5HLFA

Structure of hiv-1 reverse transcriptase in complex with a 38-mer hairpin template-primer dna aptamer and an alpha-carboxyphosphonate inhibitor
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the role of the alpha-carboxyphosphonate moiety in the HIV-RT activity of alpha-carboxy nucleoside phosphonates.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/inhibitor/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 143
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hlfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hlfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hlfA05
4IKAA 5F8LA 3MR3A 1DTTA 3BQ1A 3D5MA 3OS1A 2Z1HA 3QO9B 4CIFA 4YMEA 3RB4A 3I5CA 5KFBA 3MF5A 1RDCA 4K50A 3SI8A 4XIUA 5KFRA 4F4YA 4NLYA 1JLFB 3OHAA 4FK2A 1HYSB 3ZSZA 3CYMA 1ZTWA 2BR0A 3S3MA 3QEXA 1HMVB 1CZ9A 3V81A 1HNIA 4IG3A 4EZ9A 4DL5A 4IG0A 2OPQB 2HMIB 4YNQA 1JX4A 3EY1A 2J6SA 2DFEA 2GV9A 3MXIA 1TL3B 4R5PB 4AILC 3CDUA 3NE6A 5C25B 4HTUA 3IS9B 2IBKA 3HJFA 2BE2B 3HKWA 4DL3A 2VWKA 4O3RA 4IH6A 3TAFA 3DLKB 4NCAA 1BISA 3MAQA 4FJ7A 2EX3A 3H4DA 3H4BA 1X9MA 3AVLA 1FKPA 3G6YA 3NGIA 1LWEA 4GC6A 2BANB 1S49A 1D5AA 4R8UA 4HUFA 4KKOA 4KHSA 4DG1A 2C2EA 5L1IA 1EKEA 3LZIA 4E1MA 5K14B 1SKRA 3LP1A 2E9RX 1L3SA 5KT5A 1RT1A 4F2SA 5J2QB 5J2PA 3KJVA 5L9XA 3RMCA 2YNHB 4E1NA 4CHNA 4DSEA 1KLNA 1EETA 4RW6B 2FJXA 4AHCA 1BCOA 1RTDB 2AJQA 3IRXA 4FCYA 3KLGB 3AA3A 3VQ9A 4RNOA 3GV8B 3AVAA 5HROB 1NK9A 1LV5A 3AVKA 2KFNA 2QXFA 4NLXA 4JV1A 1WSGA 2ATLA 1C2PA 1HPZA 1LW0A 4MKBA 4RW9B 3K58A 4RNMA 4OKKA 3AO5A 5I3UA 4XPEA 2G8FA 2WRMA 4TY8B 4Z4EA 2YNGA 5KG3A 1GOBA 2IMWP 2AX1A 4NYNA 3SI6A 4DFKA 5F8HA 4BWJA 5DK5A 3L2QA 2W9BB 1Z4UA 1RTHA 4CGFA 3FFIA 2XGPA 5F8IA 3KTQA 1RDBA 4MK9A 4CEQA 2OPPA 4L8RB 1JLEB 2WK4A 1RT3A 2I1RA 2PZSA 4ED6A 5J1EB 3L8BA 4M3UA 3NF8A 5FDLA 1W9HA 4FM1A 2GC8A 2Y1JA 4MQ3A 1TK0A 4I9LA 2ITGA 5EUHA 4DSFA 3TABA 4PUOA 4ECSA 3GV7B 4CEEA 3U6FA 2QKKA 1RBSA 3CQ8A 2PY5A 4O44A 2FBVA 3V6DB 1T05B 2XHBA 5KFVA 5HLFB 2D0CA 3I5BA 2ILYA 3OS0A 4Z4IA 4CHOA 3H5YA 4O0JA 1JKHB 4NRUA 1TL1B 4ZMMA 2FLPA 3PR4A 2AU0A 4PQUA 1NOZA 1WLJA 3FRZA 4MK8A 3KKRA 4E89A 4HUGA 3HL8A 4DU1A 4B8CA 3UDLA 3U3GA 3AO1A 3NH1A 2PYJA 2YNFB 3V9ZA 3RAXA 5DMRA 3C94A 5KG1A 4YQWA 4FZYA 2E6LA 4KTQA 3K5NA 1TGOA 1KFSA 1RT6A 5J2NB 3PUFA 3VQEA 4ZPBA 4B8AB 4ECVA 3FDSA 3NBPA 3GQCA 2WONA 4ZHRB 2B6AA 4IG3B 4F2RA 3OL6A 3MFHA 2C2DA 3OLBA 4K4SA 2G8UA 4DF4A 1UA0A 2BQ3A 3TAMB 3MEGA 4ECWA 3I5AA 1C1BB 1I39A 2VG7A 3MTKA 1TKDA 4KV8A 3PJWA 5FRMA 5KFSA 5FRNA 2BQRA 1VSEA 2IJNA 4FK4A 2IAJB 1JLBB 3B6OA 3AVFA 1XC9A 3TI0A 4IOBA 4IH7A 4FJKA 3F9KA 4K4TA 4LH5A 3DLRA 3QNNA 2EHGA 4FLVA 4KHQA 2JLEA 3T5KA 2D0AA 4I7FB 4FLZA 2HHTA 3VQCA 3CJ4A 4U7CA 2UVUA 1J54A 3OYAA 1TK8A 2W9CB 3KJVB 5KT4A 1VK0A 2YNHA 3OHBA 2AWZA 1RTDA 1CXQA 4KB7A 2BGGA 3OSNA 3ZSVA 1NK6A 3SFGA 3JSMA 5HROA 4DTUA 4KB1A 1VRUA 2R2SA 1JLGB 2F8EX 4M41A 1RBTA 3C6TB 2G8WA 4NLOA 1JLQA 1RDAA 1S6PB 2NUBA 3NGYA 1GX5A 4CJ3A 3SUOA 3NAIA 2OH2A 4LQ3A 4WZMA 1S9EA 3ZT2A 1TV6B 3SQ1A 1JXBA 2ZE2A 4K8ZA 2E9ZA 3HVTB 1J5OA 2W9BA 2HNYB 1RTJB 3PW0A 4JV0A 3NDKA 4YR2A 4FJ9A 4AH9A 1IM4A 2VG5A 3H59A 4HVJA 1C0TA 4KBIA 3HHKA 4M42A 3K2PA 4M94A 5KG5A 2YKNA 2B5JB 3NFAA 2B43A 4CF2A 3CDEA 4Q45A 3G6XA 3EPIA 4IKFA 5JXSA 3PW7A 1S9FA 4O3SA 3RMDA 3PW4A 4MFBA 4NZ0A 5JUMA 5KFEA 4PUOB 4H8KA 2ILZA 1N56A 1Z25A 3AVBA 3TQ1A 4O3OA 4HUEA 1RYRA 4DTXA 1NK0A 3KK3B 3V6DA 4Y1DA 5KFWA 5KT2A 1YVUA 3I0RA 4RW4A 1EX4A 3PZPA 5J2MB 1LW2B 1TKZB 4OPJA 1HYSA 3DI6B 4DTRA 1LWCB 1CSJA 2C22A 1NKCA 4KTZA 2GIRA 2Y1IA 1S97A 4CF0A 4M3WA 2Z1IA 4AHUA 1NHUA 1IG9A 1B92A 3AVNA 3MR2A 3LP3A 1C0MA 4B9MA 3DRRB 2XC9A 1KHVA 3T3FA 3NBPB 3K59A 3HP9A 5CZ1A 4CJTA 3H5SA 3G10A 3CFPA 4R8UB 2G8VA 1VSJA 4KKOB 4RUCA 2HHQA 4CJUA 4KO0B 5D3GB 1EP4A 3KLEB 4CJPA 1SKSA 5CY4A 1ZBUA 1UWBA 4IRCA 5KG2A 3QEVA 2HWIA 1RT1B 3L3VA 5J2QA 3PV8A 1WN7A 4O3PA 2IAJA 2A1SA 3DRPB 1DTQB 3QLHA 3IRXB 3EZUA 1QHTA 5HBMA 4CJVA 1XWLA 1S1UB 5EWFA 4ZVFA 1N5YA 4IDKB 3GV5B 3M8PB 2DFHA 3OYBA 1JL1A 3NGZA 3QGGA 1ZBFA 5KG4A 3M9MB 1S5JA 5KFZA 5KFIA 4ZPCA 3H40A 3ITHA 1ZETA 4RNFA 4GC7A 5I3UB 3O3GA 4YR0A 4CF1A 3BREA 4M45A 4Z4CA 3AVGA 1HQUA 2RKIA 5E41A 1RTHB 3FFIB 1Q9XA 3DLGB 2WOMB 2RDIA 2X6NA 3BGRB 3OYLA 1RTIB 3RAQA 2W7OA 5KFGA 5KFQA 4AHSA 1C1CB 3H08A 1LAWA 1S9EB 3MEEB 1GX6A 3DOLB 4RW8A 1S1TA 4F3OA 4B9VA 4QWDA 3ZSWA 4JV2A 1RYSA 2W8LA 2DY4A 2G8KA 3H2LA 3LWMA 3KLIA 3MECA 3TAQA 5KFYA 3OYFA 5CYQA 4I2QB 1ZTTA 4OGCA 1RT2A 2HHXA 3CJ0A 5KGWA 3RMBA 4CHQA 4JLHA 4B9LA 3LDSA 2HHWA 4IR9A 3IG1B 3GIJA 3CM5A 3SNNA 1TP7A 4ZPAA 3V9SA 2DTUA 4XPCA 5KRSA 2HVHA 2OA8A 3OVNA 4NCGA 3NAEA 4W5RA 3KHGA 1L5UA 3SQ2A 1QE1A 4DU3A 2I5JA 2WHOA 4ELVA 4FJ8A 4MIAA 2BRLA 3N6LA 4FJLA 3BR9A 4EZ6A 3MR5A 1RT6B 4FS2A 3CFOA 1NJWA 3KLHA 1VSMA 3E51A 1CZBA 1EXQA 4KHNA 2WONB 2IOCA 4WE1A 4ECUA 1T7PA 1WSFA 2V4RA 4EYIB 3QEWA 3AA2A 5C42B 2FVQA 1IKXA 4J9QA 4JRQA 3I0SA 3L2WA 4K4XA 3HVAA 2OZSA 2OPSA 4CEOA 4IH5A 4XO0A 1NK8A 1K1QA 3S3OA 4KFBA 5I42A 1RA6A 4RNHA 1J53A 3KHLA 5KFUA 1T03A 3KMSA 3SQ0A 4Y3CA 4DF8A 4E0DA 3JYTB 3OJSA 4FLUA 2KZMA 3LP0A 3KIOA 4TQRA 4I9QA 1J9AA 