 3GJQB 4NXNK 1ZM2A 3ZTQA 2DR9A 5D4LA 1VLOA 2POKA 1P1LA 3AVIA 3IAM9 4DQIA 3VQPA 5ETMA 5CR4A 4CO3A 5AJ3F 1S9EB 1FDDA 2H3EB 2DH7A 1FD8A 2C3PA 1R8HA 2M52A 4QOTA 2P9IB 2E1PA 2CJQA 3Q23A 1GLDG 1TFYA 5T14A 4HDHA 2A18A 5HROA 3HO1A 4DB3A 1Y3KA 2HVDA 2HK2A 1DTTA 1YWXA 3O6WA 3PSIA 4BC4A 1WI8A 5ADXA 1N54B 1ZETA 3IMXA 3CT9A 2WOMB 1X5OA 4KHUA 3QGIA 3SUNA 3M6XA 4LFBJ 3J7YP 3MECB 5MLCQ 5EY4A 2NSBA 5HVHA 3H59A 2MKCA 3VQ6A 3POTB 4RW4A 2IIRA 3TSUA 2MQ8A 2UVRA 4X65F 3G82B 3IR6B 4JI1K 4IG0B 1Q5VA 3CHWA 1CJTB 1RTJA 2GV9A 1TR0A 1VQKS 1J54A 2DVIA 1V4SA 1UVJA 3RW6A 4WIQA 4BVOA 1P1TA 2KT2A 1N5VA 2M8HA 3R1HA 4DQ8A 3KJQB 4I0WA 4HTUA 4NO7A 3NNCA 3U9DA 5GINA 1X3MA 3ZZPA 4USJC 1N33J 5LXRA 4AD6A 4Y28C 1RBOB 5CCMA 3CO0P 2NCKL 5IM0B 1Y5LB 2AV5A 4G3IA 3A8KA 2O3DA 3H25A 2C28A 1XHXA 3DYAA 4NB4A 2OD6A 3DRPB 3EE8A 5IC6B 2ZDPA 2OTLN 2DT9A 1OH7A 3H5XA 1KONA 4ZPVR 3UPFA 3D66A 4FVMA 4Y2IA 4B3TJ 3UD5A 3TANA 3JSYA 4ZPDA 3WEEA 1OY9A 5LMNF 2VOOA 4HDGA 1WHYA 3G8SA 4JYAF 3MMJA 3PW2A 5CZVA 4DTNA 5FDLB 3WXIA 5A6PA 1RCXB 3KLEA 1SKWA 2VG5A 3F9KA 4EMDA 1C0TB 2DR7A 3QIOA 1HLWA 1EETB 1PYTA 3AVHA 3AVAA 3H4BA 4J9SA 5C2CA 2XMWA 3A3NB 2EFPA 1UVIA 3TAFA 1WI6A 1QUVA 4ECYA 2XNRA 4KGMA 2VGNA 2K3IA 3ASMA 1U2RA 1T6CA 5M2UA 2CQHA 2GGPA 4DLEA 1Q1KA 3IGVA 2YQ0A 1YTUA 3AAPA 3J81j 3G6XA 4IOXA 3NS5A 3V9XA 3OYLA 2YY3A 2X78A 5L46A 3SPYA 5CYQA 3FCVA 3ULEA 4BRHA 4WU2A 5LSOA 4ZVOB 1U45A 6FD1A 2V69A 3N5FA 3L2VA 4JI2F 1GLFO 3EZ5A 1T9VA 2HAFA 3TJ8A 3IGNA 1MW7A 3ILOA 1S1UB 1S9GB 2F65A 2RD5C 3PRDA 1LWEA 5EX3A 2CVEA 3CCMN 4U8VA 3DMJB 5A0YB 3MN9A 1EQYA 4FK0A 4FXWA 3SFGA 4CLSA 2J7UA 1CG2A 2EFVA 2Y9HA 4RNHA 4C3LA 1WC3A 2CVIA 3UKRB 4WKYA 3A8YA 4NOHA 3M2VB 3E01B 1TL7B 1J5OB 3AA8A 2N4CA 3F73A 3ALYA 1NSAA 3WX8A 4A4JA 3VGTA 4K5SA 4RG8A 1UZHA 3HSGA 3HI9A 3RVCA 4A8FA 3IS9A 4HCCA 2ZC4A 4H0YB 3IXQA 2Y3YA 1NHUA 