5HLIA

Structure of disulfide formed abfr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
149
structure length
146
Chain Sequence
QSNMKQEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLPDTTEYDETKYVFEELEQTLKHLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
molecule keywords MarR family transcriptional regulator
total genus 55
structure length 146
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hliA00
2DT5A 3E3VA 2A6HF 1PP7U 4HDVA 1P2FA 3R61A 3EYYA 4ESBA 3RKXA 3P7NA 1SD6A 1D5VA 1BIAA 5K5QA 4FT8A 3BJOA 4YFNF 3PFIA 2GA1A 4WXHA 2EV6A 5FB2A 3P9IA 1IXCA 2ELHA 2IVMA 4G6QA 4RGSA 1FSEA 2XKPA 4HF1A 5L3CA 5E1ZB 4YG2F 3M1EA 1UHMA 3E5XA 2V9VA 2HFHA 3BJAA 4ESFA 2Q2EA 1ZGJA 2H6BA 2HGCA 1Z6TA 4EV0A 4YIIA 3U9GA 1H9GA 1KA8A 4ENNA 4ZYHA 3FF5A 2ZNYA 2LF8A 1YTYA 1UCRA 3WTVC 4UNOA 4R79A 4LK1F 1GXQA 3Q9VA 2FE3A 3AAFA 2EFQA 1BJAA 1QNTA 1W7PA 2XASA 5TJJA 3V7SA 2V1UA 4UVCA 3SQNA 3HIFA 3M9AA 2K4BA 3QP5A 2M1BA 3ZP5A 3WTXC 2VT2A 2OA4A 3VOEA 2XAGA 3GWZA 3MAJA 1ZLKA 4ZZDA 4G7OF 2DAOA 1YW8A 4GCVA 2A69F 4Q5SF 3WE2A 3F6VA 2P5LC 4YFKF 2EB7A 4UVBA 1LVAA 4ETSA 1B6AA 4HLYA 2KKOA 1BI1A 3OV8A 2VOOA 1ZYRF 3TO7A 5CVRA 4LG0A 4HF0A 4IPAA 2RDPA 1SFUA 5ILUA 5LGNA 2H6CA 1SMYF 3QU3A 4EJVA 4BH9A 3I0TA 3E6MA 2HYGD 3KP3A 5J6XA 2A6EF 3C7JA 4CGZA 3M7GA 1MDMA 2M5WA 3I53A 4M9XA 1MJ9A 1EH6A 2EA4A 4PCQA 2EWNA 1XMKA 2JRTA 3GXOA 4WF2A 2K27A 1OKRA 1B9NA 4GYIA 1Z6RA 4ENJA 2K86A 3MCZA 4D0PA 1ZH5A 1IZ1A 2PQ8A 3GW2A 4ENMA 2LF7A 2VONA 4BXUA 4IJAA 1TNTA 2M8EA 4B8XA 1KQ0A 4DQ2A 3FMRA 3LA2A 1IW7F 4N9IA 4UV8A 3GZ6A 1EH8A 2PBIA 3PQJA 3GF2A 2R7DA 3TO6A 4GYGA 2D45A 3HTSB 5L3BA 3F72A 1YW7A 4R1HA 3IRRA 1U78A 3CUQA 1T39A 1XCBA 1TNSA 1TQPA 5FD5A 1RUOA 2CW0F 3LQQA 4HV5A 4HYEA 3FM3A 1Z7UA 4KN4X 2MH9A 3HRSA 4U0WA 5K5OA 4QWQA 4IRHA 1U8RA 2JTVA 2XAFA 2YU3A 3JTHA 4A0YA 4TV7A 3M8FA 1C0WA 3K2ZA 2FU4A 1OPCA 3KLNA 1F5TA 1FC3A 1R1TA 4HQMA 1K78A 3CJNA 1OYWA 5D5VB 4L9TA 1BM9A 4RB3C 2KRFA 4RAZA 5DDGA 3RPQA 3DKWA 5CLSA 1ZRFA 2DQRA 3NQOA 3IKVA 3RIRA 2PG4A 1U3EM 2LSOA 2QM3A 3F23A 2OBPA 1LEBA 2LKPA 2PI0A 1DPRA 3I5UA 3KEQA 3L9FA 1ON1A 2F5CA 3GFJA 2HWVA 4Q48A 1HW1A 1R58A 5HDKA 5F6FA 1B9MA 1DUXC 4BAYA 3BP8A 2P8TA 5DEQA 4L9JA 2K4JA 2M45A 1RIOH 1A04A 4I7HA 2RV8A 1ONVA 4OMZA 2DI3A 3EUHA 3WTZA 1KU7A 1JHHA 1O7FA 1HQCA 2L02A 1WQ2A 2IJLA 4BHCA 5ILVA 1EH7A 5CVJA 1OR7A 2H94A 2VBYA 3KZYA 2BBYA 3KP4A 3P9KA 2ISZA 3M8EA 1RNLA 3HOTA 2A68F 3B73A 4OMYA 1G3WA 2DFIA 1F1ZA 1REPC 4ESJA 5E1XA 3IC7A 3V8JA 5CVUA 5F1RA 3I4PA 3H92A 3HHGA 2FXAA 2FF4A 1CF7A 3ZMDA 4LFUA 1I1SA 3ZMVA 4U88A 2OAZA 5BPIA 3FM5A 4U7DA 3RKWA 2XVCA 2DK8A 3HRTA 1IRGA 4NB5A 1IN7A 2HOEA 3O2PE 4HLXA 3V7CA 3F8BA 2L54A 2WV0A 3TO9A 3ABUA 2O8XA 3J80K 1E17A 1LEAA 2PMHA 4I01A 2OU2A 2ZNZA 5J8CA 2ETHA 4XSXF 3ECOA 3ZN1A 4N9HA 4AIJA 5HS9A 4KIGA 1XN7A 2HQRA 1OMIA 2JPBA 2DLLA 1H9TA 4KN7X 2QQAA 5E8GA 2DU9A 4IRGA 5EEGA 1R7JA 1HW2A 2VXZA 5DCFA 3T5XA 4CO8A 2VT3A 1GVJA 1R22A 1UFMA 1FYLA 2QUFA 1MZBA 2COMA 3FX3A 4BHBA 1SAXA 2FQ3A 2L4MA 3JAMK 3GFMA 4UVAA 4AWXB 5FD6A 4CHUA 4NQWA 1P92A 5FO5A 4GXOA 2XRNA 2AXLA 4WXCA 4I09A 2G7HA 2A3SA 4LJZF 4K2EA 1FT9A 4U0YA 5HLIA 4IF4A 5H6QA 5HS8A 1PP8F 1U6GA 4P9UA 3I54A 1XCVA 1G4DA 2DO7A 2DK5A 1MKMA 2C6YA 3RYRA 4H0EA 2X4HA 3S2WA 4EVIA 1BN5A 2FNPA 2UXNA 3Q5FA 3FXQA 3R4KA 1ZLJA 5DV5A 2EV0A 4Y13A 3J81K 3ZMUA 2DPUA 5A2QK 3IWFA 3LA7A 1S3JA 3T8TA 3HRUA 3GUDA 3BPVA 3FMSA 2DW4A 1L0OC 3D0SA 3G3ZA 3CTAA 4RGXA 2ZO4A 4M73A 3HRMA 1QZZA 2KIFA 2HQNA 2Y0MA 1I27A 1I1GA 4WK8F 2AS5F 2X0LA 3CO6C 3VODA 2H27A 3QOPA 4P55A 5KVRA 4HF2A 3KLOA 4Y17A 3SFZA 5BMZA 1T98A 3BWGA 2QYOA 2GXBA 3N4MA 5JFRA 2UZKA 1Y0UA 1O7LA 2RC4A 1GHCA 4KICA 3RPUA 2WC2A 3CDHA 2HDCA 1R5GA 3E97A 4XLNF 2VODA 3EYIA 3K1PA 1O3SA 2E7WA 3FXUA 3MWMA 2Z5UA 2HEOA 4PZJA 3T1BA 2GAUA 5LBQA 5E20A 3LWFA 1T38A 1CGPA 1KYWA 1P4WA 2BGCA 1HBXG 2O0YA 2PFBA 3IHUA 4S05A 2DPDA 3COAC 4A5MA 2W85A 2P4WA 3HUGA 1FYMA 4M6XA 3HTUA 1ZRDA 3L09A 1SFXA 3WU0A 3J7AO 1HKQA 1V4RA 3REOA 3DP7A 1ZN2A 2VE9A 2P5KA 2KIMA 3F8MA 3I71A 1ODDA 3WE3A 3JW4A 4L9VA 4OIOF 1YYVA 1TW3A 3KE2A 1ULYA 3HOSA 4EGYA 1QGPA 2CQKA 2VN2A 3QPTA 2A5YB 4L9NA 4L0ZB 2BYVE 2L4AA 2ZFWA 1O3QA 1SMTA 2MBFA 4O6JA 4P96A 3J81Z 2HKXA 3ZN0A 3K1MA 5ICFA 5TRDA 2VC0A 2YPRA 4PDKA 1R00A 2HKOA 4A6DA 4G9YA 5ICEA 4L0YB 4IHSA 4BNCA 4ON0A 4LLLA 3FZVA 2WWYA 2NS0A 2K7LA 3RDIA 1LDKB 4HDUA 3QAHA 1BC8C 4FX4A 1O3TA 3ERED 3R6SA 2NNNA 3DPTA 4LG0B 3SZTA 1ZARA 1USTA 2JT1A 3F21A 2BE5F 6PAXA 1J75A 5J8FA 3CUQC 1XSVA 5LRSA 5H6RA 2CG4A 2QENA 3WU1B 4MQVA 2VE8A 2CGPA 4A6EA 5LGUA 1U5TB 1BC7C 4QLCU 2MD5A 2OD5A 4A5NA 1MD0A 3Q9SA 1UHWA 2XAJA 3H3ZA 3CUOA 4U0VA 2STWA 5K1YA 2IA2A 1L3LA 3WGHA 3QU6A 2XGXA 4GO1A 1P4AA 1G3TA 1OYYA 2YX7A 3C18A 4G8XA 3ELKA 4DNCA 5D4SA 2LNBA 1IRFA 3VFZA 1YLFA 3KEOA 4LB6B 4FHTA 1IN5A 4CYDA 2F5FA 5ICCA 3JSPA 1B4AA 1BIBA 1QZYA 3BDDA 5CJ9A 4HAMA 5ED4A 1WI9A 1VTNC 3WTWC 3LAJA 2RN7A 2VC1A 3W6JB 5D5UB 2IA0A 2OQRA 2EA2A 2ACJA 3WGGA 4Q47A 4LLNA 2YR2A 4R8HA 4A0XA 1WSUA 5D5XB 3HHHA 2Z9OA 1TLHB 1I6XA 2RKHA 3MQ0A 5DCMB 2FMLA 3IKTA 3F3XA 3DEUA 3WODF 4BHPA 4OIQF 2IT0A 1TQMA 1KQ8A 1IN6A 5HDNA 1XGOA 5FLXZ 4PGHA 4MTEA 2CYYA 1K78B 1YW9A 2ESNA 2OQGA 1S7OA 3GVAA 4B09A 1STZA 2XKOA 1K7AA 5L3FA 2OZUA 2XAHA 1TW2A 3GZ5A 1KU9A 1P6RA 1DDNA 4CDGA 3I59B 1FX7A 1IUYA 1G6NA 2BV6A 5LRRA 3ROUA 3WTYC 4LLGF 4G7HF 2FBKA 5LHHA 1HSTA 2XAQA 1HW5A 2QLZA 3TQNA 1D8JA 3EQLF 4YIFA 4OINF 1KGSA 2E1NA 1H0MA 3V4GA 1FYKA 4A2UA 3L2CA 3G73A 4L18B 1KQ9A 3TKYA 4HX4A 5IT9Z 5DCMA 2MLKA 4EJOA 1UB9A 3IWZA 4O3MA 3GLXA 3DQVC 1PDNC 3I58A 3MFKA 1ZHFA 4I98B 2V79A 4M9SA 5HVQC 4KMUX 2NRAC 3E5UA 3U2RA 1AWCA 5D8KB 1HSJA 1KU2A 4AIKA 4I02A 3KETA 2KIUA 5LHGA 5FFZA 1R5HA 5HLGA 2HYFA 1XSDA 1U5TA 4KFCA 2ISYA 1P4XA 3RTRA 2V1XA 5LHIA 4IHTA 1TQIA 2CWEA 4N0BA 1LJ9A 2D1HA 3V8KA 2XHKA 1W4MA 3E6DA 3K9TA 2RQPA 4M9ZA 3J80Z 1JHFA 4KUMA 2DQLA 3HSEA 2FRHA 4A12A 3O6BB 4L5JA 3CO7C 1SD7A 2EFPA 3FMQA 1FBUA 5DYMA 4MEXF 2HTSA 2EFNA 4OU0A 3VEPA 2ZCWA 4GGGA 1BBYA 1ZRCA 2G9WA 3BY6A 1F4KA 4RGRA 1B59A 1IXSB 3NRVA 1TBXA 3WGIA 1S29A 3LSTA 5L3DA 1BI3A 2UXXA 4LGWA 4ZZLA 1V3FA 3E6BA 3V8LA 5JVTA 2DBBA 2EFOA 5E18F 2UWMA 1KYZA 2A07F 5LEKA 4G7ZF 1S6LA 1SFEA 3F8NA 3ML6A 3ZPLA 4KT5C 2Y48A 1FSHA 1FWZA 2IA1A 2Q0OA 4Q4ZF 4HW0A 4EQQA 3O3KA 4IVNA 3U1DA 1IF1A 2Q8KA 3WG9A 3V7RA 4ZYEA 4CZZA 2YX4A 3DFGA 4EMSA 4PGGA 2MC3A 3P9CA 4IXAA 5IT9K 2XIGA 4RAYA 1XDUA 1QPMA 1J7KA 3F8FA 2MLGA 