2RPIA 1REVA 4GW6A 3LP2A 3AVHA 4EYHB 3SZ2A 4B9SA 4JS4A 3HXMA 4FW2A 4ED1A 3SFUA 1HYVA 3BSAA 2P51A 4FM2A 3NAHA 4MKAA 3AV9A 1JXEA 2DPIA 1YT3A 4OKEA 1DTQA 4CJLA 1L3VA 4CEBA 1R0AB 4NLSA 5DQIA 5F9NA 1X9WA 3MR6A 3JSMB 1UOCA 3CG7A 3OYIA 1SL0A 2VG6A 1JLCB 3DOKB 3CWJA 3C6TA 4N47A 1T8EA 4CEZA 4O0IA 4B9UA 2P1JA 1NK5A 5JS2A 2D3UA 1S4FA 5HRSA 3C6UB 4R0EA 4J9PA 1VSDA 4ELUA 3OYCA 2KTQA 1A5WA 4IFVB 2DFFA 2IDOA 2QE5A 3QIPA 4CGDA 1FK9A 2D41A 2R8KA 4Q8EA 1JLAA 3BQ0A 1SH0A 3UR0A 1VSIA 3SPYA 3VQ6A 3CVKA 1S48A 3RR7A 4WXWA 1RTIA 1C0TB 1S1XA 3N6MA 4DFMA 3V6JA 5KG0A 4WZQA 1Y97A 1RT5B 1BIUA 3HYFA 4W5TA 4H54A 1L3UA 2R8HA 2QKBA 2RDJA 3ZSYA 2J6UA 5L1LA 3D45A 3M8QA 1NJXA 3IGNA 2OZMA 4J9SA 1I6JA 4DL4A 4DFJA 4Q0BA 4C8KA 4DSKA 1SV5B 4J9OA 2C28A 4TY9A 3KK3A 1W0HA 3DYAA 3AO4A 4DTPA 2ZKUA 4IR1A 4F8RA 3KKSA 3VQDA 4CIGA 3QEPA 3DRSA 4LSLA 4CE9A 4ECZA 2HW3A 3WNGA 4DMNA 3PX4A 4B08A 1KVAA 4RW7A 4DTJA 3UQSA 5KFDA 3FQLA 4FJNA 2IC3B 3HO1A 2FLLA 4ID5A 1HMVA 1U48A 4OPKA 2O5DA 4WFXA 4EO8A 2EC0A 2JC1A 3V6KA 1RBVA 3KLFA 4LQ9A 2OPQA 2HMIA 3OYEA 1IO2A 4RNNA 3IGVA 3UPFA 3DRRA 1VSFA 4OL8A 4TYAA 2IM3A 5C25A 1QTMA 3EZ5A 1IKYB 3RRGA 2IM0A 1S0OA 2G8IA 4AHRA 3V1RA 1XR7A 3SUPA 4IQXA 4NYZA 4TYBA 1IKXB 4E3SA 2ASDA 3RMAA 5D3GA 2GIQA 3KLEA 1JL2A 3ALYA 4CJFA 4ZP9A 2AX0A 3ZSXA 4FS1A 1UWBB 3CFRA 4DG1B 1LWFA 2V0NA 3OL7A 4CGJA 3PHEA 3RWUA 4J2BA 1U09A 3LANA 3P1GA 1XR5A 4FJJA 1Z26A 3KD1E 1EETB 4RW6A 4PWDA 1KVBA 3KHRA 4Q5VA 5KG6A 3KLGA 2FVSA 4OLBA 4DU4A 2IJFA 5DGBA 1YVFA 2RN2A 4EEYA 4CEFA 1D9FA 3MXJA 5KT3A 5C24A 5DLGA 1FKOA 2FJVA 2D7SA 1D8YA 1IKWB 3NKYA 4CJ4A 3WNEA 4BE0A 1HQUB 2RKIB 4K8XA 3ZT1A 1XI1A 1TK5A 1VRTA 1U47A 3K5LA 4N76A 2WOMA 5CYMB 4CFAA 3OYHA 4EP4A 3BGRA 1Q9YA 4EBEA 3V9WA 2UVRA 4Z4FA 2CKWA 2R2TA 5F8MA 3PJXA 1BI4B 3C6UA 3DM2A 1TKXB 2OPRB 3LAMA 4QWEA 4KRFA 3KK2B 3TAEA 4NLTA 4ICLA 3EYZA 1S1WB 3Q8SB 3MFIA 3DOLA 4FBUA 5F8JA 4RW8B 1S1TB 1ASWA 2V9WA 2HVIA 2FBYA 4ZP7A 4TQSA 4IG0B 1S1VB 1C0UA 4W5QA 2XY7A 1TKTB 3PO5A 4IBNA 1SUQB 3VQQA 1BL3A 1S1XB 3LAKA 3T1AA 2LSNA 3QGIA 3BQ2A 3PW2A 5DQHA 3LPUA 4F50A 4DSIA 4ZVGA 3T5LA 4HCCA 3RTVA 3IG1A 1FKPB 1OS5A 3H5XA 4N56A 1S6QB 1LWEB 4K4UA 2BANA 5KFLA 5KFHA 4NYFA 1VSHA 3V81B 4I2PA 1VSKA 4RG8A 3DYAB 1D1UA 2ATQA 3RB0A 1BQNB 4NCBA 1S9GA 4DEZA 4DQIA 2GUIA 3DRSB 1TL3A 4R5PA 1HNVB 3ZT0A 3TVKA 1G15A 1IKVB 4B3OA 3OYJA 5J2NA 2XI3A 2IC3A 5C42A 3QINA 4K4ZA 3SPZA 4KHWA 3VQSA 4FLXA 3MEDB 1B9DA 3CJ3A 1HPZB 1LW0B 1A5VA 3RRHA 4ED0A 4G1QA 1WSEA 2JEJA 2FVPA 1SL1A 4N5SA 4URQU 2W7PA 4FLYA 1XR6A 2KZZA 2W42A 4Z4HA 3LP1B 3JYTA 4KPYA 4FJGA 4LSNB 3V9UA 3LP2B 1RDDA 4NLPA 3BSOA 4DSLA 3TWHA 2V4QA 4CJQA 1QSSA 4I7FA 2VWJA 4WYLA 2Q3SA 3CJ5A 3HPHA 5FDLB 1R0AA 2HWHA 4ZP6A 2DPJA 4FJHA 2GBZA 1RAJA 4W5OA 1NOYA 3VQBA 2W9CA 5EWEA 4CERA 1KSPA 1RNHA 1DTTB 2D5RA 3NMAA 4C8NA 1WAJA 1MMLA 3GIMA 3OY9A 4E19A 4CHYA 5KI6A 4TSXA 4CEDA 1JKHA 4J9NA 1RILA 1JXLA 4UQGA 3QIOA 2W8KA 3Q8RB 1S6PA 4IFYA 4PQUB 4K4YA 2HNZB 2WTFA 4GVMA 4KAZA 3ZT3A 1FK9B 1N6QB 4N41A 1F21A 2Z1JA 3A2FA 2C2RA 5CYMA 4DL7A 4C8OA 4MK7A 2X6SA 4PA1A 2YNIA 1J5OB 1MU2A 1YTAA 4ELTA 4F4WA 3P83D 4CJRA 3I8DA 3IS9A 4M3TA 3VQ8A 1RT5A 4AHVA 2XY6A 4M3RA 3AVJA 3KK2A 5HP1A 1SH3A 3AO2A 2R2UA 3PX0A 2XY8A 1C6VA 3UIQA 4ZHRA 3V1OA 4F4XA 2B5JA 1TL1A 5KFFA 1GOAA 1C1AA 5EDWA 2ZD1A 3M9NB 4CJKA 3V4IA 1C1BA 1SL2A 5K14A 1S0NA 3WNHA 2JGUA 2J6TA 4FM0A 2YNFA 4QWAA 3QEIA 1BCMA 4RW4B 4KREA 1KLMA 2AQ4A 5J2MA 1S6QA 2FLNA 1X1PA 3NCIA 3TARA 4RU9A 1LWCA 4OVLA 2FJWA 1BIZA 2XWYA 4JS5A 1RBUA 3ZSQA 4I2PB 1K6YA 2JC0A 5KFTA 4DQSA 4M95A 5FROA 3TAMA 5KFXA 1HNVA 4LH4A 4TY8A 2YNGB 5T7BA 1WNEA 3DMJA 4DQPA 3HPGA 2VA3A 2RF2B 4DL2A 4TN2A 4CK2A 2IS3A 4CJ5A 4KHYA 1BHLA 3T19A 1JLEA 3N6NA 5KFKA 4K4WA 4FYDA 1RT4A 4ED7A 2R8JA 4KO0A 2XI2A 4NLDA 2E6MA 4GMJB 4Q8FA 1WSHA 4RUAA 4BACA 4FK0A 4ED8A 3QIDA 4DWIA 3BJYA 4AHTA 3VQAA 1YTUA 4Y34A 4E7IA 1GOCA 3VQ7A 3ZSOA 2IGIA 4OGEA 4KAIA 4Y1CA 2VG5B 4CGIA 2O4IA 1TQLA 4HHTA 1U04A 1UAXA 2YKNB 3M8PA 1JLQB 4FW1A 3S9HA 4KI4A 4J9MA 3PW5A 2JEIA 5DQGA 4F3TA 2UUTA 3GIIA 3QNOA 3H98A 3E01B 3G86A 3M8RA 3BSNA 4WFYA 1TV6A 3NH2A 3T5JA 4M3XA 4LY7A 2ALZA 4JRPA 3HVTA 5F9LA 3TANA 4NLQA 4CGHA 3RB6A 1N48A 4CJWA 1SH2A 3D28A 4NLRA 3DM2B 1LW2A 1D9DA 3GYNA 1TKZA 4IFYB 4ICLB 3DI6A 3ULDA 3O3HA 2B6AB 3V1QA 5KG7A 4CECA 2HNDB 2WB4A 1U49A 3KD5E 1N6QA 2YKMB 3CIZA 3OYKA 1S10A 4URSA 3BSCA 4ECQA 3NF9A 2XY5A 1NK4A 4MFBB 3OYMA 4O55A 2YNIB 1MU2B 5KGXA 4DSJA 2VG7B 3ASMA 4CGGA 4HKQA 3KMQA 1WNSA 3NL0A 4FJMA 5HP1B 3I0RB 5KFOA 4QWCA 1RDRA 1U4BA 1IH7A 1KTQA 3MECB 4K4VA 1HQEB 3ZCMA 4NLGA 2ZQBA 3K57A 1RA7A 1RT2B 5DGAA 4ED3A 3V6HA 5KFPA 1EP4B 3QZ8A 1BQNA 3CJ2A 3CDWA 2HB5A 1D0EA 1S9GB 2UVVA 3SCXA 2F96A 5EWGA 4G3IA 4FJ5A 3L2VA 4CK3A 4KSEB 3RBEA 4YFUA 2XCAA 4B9NA 5SZTA 3ZSRA 4B9TA 1VRUB 5L1JA 4QCLA 4F4ZA 3NF7A 3HP6A 3OLAA 3HT3A 3SV4A 4CESA 4Y2AA 4MIBA 1KVCA 3GILA 4BWMA 3DLEB 2BRKA 4KE5A 4DS5A 4ECTA 1NJYA 4QOZB 2E9TA 2ZE2B 2YHBA 4J2AA 4U6PA 3LALA 2RF2A 1XHZA 4EBDA 4DQQA 3DRPA 4M3ZA 1T03B 1ASVA 3QLHB 1DLOA 1TAUA 1RT7A 1TVRA 3GIKA 3O4QA 4EO6A 2G8HA 1S1UA 5DG8A 4ED2A 1VSLA 3K5OA 4FVMA 1QSYA 3DLBA 4H4OB 4CJEA 