1X1PA 3B4DA 1R43A 2B4PA 2GMLA 4OHVA 1FRIA 4JI0J 1U2CA 4OYBA 1R7IA 3O9SA 4MKAA 2IHR1 1QQMA 1EKRA 5M1KA 2UZAA 1NPKA 2Y0SD 3L2UA 1SUQB 2APOA 2QZ8A 3SIPB 5GADI 4MIBA 3MCMA 4LFBK 4X65K 4J9LA 3PO5A 2YJEA 3Q2SC 3T1YJ 1RT7A 4QW9A 4CFCA 3CXCR 1HWJA 5F8MA 4O3PA 1WOSA 2XY7A 3THXA 4LF5K 3MM7B 2ATQA 1X4CA 5AZIB 4R25A 4GW6A 3OSNA 3C7NB 1SV5B 2P9PB 3JSMB 4H0OA 4HT5A 2ZH5A 1NGEA 4Q43A 3HXMA 2R7YA 5RUBA 1IXKA 3B6BA 3KK1B 1VCTA 3U1MA 4CW7B 2W01A 3TUIC 2E6MA 4DV0J 4DL3A 1I94F 2YVSA 2MHNA 2B7CB 1SQGA 2F4FA 2OZSA 3FDSA 1HYVA 2UVUA 3AD8C 2HURA 4NYNA 3R8EA 4KHSA 3ET6A 1IKVA 5CYMA 4LRBA 4KFBB 1S5JA 3QERA 2QEXN 2ZH1A 1KAZA 4CBUA 3I0SA 1CQNA 4WXWA 3EYZA 3W5YA 4ZKAA 4GC6A 2IC3A 4KPCA 5AQVA 2OPRB 3CJBA 3OXLA 4ZP6A 2HFUA 3RYLA 3T1HK 3BO2A 2W6KA 2W8KA 3OTOJ 1F5BA 1S99A 1H74A 2HNYA 4XPCA 1DJ0A 3CXCM 3FMWA 3NP5A 3CCWA 4HVJA 1PGZA 4NLBA 3CSKA 1RT2A 2Y1JA 2HSTA 1FDNA 2OA8A 4JK9A 4CD3A 3C6UB 2OPPA 4I6MB 5KGXA 4LY7A 3T1HJ 3L7OA 3GIIA 3CM6A 3OTCA 4C4WA 2D0CA 1T3VA 1R3NA 4JKGB 3PX0A 3ZT0A 4I2QA 3CD5A 2FB0A 3T1AA 2RT3A 4CJRA 2V8GA 5L38A 2W6LA 2PY5A 3K2YA 4NLPA 3BBFA 4ES1A 2IYGA 1VQ9S 3H5YA 2BX6A 4IFYA 2EFNA 3SMPA 4ECVA 3P39A 4GO5X 1DAXA 3UE5A 1VQ9N 4KAIA 3G4SS 2F4VK 2OEJA 4ZVEA 4UY8O 2E2PA 5KT5A 1B99A 1N8RT 1NSQA 1XQIA 3IFEA 2EX3A 2B6AB 2AT1B 3PKYA 3UE2A 1RTIB 3EDRB 2BEFA 3PRBA 1LV5A 2LVWA 2O8FB 1N34F 2WTFA 3W8GA 4M7YA 1KHVA 1YX2A 3HSDA 2QV6A 2HHSA 2VG6A 3OFHA 3BSOA 1WKLA 4DL7A 2H5EA 1GLAG 2QLFB 3KLGB 2D3OR 2NUHA 2ZOFA 4G1QA 3AB4B 5F3TA 2XMKA 4F0MA 2YWFA 2OP5A 3RMBA 1HW8A 2HWTA 3LP2A 3QT8A 2H54B 4NCGA 5C24A 3OYJA 2DHAA 5KT7A 1JLCB 2YNIB 3OXGA 1V5IB 4IKAA 4O3NA 1Z2ZA 3AXKA 4R8UA 1U7LA 3MCAB 2I5JB 3HDSA 2ZBRA 2PEBA 4ZHRB 3NGKA 4TU7A 4KI4A 1W9HA 4EBCA 4M5JA 5ETKA 4ICLA 3LP1B 1QVFR 3C6TA 3B4MA 3EJMA 2OJ3A 1RWWB 1KVAA 1C1AA 3GIMA 2VA2A 2PYLA 3Q83A 3K7RA 4DSIA 4CQ1A 