4ZYGA 4WCGA 1HKTA 2G7UA 2PLYA 1DP7P 1HKSA 1J0RA 5ERIA 2QBYA 2O03A 1FOKA 1LDDA 1X3UA 2QVOA 3GFLA 1YS7A 2JZYA 3MEXA 4G6DA 4HQEA 1EV7A 4KIBA 3DPLC 5E8IA 1SD4A 1W7PD 2Z99A 1MJBA 4EGZA 4G94A 2PJPA 2OZ6A 1IXRC 2M87A 3TDZC 2STTA 2QQ9A 1R23A 1BI0A 3HSFA 2VOPA 4IRIA 5D5WB 2LDUA 2ZMEA 3T8RA 5AONA 1AOYA 1YIOA 1Z9CA 1ON2A 1MGTA 3GFIA 4MHGA 1FBSA 4M6YA 2W57A 3WTSC 5E17F 3I59A 1XDSA 3ZMZA 1FY7A 1QO0D 5HS7A 1D3YA 2O61A 5KK1A 1JXSA 2FOKA 2ZKZA 2WTEA 3H3UA 1MJAA 4MNUA 2F5DA 4HZFA 2QBYB 1T6SA 2DTRA 3BZ6A 1MDMB 1NHAA 2FSWA 1O3RA 3RKYA 5F64A 1J5YA 1LQ1A 1Z1DA 1WRJA 1Q1HA 4YFXF 1ZGAA 4RB1A 3SHFA 4S04A 5JHUA 2JPCA 3GEZA 3LQRA 1YO5C 3D5LA 1PUEE 2KJBA 2Z3YA 4EJUA 2PEXA 2YSRA 1JE8A 5LEJA 4RB2C 5IT3A 4M72A 3F22A 2ADUA 2R7FA 1ZREA 5CVIA 3PQKA 4FX0A 1U5TC 1W5TA 5HOOA 2ZMEB 5FGMA 4UV9A 1IN4A 2IPQX 4L5IA 3RJPA 3LFKA 3HSRA 4JQFA 4HV6A 1K6OA 5H20A 2KJCA 3L00A 3TDUC 3K69A 5LLQA 1XD7A 5DUIA 3DV8A 1E2XA 2J5OA 1GXPA 2RGVA 2P7CB 1JGSA 4XSZF 5FFXA 3DXJF 2GA2A 2L3DA 4P5OA 5BOXA 2W84A 4Y15A 2FBHA 1YQAA 2L01A 2Y75A 4M74A 5CYVA 5D4RA 5DUKA 1R36A 4XLPF 1W7PB 3SZPA 4RS8A 4UXNA 2P7VB 1FBQA 1S8NA 4P9FA 1O57A 4LB5A 2IP2A 4ASNA 4AVPA 3RI4A 3EDPA 3FXRA 4F7ZA 3IRQA 4RB0A 4EM0B 4EJWA 3KP5A 1Z05A 1QBJA 4MTDA 2E7XA 2V1DA 3R60A 3JTGA 2HZTA 2VBWA 5AIPA 1T2KA 2PN6A 4OIPF 3WTTC 2W24A 4KYWA 1R1VA 4BYYA 1YFHA 4KIFA 3EETA 2TDXA 4WXDA 4ZH4F 2QQBA 2NAZA 3QRFF 3KCCA 4WX9A 5L3EA 1SD5A 2V6CA 1LDJA 3N97A 1XMAA 1LB2A 3KFWX 4NHJA 4AD9A 4KDPA 2R3SA 4I0AA 4KMFA 4EM1A 5DD4A 1G3SA 2GZWA 1IAWA 3ZMSA 3NEUA 2HS5A 5BQTA 1XGNA 2RVCA 1J59A 4I2OA 3MZYA 2XUBA 1HXDA 4LK0F 3KZZA 1BOAA 1U2WA 2D2WA 3ULQB 3SXYA 3TGNA 1DPUA 1FP1D 4JBAA 1OYIA 2D1VA 3ECHA 2EFWA 5ICGA 2XROA 1YG2A 1R1UA 1BI2A 4HX7A 1ZG3A 5D6FA 3F6OA 2GIVA 3F8CA 2CSOA 5BS6A 1J9IA 5JI6A 3KP2A 2NYXA 2JSCA 2W25A 5HDGA 2E1CA 3C1DA 4ENKA 3BOQA 1ZAOA 3BJ6A 4XRFA 1S7AA 4M71A 3CUQB 4LMYA 2RNJA 1FNNA 3ZMTA 4EM2A 2NNYA 1FLIA 3BPXA 2J5PA 1W5SA 2P5VA 1TTYA 5CVVA 3C3WA 3WTUC 3R0JA 1XGMA 2MA3A 3T0YA 2FMYA 2O6GE 3K0LA 3GO5A 1B1BA 1F9NA 3TOAA 4JK1X 2VBXA 3QP6A 1FP2A 1RUNA 3W6KB 2FBIA 2PMUA 3RYPA 2HR3A 3FWEA 1XSXA 3E5QA 3OOPA 2H09A 2IRFG 2HTJA 2BEOA 4KA4A 2CFXA 5FLXK 4HOBA 2CO5A 2EJRA 4UHTA 2IW5A 3I64A 4HBLA 5ILSA 3JSOA 2O3FA 3LA3A 4WWCA 3TOBA 3JAMZ 2F5EA 4CICA 4OOIA 2ESHA 2M30A 3IL2A 4LD5A 4Z2YA 1RI7A 2GWRA 3ABTA 5JR3A 3HYIA 2GXGA 3KP7A 4EJTA 3LAPA 3QPHA 2VBZA 3CLOA 1T0FA 5E1WA 1I5ZA 1FPQA 2FEZA 1WKMA 4E70A 3R0AA 3FHZA 3DF8A 2GQQA 2MH2A 4HX8A 1WWXA 1RZ4A 1XGSA 2Z33A 5HLHA 1J2XA 1FZPB 1KU3A 4KNYA 2F2EA 1ZG1A 2FNAA 5D8LB 4U7BA 4RGUA 4O5VA 1ZG5A 1LNWA 2QWWA 2ZXJA 1USSA 1YS6A 4I0BA 5DD8A 3GX4X 5AIQA 3KP6A 4HA8A 2EK5A 2EV5A 1Z91A 2FA5A 3GYHX 2K02A 3K1NA 4MEYF 3L7WA 5D6EA 4XBFA 4BQAA 3MZHA 3B02A 1XB4A 4ZYDA 3E6CC 1G3YA 5A2QZ 1QQIA 5BPDA 2ZJ2A 4OIRF 5K5RA 1CF7B 3ISPA 3ZQ7A 2P6SA 1IN8A 2QZ8A 2B0LA 3BROA 5EEHA 5LGTA 3VB2A 1K79A 1D8KA 4AIHA 4MQ9F 4CXFA 4MGRA 5L3GA 2XV4S 2A61A 4A0ZA 2P6TA 4UUVA 2ZBKA
chains in the Genus database with same CATH superfamily
2DT5A 1ETOA 3E3VA 2A6HF 1PP7U 2NVXJ 4NUBA 4HDVA 2Y0SN 1P2FA 1MW7A 3R61A 4XKCA 4E7ZA 1JI8A 2QKLB 3EYYA 5TGTA 1SFKA 4ESBA 3RKXA 1VZ0A 1SD6A 3P7NA 1D5VA 1BIAA 5K5QA 4FT8A 3BJOA 1UG2A 4YFNF 3PFIA 2GA1A 4WXHA 5JLXA 5DM7F 3M3YJ 2EV6A 3PFYA 5FB2A 1VQ9I 3P9IA 3H9GA 3ABKH 1IXCA 2ELHA 3W3CA 2IVMA 4G6QA 5CKTA 3WU2C 1HF0A 2ZJRF 4RGSA 2NOJB 1FSEA 3HOWJ 2R7SA 3M07A 2XKPA 4HF1A 5L3CA 4GDFA 5E1ZB 1V54H 1K83J 3HPHA 4YG2F 2DOFA 1HLVA 3M1EA 2Q1ZB 4UUSA 1UHMA 3E5XA 2X48A 2V9VA 2HFHA 1YRNA 3BJAA 4B1RA 4ESFA 1Z77A 3AFHA 2Q2EA 1ZGJA 3TBIA 2H6BA 2KDOA 3VDXA 2HGCA 1Z6TA 5HNHA 4EV0A 4YIIA 3U9GA 5LD2C 1O4XA 1H9GA 1KA8A 2WAQN 3GTLJ 4NQWB 2MD0A 1AKHA 4ENNA 4ZYHA 3FF5A 3CMMA 2ZNYA 4XR6A 2LF8A 1YTYA 1UCRA 1QZEA 3WTVC 4UNOA 2K85A 5DS9A 4R79A 4LK1F 5F0HA 2JVGA 2FQ4A 3HEFA 3HJEA 1GXQA 3QPLA 4DIQA 1SVMA 1IJWC 2E71A 3Q9VA 2FE3A 3AAFA 2EFQA 1BJAA 2JMWA 4AYBN 3IAM2 2LKXA 2ZJQF 1QNTA 1W7PA 2XASA 3HOXJ 5C3EJ 5TJJA 3V7SA 2V1UA 1W5CC 3FXLA 2E1MB 3G71I 3DKXA 1VQNI 2R5YA 2KQRA 4UVCA 3SQNA 1Y1WJ 2DTZA 3HIFA 3M9AA 1VQPI 2K4BA 3QP5A 2M1BA 3ZP5A 3WTXC 2VT2A 2OA4A 2DA1A 3VOEA 3KYCB 3JRIA 3UKGA 2XAGA 4XORA 3GWZA 3MAJA 4M3FA 3C2GA 4ZZDA 2A05A 4C3HJ 5K7FA 4J19A 1ZLKA 4G7OF 2DAOA 1ENHA 1YW8A 5IP7J 4GCVA 2A69F 3JRFA 4Q5SF 1YITI 3WE2A 3F6VA 2P5LC 4YFKF 3IP4B 2EB7A 4XOPA 3OIOA 4UVBA 1LVAA 4ETSA 1B6AA 2DMNA 3L2RA 1DGRM 3AG3H 4HLYA 5IYCJ 2V6EA 2KKOA 1BI1A 3OV8A 2IBDA 2VOOA 4IHXA 2L9NA 1ZYRF 4HSTA 3TO7A 5CVRA 4LG0A 4HF0A 2GM4A 4IPAA 2O9LA 2RDPA 1SFUA 1Z0XA 3TEDA 1KZHA 4NNJA 5ILUA 4D7MA 5LGNA 3CCVI 3SEQA 2H6CA 3GTPJ 2NVYJ 1SMYF 3QU3A 3G2BA 4BH9A 4EJVA 3I0TA 1Z21A 5HNFA 4BXFA 3E6MA 2HYGD 2I5UA 3KP3A 5J6XA 2A6EF 3C7JA 4CGZA 4Y33A 3M7GA 2XPVA 2M5WA 1MDMA 1ZK8A 3I53A 4M9XA 1MJ9A 1BA5A 1EH6A 3A1YA 2EA4A 1FTTA 5C44J 4PCQA 2EWNA 1XMKA 2JRTA 2JA5J 3GXOA 2WY7Q 4WF2A 2KRHA 2QSGX 2K27A 4ZDOA 4IHWA 3RPUD 1OKRA 1SAUA 1B9NA 4GYIA 2LY2A 3DU5A 1YHQI 2LC2A 1Z6RA 2K86A 3MCZA 4ENJA 1YX3A 2A6TA 4D0PA 5J1RA 2Y30A 2AO9A 1ZH5A 3HB9A 1IZ1A 4A3EJ 2PQ8A 3GW2A 1MNDA 2KIQA 2WADA 4ENMA 2LF7A 5TISC 3U1KA 2VONA 1ITYA 3O8GA 4BXUA 4IJAA 1TNTA 2M8EA 4B8XA 4E7JA 1KQ0A 3K70D 3JCUC 4DQ2A 1IC8A 2XAUA 3WHCA 3FMRA 2RQQA 9ANTA 1Y6IA 1IW7F 2DDAA 3LA2A 4FETA 4N9IA 1X19A 4UV8A 3GZ6A 1EH8A 2PBIA 4CSWA 2E36A 3PQJA 1S72I 2BY0A 3RQ4A 1VQMI 3GF2A 4II3A 3S1NJ 2QSHX 4KITB 2R7DA 3TO6A 4GYGA 4CCOA 5DTDA 2CV0A 3CCQI 2D45A 2BW3B 2ZXWH 3MMYB 3TW7A 3HBLA 5GTHC 3HTSB 2ZMEC 5L3BA 3F72A 1YW7A 2R5ZA 4R1HA 3I55I 3IRRA 1U78A 3TP0A 3CUQA 1T39A 3FK6A 1UG0A 1XCBA 1TNSA 3DTEA 1TQPA 2VLAA 2L9VA 2AQFA 5FD5A 1RUOA 5IOYA 1RC9A 4FE4A 4IHVA 3VWBA 2CW0F 3LQQA 4HV5A 3K4BA 3ZCOA 2QF7A 4HYEA 3F0CA 2VJ4A 3FM3A 4QSHA 2Y2ZA 1Z7UA 4KN4X 4GFBA 2MH9A 3HRSA 4U0WA 3CCRI 4BEHB 1WGXA 1WJBA 5K5OA 3ZXSA 4HEA2 4ZC3A 4QWQA 4IRHA 5KAIC 4IKFA 4XKBA 2LK2A 4UUTA 1ORKA 2XF6A 2FOWA 3MKZA 1U8RA 4RDUA 2JTVA 2XAFA 2YU3A 1T56A 3JTHA 4A0YA 4TV7A 1JT6A 3M8FA 1RR8C 1C0WA 3K2ZA 3FK7A 2FU4A 1OPCA 3KLNA 1F5TA 2DJNA 3KEYA 1FC3A 2DDBA 2HOAA 1TWHJ 2M34A 1R1TA 4HQMA 1D1BA 3FKJA 1K78A 2OTLI 3CJNA 4B3XA 1OYWA 5D5VB 4L9TA 1BM9A 4RB3C 2KRFA 4RAZA 3OR2C 5DDGA 4UB6C 3RPQA 1JTYA 1OFCX 2HVRA 3DKWA 3I9V2 5CLSA 3OYDA 2DQRA 1ZRFA 3NQOA 1R9TJ 3IKVA 3RIRA 4I6ZA 2PG4A 1U3EM 1VQ7I 1Z3YA 2LSOA 3RCOA 2DA5A 3EPZA 2QM3A 4PJMA 1DU6A 3PJRA 1D0ZA 2ZXHA 4F52A 3F23A 2OBPA 1LEBA 2LKPA 1GUUA 5J47A 