1REVB 4EP5A 4TXSA 1N5YB 4Q44A 3C95A 3D0PA 4EBCA 3O4NA 1JIHA 4FLTA 4NLWA 1CXUA 2Z1GA 4Q43A 4YP3A 2XRIA 4ECRA 2AGQA 3VA0A 5KFAA 1SKWA 1HYZA 1HARA 3HK2A 1ITGA 4KHRA 4J9RA 4DTSA 4BDZA 3SUQA 2R8GA 1JLCA 1B9FA 4ZPDA 3VQ5A 3DLGA 3M8SA 3QO9A 3NGDA 4BDYA 2F8SA 4ECYA 4KI6A 4ZTJA 3HVRA 4IRDA 4E7KA 3PVXA 2HNZA 4KHUA 3SYZA 3AA5X 2AGOA 2ASLA 4CK1A 2XGQA 3E01A 1C1CA 4TLRA 3MEEA 3T5HA 2D0BA 3O3FA 2I5JB 2AGPA 3QZ7A 3VQPA 4DQRA 4JUZA 4FXDA 2YHAA 1I3AA 1KFDA 3LZJA 3KLVA 3M9OB 2W9AA 3KLHB 4E7HA 4DS4A 2IM2A 4Z0UA 5KT7A 3KLIB 1ZYQA 2FBTA 3TAPA 2BE2A 4IRKA 1S0MA 3SUNA 2YKMA 4OJRA 5HRPA 4O4GA 5DLFA 3FQKA 2XO7A 4MH8A 2OYQA 3ZT4A 3OYDA 2ZD1B 3LPTA 3M8QB 3QGHA 4ZVEA 3V4IB 3HVWA 4HCBA 1QSLA 3QETA 4CEAA 2FVCA 4QPXA 2KQ2A 2OPSB 2FC0A 3AVMA 1QE1B 2D3ZA 4ZVHA 4H4MA 4O3NA 3G6VA 4BDPA 1KLMB 5HBMB 1BGXT 1RBRA 3F73A 5J2PB 4Z4GA 3VN5A 4HYKA 4ZP8A 4KHMA 1QS4A 1KRPA 4IDKA 3SV3A 3TAGA 3L2RA 5KTQA 4QAGA 4E7JA 3AO3A 1QUVA 4NRTA 2P5OA 3ISNC 5T14A 4ZTFA 1NK7A 4F4KA 3ITHB 3PO4A 1QAIA 2IM1A 3FSIA 5JS1A 3KOAA 4RW9A 2JEFA 3KLFB 4WYWA 3OSPA 3WNFA 5C5JA 1KHWA 1QAJA 3DMJB 3SJJA 5HRRA 5I42B 1LAVA 3RR8A 4URGA 4DLEA 2R8IA 5DG7A 1BQMB 2VG6B 1HJRA 3PR5B 1WSJA 2B4JA 4O5BA 1IKYA 3DLHA 1A5XA 4KB0A 3L3UA 3LP0B 3OYGA 3RBDA 3IAYA 1RT4B 5CZ2A 4J2EA 3MXMA 4QW9A 2R7YA 3S3NA 3DLEA 3V9XA 4C8LA 4DL6A 1RT3B 1NKBA 3PY8A 1LWFB 2FBXA 1ZBLA 2PYLA 3EPGA 1RT7B 1TVRB 2ETJA 3KK1B 5SWMA 3IN5A 2UUWA 3G0ZA 2CJQA 4H4OA 5HRNA 5KFCA 4CIEA 1NNDA 4O44B 3CM6A 5CYQB 3CO9A 4LD0A 1T05A 4CF8A 4I2QA 3P5JA 4FJIA 4ECXA 5F8GA 3K5MA 4DTOA 1Q8IA 5DG9A 3HPOA 3QYYA 5C24B 4Q0BB 1JLFA 4WXOA 4IFVA 1T94A 4NCGB 3QIPB 3AVCA 4CHPA 2UVWA 2IA6A 1HNIB 2WCXA 1O1WA 3PX6A 2O4GA 4FZXC 4J9KA 3HSTB 1NKEA 4O4RA 4LSLB 2XCPA 3VQ4A 1WAFA 4FZZA 4O3QA 1NJZA 1L3TA 4WE1B 4RW7B 1BI4A 1HRHA 2HNDA 4CFBA 1TKXA 4NLVA 3B6PA 1W25A 3OYNA 5EU7A 3DLKA 4J9LA 2HHUA 4OKJA 3H5UA 1ZBIA 3U3YA 3SQ4A 1KCFA 3I0SB 4ID5B 4BE2A 3OL8A 2X78A 2QK9A 1SV5A 3Q8QB 4DFPA 1C0UB 3KNAA 1TKTA 4WFZA 4KFBB 1T3NA 4E7LA 3MEGB 4CJSA 1N4LA 2HHSA 4C8MA 4W5NA 4KV8B 1HQEA 4M3YA 4YR3A 4O4GB 3DDKA 3OS2A 1JLBA 5L1KA 2FVRA 1TAQA 4FLWA 4CCHA 3HM9A 4BE1A 3NHGA 2F8TA 1XHXA 1WSIA 1ZBHA 5KFJA 1NHVA 2BQUA 4CFCA 4H4MB 4DTNA 1CLQA 3AA4A 4DLGA 1UA1A 4QW8A 2YV0X 2KFZA 1U45A 1ASUA 1IKVA 3DOKA 4ID1A 4CFDA 4B3OB 2VA2A 4DTMA 3LWLA 3ISND 4OLAA 2QV6A 5KRTA 3ICLA 1JLGA 5KT6A 3MEDA 4PY5A 2OPPB 4KTWA 2HHVA 4Y2CA 1IKWA 3VA3A 2A1RA 4J2DA 2R2RA 4G1QB 1FXXA 3QERA 5J1EA 1JLAB 1BQMA 3BDPA 1QQCA 2ASJA 3AVIA 1K1SA 1DLOB 4FBTA 4NLUA 2X74A 4CHZA 2BDPA 4FJXA 2JEGA 4LSNA 5KFNA 3Q8PB 2HNYA 4PWDB 3KHHA 1RTJA 3THVA 3OL9A 2OPRA 2E4LA 5HLFA 4X2BA 1S1WA 1RCHA 1X9SA 3L2UA 3OJUA 4QWBA 1FKOB 3NH0A 3QESA 3RB3A 5F8NA 4CF9A 1S1VA 5KFMA 2P5GA 2KW4A 4RZRA 3KK1A 2HAIA 3NF6A 3TR8A 1SUQA 1VRTB
chains in the Genus database with same CATH superfamily
2AA4A 5F8LA 1V6HA 1DTTA 3NGTA 1JB0C 4PYDA 3C15A 1E4FT 3RB4A 1RDCA 4K50A 2J7KA 3AOAA 5KFRA 1FX2A 4F4YA 1GH8A 4JKGB 5HMXA 2DRBA 1WEZA 4EUVA 2J0WA 2P2CB 3NCQA 3P4IA 4FK2A 4K8RA 5E3RA 2GHWA 1HMVB 1HNIA 4IG0A 2HMIB 1ZXOA 4YNQA 3EVOA 2J6SA 4OYZA 4ZVSB 4OV1A 2C1EB 4HTUA 2V52B 2QLWA 1AXQA 3HKWA 4O3RA 2G9OA 4KBOA 3TSUA 3DLKB 2FZCB 4G65A 2EX3A 3CF5L 4BROA 2NRZA 3AVLA 1F1BB 3WEEB 1S49A 1FNXH 4X4OA 4R8UA 4HUFA 4KKOA 2PEBA 4DBQA 5L1IA 3EDQB 3PLAA 4NYPA 4MKYA 1MMNA 1CPZA 1L3SA 2VQEJ 4LF5J 2K3KA 5L9XA 3W7BA 2NR0A 1KLNA 4RW6B 2XWXA 3KWMA 1T9VA 3A5NC 2EI5A 3KLGB 2BJ3A 3AA3A 3BZKA 1DFDA 5LXYA 4RNOA 3O8WA 4F0HA 3AVKA 3CD7A 2QXFA 3W61A 3AGKA 4TVAB 1WSGA 1HPZA 4MKBA 3T6JA 4IQMA 4RW9B 2HHHK 3I56N 4RNMA 2HHHJ 2GJFA 2GCFA 4KGXB 4Z4EA 3MM5B 4R79A 2AX1A 4JHDA 3Q8VA 2R42A 2HK3A 2ZJPQ 5DK5A 5CA5A 3DXKB 1Z4UA 1RTHA 2OI2A 1GLCG 3KUHA 4K59A 3CCJN 2DGOA 2ZH3A 3CIPA 3TJAA 1RT3A 3GR1A 4ED6A 1GT8A 4M3UA 2ZGZA 3VTHA 2BZ2A 4MQ3A 4I9LA 1XTZA 5LSRA 4FYXB 4CEEA 2M5YA 4O44A 1MROA 4RJVA 5TKWA 1T05B 4DZDA 2MDAA 1S12A 2ILYA 3VZHA 4X64K 2QL9B 1TL1B 2FLPA 3I8BA 5A0YA 5T41A 3W2VB 2AJ4A 4PQUA 1RAOA 1BWVA 4JP8A 3BDEA 3FRZA 2V8DA 1OPZA 1YJWS 3BUZB 4HUGA 3MUVP 3THTA 4P2MA 3BF1A 2YX1A 3U3GA 3AO1A 2PYJA 3JTNA 3UCZP 3UDEA 3C94A 4N8OA 5KG1A 3X1LB 4FZYA 2O01C 2DGVA 5MAOA 4B8AB 3KJFB 3OXGA 2VIHA 2P9IB 3MPVA 2ZH4A 3DJCA 3GQCA 1WBBA 2B6AA 2B9EA 4KHPK 1V4TA 4IG3B 2P9UB 4DV4K 4B1WB 3AA9A 4M5DA 3MFHA 1NBWA 4K4SA 4DF4A 2HIYA 1RWXB 3HTVA 1I39A 3SXLA 2B3TB 4NEYA 2VG7A 1TKDA 2VF3A 3S6EA 2BKNA 5FRNA 1NDKA 2IAJB 4FYVB 3WXJA 2UXDK 1VQ7N 4LH5A 2EHGA 2IA0A 2VOPA 4I4BA 2KVIA 1I94K 1Q79A 3VQCA 2W9CB 3BGOP 3KJVB 2G1DA 1T11A 3CJ1A 2YNHA 3JSBA 2VWBA 1F5CA 2BGGA 2K1RA 1HBOA 3ZSVA 3OFFA 5HROA 3D6TB 4WFNQ 4M41A 2F8HA 1U0HB 4NMXA 1RDAA 1S6PB 3E9OA 2NUBA 2QX0A 3K17A 1U1LA 4LR7A 2JVOA 3T1HJ 2VOOA 2ZH7A 2EG2A 5IQQA 4CO5A 2GAGC 4BRGA 3M7VA 1JMTA 4GV6A 3W3DA 1FI4A 4WFBQ 3HI0A 2HNYB 1M0SA 2HBJA 1RTJB 4BRFA 2ZJQL 2OGUA 3M8WA 4MO5A 1IM4A 4HVJA 3HHKA 3J7ZO 2A6AA 2A0FB 5KG5A 2B5JB 3CGIA 3CDEA 2KXFA 1Z2LA 4IKFA 3IO1A 1M5KC 5JVGQ 2H4YB 3RMDA 4NZ0A 5JUMA 2I7NA 4PUOB 2ILZA 3OPKA 4QIVA 3CC4N 4ZA1A 4HUEA 3KK3B 3V6DA 4Y1DA 5KFWA 1I5OB 1UEUA 3P4UB 3IFEA 4FVUA 4OYMA 1YVUA 3I0RA 4H03B 