2HQCA 4WFBL 4B1UB 5AXKA 1JCEA 2KLAA 3KOAA 3M6GA 1B7FA 2AGOA 3MAQA 4OYMA 3KKSA 2R7OA 4LD0A 1Y11A 2RRNA 2E9TA 4B8CA 3A5OC 3CJ1A 3UN2A 3J7ZT 3U1LA 2XGQA 4FS2A 4BLGA 4CEBA 3LALA 5AQNA 3RB6A 2ZM6J 5M1NA 4USHA 1VQ8S 1X4EA 3SMSA 3QEXA 2CQPA 4LF8F 4PR6A 3R6GB 2QLJB 4O44A 4XTTA 4QS9A 1PJ6A 4FJ8A 1YGYA 2IDEA 2OPQB 5AT1B 1LFWA 3ITHA 2CFXA 3FK4A 3FZ2A 5D78A 2V51B 4EHUA 3GYXB 1RFQA 3JTOA 3BJYA 1NHKL 2B4JA 1PBUA 2E5HA 3DLHA 3QBWA 2P9NB 3B82A 1JX4A 1Q4RA 2W24A 1AT1B 2ZWPA 5F8GA 5M1QA 4C6AA 5CQGA 3K8WA 1FWLA 3E51A 4KT0C 4FLXA 1TKZA 1WBBA 1LXNA 1G6BA 1BY9A 3D0IE 3W5XA 2JC0A 5EHHA 5DQIA 3NS6A 1RHRB 4X4NA 2MZJA 5BRHA 4K8XA 2R7TA 3I33A 3L4IA 4LUBA 3LH2S 1Z2LA 3UQSA 3AVLA 5M1OA 4PWDA 3VWSA 1LWFA 1GOAA 3CGIA 1T02A 4DR1J 2HF3A 2CDQA 1KOOA 4B3TK 1WOQA 3CFOA 1IR2A 4X2BA 2RS2A 3QT5A 1MMLA 4FLZA 1LW2B 4LQ3A 1Q81T 1D1UA 2VJVA 2DNKA 1NKBA 1S3XA 4KYZA 1TFWA 1Z05A 1SCJB 4DPWA 1WJ9A 4Y2MA 4LF5J 2ROPA 1NGHA 3U8XA 1U0HB 4NI2A 2FTRA 2I7NA 1D0EA 1ZZNA 5FRMA 3TVYA 5HI7A 2A5XA 2WBMA 2BKPA 1X5TA 4JYAJ 3SI6A 4WYBA 1GH8A 2E2QA 4HT7A 1KQGB 3IG1A 3WZ0A 4IH6A 2C2RA 4QIVA 4M3RA 2V4QA 3AVJA 5GMDA 1RT2B 4ZPWR 3ZT4A 2HS0A 4XH5A 4F9OA 1E3MA 3THVA 4BQLA 3QATA 1OO0B 1ACMB 2G1HA 3U3YA 3DXBA 1VSEA 3WDOA 2E88A 2F8TA 2BOPA 3CYMA 4HYKA 3R7SB 4CIEA 1IKWA 4CECA 2RRAA 4HHTA 4NLVA 1RTHA 3SUOA 4M41A 5I3QA 1TV6B 4FKXA 4X66J 3IRXB 3D5MA 1OSCA 1YBUA 5KPTA 2E1MC 1LOUA 3O1WA 5CCLA 1AFIA 4G9ZA 1GX5A 3ZNUA 3AJ1A 4IQMA 1IWGA 2XM3A 4W5OA 4LF9K 4B3RK 4LBHA 3W2WB 2HYIB 3HP9A 3UO0A 2MKKA 1S1UA 1S9GA 5KFDA 3AD9C 2IM2A 5LJ5Y 4FVUA 3CDBA 4CEFA 2RIJA 3ZZRA 2LQ9A 1KBRA 4C9DA 3V6DA 2ASOA 3KWGA 1KQSR 4LBIA 3W64A 1NSPA 4P6QA 5DETA 4JP8A 4USTA 1LFPA 3NCIA 2J9DE 2XMVA 5EUHA 3BYPA 2XWYA 1K8KB 1XNQK 2DEJA 4OI1A 4CJLA 3QBXA 1VQ6N 2MZSA 4TY9A 4EGLA 4U67Q 1TTHB 2HHXA 2BJ8A 4DV3J 1EP4A 3PR5B 1QS4A 1X4FA 2H4YB 