2PI0A 2L2OA 1JJ8C 2JQ7A 1DPRA 3I5UA 2DMTA 3KEQA 4JP0A 4UY8I 3L9FA 1U9NA 2BHYA 2R4GA 4C3IJ 3HXLA 4BKXA 1ON1A 3OYGA 2XB5A 3HKZN 2F5CA 3GFJA 3JRGA 2HWVA 3HL2A 3HPGA 4Q48A 1HW1A 1A6QA 1R58A 2JUGA 3LSGA 3K4NA 5HDKA 5F6FA 2HVSA 4I99C 1B9MA 2VJIA 1DUXC 4BAYA 3BP8A 2P8TA 1TC3C 5DEQA 4L9JA 1A6IA 1Z7LA 4S0HB 2FD5A 2K4JA 2M45A 1VF9A 2ZSIB 5EZHA 2JN6A 4IOCF 1RIOH 1A04A 4I7HA 1AU7A 1K6YA 2RV8A 1ONVA 3E7LA 4RA2A 3HKZA 4XN3A 2Q2EB 1PUFA 4OMZA 2DI3A 3EUHA 1GDTA 3WTZA 5JVGF 1KU7A 1JHHA 2JK3A 2F4IA 2JA2A 2ZC2A 3B6CA 4IOAF 4HPQA 1RKTA 3DTIA 3S32A 4V19K 1O7FA 1HQCA 2L02A 1MBFA 2KISA 1WQ2A 2IJLA 4BHCA 3H9QA 5ILVA 1EH7A 4G6TB 2R7XA 5CVJA 1OR7A 4A3KJ 2H94A 2VBYA 3BR3A 3KZYA 2BBYA 1ZTRA 5IOZA 3KP4A 3P9KA 2W4SA 3KZIC 2ISZA 4FISA 3M8EA 1RNLA 2BY2A 5LFAA 3AKZA 4V2FA 3ZQHA 3PSFA 3HOTA 2A68F 3DEEA 4B3AA 3B73A 3J7YJ 4OMYA 4XRMA 1G3WA 2DFIA 1F1ZA 2NS8A 3I3LA 1REPC 4F3QA 4ESJA 5IYDJ 5E1XA 3IC7A 3V8JA 1B8IA 4BQNA 5CVUA 5F1RA 2HDDA 3I4PA 3H92A 3HHGA 2FXAA 3OYEA 3H5NA 2FF4A 3TMOA 1BR1A 3PSIA 1CF7A 3HOYJ 3FIWA 3OL4A 4XOTA 1ERDA 3MVPA 4F55A 4ZTFA 3ZMDA 4LFUA 2X6WA 3ZMVA 4KISA 1I1SA 5KAFC 1TL8A 4GRIA 4U88A 2OAZA 5BPIA 3SEZA 3FM5A 4U7DA 3RKWA 2XVCA 3S15J 3Q0UA 1XPXA 2DK8A 2AHQA 3HRTA 1IRGA 4NB5A 2VPLA 1IN7A 2HOEA 3O2PE 4HLXA 3V7CA 2VASA 3F8BA 2L54A 2WV0A 3TO9A 2H8WA 3ABUA 2O8XA 4E7LA 3J80K 2DFHA 1E17A 1MSEC 1XX5A 1X2NA 4H4KC 1LEAA 2PMHA 4I01A 2F48A 1X1DA 3GMEA 3OIPA 2OU2A 2XF5A 2ZNZA 2ETHA 5J8CA 3WG7H 4XSXF 3ECOA 3ZN1A 4BDYA 3GTKJ 3KYDB 4N9HA 4AIJA 5HS9A 1PYVA 3OYNA 3K4JA 4KIGA 1XN7A 2HQRA 3BG3A 1OMIA 2JPBA 3DU6A 2DLLA 3H35A 2XGDA 1H9TA 2XGCA 4KN7X 1PUFB 3DKYA 2QQAA 5E8GA 1B72A 2DU9A 4IRGA 5EEGA 1R7JA 1HW2A 4BGDA 3OL3A 3HG9A 5FKLA 2VXZA 3BR5A 5DCFA 3T5XA 4CO8A 2VT3A 3H1CA 1GVJA 3SDBA 4M3BA 1VQ5I 4UUSB 3JR9A 1R22A 1OCPA 1P7JA 1Q1VA 1UFMA 4E6KG 4E7SA 4M3EA 1FYLA 2QUFA 1BR2A 3H0GJ 1MZBA 2COMA 1YRNB 3FX3A 2CUFA 3EUHC 3K4KA 1MMNA 4BHBA 1TWGJ 2MGQA 1SAXA 2FQ3A 5KNLA 2L4MA 4HSRA 3BLYA 3OYCA 4DYQA 1RESA 3JAMK 1JT0A 3GFMA 4UVAA 2XF7A 4AWXB 4OAZA 4X1EA 1WVRA 2A5WA 5FD6A 4CHUA 4NQWA 3B6AA 1R71A 2F4OB 1P92A 5FO5A 3BG9A 4GXOA 2B63J 3CLQA 2XRNA 2AXLA 4WXCA 4I09A 1SVOA 1ETXA 2G7HA 2A3SA 2ID6A 4LJZF 5GAEJ 1QPIA 4K2EA 3I56I 1FT9A 1EF4A 1D1CA 1P9QC 2LH9A 1T0FC 5HLIA 4IF4A 4U0YA 3FKIJ 5H6QA 1NH3A 5HS8A 1PP8F 1UAAA 5J1YA 1U6GA 4P9UA 3I54A 3CMAI 1OISA 1XCVA 3OYHA 2DK5A 2DO7A 1G4DA 1MKMA 2CRGA 2C6YA 2YU9J 3RYRA 2JVHA 4H0EA 3G6EI 2ECCA 2IEKA 2X4HA 3DCFA 3S2WA 1BN5A 4EVIA 3LSKA 2GXAA 1ETKA 1R5ID 2FNPA 2UXNA 4BU2A 4DYRA 3ERMA 3Q5FA 3FXQA 3R4KA 1ZLJA 4FQGA 5DV5A 4BQOA 2EV0A 1HOMA 4Y13A 3J81K 1T33A 3CJTB 1W0TA 3ZMUA 1X4PA 4CZCA 1W0UA 1MBEA 2DPUA 2M0CA 5A2QK 3IWFA 3TW6A 2VUMJ 3FBIB 1F36A 1Y8RB 2LVSA 3OYIA 1Z3XA 3LA7A 1S3JA 1LKXA 3T8TA 3HRUA 5DM6F 2HOTA 1SVLA 3GUDA 1RKWA 4FTHA 3OSFA 1WJ5A 2ELJA 5FRMA 3BPVA 1YX5A 2VQCA 1VQ4I 3MD2A 5B3SH 3MKWB 3FMSA 4A93J 3RSNA 2DW4A 1L0OC 3D0SA 3G3ZA 4BEHA 3IH4A 3CTAA 4RGXA 4A69C 5H2FC 4A3MJ 3CP2A 2ZO4A 3OS2A 4M73A 3HRMA 1DU0A 1QZZA 2VKHA 4G12A 3QWLA 2KIFA 2EINH 2HOSA 2HQNA 2Y0MA 1I27A 3GTGJ 1I1GA 3A02A 4WK8F 2AS5F 3CDLA 2X0LA 3CO6C 4EATA 2IGNA 2OC6A 2AXTC 3VODA 3S17J 1RR7A 3OS1A 2BVMA 3LMMA 3A01A 3IH3A 2HXIA 1XS9A 1FEXA 1WI3A 2H27A 3AG1H 2K9SA 3QOPA 1OCZH 4P55A 1G2HA 2O5RA 1FOXA 5KVRA 4HF2A 3KLOA 4Y17A 5B5EC 3SFZA 5BMZA 2L7MP 1T98A 3BWGA 3LOCA 2QYOA 2GXBA 3N4MA 5JFRA 2UZKA 1Y0UA 1O7LA 2RC4A 1GHCA 4D5CA 5KHDA 1D5YA 4PK4A 1Z67A 5F0CA 4Y3OA 1FIAA 4KICA 3RPUA 2WC2A 3CDHA 2HDCA 4XLCA 1R5GA 3ZQFA 2E2IJ 1FOYA 3E97A 4XLNF 2R7ZJ 2K3PA 2VODA 3ABLH 3EYIA 3K1PA 2JA7J 2QSFX 1WPKA 1O3SA 2E7WA 3IAS2 5KCMA 3TL4X 3FXUA 3MWMA 4B4CA 2Z5UA 1QHGA 2HEOA 5J4VA 4PZJA 3T1BA 2GAUA 5LBQA 2X6OA 1X1CA 1AHDP 5E20A 4ITVA 3TP3A 2RREA 3ASNH 3LWFA 1T38A 1VQOI 1CGPA 1KYWA 1P4WA 2BGCA 2Z16A 1HBXG 1B8IB 4C2MJ 1OLTA 2O0YA 2PFBA 3IHUA 4HNTA 4S05A 1FMVA 3S1QJ 3K6GA 2DPDA 4RM2A 3COAC 4NBQA 4A5MA 3S14J 2W85A 4F91B 2P4WA 3OS0A 1HA8A 2HQAA 3HUGA 2FUG2 2I8DA 1FIPA 1FYMA 4M6XA 4II2A 3H36A 2M7AA 2FJ1A 3HTUA 1MH3A 1ZRDA 5J1UA 3CZ6A 3L09A 5J3LA 4Y52J 1NTCA 1SFXA 3WU0A 3J7AO 1HKQA 4B47A 1V4RA 3REOA 3ZQQA 3DP7A 3LSIA 1U8BA 1ZN2A 4XKWA 2VE9A 2HDWA 4DZJA 3A03A 5GAGJ 2P5KA 4QTRA 2KIMA 2IAIA 1AKHB 1FJLA 3F8MA 3I71A 1MBJA 1ODDA 5IPAA 3WE3A 3JW4A 4L9VA 4OIOF 3CCJI 1YYVA 1TW3A 3KE2A 1ULYA 3HOSA 4EGYA 1QGPA 2CQKA 4I76A 2DCEA 2Y9YA 1PJRA 1T95A 2VN2A 3QPTA 2A5YB 1T08B 4L9NA 4L0ZB 2JA8J 2H1LA 3PUBA 2BYVE 4ABZA 2IXSA 2CJJA 2VKDA 3GBGA 2L4AA 3DBRB 3A0BC 1VQ8I 2ZFWA 1O3QA 2E5NA 2W1OA 3S2DJ 1YIJI 1SMTA 1Y56A 3BR6A 3DBLB 1IV8A 2MBFA 4O6JA 4P96A 2XPWA 4XICA 3J81Z 3OR1C 3OYAA 1WJAA 2CQNA 2HKXA 3ZN0A 2OPTA 3K1MA 4FCYA 5ICFA 2NVQJ 2R5YB 5JLWA 5TRDA 2XGEA 2VC0A 2YPRA 3JREA 3CD6I 1S9HA 4BL0B 4PDKA 3VYSB 2QQ8A 1WHUA 1OCOH 1R00A 5F04A 2HKOA 1OCTC 4A6DA 4G9YA 5ICEA 4L0YB 4IHSA 3HDDA 4BNCA 4JX6A 1V5FA 1PVEA 4ON0A 4LLLA 2Z1DA 3FZVA 2F6CA 2WWYA 2NVTJ 1ZELA 2NS0A 1EKEA 1OCRH 2BXZA 2K7LA 2ECBA 1SFOJ 3RDIA 1UZCA 4L5EA 5K7HA 2WA0A 3S3MA 1LDKB 4HDUA 1KONA 3QAHA 1BC8C 4FX4A 1O3TA 2K9LA 2EZLA 2H8RA 4MO7A 3ERED 2YUSA 4YEJA 3R6SA 2GOXB 2NNNA 3M1CA 5EYRA 2OCCH 3DPTA 4CCMA 2LFBA 4LG0B 3SZTA 5E3MA 1ZARA 3A2KA 1USTA 2JT1A 4ZDPA 2W00A 4IHYA 3F21A 2BE5F 4B48A 1TWAJ 4E7IA 3DBHB 4PFPA 6PAXA 2DYRH 1J75A 5J8FA 4XN0A 3CUQC 1XSVA 5LRSA 5H6RA 2CG4A 2QENA 4IQ4A 4BUPA 5B1AH 3WU1B 4MQVA 2VE8A 3SYTA 1VQKI 4BJ5C 2R93J 2CGPA 3K10A 1U0JA 4A3IJ 4A6EA 2OCEA 5LGUA 1U5TB 3G1MA 3K70C 4QLCU 1BC7C 4XNFA 5E3NA 2MD5A 2OD5A 4A5NA 2TCTA 1EA3A 1MD0A 3Q9SA 1N77A 1UHWA 2XAJA 4AUXA 1HDDC 2VQGA 3K4CA 3H3ZA 4HNVA 3CUOA 4U0VA 2STWA 4AU7A 5K1YA 2IA2A 2CMPA 2IGMA 1L3LA 2R92J 3PIPF 3WGHA 3QU6A 2LBFB 4XLEA 1GVDA 2XGXA 4CH7A 1GT0C 3AG2H 4GO1A 1P4AA 2WB1A 1G3TA 2LKSA 3I4NJ 4A3BJ 1VQ6I 1SANA 1OYYA 2VJ5A 2YX7A 3C18A 1UJ8A 1YE9A 3ELKA 4G8XA 4AIDA 4DNCA 5D4SA 3MN2A 4N4NB 2LNBA 1IRFA 1OJLA 5EG0B 3VFZA 1LFBA 3FBNB 1YLFA 3BCAA 3KEOA 4LB6B 3FHNA 4FHTA 3CC2I 1IN5A 2VKEA 4ANJA 2R7RA 3KYLA 2X1CA 4CYDA 2F5FA 4AC0A 5ICCA 2LD5A 3JSPA 3PO3J 3N05A 2QA4I 1B4AA 1BIBA 2L9RA 1TWFJ 1GV2A 1QZYA 2R7UA 3BDDA 4BS9A 4HAMA 5CJ9A 1JJ6C 5ED4A 2ZSHB 2DT7B 1WI9A 1VTNC 3P5JA 4CCNA 2LLKA 3GZNB 3WTWC 3LAJA 2RN7A 2VC1A 5M5YJ 5FLVA 3W6JB 5D5UB 2IA0A 2OQRA 3JRAA 2EA2A 2ACJA 3WGGA 4Q47A 2E5ZA 2CUJA 4LLNA 2YR2A 1JUMA 4R8HA 2R7VA 2HYJA 4A0XA 5EEAA 3OYKA 1IRZA 1WSUA 3U21A 5D5XB 3HHHA 1GLNA 3A01B 2Z9OA 1TLHB 