2JLGA 3PZPA 2Z2YB 2CPHA 5HQ8A 1NSKL 5AQXA 1OQ6A 4ZN3A 5K8OA 4OPJA 1OY9A 3DI6B 5B0CA 3TO8A 1Q5YA 3HD1A 4M5NA 4YHHJ 4A5AA 2ASYA 2N4DA 3ZNJ1 1OH7A 3FC9A 2PA8D 4CI0B 5A8KA 2QO3A 2W2OP 3TX0A 1C0MA 2FIUA 4B9MA 1KN6A 3DRRB 2XC9A 2UXBK 3NBPB 3MOJB 4WU2A 3K59A 1UEKA 2VFVA 4P9SA 4J91A 1GXUA 2J9DE 2E20A 2MXYA 4J5OA 2ROPA 4R8UB 4KKOB 1VISA 4RUCA 3HHDA 3IUCA 2RAQA 2IJRA 2Q6CA 4P10A 1R3NA 3CC7S 3DXBA 1ZBUA 3QEVA 2HWIA 3J7YU 3QRPA 3L3VA 2KT5A 4FWPA 2A1SA 3ONQA 3KFWX 3EZUA 1QHTA 2YKPA 3CMAN 2ZNYA 4DV2J 1VQ4N 3THYA 4LFAJ 1ZM9A 3UR3C 1N5YA 4LFAK 2HGLA 3GV5B 3OYBA 3LDQA 3QGGA 4UQTA 3MM9B 3BN7A 4OX9F 2IVNA 1PAUB 2POKA 4ZLJA 3ITHA 2LQJA 2X1GA 2ZNZA 1DRZA 1TTHB 5GAEP 3VALA 4U96A 1WELA 3BREA 4BG9A 3KK7A 1IVZA 2RKIA 3AVGA 3QT5A 1IWGA 1UAWA 5DS7A 4DPWA 4OZNA 1RTHB 2DPNA 3H2VE 1ZBTA 2JFKA 3EXCX 2PEHA 1AW0A 2P9SA 1LFPA 2ZHOA 4AHSA 1VQON 5ETKA 4F3QA 1PIEA 1C1CB 2HFZA 1ZZFA 2W4PA 3HI9A 2YQ3A 4K0KK 3DOLB 2W2PP 1S1TA 1X4FA 2Z58B 2DIUA 1ROFA 2DO4A 2O8DA 2W8LA 5M1QA 2G8KA 4H5VA 3KLIA 2MKHA 5KFYA 3B4DA 1ZTTA 5AQRA 1OH8A 1RT2A 3T1YJ 4CHQA 4CO4A 1W7WA 2NZ4A 3T1YK 4IR9A 1VYAA 3ENQA 3GIJA 3F0NA 5ETNA 2VASA 4XPCA 2HVHA 1IBLF 3F9MA 4NCGA 1VJWA 3NAEA 3MMBB 1UVMA 5CHCB 4DU3A 4ELVA 1RACB 3AHPA 3N6LA 4FJLA 1B0PA 1GXTA 3KLHA 1F9FA 1U2FA 2QMUB 1CZBA 4KHNA 2IOCA 4A8XA 4DMZA 3T69A 1NO8A 1YXQA 4EIAA 2JZ5A 2VQEK 1UP1A 1Y5LB 4DX6A 3AA2A 1X4BA 2GZOA 4X4TA 2FVQA 4J9QA 1VJQA 3JAMU 3I0SA 4NEZA 2MQNA 2OZSA 2OPSA 4CEOA 1E6VA 4IH5A 3THXA 1SVDA 1SB6A 4K2XA 1NK8A 4RNHA 5I42A 1RA6A 5ADXA 1HWKA 1V9OA 5BR8F 5IT9O 1T03A 3KMSA 4Y0FA 2V34A 1CC7A 4FLUA 4GW6A 1REVA 1NLKL 3AVHA 3EICA 4HWIA 4DV7J 1HYVA 4DV7K 3BSAA 4EGLA 1YJRA 2HF3A 4ATNA 1JXEA 1X31C 4Q2MA 4QPTA 2DPIA 3ATUA 1DTQA 1X4AA 1LCUA 4NLCA 5DQIA 2FZGB 1HBOB 1QAXA 3KHYA 3MR6A 4QIFA 2YKAA 3CG7A 3TZWA 1QVFR 5GMEA 2VG6A 3DOKB 1AZSA 3BM7A 1T8EA 4PXEA 4B9UA 5SUHA 1NK5A 2IMOA 4AT1B 5JS2A 2XS5A 5AQUA 1XBWA 2D3UA 4RO0A 3QRQA 5HRSA 4R0EA 8AT1B 1VSDA 2KTQA 4CZFA 3SBMA 3SAGA 2FHJA 4RWTA 4A8OA 3LTOA 3GJTB 2R8KA 1Z6RA 1HHSA 4Q8EA 2NUHA 2CWKA 1DGKN 2G2YA 4U67Q 4M7XA 3CVKA 2PMZD 1RTIA 1Q86T 3BEXA 1ATSA 3G8QA 1WKKA 5HO4A 5DDRC 4WZQA 5KG0A 4JI8J 1RT5B 4H54A 3HFZB 2RDJA 2C2KB 3ZSYA 4FXVA 3M8QA 4J9SA 3RJMB 1I6JA 4CDIA 1KBRA 2BM1A 2FTRA 4J9OA 2HLTA 3IBWA 3KK3A 3D6HB 3DYAA 1H73A 5ETPA 1NM2A 3VGKA 3KKSA 4CIGA 3S1TA 3HT0A 4ECZA 3M6WA 3PX4A 4JKCA 3GJRB 3NOGA 4DTJA 2AV5A 4U67L 4F4AA 2E5GA 3FMBA 1HNXJ 1GLLO 5LM7E 2FLLA 1PAEX 3CJ7A 2VDIA 3AQOA 5ADXH 2UXDJ 3MN6A 1NPKA 2EC0A 3GSDA 2J9DA 2EFOA 3Q2SC 1FCAA 3UPFA 3DRRA 2L9DA 4IO9Q 1WI6A 1I94J 4OL8A 1GFWB 4GVBB 2IM3A 3VAGA 4OIXA 2OKQA 4WU3A 1S0OA 3V1RA 4PG7A 4ISGA 1N5SA 1WC5A 4BR4A 1IKXB 4E3SA 3RMAA 1NM1A 3I4HX 3ALYA 4ZP9A 5U47A 5E2QA 2AX0A 3ZZOA 4FS1A 1KQGB 3CJTA 1LWFA 2V0NA 1VQOS 2WB1D 4F0MA 2Z2MA 3A13A 2RIJA 1H98A 3CCTA 2I38A 5D4NA 4ZCMA 5M2UA 1YVFA 4CEFA 2JH3A 4A57A 1FKOA 2CPEA 1D8YA 3NKYA 1WDTA 4DV2F 4BRNA 2RKIB 4K8XA 3CUNA 1TK5A 2H1YA 1VRTA 1CJUA 2P8IA 3VR1A 6AT1B 3SSRA 1JCEA 4EP4A 1Q9YA 2GA7A 2F9JA 4Z4FA 2FZKB 2CKWA 4PXDA 2R2TA 4AD6A 3JB9k 2VH7A 2UXBF 2RUGA 5IC4B 3C6UA 4USUA 2OPRB 3DLJA 4QWEA 1U6ZA 5D4LA 3KK2B 3BZCA 4JI1F 3DOLA 2J7UA 1S1TB 1ASWA 3E9LA 1DT9A 2HVIA 4EWTA 4A8SA 1P8GA 4C8ZA 4ZP7A 2DR8A 3GFZA 1BL3A 5B0DA 3GR0A 1LFWA 3QQCD 3T1AA 2LSNA 5B08A 4J8FA 3I87A 3JXUA 5IT9U 2D69A 3H90A 3HOSA 4F50A 3EM1A 1XNQF 1UVKA 4HCCA 2QG9B 3RTVA 1XIQA 2OD4A 1S6QB 1HJOA 1RABB 4ZVRB 4R0JA 2CZ9A 1FHTA 4ID8A 3N9UC 4FF4A 2NSCA 2FC8A 3V81B 4Y28C 2OUGA 1VSKA 4RX6A 1NG9A 3CDBA 2X1FA 3SDEA 1BQNB 1SJ3P 1J5EK 2R9LA 4DQIA 3DRSB 3ZTOA 4MDAA 2E7WA 2RQCA 3L4IA 1AUSL 4DX8H 3V5RA 1YUWA 1N34F 1R43A 3QINA 4DR1K 3SPZA 2YKOA 3HFVA 2HBMA 1LKZA 3B82A 4IYQA 5BYSA 4F04B 3RRHA 1YIJN 2FB0A 2JEJA 1Y11A 2ATCB 3CMQA 3CJCA 4N5SA 2FD2A 3HHLA 2ZZNA 3QJJA 2KHDA 2RU9A 1XR6A 4Z4HA 3O3LA 4HDGA 2MKYA 1YITS 1YJ9N 1VBXA 4LSNB 3AOBA 2LEAA 1RDDA 4H5NA 3ETMA 3H45C 3TWHA 1SCJB 1FTCA 1OKJA 2VWJA 5L38A 1X0FA 3CJ5A 4YOEA 2HWHA 3EVWA 1WOPA 4W5OA 1NOYA 1YTYA 2DIVA 4X4RA 5BPNA 1KSPA 4MAKA 1AZSB 2DGTA 1DTTB 2D5RA 3M8ZA 3G71N 3DOMB 3M32A 3EKUA 1WAJA 1MMLA 3C15B 3GE1A 4ES1A 3L9ZA 1Z1ZA 5KI6A 2VBZA 3IR7B 3JTPA 2V8HA 3FRYA 3Q8RB 4CO1A 4BR2A 4DQ8A 4DR3K 3DC2A 4DR3J 4OX6A 3A2FA 4C23A 2C2RA 3FZFA 5LJWA 1UVLA 4TU8A 2YNIA 2KL8A 3K89A 1SBRA 4F4WA 1VQ5S 3VQ8A 1RT5A 4AHVA 4M3RA 3AVJA 2IRYA 2R2UA 4FP9A 1C6VA 2W6LA 3EE8A 3KG1A 3FZBA 4HH0A 2HOEA 3SQGB 2FHMA 3FNNA 4OJ1A 4AQYJ 4MTPA 3W3SA 2O8CA 3CCZA 4AL6A 4OV6A 4OFZA 3NNCA 2FLNA 1O13A 1GMVA 4F02A 4QQBA 2XWYA 1RBUA 2XS7A 1VC6A 3RRKA 2NXUA 1TUUA 2RS8A 1UTAA 5K20B 4I6YA 3NXZA 2OEJA 4CYUA 3MM5A 2VA3A 2YI1A 4RUHA 4FWOA 1KAZA 3ZTRA 2LCWA 2GIFA 1BHLA 3N6NA 3W8PA 1WTBA 1RT4A 1M5VC 4KO0A 2ZUGA 4RUAA 1TMJA 4FK0A 2GX8A 4ED8A 1R8CA 2MGZA 1F60B 4FKXA 4ES3A 3ZZRA 2HZAA 3BF3A 5LMUF 1GOCA 2CNOB 3ZSOA 2IGIA 4RU2A 5EX3A 4CGIA 2V69A 4B3SF 4RWWA 4X62F 2ZH8A 2AEJA 2YKNB 3M8PA 3P45B 3IMQJ 3S9HA 1BHNA 2AEMA 2VFUA 1VBKA 5DQGA 3GIIA 3QNOA 3CCMN 2FF3B 4OO1J 3D68A 2KLAA 3NH2A 3T5JA 4M3XA 4JRPA 5CD4A 3G9CA 4CGHA 1K9MO 4BC7A 2ZJQQ 2HS0A 2VDHA 4NLRA 2ZZTA 2AYMA 