4WF9L 4CHZA 1KVIA 4NLWA 2HMIB 2G9OA 4ZP8A 2HBRB 3CJ5A 5J2QA 1RT1A 2GQQA 2B5JA 4NLUA 3SPZA 4CZCA 2M9KA 1WELA 3D67A 4J9KA 4EBEA 3WXKA 4O55A 2NXCA 1T03B 3A8JA 4NYZA 4RO0A 5H9FK 3BDEA 3WNGA 2KVIA 4NI2B 4I64A 4P2FA 3CJCA 3H4DA 1VR6A 4L73A 3M6UA 5D0HA 2C2MB 2CPIA 4Z4EA 1DARA 4CWBA 1Y0HA 2I0XA 4JKAA 3BQ2A 2IDLA 3DI6A 1N5TA 2G2ZA 4KJIA 1DZ5A 5FJ4A 4DV6K 1KVKA 2IVFB 1GX6A 4YY3K 4M5DA 1YLXA 5ETVA 5DJBA 4DUTA 4Q2LA 3BDPA 3DJCA 1T94A 2ZJQL 3HVWA 1FX4A 4ZS6A 2XO6A 3PSFA 1OH6A 3DHXA 1MSWD 2XLIA 8AT1B 3JSRA 1LNQA 4B9QA 4QS8A 1N52B 1HHQA 3PDNA 2IPOB 2J0SD 3AV9A 4DU3A 1QQOA 2ZM6K 4HACB 3TAGA 4KIAA 4Z4CA 5L1JA 3HHLD 3GSDA 2J0QD 1I5OB 1OSDA 4RTFD 3UN5A 2YKMA 2E5LF 2O8DA 4WIIA 1YI2S 2B9YA 3RRHA 2RU9A 1SBRA 2ZH6A 3OYBA 2MGZA 3GU0A 1X7VA 2W9CA 4HUGA 3C8YA 3NH0A 3P38A 4JI4K 4DR2F 5J2PB 3W65A 2UU9J 3I8DA 3DWLA 5I42B 4M5NA 2RHSB 5FLXY 3HZGA 3O5TB 3GYNA 3SJJA 2YX4A 1WAJA 2R3VA 3ADAC 5KTQA 2U1AA 2BZ2A 1U1PA 1WB9A 4FK4A 3D6TB 1GLLO 2PO4A 4BRCA 4BG9A 3QJPA 2OPQA 1KXPA 5CYQB 5GADU 4RNFA 4FJ5A 2Q0RA 4MO4A 3PYDA 1KVJA 3OFEA 4FL9A 2BGGA 4JI8K 5ADZA 1REGX 3I0RB 2BM1A 1P90A 4JD2B 3D1QA 1HNWK 4IFVA 4U96A 1L3UA 4HUEA 3PYEA 3NRBA 2OMLA 4F26A 4WTOB 1VQ7S 3QEIA 1SAZA 4DTXA 3L8BA 2O01C 1EB0A 4K4UA 4Y00A 3BN7A 4M3YA 4CF1A 2NXUA 2XZTB 1JNZB 4ILMA 4K2XA 2DD8S 1F5AA 4IOCL 3BZQA 1T7PA 2E9ZA 2NSCA 5JVHQ 3ENHA 3S41A 1VYAA 4CJVA 3KD1E 3FUYA 4LBPA 1HBOB 2Q1NA 5KT3A 2YH0A 4GRSA 5AXLA 1T9YA 1Q8BA 1YIJS 1N4LA 3D2EA 3C94A 3MXJA 3CMAN 3O6QA 2UUBK 2UV8A 1S1WB 1S77D 1KAYA 2FJWA 3VENA 4FDFA 2MZTA 3CMAS 4YN3B 5C2FA 1VFJA 3L09A 2PN6A 3DHWC 3AGKA 1C1BB 3MUTP 5HVFA 5KG3A 2OFGX 2DRBA 1UJ4A 3NVMA 4JS5A 2XSJA 4X66F 3ZSRA 2BOAA 3T9ZA 4BR4A 2HS3A 4R8UB 4A8OA 1BLUA 2P9EA 4FBTA 1RA6A 3DLJA 1CBKA 4KHPF 1SJ3P 4ATNA 1FTCA 1ZBLA 2QWNA 3CCTA 3MM8A 1S1VA 1F5CA 3ZTOA 3V1QA 4LIRA 1S76D 1DTQB 