2PMZA 2V1NA 1I6XA 2RKHA 3NARA 3MQ0A 5DCMB 2FMLA 3IKTA 5HODA 3F3XA 3OY9A 3DEUA 4IL6C 3WODF 1E3HA 4BHPA 4OIQF 2IT0A 1TQMA 1DP3A 2Y9ZA 4CCLA 1KQ8A 1IN6A 4W97A 5HDNA 1XGOA 5FLXZ 3OSGA 1W36C 3G1OA 4PGHA 2KZGA 2CYYA 4MTEA 2JWTA 1K78B 1QVTA 4NDLA 1YW9A 2ESNA 1DGWY 2OQGA 1S7OA 1JGGA 1X3WB 3GVAA 4NC8A 4C9YA 4F92B 4B09A 2LTPA 3LFUA 4BQQA 4PUSA 5FLMJ 1STZA 3QOEA 3BG5A 2EBIA 2XKOA 1K7AA 3RZDJ 5L3FA 1LPQA 2OZUA 3MKYB 2XAHA 2K5CA 2DOAA 1TW2A 3GZ5A 3PNVA 1KU9A 4BJ6C 1P6RA 1DDNA 1VI0A 4CDGA 1R49A 3I59B 1FX7A 1IUYA 3M4OJ 2MW8A 3BG6A 5IP6A 3FXJA 4XK4A 1G6NA 2ZFUA 2BV6A 5LRRA 5E3LA 4ZJZA 3ROUA 3WTYC 4RAGA 4LLGF 5EJCA 2DFEA 2XB0X 1N78A 3GLLA 2I10A 4G7HF 2FBKA 1UHSA 5LHHA 3CESA 1HSTA 2ZB9A 2DA4A 2CH0A 1YJNI 2LRDA 2XAQA 2K40A 1HW5A 2QLZA 4W1UA 3C2HA 3TQNA 1D8JA 3EQLF 4YIFA 3SZGA 3VSKA 4UB8C 4DBRA 1I3QJ 3ZQGA 3CDIA 4OINF 3BTJA 3S1MJ 1KGSA 5EF6A 3GTJJ 2F4MB 2OF7A 2E1NA 1H0MA 4DJAA 2WY8Q 4XLHA 3DEWA 3V4GA 2L5QA 1FYKA 4A2UA 5CQGA 3L2CA 3G73A 3BQYA 1E3OC 4L18B 1KQ9A 5EGOA 3TKYA 4IX7A 3HM5A 4HX4A 3PO2J 5IT9Z 5DCMA 2BOLA 4P1WA 1D0XA 2MLKA 4EJOA 1UB9A 3IWZA 1X1PA 4O3MA 4CCKA 1LFPA 3GLXA 3DQVC 1PDNC 1MH4A 2VL8A 3I58A 3MFKA 1ZHFA 2GLOA 4I98B 3DLAA 3W2AA 2V79A 4M9SA 1MMGA 4Y4RA 5HVQC 4KMUX 2JUCA 2NRAC 2VJJA 3E5UA 2X9DA 2E35A 3U2RA 1AWCA 3DTKA 2JA6J 3ASOH 1J09A 3HGYA 5D8KB 2K3FA 1S7EA 1HSJA 1KU2A 5FRNA 4AIKA 1FMWA 4I02A 2KIUA 3KETA 5LHGA 5FFZA 2W7NA 1R5HA 1RETA 3L2WA 5HLGA 2HYFA 1XSDA 5JHFA 2K9NA 1U5TA 3AL0B 2N8GA 2FX0A 3WHBA 2ISYA 5M5XJ 1P4XA 4KFCA 2L0KA 3RTRA 1WH7A 2V1XA 3H5RA 5LHIA 4IHTA 1TQIA 2CWEA 4N0BA 1LJ9A 4XQFA 1JUSA 2VXDA 3W6VA 4JX5A 1S5LC 2D1HA 2DA6A 3V8KA 2XHKA 1Y8QB 1W4MA 3E6DA 2RNGA 2R7TA 1IDYA 1LE8B 1JKPC 3K9TA 2RQPA 2DA3A 4M9ZA 3J80Z 3S16J 2O7OA 1JKRC 1JHFA 2BXYA 4KUMA 1YOVB 1V55H 1HDPA 2DQLA 3HSEA 1MBGA 2FRHA 2CS3A 4A12A 3O6BB 4XL9A 3OIQA 1MMDA 4L5JA 3CO7C 2HPIA 2VPRA 1SD7A 3VYRB 3HOUJ 2EFPA 2LR8A 3FMQA 4PSWA 1FBUA 1A5JA 1WJFA 5DYMA 2CU7A 4MEXF 2HTSA 1QU3A 1D1AA 2EFNA 4OU0A 3VEPA 4JOMA 2ZCWA 3BT9A 4GGGA 1BBYA 2O8KA 1ZRCA 3MZ8A 2G9WA 3BY6A 2Z2SB 3Q3SA 3HGGA 1F4KA 3IUOA 4XRSG 4RGRA 1T8IA 2CW8A 1ETWA 2EPFA 2M9HA 3ZOBA 1A35A 3JRHA 4DGWB 1B59A 2NOGA 1IXSB 3NRVA 1TBXA 3KPHA 3S3NA 3WGIA 1S29A 4N4OB 1E0EA 1YI2I 3LSTA 1ZGWA 1YJWI 5L3DA 1BI3A 3CP8A 2UXXA 4PJ0C 1ZQ3P 2HZDA 4LGWA 4ZZLA 1V3FA 2M3AA 3E6BA 4XLAA 3V8LA 5JVTA 2DBBA 2EFOA 5E18F 2UWMA 5FROA 1KYZA 1MBHA 2X1DA 2A07F 5FKNA 2G0EA 5LEKA 4G7ZF 1LFUP 1S6LA 1X1AA 1SFEA 3FXKA 3F8NA 3ML6A 1X1BA 3ZPLA 4KT5C 2Y48A 4QPOA 1FSHA 3K2AA 1FWZA 2IA1A 2Q0OA 3PNTA 4XKVA 4Q4ZF 4HW0A 4EQQA 3O3KA 1ZKGA 1MIJA 2VQLA 4LITA 4IVNA 1M1EB 3U1DA 3IV5A 1IF1A 2CV1A 2Q8KA 3WG9A 4BE0A 1APLC 1R4MB 3OMYA 5IYBJ 3V7RA 4ZYEA 4CZZA 3FDYA 2JSPA 1TZLA 2E19A 2YX4A 3DFGA 4EMSA 4PGGA 2MC3A 3P9CA 4IXAA 2DMPA 5IT9K 1VFCA 1YJ9I 2XIGA 4RAYA 5EDNA 3Q0VA 2DMQA 2HXOA 2JJ7A 1XDUA 1XG1A 1QPMA 1J7KA 3F8FA 2V26A 1XC5A 2BZTA 2MLGA 1JUPA 4RM3A 2GBYA 4ZYGA 4WCGA 1BJZA 2G7UA 1HKTA 2PLYA 4J01A 4BY7J 1DP7P 3QQAA 1HKSA 1J0RA 3BTIA 2DODA 5ERIA 2O03A 3RQIA 3J7ZI 2QBYA 1FOKA 2IS6A 2LMDA 1LDDA 1X3UA 2QVOA 2CQ7A 1IG7A 3ZRGA 3GFLA 3EUAA 1YS7A 2L9SA 2JZYA 1BL0A 3KIOA 3MEXA 4G6DA 3S3OA 4X6AJ 4HQEA 1EV7A 2E60A 4KIBA 4LG3A 3DPLC 5E8IA 2MFZA 1SD4A 5IP9J 2BY3A 3BC8A 3ZQLA 1W7PD 3S93A 2P0WA 2Z99A 1MJBA 3PNYA 4EGZA 4G94A 4RLFA 2OZ6A 2PJPA 1IXRC 5GAHJ 2M87A 3TDZC 1UELB 3ZR8X 2QQ9A 2STTA 1R23A 2M8GX 4DBQA 3D5SC 3OYMA 2TRTA 3G1LA 3HZJA 4A3JJ 1BI0A 2LOOA 4A3FJ 3HSFA 3LNQA 2VOPA 4IRIA 4A3GJ 1HCRA 5D5WB 5GPAA 5GPCA 1HC8A 5F27A 2LDUA 2ZMEA 4YRVA 1VQLI 3T8RA 5AONA 1K4SA 1AOYA 2NS7A 1XMXA 1YIOA 1H8AC 2OUMA 2EH3A 4ZYAA 2M4GA 1Z9CA 4XIDA 1ON2A 2JRMA 1EJ9A 1MGTA 2V9KA 2VKVA 3GFIA 4MHGA 1ETVA 3E0JB 1FBSA 4M6YA 4Y7NJ 2KP6A 4HNUA 2LY1A 2EIMH 2W57A 5FKOA 2XSDC 3K4LA 3WTSC 2E2HJ 3I59A 1H88C 1XDSA 2WBMA 1W1WE 2Y31A 1JKOC 2E2JJ 5E17F 3ZMZA 1FY7A 1QO0D 5HS7A 3CCMI 2BY1A 1W36D 4MIMA 1D3YA 3MKLA 2O61A 4IO9F 1N25A 5KK1A 4DZPA 1MNMC 1TWCJ 1JXSA 2FOKA 2M7BA 1WJEA 1FOWA 2WTEA 2ZKZA 3H3UA 2VI6A 1POGA 4BACA 1MJAA 3H3VK 4M3GA 2EQRA 3PM1A 4CYCA 4FASD 2X51A 4MNUA 3J7AY 2F5DA 4HZFA 3PUFA 1X4OA 4BE1A 2HVQA 2QBYB 1T6SA 2DTRA 3BZ6A 3QYFA 3H0DA 5J4YA 1MDMB 2XDVA 2ME6A 2EZHA 1WJCA 1NHAA 3K7AJ 2FSWA 1O3RA 3RKYA 3W2WA 1BR4A 5K7ZA 5F64A 1J5YA 2XRLA 1LQ1A 3BCBA 1Z1DA 1WRJA 2LYCA 4F93B 3SFIA 2KPMA 1Q1HA 3ONQA 2M4KA 1ZGAA 4YFXF 3OYFA 4B43A 4RB1A 5FKKA 1MBKA 3SHFA 4CA0A 4XM3A 2X6XA 4U87A 4S04A 4XONA 5JHUA 2JPCA 3A0HC 3GEZA 2CQXA 3LQRA 4LOCA 4A3DJ 1YO5C 3D5LA 1R6RA 1PUEE 3CJQB 3LSHA 2KJBA 2Z3YA 4EJUA 2PEXA 2YSRA 2ICWG 1JE8A 5LEJA 3HOZJ 4RB2C 5IT3A 3S1RJ 4M72A 2QGUA 3F22A 2ADUA 2R7FA 1ZREA 2IS2A 5CVIA 3PQKA 2OJED 3L1PA 2E34A 3AG4H 4FX0A 1WZ2A 1U5TC 2QKMB 1W5TA 1TT5B 5HOOA 2ZMEB 3FXOA 3K4MA 5FGMA 4UV9A 1IN4A 2IPQX 1RPWA 4L5IA 3RJPA 3SJMA 3LFKA 1LVKA 5CPRB 1OQYA 3HSRA 2MC4A 4JQFA 2LG4A 4HV6A 2R5ZB 5HLTA 1K6OA 4NC7A 2DA2A 1U9OA 3LSRA 3LSJA 2KHMA 5H20A 2KJCA 2CUZA 1XTAA 2BHZA 5CQEA 5BNGA 3L00A 3LSMA 2UV1A 3TDUC 2HPMA 3K69A 5LLQA 4DW6A 1XD7A 5DUIA 3DV8A 1E2XA 2J5OA 1GXPA 3ZQIA 2X6YA 3L2VA 3LL7A 2W48A 1IGNA 2RGVA 4C2UA 2P7CB 2QCOA 1JGSA 4XSZF 5FFXA 4JYKA 1NK2P 3DXJF 2GA2A 2L3DA 3QPSA 4P5OA 2ZXIA 4BBRJ 4AM3A 3IH2A 5BOXA 2W84A 2EZKA 2UUZA 4E7HA 4A3LJ 5B66C 4Y15A 1X58A 2KZVA 3S8PA 2FBHA 1YQAA 2L01A 2Y75A 3FXMA 4M74A 5CYVA 5D4RA 2H1KA 5DUKA 3L2QA 4BXXJ 4XMYA 1R36A 4XLPF 1W7PB 2CFOA 1Y1VJ 4ZTJA 3SZPA 2V7FA 1NG6A 4RS8A 4UXNA 2P7VB 4BY1J 1JTXA 1FBQA 1S8NA 4P9FA 1ACIA 3VSLA 1O57A 4LB5A 3QYEA 2V9PA 3CC7I 1X2MA 2IP2A 4ZDLA 4ASNA 2CUEA 3EUKL 4AVPA 3CF5F 3RI4A 2IS1A 3EDPA 3FXRA 3NAUA 1BOBA 4F7ZA 3IRQA 4M3DA 2W82A 4RB0A 4EM0B 3A4CA 4EJWA 3UR3C 3KP5A 1Z05A 3Q0WA 1JKQC 2R7QA 3S2HJ 1QBJA 1F43A 4MTDA 2E7XA 2V1DA 3R60A 2WB1N 3JRCA 2YS9A 2PJRB 3JTGA 1P7IA 2HZTA 2VBWA 5AIPA 3CJRB 4QPQA 2PN6A 1T2KA 4OIPF 2LY9A 3WTTC 2W24A 4KYWA 1R1VA 3GCMA 5EGOB 2ME0A 4BYYA 1GV5A 2X85A 1QHHD 1YFHA 4JX4A 4KIFA 2ZJPF 1B72B 3EETA 4C3JJ 2TDXA 4WXDA 4ZH4F 2QQBA 4BDZA 2LP0A 3VYUB 2NAZA 3QRFF 2KMUA 1WCMJ 4NC6A 1ZR2A 3KCCA 1QVUA 2LBFA 4WX9A 1QA6A 3CQZJ 3BR0A 2M2EA 1OCCH 2WV1A 3DPUA 5L3EA 2KFDA 3FISA 2QEXI 2EIJH 1SD5A 2WAQA 3KX2A 1A31A 1ETYA 5F1JA 3OOUA 2V6CA 1LDJA 1IRXA 1WJDA 1XMAA 3ABMH 3KFWX 4LIVA 3N97A 1LB2A 3AL0C 4NHJA 4AD9A 4KDPA 2R3SA 2AQEA 2HQ5A 4I0AA 2D5VA 5EG0A 4EM1A 4KMFA 1NK3P 2DOEA 2WAFA 5DD4A 1TP4A 1G3SA 2GZWA 1IAWA 2VQHA 4AVZA 3O8HA 