4P73A 1TKZA 3ID8A 4LFCK 4DHVA 4IFYB 2B56A 3ULDA 4LFCJ 2B6AB 3V1QA 1GTHA 3QT7A 2E5LK 5K5MA 2GMJA 1U49A 3CIZA 2JHEA 3MZIA 4KH0B 1S10A 1IN0A 4P52A 3BSCA 4URSA 4ECQA 3OYKA 3NF9A 4YS2A 3CERA 1QVFM 3TNVA 4X64J 3WUHA 3GIRA 1U8SA 4ILJA 2VG7B 2EKNA 3KUEA 4C98A 2MQPA 4QWCA 1RDRA 3S8SA 1U4BA 3MECB 4YDDB 1HQEB 3ZCMA 2V2QA 2DD8S 2GO8A 2J9EA 5BRFA 1EWRA 2IVPA 2DRAA 4GO7X 3LPEA 4OI3A 3S01A 3AY9A 4CRJA 4EFAC 5IV3A 5DZ6A 3ENBA 1BQNA 3CDWA 3VAFA 5HVGA 2F65A 4WPAA 2X3DA 3SBGA 3L2VA 4DV4J 5AQIA 4KSEB 3RBEA 4NO7A 4IXCA 3VEZA 1F5AA 3ZZPA 5SZTA 4DR2J 2FYXA 5L1JA 3MM7A 1BO5O 3K5PA 1RAIB 3NF7A 4MIBA 4JI1K 1BUXA 3GILA 3DLEB 4XK8C 5H9EJ 4I6AA 1WOSA 4U6PA 5LMNK 4HI2A 4DQQA 5A2QY 4M3ZA 1HI0P 4JYAF 1UETA 3M1FA 1RT7A 3FGUA 2X1BA 2P5VA 2ITMA 1S1UA 4ED2A 4NXNJ 2RUSA 4H4OB 1F3FA 3WC2A 2A10A 4DUYF 3IXQA 3OHRA 1CJVB 2CG8A 5GAHU 1KONA 5DM7Q 2Z1GA 1Y4ZB 3BB5A 4Q43A 2XRIA 3BR8A 2AGQA 3DCAA 5FPEA 3OTOJ 3DOMA 2QXLA 4HVZA 3AOCA 3SUQA 5L8RC 5IV4A 3VQ5A 3M8SA 3QO9A 3LL3A 5KOWA 1FA0A 2JSXA 3EVMA 3NGDA 4KI6A 4IRDA 3LOUA 2JDJA 3E66A 4ZCKA 3TZZA 3AA5X 3HX9A 3SYZA 2ASLA 2AGOA 2IVYA 2LP4A 1FWLA 3MEEA 3RAMA 3O9QA 3A5MC 2DHAA 2I5JB 2L41A 3QZ7A 3VQPA 4JUZA 4FXDA 2Q0RA 2YHAA 1KFDA 2G1HA 3M9OB 2CH6A 2EPIA 3UCUP 5C2CA 2BXJA 2CADA 2FBTA 3TAPA 2BE2A 4IRKA 1RXOB 1S0MA 3I31A 3O1BA 5DLFA 3FQKA 2HRTA 3ZT4A 3EMTA 1GNKA 3QGHA 4JV5F 3C16A 2QN6B 2XMWA 3JQKA 5HQLA 2V4JB 3VQTA 2KH9A 2FC0A 5LXRA 1NB7A 2YHYA 2EBGA 2Y1LB 4ZVHA 3HJVA 1QDUB 4OHXA 4BDPA 2UUBK 3CC2N 3MAHA 3CCVN 1RBRA 2V9KA 5J2PB 4Z4GA 4KHMA 2N3LA 1PC5A 4CZJA 1ITPA 2R7SA 4E7JA 2CAJA 3MMCB 3F41A 2P5OA 2CJ9A 2R3VA 1NK7A 3ET6B 3GLJA 3ITHB 5A2QO 1YAGA 3OTOF 2IM1A 1PJ7A 2M2BA 2PMHA 1QAJA 2I6WA 5AZIB 3F5TA 2OCEA 2G0CA 4URGA 1GMUA 2DHGA 1BQMB 1HJRA 4IOCQ 1UW4A 3PR5B 1WSJA 2B4JA 4O5BA 3M2RB 3R1XA 3GG1A 2BX6A 3OYGA 3IAYA 3MPUB 1RT4B 3A8EA 3MXMA 4J2EA 3MR7A 3S3NA 3V9XA 1HPMA 4C8LA 2FSJA 1GLEG 1WG1A 2LECA 1ZBLA 2PYLA 1JNZB 3CC4S 2N4CA 4DCHA 3MD1A 3W63A 1TVRB 2KRRA 2RRBA 2ETJA 5BRHA 3G0ZA 2WBMA 2HGMA 4X4VA 2DNYA 5KFCA 2R7VA 3LDOA 1VQ8N 1URRA 5A6WA 4HEA9 4YB7A 2A42A 3HPOA 1E4GT 3VF0B 3W60A 4Q0BB 3TSPA 1CULA 2DNPA 3U02A 1T94A 3BKFA 4NCGB 5THWA 3MMBA 1W2IA 4Y2IA 5AQZA 4WP3A 2B51A 4CHPA 3GE9A 3TRGA 3W8GA 5DM6L 4ZN1A 5M1KA 1O1WA 4DV1F 2QWLA 3C6HA 2DNNA 4K0KJ 3N4QA 1R31A 2YX6A 1WAFA 4IJNA 1E6YA 1BI4A 4CFBA 1XN9A 5EU7A 2ROGA 4J9LA 5ITHA 2KYXA 1OH5A 5GAGI 3ENHA 1ZBIA 3SQ4A 1KCFA 3I0SB 4BE2A 4NOHA 5GADI 1E6VB 4PG8A 2QK9A 1SV5A 2HLUA 1C0UB 4ZDNA 4WFZA 3SMZA 3CI5A 1T3NA 1EX8A 4CJSA 3HF5A 4QIGA 1N4LA 1EKSA 2HHSA 4W5NA 1HQEA 1I1GA 4YR3A 4O4GB 3DDKA 3AAPA 4UUXA 2Q0UA 5FLXY 5BYRA 2FVRA 5L1KA 2R4FA 4JKEA 1H1VA 2GTDA 1UFKA 2FQQB 4BE1A 2QA4G 1CQNA 4JI4F 1NGJA 1WSIA 4ETZA 1UVIA 3A4TA 1ZBHA 1S57A 1WHXA 5FJ4A 3GDQA 3EWGA 4OYBA 3K0SA 1UA1A 3AA4A 4QW8A 2KFZA 1U45A 4OLOA 4ZJQA 3DU5A 2M52A 1IKVA 3DOKA 4ID1A 4B3OB 4UTGA 2NREA 3Q7BA 3ISND 2Y3YA 3BBBA 3O5BA 3ICLA 3QNWB 5KT6A 3MN5A 3KYLA 1KNZA 4PY5A 1NUEA 3WX8A 4I68A 4JKAA 2HHVA 1F3VA 4WFBL 1VOMA 2EBEA 5AJ3K 5IM0B 3PXGa 3QERA 1HBNA 1K1SA 4FBTA 4NLUA 1VQNS 4CBXA 4FJXA 4BGAA 1N5VA 5CXTA 4I6MB 3KHHA 3FZLA 1JWWA 1CJVA 3OL9A 2J4RA 1IXKA 4ZVOB 4ZJOA 1S1WA 4A59A 1OVQA 1HR0F 3IR5B 3OJUA 5F2RA 1P1LA 2XMAA 1WF1A 3QESA 3BGUA 3ZTPA 2OTLS 3C65A 4CF9A 1S1VA 5KFMA 2KW4A 4RZRA 2HAIA 1SUQA 3GJSB 2DY1A 3GG0A 4DCOB 3DWLA 3QO9B 3B6BA 5KFBA 1MN7A 2IDEA 5M1FA 4XIUA 1BA1A 3ENVA 2XLIA 3ZZUA 1HYSB 4B3MF 2W40A 4KGKA 1ZTWA 3S3MA 1RGVA 2GJ2A 3QEXA 2KDOA 1X4CA 1CZ9A 4A2BA 2GUPA 4H4KA 3P3DA 1FJGF 1TL3B 4R5PB 1IJJA 4AILC 3NP5A 3WHIA 2F4VF 1J27A 3IS9B 2IBKA 4FL9A 1B0VA 2BE2B 2FHJD 4HR2A 2HBKA 4W92B 4DL3A 3MK6A 2ACYA 2VWKA 4D3HA 1UZDA 4IH6A 3TAFA 4NCAA 1OWXA 4FJ7A 1H2VZ 1RTZA 1FKPA 2P9EA 2CQ4A 1LWEA 4GC6A 4DUYK 1YK9A 2BANB 1TZ0A 3W5ZA 1BWFO 4DUYJ 4KHSA 2UV8G 1RHQB 4DR5F 1EKEA 3D66A 4E1MA 2GV1A 5K14B 1SKRA 2PSZA 2E9RX 2D1KA 2B9WA 1HNXK 3O1LA 4BR9A 5J2PA 3RMCA 1VQPS 2HPUA 3TJ8A 2AYEA 2FJXA 4JI1J 3D6RA 2AJQA 3CE8A 1N34J 2F9TA 3FLCO 1PILA 4AF1A 3MMCA 5H1SV 3GV8B 5D77A 4DV3K 3IFRA 2ATLA 3HD2A 3UE2A 3GJQB 4NXNK 2DYAA 1H2UX 1JQGA 2BJDA 4FOIA 1NWKA 1CJUB 5AQQA 3AJ1A 1FW6A 5AQPA 3POTB 3NS6A 2IMWP 1GOBA 3ILJA 3OFGA 4NYNA 4DFKA 5F8HA 1UWAA 4WF9L 2XGPA 3KTQA 4JI2K 4NB4A 2OPPA 4JI2J 4RUBA 4CD1A 3QPIA 4J37A 2P9LB 5J1EB 1TK0A 1ZPWX 3THWA 1A6LA 3TABA 2O67A 3QBCA 3VGVA 2QKKA 7FD1A 1RBSA 1Q8KA 3VF2A 3EE9A 1QZ6A 3I5BA 3PYEA 5JVHL 3NGKA 3OS0A 4CHOA 4JKDA 1ZBSA 4ZMMA 2RSQA 3D3CJ 2WSFC 3TUIC 2ZH5A 1NOZA 1CLFA 2C2MB 3SCIE 5H9FK 4E89A 5JVGL 2JVRA 4X64F 4B8CA 4LRFA 3NH1A 2QRRA 2YNFB 2LU2A 5DMRA 2GW8A 3MUTP 4KTQA 4LVOP 3K5NA 4UZBA 4UW2A 3PUFA 3VQEA 4ZPBA 4JKGA 3AT1B 4DPYA 2WW4A 2DY9A 1H0HB 3D0HE 1S99A 3ZX3A 5ETVA 4ZHRB 2BJ9A 3EN9A 1RU1A 1H72C 1NHKL 1C4AA 1VQ7S 1S22A 4KGZB 1ZM3A 2ZBPA 2UUBJ 4F2RA 1Q18A 1H7XA 4P2XA 3TVZA 1TL7A 1UA0A 6FDRA 3TAMB 2BQ3A 4ECWA 3I5AA 1C1BB 2M88A 2D4WA 3EO3A 5C2FA 3MTKA 5BYQA 5FRMA 2CG4A 5KFSA 2UXBJ 2BUNA 2W4CA 1VSEA 1CJTB 2NNWA 3AVFA 5C7PA 4OI2A 3TI0A 1EHWA 5HVFA 4FJKA 2HKEA 2WSEC 1S79A 3UKUB 3WEEA 3T1HF 5GAGU 3SCKE 3CJKA 4FLZA 2K2PA 3D54A 4QU6A 3CJ4A 