2FJDB 2Z56B 5IZHA 1I3AA 1K9MO 2HOEA 2V2QA 2W7AA 1K44A 3JAMY 4Q7AA 1RGIA 2BJDA 4PG7A 2V94A 2VG5B 3TR5A 3OBIA 4BDZA 4M94A 2QO3A 1W97L 1RU2A 3O3LA 4K5RA 3D28A 3C3LA 5D77A 2VD3A 4CH0S 4WYWA 1WDDA 4DG1B 3HRGA 4B9NA 4JI6F 3MAAA 1L5UA 1TV6A 2OLWA 2GHPA 2MKSA 4LRFA 2C3YA 4NA1A 4TKTA 2BJ3A 1T3OA 2OTJS 2HBKA 4KTWA 3JXUA 3D2FA 2D7SA 1RHKB 1SIWB 4F50A 1RHUB 3ZYYX 4BGBA 4M5HA 2IJFA 3OYCA 4CJPA 2ZH9A 3C46A 2IVNA 4BC2A 4IR1A 2C2NA 1KKHA 3QGPA 2BQ3A 4H0VB 4LF6F 1RWKB 1ULRA 2ABYA 2IM1A 3NFAA 3MHYA 1EZZB 3THYB 1WDTA 3N01A 3P3DA 1GXLA 3DYAB 2YI1A 3R2CJ 2R7XA 2QN6B 3DKDA 5JLFA 4JBCA 2UU9K 3FBFA 3JS6A 3M32A 1DY3A 2VWBA 4DR3J 3CMQA 2ZGZA 2G8KA 4P7TA 1QY7A 3TABA 1S6QB 3FQKA 4URSA 2R7SA 3CD6N 3OTOF 3HBTA 4CI0B 3HKWA 3NE6A 4NXMJ 3HCXA 4X4SA 1VMBA 5G0RB 3HP6A 3OYEA 4NASA 1U02A 2RUSA 1EO1A 3OW2M 1NUEA 2YWEA 2OSQA 2UXBK 2VUGA 4AM7A 4UOGA 4C11A 2RKIA 4H5TA 5CZXA 4PWUA 3CCJS 5CZ2A 2VC1A 5H1SV 1VS3A 1SPBP 2C2KB 1C0MA 2FVQA 3TYTA 5KFWA 4RU2A 2VG6B 5AE1A 2E4LA 4NMLA 3P83D 3AHPA 3D54A 3QFUA 4FO0A 2LU2A 4EYHB 1BU6O 4RW7A 3ZFVA 3KDNA 2LFVA 2XY8A 4RW6B 3B6OA 3SLCA 2QT7A 2DRDA 1EKSA 1NSKL 2KT3A 4JI5J 2YNHB 2WW4A 3ATUA 1M1KT 5IC4B 1U8WA 3PUFA 3SMZA 4LF4F 2VFSA 2HVIA 3VEXA 4QPTA 1SL1A 1X4GA 1S12A 1MMNA 4L3KA 4BRIA 2ZITA 3MMBA 1RKJA 3M8RA 4NXNJ 1LW2A 1YVNA 5D3GA 5LOQA 4M7XA 2FJBB 2VONA 1K0TA 3TQ1A 2MSTA 4IOBA 5AQRA 4E1JA 3MPYA 4BROA 4J7CA 4B9VA 3S8SA 4KTQA 1CJKB 2OANA 4MK9A 1FVSA 4I1TA 2O4IA 2F9WA 4AXJA 1NLVA 3D6FB 4LRAA 5A2QY 4CRJA 3OUYB 4IH7A 2CIMA 4FM2A 1PO6A 3GIRA 1Y64A 3AH6A 3KK1A 3P4IA 1F2GA 4K4SA 2QMWA 3L4QA 1SJRA 4HI2A 1TK5A 2FZCB 1G4CA 1EARA 1UAWA 3EGVA 3W8PA 5A8WA 3VAKA 1F0XA 1PG5B 2F7TA 2DXFA 4C3KA 4FCYA 5B0BA 3FSXA 1HNZK 3OLAA 4QR2A 4ZHRA 4FXVA 2DFFA 3HLUA 4CGGA 5C2DA 2E29A 3OL8A 4Y2KA 3THYA 4RL1A 2FJEB 5AQGA 3K8VA 4ZPAA 4LFAJ 5KFRA 2E20A 3IWNC 3V6KA 