3ZMSA 3NEUA 2HS5A 5BQTA 1MMSA 1XGNA 4DYCA 2RVCA 4EEFG 3CCLI 1J59A 1LE8A 3MZYA 4I2OA 2XUBA 1H89C 3OWTA 1SEUA 2PX9A 1HXDA 4LK0F 3KZZA 1BOAA 1U2WA 2D2WA 1WH5A 5EZGA 3ULQB 3SXYA 1AA7A 2KRCA 3TGNA 1DPUA 1FP1D 4JBAA 1OYIA 2D1VA 3ECHA 2R7OA 4KT6A 2EFWA 4M6VA 5ICGA 3DLLF 3NWSA 2XROA 1YG2A 2B9SA 2Y0SA 1R1UA 1VNDA 3PL8A 1BI2A 3W2VA 3QYBA 4MLOA 3BTCA 4HX7A 2PMZN 1ZG3A 3ESWB 5D6FA 1UMQA 5J40A 3F6OA 2GIVA 3F8CA 2CSOA 5BS6A 3JRBA 1J9IA 5JI6A 3KP2A 2NYXA 1ZR4A 1TT0A 2JSCA 2W25A 4MFEA 2XSJC 5HDGA 1FTZA 2GIZA 2L7FP 2E1CA 2R7WA 4XLFA 1MMAA 3C1DA 4ENKA 3BOQA 1ZAOA 3BJ6A 1QRYA 2BW3A 4XRFA 1S7AA 4M71A 5F0FA 3GTQJ 2ID3A 4AYBA 1IV6A 2COBA 3CUQB 3UNGC 4LMYA 5GTIC 2OTJI 2RNJA 1FNNA 3ZMTA 3HC7A 4EM2A 2NNYA 1FLIA 3BPXA 4X0GA 2J5PA 1MSFC 1LUJB 1W5SA 2P5VA 5C4JJ 1TTYA 2F5VA 4D9JA 5CVVA 3RZOJ 3ZQCA 3C3WA 3WTUC 2MG4A 1XGMA 3R0JA 4C2TA 2MA3A 3HOVJ 3OYBA 3T0YA 2FMYA 3H5AA 3LSPA 3K0LA 2O6GE 2XPUA 3GO5A 1B1BA 3JRDA 1IO2A 1D0YA 3BG7A 1F9NA 5M3MJ 1DQUA 3TOAA 1NG7A 4JK1X 1N75A 2VBXA 4BBSJ 3BR1A 3QP6A 1FP2A 4D7NA 4BJTA 2Y69H 3C2BA 1K61A 1RUNA 3W6KB 5GP9A 2FBIA 4J00A 5C4XJ 2PMUA 3FWEA 2HR3A 4HG2A 2HU9A 1XSXA 3RYPA 5GADJ 3E5QA 3OOPA 4QIWN 4BE2A 4LIUA 2MSYA 1IUFA 4DOZA 4D1QA 2DMUA 3SDGA 2H09A 3BZCA 4E7KA 2CV2A 2IRFG 4PSXA 1I39A 1V5GA 2HTJA 2DYSH 2MYSA 2BEOA 4CCJA 2GOMA 4KA4A 2CFXA 5FLXK 4MFDA 4HOBA 1Y0NA 2CO5A 4IZZA 3CMEI 2EJRA 4UHTA 2IW5A 2BVLA 3I64A 2DFFA 4RBOA 3DWLE 4OWRB 2KT0A 3CCSI 2ELKA 4HBLA 5ILSA 3JSOA 2IGOA 2O3FA 3CF2A 2KLOA 3LA3A 4WWCA 1E3PA 3F9KA 4A3CJ 3TOBA 3JAMZ 2F5EA 4OAYA 4XRSA 2E1MC 1G8XA 4B44A 4CICA 4OOIA 2X1EA 5M5WJ 2ESHA 2M30A 3IL2A 2VB6A 4CUGA 4D5FA 4LD5A 4Z2YA 1RI7A 1R4NB 2GWRA 3ABTA 5JR3A 3HYIA 4IEJA 2OV7A 2EILH 2GXGA 4E4HA 3KP7A 4EJTA 3LAPA 3QPHA 1MNEA 4PJNA 2KDZA 3OYJA 3CCUI 1X3ZB 3G4SI 2VBZA 4PJJA 3CLOA 1T0FA 5E1WA 1K4TA 1I5ZA 3HUGB 1FPQA 2EZIA 1WFXA 2FEZA 1WKMA 2L7ZA 4E70A 3R0AA 1I50J 3FHZA 3DF8A 2VIXA 2M0MA 3NWTA 2GQQA 2MH2A 4HX8A 2P81A 1WWXA 3GTMJ 1RZ4A 1XGSA 2Z33A 1CQTA 5HLHA 4IQJA 1J2XA 3VPRA 3X2QH 1SC7A 3M8JA 1FZPB 3PIOF 1KU3A 4KNYA 1IDZA 2K9MA 2HI3A 2LREA 2F2EA 5FKMA 2DXIA 1ZG1A 2FNAA 1V5EA 5D8LB 3CCYA 4Z6YA 4U7BA 2DN0A 4O5VA 4RGUA 1LNWA 2QWWA 4YIRX 2ZXJA 1ZG5A 1G59A 2PJRA 1USSA 1YS6A 1BW6A 3CMYA 2CW7A 3V42A 5IY5H 4I0BA 4RLQA 5DD8A 2IS4A 3GX4X 5FJ8J 3BQZA 3BTLA 2EIKH 3OYLA 4PFOA 5AIQA 1A36A 3KP6A 4HA8A 2EK5A 3VYTB 2EV5A 1Z91A 2IGKA 2FA5A 4C30A 2NVUB 3GYHX 2R0QC 2K02A 1RRJA 3K1NA 2HNHA 4FE7A 4MEYF 3L7WA 3QODA 1Y39A 5D6EA 2WAEA 4RAFA 4XBFA 5M3FJ 4BQAA 2DT6A 4V2GA 3ZGKA 3MZHA 3B02A 3RKQA 1XB4A 2CQQA 4CYCB 4PJLA 2DJIA 4ZYDA 3E6CC 1G3YA 2E1OA 3L2UA 4KJZA 1OR7C 1ETQA 5A2QZ 1QQIA 1I3AA 3D5RC 2MABA 2NXNB 5BPDA 4YELA 2ZJ2A 1I6HJ 4RMNA 4OIRF 3BZKA 5K5RA 5B1BH 3CC4I 1CF7B 3ISPA 3ZQ7A 1BW5A 5F08A 3D1NI 2P6SA 3E1SA 1IN8A 3CCEI 2QZ8A 5E3OA 2B0LA 2DA7A 2XC7A 2B7EA 3BROA 5EEHA 3I4MJ 2L7KA 5LGTA 5E79C 3VB2A 1K79A 2RAEA 1D8KA 4AIHA 3BR2A 4MQ9F 4CXFA 4MGRA 2KL4A 5L3GA 4HRIA 2XV4S 2A61A 2K9QA 3GTOJ 4A0ZA 2V4JC 3H9JA 2P6TA 4UUVA 2ZBKA
chains in the Genus database with same CATH topology
2DT5A 3E3VA 2A6HF 1PP7U 4HDVA 1P2FA 3R61A 3EYYA 4ESBA 3RKXA 3P7NA 1SD6A 1D5VA 1BIAA 5K5QA 4FT8A 3BJOA 4YFNF 3PFIA 2GA1A 4WXHA 2EV6A 5FB2A 3P9IA 1IXCA 2ELHA 2IVMA 4G6QA 4RGSA 1FSEA 2XKPA 4HF1A 5L3CA 5E1ZB 4YG2F 3M1EA 1UHMA 3E5XA 2V9VA 2HFHA 3BJAA 4ESFA 2Q2EA 1ZGJA 2H6BA 2HGCA 1Z6TA 4EV0A 4YIIA 3U9GA 1H9GA 1KA8A 4ENNA 4ZYHA 3FF5A 2ZNYA 2LF8A 1YTYA 1UCRA 3WTVC 4UNOA 4R79A 4LK1F 1GXQA 3Q9VA 2FE3A 3AAFA 2EFQA 1BJAA 1QNTA 1W7PA 2XASA 5TJJA 3V7SA 2V1UA 4UVCA 3SQNA 3HIFA 3M9AA 2K4BA 3QP5A 2M1BA 3ZP5A 3WTXC 2VT2A 2OA4A 3VOEA 2XAGA 3GWZA 3MAJA 1ZLKA 4ZZDA 4G7OF 2DAOA 1YW8A 4GCVA 2A69F 4Q5SF 3WE2A 3F6VA 2P5LC 4YFKF 2EB7A 4UVBA 1LVAA 4ETSA 1B6AA 4HLYA 2KKOA 1BI1A 3OV8A 2VOOA 1ZYRF 3TO7A 5CVRA 4LG0A 4HF0A 4IPAA 2RDPA 1SFUA 5ILUA 5LGNA 2H6CA 1SMYF 3QU3A 4EJVA 4BH9A 3I0TA 3E6MA 2HYGD 3KP3A 5J6XA 2A6EF 3C7JA 4CGZA 3M7GA 1MDMA 2M5WA 3I53A 4M9XA 1MJ9A 1EH6A 2EA4A 4PCQA 2EWNA 1XMKA 2JRTA 3GXOA 4WF2A 2K27A 1OKRA 1B9NA 4GYIA 1Z6RA 4ENJA 2K86A 3MCZA 4D0PA 1ZH5A 1IZ1A 2PQ8A 3GW2A 4ENMA 2LF7A 2VONA 4BXUA 4IJAA 1TNTA 2M8EA 4B8XA 1KQ0A 4DQ2A 3FMRA 3LA2A 1IW7F 4N9IA 4UV8A 3GZ6A 1EH8A 2PBIA 3PQJA 3GF2A 2R7DA 3TO6A 4GYGA 2D45A 3HTSB 5L3BA 3F72A 1YW7A 4R1HA 3IRRA 1U78A 3CUQA 1T39A 1XCBA 1TNSA 1TQPA 5FD5A 1RUOA 2CW0F 3LQQA 4HV5A 4HYEA 3FM3A 1Z7UA 4KN4X 2MH9A 3HRSA 4U0WA 5K5OA 4QWQA 4IRHA 1U8RA 2JTVA 2XAFA 2YU3A 3JTHA 4A0YA 4TV7A 3M8FA 1C0WA 3K2ZA 2FU4A 1OPCA 3KLNA 1F5TA 1FC3A 1R1TA 4HQMA 1K78A 3CJNA 1OYWA 5D5VB 4L9TA 1BM9A 4RB3C 2KRFA 4RAZA 5DDGA 3RPQA 3DKWA 5CLSA 1ZRFA 2DQRA 3NQOA 3IKVA 3RIRA 2PG4A 1U3EM 2LSOA 2QM3A 3F23A 2OBPA 1LEBA 2LKPA 2PI0A 1DPRA 3I5UA 3KEQA 3L9FA 1ON1A 2F5CA 3GFJA 2HWVA 4Q48A 1HW1A 1R58A 5HDKA 5F6FA 1B9MA 1DUXC 4BAYA 3BP8A 2P8TA 5DEQA 4L9JA 2K4JA 2M45A 1RIOH 1A04A 4I7HA 2RV8A 1ONVA 4OMZA 2DI3A 3EUHA 3WTZA 1KU7A 1JHHA 1O7FA 1HQCA 2L02A 1WQ2A 2IJLA 4BHCA 5ILVA 1EH7A 5CVJA 1OR7A 2H94A 2VBYA 3KZYA 2BBYA 3KP4A 3P9KA 2ISZA 3M8EA 1RNLA 3HOTA 2A68F 3B73A 4OMYA 1G3WA 2DFIA 1F1ZA 1REPC 4ESJA 5E1XA 3IC7A 3V8JA 5CVUA 5F1RA 3I4PA 3H92A 3HHGA 2FXAA 2FF4A 1CF7A 3ZMDA 4LFUA 1I1SA 3ZMVA 4U88A 2OAZA 5BPIA 3FM5A 4U7DA 3RKWA 2XVCA 2DK8A 3HRTA 1IRGA 4NB5A 1IN7A 2HOEA 3O2PE 4HLXA 3V7CA 3F8BA 2L54A 2WV0A 3TO9A 3ABUA 2O8XA 3J80K 1E17A 1LEAA 2PMHA 4I01A 2OU2A 2ZNZA 5J8CA 2ETHA 4XSXF 3ECOA 3ZN1A 4N9HA 4AIJA 5HS9A 4KIGA 1XN7A 2HQRA 1OMIA 2JPBA 2DLLA 1H9TA 4KN7X 2QQAA 5E8GA 2DU9A 4IRGA 5EEGA 1R7JA 1HW2A 2VXZA 5DCFA 3T5XA 4CO8A 2VT3A 1GVJA 1R22A 1UFMA 1FYLA 2QUFA 1MZBA 2COMA 3FX3A 4BHBA 1SAXA 2FQ3A 2L4MA 3JAMK 3GFMA 4UVAA 4AWXB 5FD6A 4CHUA 4NQWA 1P92A 5FO5A 4GXOA 2XRNA 2AXLA 4WXCA 4I09A 2G7HA 2A3SA 4LJZF 4K2EA 1FT9A 4U0YA 5HLIA 4IF4A 5H6QA 5HS8A 1PP8F 1U6GA 4P9UA 3I54A 1XCVA 1G4DA 2DO7A 2DK5A 1MKMA 2C6YA 3RYRA 4H0EA 2X4HA 3S2WA 4EVIA 1BN5A 2FNPA 2UXNA 3Q5FA 3FXQA 3R4KA 1ZLJA 5DV5A 2EV0A 4Y13A 3J81K 3ZMUA 2DPUA 5A2QK 3IWFA 3LA7A 1S3JA 3T8TA 3HRUA 3GUDA 3BPVA 3FMSA 2DW4A 1L0OC 3D0SA 3G3ZA 3CTAA 4RGXA 2ZO4A 4M73A 3HRMA 1QZZA 2KIFA 2HQNA 2Y0MA 1I27A 1I1GA 4WK8F 2AS5F 2X0LA 3CO6C 3VODA 2H27A 3QOPA 4P55A 5KVRA 4HF2A 3KLOA 4Y17A 3SFZA 5BMZA 1T98A 3BWGA 2QYOA 2GXBA 3N4MA 5JFRA 2UZKA 1Y0UA 1O7LA 2RC4A 1GHCA 4KICA 3RPUA 2WC2A 3CDHA 2HDCA 1R5GA 3E97A 4XLNF 2VODA 3EYIA 3K1PA 1O3SA 2E7WA 3FXUA 3MWMA 