1J54A 2G0JA 3PJ9A 3J7Z5 2EWHA 1VK0A 4K25A 4WP8A 3CB4A 3M32B 5FIIA 3MMAA 3UI3A 3SFGA 5C15A 4DXLA 1M1KO 4JI6F 4DTUA 5C0YA 2WTUA 2G8WA 3W0LA 1JLQA 1N32J 2ZHAA 2Q43A 4LR8A 4F26A 4AL7A 2VHGA 1WUUA 3WXIA 2O3DA 3EX7B 2K8GA 1BD6A 4M63A 4L3NA 4K8ZA 2GHPA 3HSZA 4JHDB 4CT9A 1VRQC 3PW0A 4K41A 4OZ3A 4AH9A 3FEYB 4BBYA 1SS6A 1YJVA 3RG6A 4C2MA 2QW9A 3VEYA 1FVQA 2YHXA 3H20A 2E5HA 4JI5J 3NFAA 4C9DA 4UY8O 1PGZA 3HSDA 3CCRS 4OX8A 5JXSA 2RNEA 1S9FA 4BG8A 9ATCB 1VR6A 2LYVA 3MWTA 4H8KA 1M1KT 3UD4P 3AVBA 4O3OA 1RYRA 3D0IE 4DTXA 4QR1A 2B8PA 2B4OA 3Q2TC 3M1VB 2LXFA 2GFFA 1HLUA 2A6OA 1UVNA 1GQEA 5A0YB 2HVZA 4BHQA 1HYSA 1FE0A 2VBYA 3IC1A 2KKZA 2MLYA 4A61A 5DDPC 1CSJA 3BKTA 1EQYA 2XLKA 4KTZA 2WBRA 3PYGA 1NJIO 3A3OB 4JOUA 2RS2A 4I64A 1ZM2A 1W2BR 2MKJA 2AP6A 1I3OB 2P9IA 3GG4A 1F9EB 2OAUA 4OX9J 2ASOA 2Q3PA 3MMVA 4ILHA 3H5SA 3PIPQ 2G8VA 1LK7A 1VSJA 3PCOB 4KO0B 2FJEB 1MWKA 1K0TA 4M63C 4X65F 1SKSA 3ZZTA 4IRCA 1WWHA 4DX7A 4K43A 1NH8A 3A0IX 3PV8A 2EFVA 2IAJA 3GPAA 3QLHA 2QTDA 1V3SA 3RVCA 2ZUAA 4CJVA 1XWLA 1KQFB 3MM8B 2C3MA 4DV5F 1VQ5N 2Y1RI 1K8AT 4ZVFA 4Y6IA 2VPWB 4IDKB 3M8PB 2DFHA 4QIEA 2VQFJ 1JL1A 2RQ4A 1ZBFA 2VQFK 1RAAB 3M9MB 2PFUA 2V6AA 1P6TA 4WJBA 1S5JA 4EMDA 3PIOL 1ZETA 4RNFA 2MQMA 5IWAF 2V51B 4YR0A 4CF1A 2FLOA 4Z4CA 2UYTA 4WQ4C 2FC9A 3DLGB 3ZZ0A 3CJBA 1VHIA 2RDIA 2X6NA 1HNZJ 1LNQA 2ZHBA 2W7OA 1T6CA 5KFQA 3DU6A 1LAWA 4N8NA 2H65B 1LOUA 1VQSA 3UVJA 1VCTA 2MEWA 4JV2A 3H3NO 3CC2S 3OBYA 2QWQA 3LWMA 2LQ5A 2WVFA 1HNXF 3MECA 2QSFA 4KH4A 4RCHA 1APSA 4WIQA 2XTJP 2DKOB 4ETXA 3Q24A 5KGWA 3I56S 5DM6Q 3CMEN 3LDSA 2HHWA 2YJEA 4JI0J 4QS8A 1TP7A 4FPBA 4JI0K 3IM9A 3V9SA 3O2IA 3SQ2A 4WQ4A 1QE1A 2Q36A 4XH5A 3DLLL 1FRXA 4FS2A 3QAEA 1LWXA 3CFOA 1NJWA 4O8UA 3TU5A 3CD6N 1C0GA 4OX7A 3NS5A 2XSJA 3VF4A 1T7PA 3EGNA 2DGSA 4JI8F 2DXEA 3QEWA 1Q7LB 2P9GA 1F5BA 2OANA 2BVZA 4HACA 3TX8A 3HVAA 4XO0A 4C3LA 4KRWA 4ILMA 3WXKA 1DHMA 4DV3J 5KFUA 1WHVA 1XQSC 3OJSA 5CE3A 2KZMA 2IVFB 3LP0A 2CFXA 1J9AA 3ZXWA 2RPIA 3LP2A 4USKA 3CJKB 3K0JA 4B9SA 4GY2B 2CVEA 3HXMA 4FW2A 4ERDA 2XYPB 3SFUA 2P51A 2H54B 1KP6A 2A2DA 2DGXA 2CPXA 5EN1A 1OPIA 4OKEA 4CJLA 3Q7CA 4NLSA 2HZVA 1UOCA 4OQJA 1U7LA 1SL0A 5H9EK 3SAFA 2GQ2A 3TTFA 3NCPA 2QWOA 4UOCA 5EVZA 2IBOA 1XMQK 5AR0A 4DR7K 2JL9A 1XMQJ 4ILGB 4J9PA 1CBKA 1RBOB 4LF7F 1FXRA 4MKVA 3TJ9A 3GYGA 4DV4F 4CGDA 2D41A 1VSIA 1SJ1A 1SH0A 3SPYA 3B4MA 5IXUA 3VZIA 3PHTA 4H0OA 3W2WA 2CNLB 1CC8A 3CHWA 4QBUA 1S1XA 2OEMA 2XLJA 3N6MA 5H9FJ 1UL3A 2HVEA 3B54A 1AB8A 5T7LB 1BIUA 3HYFA 4W5TA 4WIIA 2RRAA 3T41A 4LF6F 5L1LA 3TA0A 1WF2A 3P5TL 4DL4A 2XS2A 4AM6A 2LVWA 4C8KA 4DSKA 3L3CA 2C28A 4CO2A 4EHTA 1VQKS 4UF4A 3AO4A 2NPFA 3OVBA 5D0RA 2CQIA 5CR4A 1ZA1B 3BP8A 8ATCB 4LSLA 1Q1KA 3JSYA 5I4MA 2L9NA 3NGRA 5E3QA 3G2XA 3WNGA 4B08A 1KVAA 3VV2B 5KFDA 4A8FA 3HO1A 3P6YC 3C8YA 3CJQA 3ET6A 3TWZA 4EO8A 2JC1A 1J5EJ 3TTCA 2U1AA 4LQ9A 2OPQA 4H4KC 1IO2A 3IGVA 4G9ZA 2DHHA 1VQLS 1QTMA 4DR1J 3VGLA 5TKYA 4AHRA 1XR7A 2N7CA 3SUPA 5CQGA 4OZ2A 2ACMA 2GIQA 2W1BA 2GVZB 3ZSXA 2HBRB 2PMWA 3CFRA 2AJ0A 4DG1B 2E1YA 1W26A 4CGJA 4PPDA 3CJ8A 3D9BA 3PHEA 4U8YA 3RWUA 1EO1A 2CJKA 3VAIA 2VC0A 1Z26A 4PWDA 3KHRA 2NUUG 4USJC 3H1QA 4ENOA 2BOPA 2J9CA 2CNKB 2M9KA 5KOXA 4EEYA 1D9FA 3M05A 1RZMA 2QMWA 3MX5A 1H2TZ 3P5BP 2CQ3A 2D7SA 4CJ4A 3WNEA 4BE0A 1Q82O 3TUJC 4YOVA 2KT3A 3Q83A 1IBKK 1SXLA 1XI1A 1R8BA 3GWCA 1FF2A 2DNLA 4USMA 1U47A 4JI5K 5CYMB 2C2ZB 1XNQJ 2UVRA 3A8YA 4NWBA 1E6YB 5JMNA 1BI4B 3DM2A 3LAMA 4N7TA 2E5JA 4KRFA 3FFKB 2F4FA 4NLTA 3EYZA 3Q8SB 4MYTA 5F8JA 2V9WA 5M1NA 4RWXA 2DGQA 3PFEA 5J1PA 2YBVA 4IG0B 1C0UA 3EDRB 5A8WB 4W5QA 4UT4A 4NA2A 1MLAA 3CCWA 2EK1A 3LQVA 4HHHA 1XMOK 3LAKA 2R7TA 3QGIA 3PW2A 1PG5B 3HHLD 5AE1A 4X62K 3VGMA 3DHWC 4ZVGA 1FESA 4X62J 4K4UA 4TKTA 4OHVA 4NYFA 3A8KA 4AQYK 1VSHA 2WSCC 4EK2A 5A2QU 2VV5A 3DYAB 4OX9K 1FJCA 5ETQA 3DLLQ 1S9GA 4DEZA 2GUIA 2F63A 1HNVB 3TVKA 1G15A 1IKVB 2XSJB 4B3OA 2CPYA 4CIOA 5J2NA 3WZ0A 3P38A 4LVNP 3GFHA 2CQCA 1HPZB 2RT3A 1A5VA 4PKDB 2IIHA 1HKAA 4AXIA 5IM0A 1SL1A 2W7PA 5D4OA 1HWUA 5LJ5Y 4FNIA 2RHSB 1N5TA 3LP1B 2UV8A 4KPYA 4FJGA 5F0XA 3H42A 2MZQA 5LT5A 3DXKA 3V9UA 4I6MA 3LP2B 3E1YA 5CCMA 1RKJA 4IEEA 3PDNA 2FY8A 2KM8C 4CZCA 5E7OB 2V4QA 1U25A 1S6UA 4OHWA 4Y65A 2FY1A 4WYLA 1N36K 3HPHA 4DOZA 2LA4A 2P6SA 4ZP6A 2DPJA 2GBZA 5IOLA 2PI4A 3AAWB 4BC3A 1ZS6A 5EWEA 3EL2A 2MQLA 1IBMF 4B3TK 3BBFA 4C8NA 1QHAA 2RVJA 3NVKA 3PNIA 5AJ3J 4E19A 3FSXA 1XC3A 2V7ZA 3DRXA 2XMMA 4CEDA 4OYIA 2KG1A 1KS2A 1YIJS 2VBXA 1JXLA 2W8KA 1Z05A 3R3LA 1REGX 4PQUB 1JNRB 4KQZA 4K4YA 2QL5B 2R7UA 3AARA 2HNZB 2WTFA 3I6PA 2WVEA 3ZX0A 1FFSB 2MLZA 3TP2A 1HBMB 1PC4A 1F21A 4BC4A 2ZGYA 1J5OB 1MU2A 4ELTA 2EFQA 1YTAA 3ENWA 4DR3F 4G1IA 3IS9A 4DV0K 5T7LA 5AQFA 3KK2A 1SH3A 4MO4A 2FGCA 2E5LJ 3PX0A 3UIQA 5EX5A 5GINA 3V1OA 4Y2KA 2KT2A 1NSPA 1PSDA 1UFLA 3TA1A 4BVPA 2NPIA 2BYCA 3MCOA 4NE9C 3V4IA 5HATA 1ZM4A 3MCSA 5K14A 3J7AN 1S0NA 3DN9A 4BRKA 5KAKA 4FM0A 3QEIA 4ISEA 3OTDA 4RW4B 5DM7L 1W2BM 4NXMF 5J2MA 2MHEA 5GADP 1QVGM 1S6QA 4DUZF 2DNMA 2QLXA 4RU9A 6FD1A 3NY0A 3CCES 3FSYA 2QA1A 4JS5A 4CZKA 2JC0A 3SDEB 2VPZB 4DQSA 1VBYA 4ZCLA 1DJ0A 4MYUA 5IC6B 5LMUJ 5KFXA 