4AILC 4J2BA 4J8FA 2YKQA 1YITN 4BC7A 3D4JA 4AHUA 1QSSA 3SQGB 4JLHA 4H4KA 4OX6A 1WF1A 1IN0A 1TP7A 4QBUA 2BR0A 5KG5A 2ZHAA 3WHIA 1YK9A 1FD2A 3BKUA 4O8UA 4KV8A 2AYGA 2KHCA 1KTVA 1R0BG 3CJ7A 1MWKA 3BZKA 1LQ9A 4RCHA 7AT1B 4CLKA 3O4QA 2GFFA 3H3OB 3CC2N 4IG3B 4CIGA 3K0JA 3W66A 4PL7A 1TUYA 2B4VA 2A3JA 1C4AA 1RDDA 4DHYA 1XWLA 4CHPA 2HQ3A 4OX9K 2W25A 3OR1B 2VDIA 1Y00A 3U4LA 3MAHA 3VAIA 1UA0A 4DZDA 2AEJA 1KQSM 1DFDA 1Z1ZA 3QNNA 1CVJA 3P8BB 1YUWA 3AO5A 3R1XA 2DHHA 1WNSA 2KRRA 4JI1J 2U2FA 3LW5C 5JS1A 2O66A 5HMWA 3OR2B 1JLBA 4H5NA 3MK6A 4HH0A 3UN3A 2KHOA 2PA3A 1HNVA 1FXXA 3TW0A 2P2CB 4NEZA 1Q7YT 1W25A 1FE0A 5CA5A 5FPMA 3OBYA 3VQBA 1EP4B 5IXUA 5JICA 1Q7YO 1ZBIA 2ZEJA 2HIYA 3TUJC 4ECQA 2YH1A 1UWBA 1KOHA 4FYYB 1Q86O 1ZM4A 3H6EA 4DEZA 2EKYA 1EHWA 4LC9B 4BC5A 3X1LB 5IT0A 1BQMA 4Q45A 4X4RA 3QRQA 2YKOA 3BN4A 3RR7A 4CF8A 3ZT3A 3U9ZA 1RBLA 3LL3A 2MPUA 2V0NA 2JC1A 4PXEA 2W2QP 3MTJA 1S57A 3C6TB 4FM1A 1IG9A 1IBLK 2NUBA 3TJ9A 4ZPTR 3HHLB 2KT5A 1J5EK 2NRHA 3WIVA 4CBXA 4F0KA 3OVBA 1Q82T 4CF9A 3SZ2A 1Q95G 1FRHA 5DG7A 1CQMA 1V3ZA 4PAAA 1X9SA 1RBRA 2FZGB 3CCQN 1GAOA 2ATCB 2EK6A 3DLBA 2PYJA 1NK5A 4NXMF 1D09B 2VB6A 2AX1A 3V1OA 2QJ3A 1G1XA 1IM6A 3FJ2A 4YDUC 1Y4ZB 4JI8F 1XNRF 4GKJF 1FERA 3SQ2A 1QVFM 2GIFA 4DCOB 2BMBA 2HQGA 1HR0J 2DNGA 5C0YA 2V8PA 3OD2A 5AQTA 2AEMA 1GLEG 4MH8A 4OYPA 1H72C 1ZM3A 4CEOA 2GA7A 4H03B 2QL5B 2DIVA 4TNOA 2E1CA 3E2EA 4EHTA 2CG8A 4JI4F 3CIZA 1IR0A 4O44B 1D3WA 4I69A 3AJ2A 4HCBA 3EDQB 3T6JA 2YHBA 4MDBA 1T95A 2BW2A 3MMAB 4YDDB 1LWCB 4KR0B 2ZZNA 4DBQA 2MZQA 3D1OA 4CZJA 1HL6A 1VQPN 4IRDA 2QTWA 1T9TA 3R7BB 3LQVA 3FR0A 3DLLQ 5EGYA 2AGQA 1NPRA 2V2ZA 2ZF5O 3NGYA 1KTQA 2RDIA 4K43A 3CJ4A 2VWKA 4QAGA 3R6LB 3AAWB 1IJFB 3LO3A 3RZAA 1JLEA 3NHGA 5E0OA 2HZVA 5K14B 3MEDA 2XHWA 2B5JB 3EPGA 4I68A 1FI4A 3MOZA 4LF9J 4B3RJ 2YPYA 1MROB 4KGXB 4EP4A 4ZK7M 2FHOB