2Z5UA 2HEOA 4PZJA 3T1BA 2GAUA 5LBQA 5E20A 3LWFA 1T38A 1CGPA 1KYWA 1P4WA 2BGCA 1HBXG 2O0YA 2PFBA 3IHUA 4S05A 2DPDA 3COAC 4A5MA 2W85A 2P4WA 3HUGA 1FYMA 4M6XA 3HTUA 1ZRDA 3L09A 1SFXA 3WU0A 3J7AO 1HKQA 1V4RA 3REOA 3DP7A 1ZN2A 2VE9A 2P5KA 2KIMA 3F8MA 3I71A 1ODDA 3WE3A 3JW4A 4L9VA 4OIOF 1YYVA 1TW3A 3KE2A 1ULYA 3HOSA 4EGYA 1QGPA 2CQKA 2VN2A 3QPTA 2A5YB 4L9NA 4L0ZB 2BYVE 2L4AA 2ZFWA 1O3QA 1SMTA 2MBFA 4O6JA 4P96A 3J81Z 2HKXA 3ZN0A 3K1MA 5ICFA 5TRDA 2VC0A 2YPRA 4PDKA 1R00A 2HKOA 4A6DA 4G9YA 5ICEA 4L0YB 4IHSA 4BNCA 4ON0A 4LLLA 3FZVA 2WWYA 2NS0A 2K7LA 3RDIA 1LDKB 4HDUA 3QAHA 1BC8C 4FX4A 1O3TA 3ERED 3R6SA 2NNNA 3DPTA 4LG0B 3SZTA 1ZARA 1USTA 2JT1A 3F21A 2BE5F 6PAXA 1J75A 5J8FA 3CUQC 1XSVA 5LRSA 5H6RA 2CG4A 2QENA 3WU1B 4MQVA 2VE8A 2CGPA 4A6EA 5LGUA 1U5TB 1BC7C 4QLCU 2MD5A 2OD5A 4A5NA 1MD0A 3Q9SA 1UHWA 2XAJA 3H3ZA 3CUOA 4U0VA 2STWA 5K1YA 2IA2A 1L3LA 3WGHA 3QU6A 2XGXA 4GO1A 1P4AA 1G3TA 1OYYA 2YX7A 3C18A 4G8XA 3ELKA 4DNCA 5D4SA 2LNBA 1IRFA 3VFZA 1YLFA 3KEOA 4LB6B 4FHTA 1IN5A 4CYDA 2F5FA 5ICCA 3JSPA 1B4AA 1BIBA 1QZYA 3BDDA 5CJ9A 4HAMA 5ED4A 1WI9A 1VTNC 3WTWC 3LAJA 2RN7A 2VC1A 3W6JB 5D5UB 2IA0A 2OQRA 2EA2A 2ACJA 3WGGA 4Q47A 4LLNA 2YR2A 4R8HA 4A0XA 1WSUA 5D5XB 3HHHA 2Z9OA 1TLHB 1I6XA 2RKHA 3MQ0A 5DCMB 2FMLA 3IKTA 3F3XA 3DEUA 3WODF 4BHPA 4OIQF 2IT0A 1TQMA 1KQ8A 1IN6A 5HDNA 1XGOA 5FLXZ 4PGHA 4MTEA 2CYYA 1K78B 1YW9A 2ESNA 2OQGA 1S7OA 3GVAA 4B09A 1STZA 2XKOA 1K7AA 5L3FA 2OZUA 2XAHA 1TW2A 3GZ5A 1KU9A 1P6RA 1DDNA 4CDGA 3I59B 1FX7A 1IUYA 1G6NA 2BV6A 5LRRA 3ROUA 3WTYC 4LLGF 4G7HF 2FBKA 5LHHA 1HSTA 2XAQA 1HW5A 2QLZA 3TQNA 1D8JA 3EQLF 4YIFA 4OINF 1KGSA 2E1NA 1H0MA 3V4GA 1FYKA 4A2UA 3L2CA 3G73A 4L18B 1KQ9A 3TKYA 4HX4A 5IT9Z 5DCMA 2MLKA 4EJOA 1UB9A 3IWZA 4O3MA 3GLXA 3DQVC 1PDNC 3I58A 3MFKA 1ZHFA 4I98B 2V79A 4M9SA 5HVQC 4KMUX 2NRAC 3E5UA 3U2RA 1AWCA 5D8KB 1HSJA 1KU2A 4AIKA 4I02A 3KETA 2KIUA 5LHGA 5FFZA 1R5HA 5HLGA 2HYFA 1XSDA 1U5TA 4KFCA 2ISYA 1P4XA 3RTRA 2V1XA 5LHIA 4IHTA 1TQIA 2CWEA 4N0BA 1LJ9A 2D1HA 3V8KA 2XHKA 1W4MA 3E6DA 3K9TA 2RQPA 4M9ZA 3J80Z 1JHFA 4KUMA 2DQLA 3HSEA 2FRHA 4A12A 3O6BB 4L5JA 3CO7C 1SD7A 2EFPA 3FMQA 1FBUA 5DYMA 4MEXF 2HTSA 2EFNA 4OU0A 3VEPA 2ZCWA 4GGGA 1BBYA 1ZRCA 2G9WA 3BY6A 1F4KA 4RGRA 1B59A 1IXSB 3NRVA 1TBXA 3WGIA 1S29A 3LSTA 5L3DA 1BI3A 2UXXA 4LGWA 4ZZLA 1V3FA 3E6BA 3V8LA 5JVTA 2DBBA 2EFOA 5E18F 2UWMA 1KYZA 2A07F 5LEKA 4G7ZF 1S6LA 1SFEA 3F8NA 3ML6A 3ZPLA 4KT5C 2Y48A 1FSHA 1FWZA 2IA1A 2Q0OA 4Q4ZF 4HW0A 4EQQA 3O3KA 4IVNA 3U1DA 1IF1A 2Q8KA 3WG9A 3V7RA 4ZYEA 4CZZA 2YX4A 3DFGA 4EMSA 4PGGA 2MC3A 3P9CA 4IXAA 5IT9K 2XIGA 4RAYA 1XDUA 1QPMA 1J7KA 3F8FA 2MLGA 4ZYGA 4WCGA 1HKTA 2G7UA 2PLYA 1DP7P 1HKSA 1J0RA 5ERIA 2QBYA 2O03A 1FOKA 1LDDA 1X3UA 2QVOA 3GFLA 1YS7A 2JZYA 3MEXA 4G6DA 4HQEA 1EV7A 4KIBA 3DPLC 5E8IA 1SD4A 1W7PD 2Z99A 1MJBA 4EGZA 4G94A 2PJPA 2OZ6A 1IXRC 2M87A 3TDZC 2STTA 2QQ9A 1R23A 1BI0A 3HSFA 2VOPA 4IRIA 5D5WB 2LDUA 2ZMEA 3T8RA 5AONA 1AOYA 1YIOA 1Z9CA 1ON2A 1MGTA 3GFIA 4MHGA 1FBSA 4M6YA 2W57A 3WTSC 5E17F 3I59A 1XDSA 3ZMZA 1FY7A 1QO0D 5HS7A 1D3YA 2O61A 5KK1A 1JXSA 2FOKA 2ZKZA 2WTEA 3H3UA 1MJAA 4MNUA 2F5DA 4HZFA 2QBYB 1T6SA 2DTRA 3BZ6A 1MDMB 1NHAA 2FSWA 1O3RA 3RKYA 5F64A 1J5YA 1LQ1A 1Z1DA 1WRJA 1Q1HA 4YFXF 1ZGAA 4RB1A 3SHFA 4S04A 5JHUA 2JPCA 3GEZA 3LQRA 1YO5C 3D5LA 1PUEE 2KJBA 2Z3YA 4EJUA 2PEXA 2YSRA 1JE8A 5LEJA 4RB2C 5IT3A 4M72A 3F22A 2ADUA 2R7FA 1ZREA 5CVIA 3PQKA 4FX0A 1U5TC 1W5TA 5HOOA 2ZMEB 5FGMA 4UV9A 1IN4A 2IPQX 4L5IA 3RJPA 3LFKA 3HSRA 4JQFA 4HV6A 1K6OA 5H20A 2KJCA 3L00A 3TDUC 3K69A 5LLQA 1XD7A 5DUIA 3DV8A 1E2XA 2J5OA 1GXPA 2RGVA 2P7CB 1JGSA 4XSZF 5FFXA 3DXJF 2GA2A 2L3DA 4P5OA 5BOXA 2W84A 4Y15A 2FBHA 1YQAA 2L01A 2Y75A 4M74A 5CYVA 5D4RA 5DUKA 1R36A 4XLPF 1W7PB 3SZPA 4RS8A 4UXNA 2P7VB 1FBQA 1S8NA 4P9FA 1O57A 4LB5A 2IP2A 4ASNA 4AVPA 3RI4A 3EDPA 3FXRA 4F7ZA 3IRQA 4RB0A 4EM0B 4EJWA 3KP5A 1Z05A 1QBJA 4MTDA 2E7XA 2V1DA 3R60A 3JTGA 2HZTA 2VBWA 5AIPA 1T2KA 2PN6A 4OIPF 3WTTC 2W24A 4KYWA 1R1VA 4BYYA 1YFHA 4KIFA 3EETA 2TDXA 4WXDA 4ZH4F 2QQBA 2NAZA 3QRFF 3KCCA 4WX9A 5L3EA 1SD5A 2V6CA 1LDJA 3N97A 1XMAA 1LB2A 3KFWX 4NHJA 4AD9A 4KDPA 2R3SA 4I0AA 4KMFA 4EM1A 5DD4A 1G3SA 2GZWA 1IAWA 3ZMSA 3NEUA 2HS5A 5BQTA 1XGNA 2RVCA 1J59A 4I2OA 3MZYA 2XUBA 1HXDA 4LK0F 3KZZA 1BOAA 1U2WA 2D2WA 3ULQB 3SXYA 3TGNA 1DPUA 1FP1D 4JBAA 1OYIA 2D1VA 3ECHA 2EFWA 5ICGA 2XROA 1YG2A 1R1UA 1BI2A 4HX7A 1ZG3A 5D6FA 3F6OA 2GIVA 3F8CA 2CSOA 5BS6A 1J9IA 5JI6A 3KP2A 2NYXA 2JSCA 2W25A 5HDGA 2E1CA 3C1DA 4ENKA 3BOQA 1ZAOA 3BJ6A 4XRFA 1S7AA 4M71A 3CUQB 4LMYA 2RNJA 1FNNA 3ZMTA 4EM2A 2NNYA 1FLIA 3BPXA 2J5PA 1W5SA 2P5VA 1TTYA 5CVVA 3C3WA 3WTUC 3R0JA 1XGMA 2MA3A 3T0YA 2FMYA 2O6GE 3K0LA 3GO5A 1B1BA 1F9NA 3TOAA 4JK1X 2VBXA 3QP6A 1FP2A 1RUNA 3W6KB 2FBIA 2PMUA 3RYPA 2HR3A 3FWEA 1XSXA 3E5QA 3OOPA 2H09A 2IRFG 2HTJA 2BEOA 4KA4A 2CFXA 5FLXK 4HOBA 2CO5A 2EJRA 4UHTA 2IW5A 3I64A 4HBLA 5ILSA 3JSOA 2O3FA 3LA3A 4WWCA 3TOBA 3JAMZ 2F5EA 4CICA 4OOIA 2ESHA 2M30A 3IL2A 4LD5A 4Z2YA 1RI7A 2GWRA 3ABTA 5JR3A 3HYIA 2GXGA 3KP7A 4EJTA 3LAPA 3QPHA 2VBZA 3CLOA 1T0FA 5E1WA 1I5ZA 1FPQA 2FEZA 1WKMA 4E70A 3R0AA 3FHZA 3DF8A 2GQQA 2MH2A 4HX8A 1WWXA 1RZ4A 1XGSA 2Z33A 5HLHA 1J2XA 1FZPB 1KU3A 4KNYA 2F2EA 1ZG1A 2FNAA 5D8LB 4U7BA 4RGUA 4O5VA 1ZG5A 1LNWA 2QWWA 2ZXJA 1USSA 1YS6A 4I0BA 5DD8A 3GX4X 5AIQA 3KP6A 4HA8A 2EK5A 2EV5A 1Z91A 2FA5A 3GYHX 2K02A 3K1NA 4MEYF 3L7WA 5D6EA 4XBFA 4BQAA 3MZHA 3B02A 1XB4A 4ZYDA 3E6CC 1G3YA 5A2QZ 1QQIA 5BPDA 2ZJ2A 4OIRF 5K5RA 1CF7B 3ISPA 3ZQ7A 2P6SA 1IN8A 2QZ8A 2B0LA 3BROA 5EEHA 5LGTA 3VB2A 1K79A 1D8KA 4AIHA 4MQ9F 4CXFA 4MGRA 5L3GA 2XV4S 2A61A 4A0ZA 2P6TA 4UUVA 2ZBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT5 A;  3E3V A;  2A6H F;  1PP7 U;  4HDV A;  1P2F A;  3R61 A;  3EYY A;  4ESB A;  3RKX A;  3P7N A;  1SD6 A;  1D5V A;  1BIA A;  5K5Q A;  4FT8 A;  3BJO A;  4YFN F;  3PFI A;  2GA1 A;  4WXH A;  2EV6 A;  5FB2 A;  3P9I A;  1IXC A;  2ELH A;  2IVM A;  4G6Q A;  4RGS A;  1FSE A;  2XKP A;  4HF1 A;  5L3C A;  5E1Z B;  4YG2 F;  3M1E A;  1UHM A;  3E5X A;  2V9V A;  2HFH A;  3BJA A;  4ESF A;  2Q2E A;  1ZGJ A;  2H6B A;  2HGC A;  1Z6T A;  4EV0 A;  4YII A;  3U9G A;  1H9G A;  1KA8 A;  4ENN A;  4ZYH A;  3FF5 A;  2ZNY A;  2LF8 A;  1YTY A;  1UCR A;  3WTV C;  4UNO A;  4R79 A;  4LK1 F;  1GXQ A;  3Q9V A;  2FE3 A;  3AAF A;  2EFQ A;  1BJA A;  1QNT A;  1W7P A;  2XAS A;  5TJJ A;  3V7S A;  2V1U A;  4UVC A;  