4FWMA 4LH4A 3FZMA 2BACA 5T7BA 1WNEA 4U7BA 1EKRA 2VCPA 2HFVA 1U0HA 4LF8K 2A3ZA 3L6QA 4PKHA 1WC1A 3UN2A 2NRXA 3EGZA 2J76E 2R8JA 1IR0A 4NLDA 3CJAA 3AODA 3MGJA 1WSHA 4BACA 5LMNJ 3BJYA 3TYTA 1RI7A 5BPMA 3TEHB 4DR7J 3L4BC 2B0GA 3AB4B 3J7A1 1AA1B 2LA6A 2DH9A 1YGYA 3R6LB 1VDHA 1UAXA 4J9MA 3PW5A 2V7YA 1FFWB 2RE2A 3K7RA 4B1XB 1NGFA 3H98A 3OTOK 3G86A 1NMEB 3R5JB 3QSYB 1TV6A 2MZTA 2CZVC 2W41A 1KVKA 3HVTA 5HSPA 4IEIA 4IWVA 3H8YA 3UD3P 2Q1LA 3RW7A 3RB6A 3CCRN 1SH2A 1OO0B 3DM2B 5DJBA 1D9DA 3GYNA 3UDVA 1RBLA 4BREA 3DI6A 3H7HB 4ZVTB 3ZYYX 4UOFA 3Q89A 3QBXA 3KD5E 2I2YA 2YKMB 5KPRA 3EKSA 2FSKA 2LKZA 2OMOA 3HZ6A 2ZC4A 1TL7B 5AE3A 4HT5A 4MFBB 4N77A 1GTEA 2YNIB 4K7QA 1YRXA 1IBCB 3W62A 4Z7YA 4V19J 3KMQA 1EB0A 3CJSA 3HHLC 1WNSA 3AJ2A 1MG7A 3CCLS 5KFOA 3IA0A 4K4VA 4AXJA 4QYZJ 4NLGA 2ZQBA 1RAGB 1MWQA 5GAGP 2NS1B 1J6ZA 2R7WA 4E98A 4BCAA 2YKQA 2DB1A 3CCEN 2KFYA 3PM9A 3UWTA 4CO0A 2OFGX 2HB5A 1S9GB 2UVVA 1ELOA 1X3NA 4G3IA 2O8CB 2ABYA 1FRHA 2LXIA 3MMAB 4CLUA 4TNOA 4B9NA 4LR9A 4QR2A 2CPFA 4IOXA 1KVIA 1WB9A 1WKLA 3SV4A 2ZM6K 3UNGC 1FRKA 4D3GA 5HVHA 2E9TA 1DQ8A 9RUBA 2YHBA 4DCPB 3DRPA 2VD3A 3GIKA 1XMOF 3K5OA 2QA2A 1WC0A 1QSYA 4OI4A 5F3TA 4YY3K 3D0PA 1VQ9S 3RZAA 2MY8A 4LF4F 5J1NA 3IP0A 2ZVIA 2M0GB 5LJVA 1MWMA 3K8VA 2BBEA 2CUYA 1I51B 3PIPL 2NRTA 1NU4A 3M3ZA 1IJFB 1CJKB 1GLDG 1P9YA 4QS7A 4KHRA 3UO0A 2HF4A 4DPUA 5C10A 4BDZA 4BRDA 4WTYA 1X0PA 1B9FA 4FWNA 5D0HA 2QZ8A 4PYAA 4ED4A 3BO4A 3HVRA 2IRXA 4E7KA 5I3QA 2HNZA 1HL6A 2W01A 4KHUA 3DGVA 2XGQA 3CCQN 1NH7A 4ILLA 3WQUA 4I69A 1U1OA 3T5HA 1KAXA 5LSOA 2D0BA 1R8AA 1HW8A 3IWNC 2LDYA 1I3AA 1FVSA 3LZJA 2QYCA 3KLHB 1NZAA 4JN4A 4Z0UA 5K8MA 5KT7A 5D0GA 2O8EB 3CCLN 1M5SA 1ZYQA 1XNRK 1GEHA 2VONA 1XNRJ 1RQ0A 2EFPA 4M5IA 1KQKA 4P7TA 3OXFA 2XO7A 4U95A 3OYDA 3ISZA 2B4VA 2Q79A 3V4IB 3HVWA 4HCBA 1NSQA 4QPXA 2OPSB 2B8QA 1GLFO 3FK4A 1ESVA 4FF2A 4GKJJ 2EVZA 3CCUN 4DR2F 2JWKA 4BLGA 1JJCB 3VMFB 4H4MA 4O3NA 3G6VA 4PEOA 3F73A 3ZZZA 3TUZC 3MM8A 2RQMA 4ZP8A 2HBZB 1NGEA 1G7CB 4IDKA 3L2RA 4QAGA 2F7TA 4JI3K 4NRTA 3ISNC 2PD1A 5EHHA 4RPFA 3G4SS 3KOAA 5DZ7A 2F40A 4WYWA 1KHWA 4E1JA 3SJJA 5HRRA 3RR8A 3HZGA 2GO9A 2VG6B 1N36J 1KVJA 3MM7B 4CM2A 2LEPA 2MQOA 2ZH2A 2M8HA 3DLHA 2XMUA 4GKJF 3DNCA 3L3UA 1VIOA 1RJJA 2IFXA 3PEHA 4LT6A 2MMYA 2ZITA 4WK1A 1OY8A 2E2OA 1V3RA 1B7FA 3DLEA 3T6BA 4B3TJ 4L3QA 5DDQC 4DL6A 3MHYA 3K9KA 1NKBA 3M6GA 3PY8A 2MZSA 2DH7A 1OVYA 3EPGA 1T95A 1RT7B 2BMBA 4M5HA 4P2FA 1TUGB 4H4OA 2JLFA 1NSAA 1P1TA 3T7ZA 3P5JA 4DKWA 2G0IA 4ECXA 4DV3F 2V2ZA 5DG9A 3F44A 3QYYA 4DV0J 3QICA 1JLFA 1L3KA 4IFVA 4CZMA 1HNZK 3QIPB 1N0UA 3R1HA 2R7XA 5HJYA 2O4GA 1PKUA 4G6VB 4C3MA 4FZXC 2E1PA 3HSTB 5AXNA 1NKEA 5B8HA 2HBLA 1WC3A 4FZZA 1L3TA 2NZCA 1HRHA 1TKXA 1JJ2M 3DHXA 1W25A 3B6PA 1Y0HA 4W98A 3NNHA 1RCXB 4OKJA 3U3YA 4HACB 3PYFA 2VQEF 3OL8A 2X78A 4CW7B 2GQCA 3Q8QB 4DFPA 3KNAA 1TKTA 3EGVA 1Q86O 4CBUA 1WOOA 3GBTA 3VERA 3MEGB 2QMXA 1SC4B 5AQYA 4H0PA 4M3YA 3VHQA 4DUTA 4C0BA 4LF7J 1WORA 2QEXS 4YEAA 1JLBA 3U27A 2VJUA 3FKBA 2CQPA 2WUSA 4OZLA 4LC9B 3M30A 4CCHA 3HM9A 2HYIB 2F8TA 1J5EF 3HFKA 2D74B 4RBUA 5L9NA 5KFJA 4A62A 4LF8J 1S7HA 2APOA 1CLQA 1R0CB 2VKRA 2VPYB 1N33F 1N34K 2W25A 2GVDB 3CCSS 1ASUA 1SIZA 4CFDA 5EX0A 3LWLA 2MPUA 4OYAA 4DR6F 1JLGA 1HI1A 4PRFA 2UU9F 4KTWA 4Z2XA 4Y2CA 4J2DA 2R2RA 1FXXA 4BS2A 1BQMA 1FEEA 4OHZA 1Q82T 4GKKJ 4B3SJ 1VQ6S 3DAWA 3W2WB 3AAQA 4CHZA 4NX9A 1KOOA 1EARA 4FN5A 2J8AA 3H25A 5AQTA 4F0KA 2OPRA 3S41A 3H46O 5HLFA 4BQLA 1YLXA 1BDGA 4AYBD 4QWBA 4QIWD 3NH0A 4DUZJ 2HQIA 3RB3A 2LLZA 2FJBB 2P5GA 1X8DA 1HWJA 2ZBQA 1T6DA 3C0BA 3KJQB 3MR3A 4CTAA 3D5MA 3OS1A 1QQNA 1WF0A 4CIFA 4PG6A 4I0WA 4JI6K 4GNIA 1VFJA 3SI8A 3GFYA 4JI6J 1TELA 4CJ7A 1CULB 4QR0A 3ZSZA 3CYMA 1GK8A 1VQ4S 2B7CB 3V81A 1RLDA 2W2NP 5I3PA 4HTJA 2OPQB 4ISFA 1YJ9S 1YITN 1JX4A 2DFEA 2C42A 2GV9A 2JWNA 2BJ1A 3FBCA 2O8EA 3NE6A 5BXIA 3R2CJ 5LMNF 1JK9B 3HJFA 3M2UA 2VBWA 1HNWJ 1BISA 3MAQA 4BC5A 3H4DA 3H4BA 1ZA2B 1HNWK 3D1HA 3TW0A 2GVZA 3G6YA 3NGIA 1D5AA 4RR5A 5JJBA 4DG1A 4F25A 5F0WA 4LF4K 2P9KB 2V63A 1O6XA 1RHRB 4LF4J 3EZWA 2UXCK 4YN3B 5CZXA 2CH5A 2H51B 2L48A 2UXCJ 5KQDA 1RT1A 5J2QB 2ZM6J 1BCOA 1RTDB 2XYHB 3J81Y 4FCYA 1B3TA 1BU6O 3VQ9A 4DPXA 4LF9K 3AVAA 1NK9A 5AE2A 4LF9J 1TL4A 3U1MA 1LV5A 3NOCA 4NLXA 3NCRA 2DO0A 3HULA 1H74A 2J7WA 2BEFA 1LW0A 4CD3A 3QDKA 1YI2S 3K58A 1K73T 1KC8O 4ZKAA 4OKKA 4YY3J 2WVDA 3AO5A 5I3UA 4XPEA 1VHXA 2G8FA 4TY8B 5KG3A 2AT1B 1WC6A 2W9BB 3HBTA 2QWMA 4BR0A 3FZHA 4CGFA 3FFIA 5F8IA 1N32K 1XNRF 4L8RB 3UW1A 1XERA 4NASA 3VEXA 2PI5A 3O9RA 3BYPA 1HBNB 2ZBRA 2PZSA 4DPTA 2UUCJ 3QWUA 3PEJA 5FDLA 2Y1JA 4ZOSA 2UUCK 5A8WA 3MCPA 5IT4A 3KG4A 5K8NA 2LQ9A 3QT8A 1NBEB 4RTFD 1G6BA 3BKUA 2PY5A 2FBVA 2XHBA 5GMKa 3A3PB 4OI1A 4O0JA 1JKHB 3J80U 4NRUA 3SQGA 4M8LA 3GP9A 1KDNA 3PR4A 1XNQK 1WD6A 3HCXA 2K06A 1R0BG 4PQAA 3UDLA 2V8GA 2F7VA 1M90O 3HOTA 1SPBP 3V9ZA 4YQWA 1KFSA 1ZH5A 1TGOA 3Q8UA 1RT6A 5J2NB 1VQ9N 1M5HA 2AEFA 1QJHA 3LM2A 1NLVA 1SI9A 1T02A 1VC5A 2P9CA 4FWRA 4GKJK 1FERA 1XMOJ 3ZFVA 2HBYB 3P96A 2CYYA 4A46A 4ANCA 3OLBA 2G8UA 2E29A 1K47A 3MEGA 4P2SA 3BF4A 2E1AA 5HMWA 1RWMB 3P39A 4CYUB 4X4SA 1KAYA 3E9PA 