3SQN A;  3HIF A;  3M9A A;  2K4B A;  3QP5 A;  2M1B A;  3ZP5 A;  3WTX C;  2VT2 A;  2OA4 A;  3VOE A;  2XAG A;  3GWZ A;  3MAJ A;  1ZLK A;  4ZZD A;  4G7O F;  2DAO A;  1YW8 A;  4GCV A;  2A69 F;  4Q5S F;  3WE2 A;  3F6V A;  2P5L C;  4YFK F;  2EB7 A;  4UVB A;  1LVA A;  4ETS A;  1B6A A;  4HLY A;  2KKO A;  1BI1 A;  3OV8 A;  2VOO A;  1ZYR F;  3TO7 A;  5CVR A;  4LG0 A;  4HF0 A;  4IPA A;  2RDP A;  1SFU A;  5ILU A;  5LGN A;  2H6C A;  1SMY F;  3QU3 A;  4EJV A;  4BH9 A;  3I0T A;  3E6M A;  2HYG D;  3KP3 A;  5J6X A;  2A6E F;  3C7J A;  4CGZ A;  3M7G A;  1MDM A;  2M5W A;  3I53 A;  4M9X A;  1MJ9 A;  1EH6 A;  2EA4 A;  4PCQ A;  2EWN A;  1XMK A;  2JRT A;  3GXO A;  4WF2 A;  2K27 A;  1OKR A;  1B9N A;  4GYI A;  1Z6R A;  4ENJ A;  2K86 A;  3MCZ A;  4D0P A;  1ZH5 A;  1IZ1 A;  2PQ8 A;  3GW2 A;  4ENM A;  2LF7 A;  2VON A;  4BXU A;  4IJA A;  1TNT A;  2M8E A;  4B8X A;  1KQ0 A;  4DQ2 A;  3FMR A;  3LA2 A;  1IW7 F;  4N9I A;  4UV8 A;  3GZ6 A;  1EH8 A;  2PBI A;  3PQJ A;  3GF2 A;  2R7D A;  3TO6 A;  4GYG A;  2D45 A;  3HTS B;  5L3B A;  3F72 A;  1YW7 A;  4R1H A;  3IRR A;  1U78 A;  3CUQ A;  1T39 A;  1XCB A;  1TNS A;  1TQP A;  5FD5 A;  1RUO A;  2CW0 F;  3LQQ A;  4HV5 A;  4HYE A;  3FM3 A;  1Z7U A;  4KN4 X;  2MH9 A;  3HRS A;  4U0W A;  5K5O A;  4QWQ A;  4IRH A;  1U8R A;  2JTV A;  2XAF A;  2YU3 A;  3JTH A;  4A0Y A;  4TV7 A;  3M8F A;  1C0W A;  3K2Z A;  2FU4 A;  1OPC A;  3KLN A;  1F5T A;  1FC3 A;  1R1T A;  4HQM A;  1K78 A;  3CJN A;  1OYW A;  5D5V B;  4L9T A;  1BM9 A;  4RB3 C;  2KRF A;  4RAZ A;  5DDG A;  3RPQ A;  3DKW A;  5CLS A;  1ZRF A;  2DQR A;  3NQO A;  3IKV A;  3RIR A;  2PG4 A;  1U3E M;  2LSO A;  2QM3 A;  3F23 A;  2OBP A;  1LEB A;  2LKP A;  2PI0 A;  1DPR A;  3I5U A;  3KEQ A;  3L9F A;  1ON1 A;  2F5C A;  3GFJ A;  2HWV A;  4Q48 A;  1HW1 A;  1R58 A;  5HDK A;  5F6F A;  1B9M A;  1DUX C;  4BAY A;  3BP8 A;  2P8T A;  5DEQ A;  4L9J A;  2K4J A;  2M45 A;  1RIO H;  1A04 A;  4I7H A;  2RV8 A;  1ONV A;  4OMZ A;  2DI3 A;  3EUH A;  3WTZ A;  1KU7 A;  1JHH A;  1O7F A;  1HQC A;  2L02 A;  1WQ2 A;  2IJL A;  4BHC A;  5ILV A;  1EH7 A;  5CVJ A;  1OR7 A;  2H94 A;  2VBY A;  3KZY A;  2BBY A;  3KP4 A;  3P9K A;  2ISZ A;  3M8E A;  1RNL A;  3HOT A;  2A68 F;  3B73 A;  4OMY A;  1G3W A;  2DFI A;  1F1Z A;  1REP C;  4ESJ A;  5E1X A;  3IC7 A;  3V8J A;  5CVU A;  5F1R A;  3I4P A;  3H92 A;  3HHG A;  2FXA A;  2FF4 A;  1CF7 A;  3ZMD A;  4LFU A;  1I1S A;  3ZMV A;  4U88 A;  2OAZ A;  5BPI A;  3FM5 A;  4U7D A;  3RKW A;  2XVC A;  2DK8 A;  3HRT A;  1IRG A;  4NB5 A;  1IN7 A;  2HOE A;  3O2P E;  4HLX A;  3V7C A;  3F8B A;  2L54 A;  2WV0 A;  3TO9 A;  3ABU A;  2O8X A;  3J80 K;  1E17 A;  1LEA A;  2PMH A;  4I01 A;  2OU2 A;  2ZNZ A;  5J8C A;  2ETH A;  4XSX F;  3ECO A;  3ZN1 A;  4N9H A;  4AIJ A;  5HS9 A;  4KIG A;  1XN7 A;  2HQR A;  1OMI A;  2JPB A;  2DLL A;  1H9T A;  4KN7 X;  2QQA A;  5E8G A;  2DU9 A;  4IRG A;  5EEG A;  1R7J A;  1HW2 A;  2VXZ A;  5DCF A;  3T5X A;  4CO8 A;  2VT3 A;  1GVJ A;  1R22 A;  1UFM A;  1FYL A;  2QUF A;  1MZB A;  2COM A;  3FX3 A;  4BHB A;  1SAX A;  2FQ3 A;  2L4M A;  3JAM K;  3GFM A;  4UVA A;  4AWX B;  5FD6 A;  4CHU A;  4NQW A;  1P92 A;  5FO5 A;  4GXO A;  2XRN A;  2AXL A;  4WXC A;  4I09 A;  2G7H A;  2A3S A;  4LJZ F;  4K2E A;  1FT9 A;  4U0Y A;  5HLI A;  4IF4 A;  5H6Q A;  5HS8 A;  1PP8 F;  1U6G A;  4P9U A;  3I54 A;  1XCV A;  1G4D A;  2DO7 A;  2DK5 A;  1MKM A;  2C6Y A;  3RYR A;  4H0E A;  2X4H A;  3S2W A;  4EVI A;  1BN5 A;  2FNP A;  2UXN A;  3Q5F A;  3FXQ A;  3R4K A;  1ZLJ A;  5DV5 A;  2EV0 A;  4Y13 A;  3J81 K;  3ZMU A;  2DPU A;  5A2Q K;  3IWF A;  3LA7 A;  1S3J A;  3T8T A;  3HRU A;  3GUD A;  3BPV A;  3FMS A;  2DW4 A;  1L0O C;  3D0S A;  3G3Z A;  3CTA A;  4RGX A;  2ZO4 A;  4M73 A;  3HRM A;  1QZZ A;  2KIF A;  2HQN A;  2Y0M A;  1I27 A;  1I1G A;  4WK8 F;  2AS5 F;  2X0L A;  3CO6 C;  3VOD A;  2H27 A;  3QOP A;  4P55 A;  5KVR A;  4HF2 A;  3KLO A;  4Y17 A;  3SFZ A;  5BMZ A;  1T98 A;  3BWG A;  2QYO A;  2GXB A;  3N4M A;  5JFR A;  2UZK A;  1Y0U A;  1O7L A;  2RC4 A;  1GHC A;  4KIC A;  3RPU A;  2WC2 A;  3CDH A;  2HDC A;  1R5G A;  3E97 A;  4XLN F;  2VOD A;  3EYI A;  3K1P A;  1O3S A;  2E7W A;  3FXU A;  3MWM A;  2Z5U A;  2HEO A;  4PZJ A;  3T1B A;  2GAU A;  5LBQ A;  5E20 A;  3LWF A;  1T38 A;  1CGP A;  1KYW A;  1P4W A;  2BGC A;  1HBX G;  2O0Y A;  2PFB A;  3IHU A;  4S05 A;  2DPD A;  3COA C;  4A5M A;  2W85 A;  2P4W A;  3HUG A;  1FYM A;  4M6X A;  3HTU A;  1ZRD A;  3L09 A;  1SFX A;  3WU0 A;  3J7A O;  1HKQ A;  1V4R A;  3REO A;  3DP7 A;  1ZN2 A;  2VE9 A;  2P5K A;  2KIM A;  3F8M A;  3I71 A;  1ODD A;  3WE3 A;  3JW4 A;  4L9V A;  4OIO F;  1YYV A;  1TW3 A;  3KE2 A;  1ULY A;  3HOS A;  4EGY A;  1QGP A;  2CQK A;  2VN2 A;  3QPT A;  2A5Y B;  4L9N A;  4L0Z B;  2BYV E;  2L4A A;  2ZFW A;  1O3Q A;  1SMT A;  2MBF A;  4O6J A;  4P96 A;  3J81 Z;  2HKX A;  3ZN0 A;  3K1M A;  5ICF A;  5TRD A;  2VC0 A;  2YPR A;  4PDK A;  1R00 A;  2HKO A;  4A6D A;  4G9Y A;  5ICE A;  4L0Y B;  4IHS A;  4BNC A;  4ON0 A;  4LLL A;  3FZV A;  2WWY A;  2NS0 A;  2K7L A;  3RDI A;  1LDK B;  4HDU A;  3QAH A;  1BC8 C;  4FX4 A;  1O3T A;  3ERE D;  3R6S A;  2NNN A;  3DPT A;  4LG0 B;  3SZT A;  1ZAR A;  1UST A;  2JT1 A;  3F21 A;  2BE5 F;  6PAX A;  1J75 A;  5J8F A;  3CUQ C;  1XSV A;  5LRS A;  5H6R A;  2CG4 A;  2QEN A;  3WU1 B;  4MQV A;  2VE8 A;  2CGP A;  4A6E A;  5LGU A;  1U5T B;  1BC7 C;  4QLC U;  2MD5 A;  2OD5 A;  4A5N A;  1MD0 A;  3Q9S A;  1UHW A;  2XAJ A;  3H3Z A;  3CUO A;  4U0V A;  2STW A;  5K1Y A;  2IA2 A;  1L3L A;  3WGH A;  3QU6 A;  2XGX A;  4GO1 A;  1P4A A;  1G3T A;  1OYY A;  2YX7 A;  3C18 A;  4G8X A;  3ELK A;  4DNC A;  5D4S A;  2LNB A;  1IRF A;  3VFZ A;  1YLF A;  3KEO A;  4LB6 B;  4FHT A;  1IN5 A;  4CYD A;  2F5F A;  5ICC A;  3JSP A;  1B4A A;  1BIB A;  1QZY A;  3BDD A;  5CJ9 A;  4HAM A;  5ED4 A;  1WI9 A;  1VTN C;  3WTW C;  3LAJ A;  2RN7 A;  2VC1 A;  3W6J B;  5D5U B;  2IA0 A;  2OQR A;  2EA2 A;  2ACJ A;  3WGG A;  4Q47 A;  4LLN A;  2YR2 A;  4R8H A;  4A0X A;  1WSU A;  5D5X B;  3HHH A;  2Z9O A;  1TLH B;  1I6X A;  2RKH A;  3MQ0 A;  5DCM B;  2FML A;  3IKT A;  3F3X A;  3DEU A;  3WOD F;  4BHP A;  4OIQ F;  2IT0 A;  1TQM A;  1KQ8 A;  1IN6 A;  5HDN A;  1XGO A;  5FLX Z;  4PGH A;  4MTE A;  2CYY A;  1K78 B;  1YW9 A;  2ESN A;  2OQG A;  1S7O A;  3GVA A;  4B09 A;  1STZ A;  2XKO A;  1K7A