4C11A 4FK4A 4MLEA 4GV9A 1JLBB 3M8YA 4J7CA 4OYWA 3F9KA 5JICA 3DLRA 3QNNA 4FLVA 1YF5L 4KHQA 1SQKA 2D0AA 3T1YF 3FCVA 5HANA 2H5IB 2WAQD 4U7CA 4MJKA 2MGZB 3OYAA 2AWZA 5L46A 4QYRA 3LH2S 4BGBA 4KGVB 1NK6A 4JEPA 2XBPA 3D6MB 2NRRA 1VRUA 2R2SA 1JLGB 2F8EX 3H6EA 3CW2C 3C6TB 1BWEA 1RBTA 1N0VC 1OIAA 2UUAF 4X4UA 2ASPA 3TZXA 3NGYA 1WSVA 4EI2A 4CJ3A 3ELHA 4NL5A 3UKRA 3NAIA 2OH2A 4LQ3A 4WZMA 1S9EA 4WQ5A 2KHCA 3ZT2A 3VAMA 2QFJA 1RHMB 2DITA 2E9ZA 1J5OA 1IUJA 3VAJA 3D2FA 3Q0AA 2BTFA 3OBWA 4JV0A 3NDKA 4YR2A 4J90A 2VG5A 3H59A 5HMYA 3DRYA 3MWBA 4PPZA 4M42A 4M94A 4L72B 1F0XA 2KVQE 3KKFA 2B43A 4CF2A 4Q45A 3G6XA 5CABA 1U6BA 3KUGA 1MNEA 5E3CA 3PW7A 2PGCA 2VB6A 3BS9A 3PW4A 4O23A 4ZLPA 2YHWA 5KFEA 1N56A 2YPZA 4CTAB 4C97A 4CO3A 1HHTP 4RW4A 2CPIA 5J2MB 1LW2B 2N3OA 3LA0A 5MLCV 2C22A 1NKCA 2GIRA 2RU3A 2Y1IA 4LF7K 2IHR1 3VAHA 2JRSA 1S97A 4CF0A 4O5FA 3I55S 1U26A 4AHUA 1NHUA 1RWWB 3MCAB 1B0TA 4LIRA 1V5VA 1IG9A 4RBTA 1B92A 3T3FA 1D3WA 3HP9A 1FDAA 2M7SA 5CZ1A 3PRDA 1UEVA 3QFUA 1PYTA 3G10A 2DT9A 1NGBA 4DR4K 3A3NB 1KOHA 3MTJA 4DPOA 1EP4A 2O8BB 1AFIA 1VQMN 1RLCL 4DL0C 3W9JA 1O51A 4HDHA 3N01A 4U9RA 1UWBA 5KG2A 2HIQA 4KH5A 4FNHA 1RT1B 1S59A 5J2QA 1FE4A 4A8WA 2UUBF 1Q8BA 4FZVA 1CJTA 4Z7CA 2LXUA 2VZ9A 4KGMA 4E8UA 2OD6A 2MJUA 3L7PA 5HBMA 1U02A 1S1UB 5EWFA 1BC6A 4DV6K 5LMUK 3CD0A 5E0OA 4NI2B 7AT1B 4GKKK 4B3SK 3KXDA 3LDPA 3U1LA 3KZBA 5KFIA 4JKHA 4B3MK 4XDCA 5I3UB 3O3GA 5M2RA 4M45A 2RH3A 2ZWHA 1KQSR 4M7YA 1Q4RA 4NLBA 5CHIA 3FFIB 1Q9XA 3RSEB 5CD4H 2P9NA 4B1YB 4BRAA 1KEKA 3OYLA 1FJEB 3RAQA 4C6AA 4L6V3 1EQMA 2PFFB 1VI7A 2DK2A 1HNWF 3MEEB 1GX6A 4B1UB 4K5SA 2O66A 1D4XA 3MCNA 4RW8A 3MPWA 5HJXA 4ANDA 1Q81O 3M2VB 5BN8A 2EK6A 4B9VA 4QWDA 1KC8T 1K73O 3C66A 3ZO7A 1RSCA 1RYSA 2CQ2A 2DY4A 2Z57B 1YJWN 4BRHA 1LQ9A 2YX4A 4S0MA 1OSDA 2JNJA 3TAQA 2C2OB 3MM6A 3G96A 3G6EN 2MQQA 5CYQA 4ER8A 4IDHA 1U1MA 2HHXA 1TL5A 2MLXA 3RMBA 4L76A 2LFVA 4JLHA 4B9LA 1HD0A 4H5RA 3IG1B 5BRDA 3CM5A 2DXDA 2DTUA 2OA8A 3OVNA 1L5UA 2E1MC 2HQCA 2WHOA 4LFBK 4LREA 3PKMA 4FJ8A 4EZ6A 3MR5A 1RT6B 3FBFA 4XEIA 1VSMA 2QSWA 1EXQA 5AQVA 4ECUA 3MDQA 2BKOA 1VQKN 4EYIB 2NLXA 1XK8A 1T9YA 3FCHA 3SQOP 4JRQA 1JJHA 5MLCQ 1HW9A 3L2WA 4QYZK 4DDFA 4C11B 1XJWB 2XZWA 4PR6A 1J53A 3KHLA 3I9ZA 4V1Ak 3SQ0A 1U1RA 4Y3CA 4C1NK 3US5A 5CZVA 4QU7A 4TQRA 4I9QA 2KJWA 4EYHB 3SZ2A 1RAFB 4ZLLA 4EAHD 1S76D 5IWAJ 1G3OA 3NAHA 3I9V9 3NGSA 2EC2A 4X66J 1YT3A 1L3VA 4CEBA 4X66K 1JJ4A 1QD1A 4CZEA 2P6TA 1X9WA 1WDDA 3A5LC 2DR6A 2HHPA 2VKZG 3CWJA 3C6TA 4N47A 4CEZA 4O0IA 4PG5A 1WACA 2I9SA 1Z2ZA 4UUWA 5AJ3F 2E44A 2OLWA 4ELUA 3JS6A 1VQ8S 3OYCA 4BVOA 3KWGA 1IBKJ 3N0VA 2BE9B 3E3XA 1LXJA 2CDRB 5GIOA 4YB1P 4OYPA 3AD9C 2HQGA 5E3AA 3BQ0A 3UR0A 1PO6A 1S48A 3L7OA 4WXWA 1FNOA 5HMZA 1TFWA 4LRAA 3V6JA 1Y97A 3Q23A 1L3UA 2ZF5O 2R8HA 2BABA 3P8BB 1AUDA 2LU1A 3A5OC 2J6UA 3C14B 3CSKA 1VLOA 1UPPA 3AJDA 2OZMA 3BO3A 3UVJB 4DFJA 5K8PA 2I8EA 1SV5B 2KJVA 1IWAA 2A5XA 2OSRA 4TY9A 4DV1J 3J7AP 1YJTA 1B4SA 5AQLA 3SJHA 2ZKUA 3CCSN 3J7ZT 4F8RA 1UPMB 3CNQP 3H3OB 4DI6A 5D4PA 2QLBB 1ZAVA 4U8VA 4RW7A 2E1CA 3GFXA 3UQSA 2FHKA 3FQLA 2CGJA 3PIOQ 2X7IA 1SJ4P 2IC3B 3BO2A 4KPCA 4FWQA 2YQ0A 4ID5A 4OYXA 1U48A 2O5DA 3R5CA 4WFXA 2WFBA 3V6KA 3H2UB 4LBPA 1GLAG 4RNNA 2HMPA 2YH0A 1B64A 4WCEL 1VSFA 1X9JA 4TYAA 1U1QA 4W90B 4RKUC 5C25A 2IM0A 2Z0GA 2DR7A 1HD1A 4DN9A 4TYBA 2ZDPA 1UCNA 3WIVA 1Q95G 4FXWA 1EQ0A 4CNZA 4CJFA 2ZFHA 1ZC6A 1UWBB 4HTIA 1NB2A 2KI2A 1RGIA 1TUYA 4MLHA 2JWLA 3HSCA 3P1GA 2O8FA 3MXHP 4NA3A 5HI7A 5E84A 4F9OA 3AQPA 2IIRA 1X3MA 3RUBL 4FJJA 3KD1E 2HSTA 1EETB 3IRWP 4QS9A 1KVBA 1WEXA 3ID6A 4Q5VA 5HAOA 3E8OA 4NI2A 5BR8J 2FVSA 4OLBA 3NMUA 5D8HB 5DGBA 1U1NA 2PE8A 2KB2A 3MXJA 5KT3A 4IOCL 2DNOA 3OBIA 3ULEA 4ZIWA 1HWLA 1K8KB 2E8AA 1VQMS 1IKWB 4P75A 3UE5A 4CLPA 4X4PA 3QFHA 2YX7A 4CFAA 3OYHA 3V9WA 4USWA 1Q8LA 3FEXB 3DKDA 4HT7A 4A8MP 5F8MA 3PJXA 1TKXB 4BC2A 4JI5F 1R89A 3TAEA 4ICLA 2HGNA 2CQBA 1DAXA 2IY5B 2VJVA 4RW8B 2HRYA 2RHQB 2A6MA 5B0FA 4TQSA 4DR6J 1TKTB 3MN9A 3VGSA 4IBNA 3GONA 3VQQA 1S1XB 2Z2ZA 2GQQA 3BQ2A 5DQHA 3B78A 3UD5A 1MN9A 4DSIA 4K42A 1LK5A 3IG1A 1FKPB 3H5XA 4N56A 1LWEB 2Z2LA 2BANA 5KPTA 5KFLA 2JX2A 5E33A 1U2VB 4I2PA 1Q81T 2ATQA 3RB0A 4P71A 1S7IA 3QJLA 3ZT0A 3M6UA 5ETOA 3AD7C 3K8WA 5L39A 3OYJA 1U2CA 1RHKB 3PSFA 3GU0A 1OSCA 4KH1B 1WUAA 4KHWA 2E5LF 2Z30B 4FLXA 1B9DA 2DEIA 3CJ3A 3R2DJ 3CCQS 4ED0A 3LDLA 1RWOB 3PRBA 4DV6J 5LSLA 2FVPA 2AJFE 3EXYA 4URQU 2YTCA 4DR1F 5JMVA 2H3EB 2CA9A 2CIMA 2KZZA 4YDUC 3VPZA 3POTA 1BXNA 1MSWD 1RHUB 1SC1B 3R5BA 3MAAA 1I94F 3BSOA 2ZWPA 2FF6A 3SCLE 1VHFA 1X5TA 1PJ5A 1YBAA 1T3VA 1FJGJ 4I7FA 2X1AA 2Q3SA 1F2GA 2CRLA 2OEKA 2OMLA 2AW0A 2JOQA 2GGPA 1RAJA 4C0OC 2XEXA 3GTYX 3VQBA 4FO0A 3D67A 2QWNA 2HRUA 3TR5A 3R7NB 3J81j 3GIMA 2E2NA 3OY9A 5HL7Q 2Q6BA 2BJEA 1IJEB 2GHVC 1RILA 2VL1A 4UQGA 3KDOA 2EEYA 3QIOA 5A6PA 3T9NA 1UW9A 2OO4A 1R6YA 4KAZA 4GVMA 3ZT3A 1N6QB 2A1BA 1N33J 3IKMA 1Q7YO 2Z1JA 3IWLA 5CYMA 1NGDA 4DL7A 4MK7A 2X6SA 1T9UA 4PA1A 3P83D 1EZZB 1SC6A 2XY6A 4XH4A 4YOTA 4ZPWR 5HP1A 3AO2A 1NMDA 2F4VK 3OV7A 4ZHRA 2CPJA 2F4VJ 4F4XA 1O5JA 1TL1A 4AUKA 5KFFA 2M8DB 2V8PA 4CJKA 4OJ3A 2YPYA 4G1PA 1C1BA