A;  5L3F A;  2OZU A;  2XAH A;  1TW2 A;  3GZ5 A;  1KU9 A;  1P6R A;  1DDN A;  4CDG A;  3I59 B;  1FX7 A;  1IUY A;  1G6N A;  2BV6 A;  5LRR A;  3ROU A;  3WTY C;  4LLG F;  4G7H F;  2FBK A;  5LHH A;  1HST A;  2XAQ A;  1HW5 A;  2QLZ A;  3TQN A;  1D8J A;  3EQL F;  4YIF A;  4OIN F;  1KGS A;  2E1N A;  1H0M A;  3V4G A;  1FYK A;  4A2U A;  3L2C A;  3G73 A;  4L18 B;  1KQ9 A;  3TKY A;  4HX4 A;  5IT9 Z;  5DCM A;  2MLK A;  4EJO A;  1UB9 A;  3IWZ A;  4O3M A;  3GLX A;  3DQV C;  1PDN C;  3I58 A;  3MFK A;  1ZHF A;  4I98 B;  2V79 A;  4M9S A;  5HVQ C;  4KMU X;  2NRA C;  3E5U A;  3U2R A;  1AWC A;  5D8K B;  1HSJ A;  1KU2 A;  4AIK A;  4I02 A;  3KET A;  2KIU A;  5LHG A;  5FFZ A;  1R5H A;  5HLG A;  2HYF A;  1XSD A;  1U5T A;  4KFC A;  2ISY A;  1P4X A;  3RTR A;  2V1X A;  5LHI A;  4IHT A;  1TQI A;  2CWE A;  4N0B A;  1LJ9 A;  2D1H A;  3V8K A;  2XHK A;  1W4M A;  3E6D A;  3K9T A;  2RQP A;  4M9Z A;  3J80 Z;  1JHF A;  4KUM A;  2DQL A;  3HSE A;  2FRH A;  4A12 A;  3O6B B;  4L5J A;  3CO7 C;  1SD7 A;  2EFP A;  3FMQ A;  1FBU A;  5DYM A;  4MEX F;  2HTS A;  2EFN A;  4OU0 A;  3VEP A;  2ZCW A;  4GGG A;  1BBY A;  1ZRC A;  2G9W A;  3BY6 A;  1F4K A;  4RGR A;  1B59 A;  1IXS B;  3NRV A;  1TBX A;  3WGI A;  1S29 A;  3LST A;  5L3D A;  1BI3 A;  2UXX A;  4LGW A;  4ZZL A;  1V3F A;  3E6B A;  3V8L A;  5JVT A;  2DBB A;  2EFO A;  5E18 F;  2UWM A;  1KYZ A;  2A07 F;  5LEK A;  4G7Z F;  1S6L A;  1SFE A;  3F8N A;  3ML6 A;  3ZPL A;  4KT5 C;  2Y48 A;  1FSH A;  1FWZ A;  2IA1 A;  2Q0O A;  4Q4Z F;  4HW0 A;  4EQQ A;  3O3K A;  4IVN A;  3U1D A;  1IF1 A;  2Q8K A;  3WG9 A;  3V7R A;  4ZYE A;  4CZZ A;  2YX4 A;  3DFG A;  4EMS A;  4PGG A;  2MC3 A;  3P9C A;  4IXA A;  5IT9 K;  2XIG A;  4RAY A;  1XDU A;  1QPM A;  1J7K A;  3F8F A;  2MLG A;  4ZYG A;  4WCG A;  1HKT A;  2G7U A;  2PLY A;  1DP7 P;  1HKS A;  1J0R A;  5ERI A;  2QBY A;  2O03 A;  1FOK A;  1LDD A;  1X3U A;  2QVO A;  3GFL A;  1YS7 A;  2JZY A;  3MEX A;  4G6D A;  4HQE A;  1EV7 A;  4KIB A;  3DPL C;  5E8I A;  1SD4 A;  1W7P D;  2Z99 A;  1MJB A;  4EGZ A;  4G94 A;  2PJP A;  2OZ6 A;  1IXR C;  2M87 A;  3TDZ C;  2STT A;  2QQ9 A;  1R23 A;  1BI0 A;  3HSF A;  2VOP A;  4IRI A;  5D5W B;  2LDU A;  2ZME A;  3T8R A;  5AON A;  1AOY A;  1YIO A;  1Z9C A;  1ON2 A;  1MGT A;  3GFI A;  4MHG A;  1FBS A;  4M6Y A;  2W57 A;  3WTS C;  5E17 F;  3I59 A;  1XDS A;  3ZMZ A;  1FY7 A;  1QO0 D;  5HS7 A;  1D3Y A;  2O61 A;  5KK1 A;  1JXS A;  2FOK A;  2ZKZ A;  2WTE A;  3H3U A;  1MJA A;  4MNU A;  2F5D A;  4HZF A;  2QBY B;  1T6S A;  2DTR A;  3BZ6 A;  1MDM B;  1NHA A;  2FSW A;  1O3R A;  3RKY A;  5F64 A;  1J5Y A;  1LQ1 A;  1Z1D A;  1WRJ A;  1Q1H A;  4YFX F;  1ZGA A;  4RB1 A;  3SHF A;  4S04 A;  5JHU A;  2JPC A;  3GEZ A;  3LQR A;  1YO5 C;  3D5L A;  1PUE E;  2KJB A;  2Z3Y A;  4EJU A;  2PEX A;  2YSR A;  1JE8 A;  5LEJ A;  4RB2 C;  5IT3 A;  4M72 A;  3F22 A;  2ADU A;  2R7F A;  1ZRE A;  5CVI A;  3PQK A;  4FX0 A;  1U5T C;  1W5T A;  5HOO A;  2ZME B;  5FGM A;  4UV9 A;  1IN4 A;  2IPQ X;  4L5I A;  3RJP A;  3LFK A;  3HSR A;  4JQF A;  4HV6 A;  1K6O A;  5H20 A;  2KJC A;  3L00 A;  3TDU C;  3K69 A;  5LLQ A;  1XD7 A;  5DUI A;  3DV8 A;  1E2X A;  2J5O A;  1GXP A;  2RGV A;  2P7C B;  1JGS A;  4XSZ F;  5FFX A;  3DXJ F;  2GA2 A;  2L3D A;  4P5O A;  5BOX A;  2W84 A;  4Y15 A;  2FBH A;  1YQA A;  2L01 A;  2Y75 A;  4M74 A;  5CYV A;  5D4R A;  5DUK A;  1R36 A;  4XLP F;  1W7P B;  3SZP A;  4RS8 A;  4UXN A;  2P7V B;  1FBQ A;  1S8N A;  4P9F A;  1O57 A;  4LB5 A;  2IP2 A;  4ASN A;  4AVP A;  3RI4 A;  3EDP A;  3FXR A;  4F7Z A;  3IRQ A;  4RB0 A;  4EM0 B;  4EJW A;  3KP5 A;  1Z05 A;  1QBJ A;  4MTD A;  2E7X A;  2V1D A;  3R60 A;  3JTG A;  2HZT A;  2VBW A;  5AIP A;  1T2K A;  2PN6 A;  4OIP F;  3WTT C;  2W24 A;  4KYW A;  1R1V A;  4BYY A;  1YFH A;  4KIF A;  3EET A;  2TDX A;  4WXD A;  4ZH4 F;  2QQB A;  2NAZ A;  3QRF F;  3KCC A;  4WX9 A;  5L3E A;  1SD5 A;  2V6C A;  1LDJ A;  3N97 A;  1XMA A;  1LB2 A;  3KFW X;  4NHJ A;  4AD9 A;  4KDP A;  2R3S A;  4I0A A;  4KMF A;  4EM1 A;  5DD4 A;  1G3S A;  2GZW A;  1IAW A;  3ZMS A;  3NEU A;  2HS5 A;  5BQT A;  1XGN A;  2RVC A;  1J59 A;  4I2O A;  3MZY A;  2XUB A;  1HXD A;  4LK0 F;  3KZZ A;  1BOA A;  1U2W A;  2D2W A;  3ULQ B;  3SXY A;  3TGN A;  1DPU A;  1FP1 D;  4JBA A;  1OYI A;  2D1V A;  3ECH A;  2EFW A;  5ICG A;  2XRO A;  1YG2 A;  1R1U A;  1BI2 A;  4HX7 A;  1ZG3 A;  5D6F A;  3F6O A;  2GIV A;  3F8C A;  2CSO A;  5BS6 A;  1J9I A;  5JI6 A;  3KP2 A;  2NYX A;  2JSC A;  2W25 A;  5HDG A;  2E1C A;  3C1D A;  4ENK A;  3BOQ A;  1ZAO A;  3BJ6 A;  4XRF A;  1S7A A;  4M71 A;  3CUQ B;  4LMY A;  2RNJ A;  1FNN A;  3ZMT A;  4EM2 A;  2NNY A;  1FLI A;  3BPX A;  2J5P A;  1W5S A;  2P5V A;  1TTY A;  5CVV A;  3C3W A;  3WTU C;  3R0J A;  1XGM A;  2MA3 A;  3T0Y A;  2FMY A;  2O6G E;  3K0L A;  3GO5 A;  1B1B A;  1F9N A;  3TOA A;  4JK1 X;  2VBX A;  3QP6 A;  1FP2 A;  1RUN A;  3W6K B;  2FBI A;  2PMU A;  3RYP A;  2HR3 A;  3FWE A;  1XSX A;  3E5Q A;  3OOP A;  2H09 A;  2IRF G;  2HTJ A;  2BEO A;  4KA4 A;  2CFX A;  5FLX K;  4HOB A;  2CO5 A;  2EJR A;  4UHT A;  2IW5 A;  3I64 A;  4HBL A;  5ILS A;  3JSO A;  2O3F A;  3LA3 A;  4WWC A;  3TOB A;  3JAM Z;  2F5E A;  4CIC A;  4OOI A;  2ESH A;  2M30 A;  3IL2 A;  4LD5 A;  4Z2Y A;  1RI7 A;  2GWR A;  3ABT A;  5JR3 A;  3HYI A;  2GXG A;  3KP7 A;  4EJT A;  3LAP A;  3QPH A;  2VBZ A;  3CLO A;  1T0F A;  5E1W A;  1I5Z A;  1FPQ A;  2FEZ A;  1WKM A;  4E70 A;  3R0A A;  3FHZ A;  3DF8 A;  2GQQ A;  2MH2 A;  4HX8 A;  1WWX A;  1RZ4 A;  1XGS A;  2Z33 A;  5HLH A;  1J2X A;  1FZP B;  1KU3 A;  4KNY A;  2F2E A;  1ZG1 A;  2FNA A;  5D8L B;  4U7B A;  4RGU A;  4O5V A;  1ZG5 A;  1LNW A;  2QWW A;  2ZXJ A;  1USS A;  1YS6 A;  4I0B A;  5DD8 A;  3GX4 X;  5AIQ A;  3KP6 A;  4HA8 A;  2EK5 A;  2EV5 A;  1Z91 A;  2FA5 A;  3GYH X;  2K02 A;  3K1N A;  4MEY F;  3L7W A;  5D6E A;  4XBF A;  4BQA A;  3MZH A;  3B02 A;  1XB4 A;  4ZYD A;  3E6C C;  1G3Y A;  5A2Q Z;  1QQI A;  5BPD A;  2ZJ2 A;  4OIR F;  5K5R A;  1CF7 B;  3ISP A;  3ZQ7 A;  2P6S A;  1IN8 A;  2QZ8 A;  2B0L A;  3BRO A;  5EEH A;  5LGT A;  3VB2 A;  1K79 A;  1D8K A;  4AIH A;  4MQ9 F;  4CXF A;  4MGR A;  5L3G A;  2XV4 S;  2A61 A;  4A0Z A;  2P6T A;  4UUV A;  2ZBK A; 
#chains in the Genus database with same CATH topology
 2DT5 A;  1ETO A;  3E3V A;  2A6H F;  1PP7 U;  2NVX J;  4NUB A;  4HDV A;  2Y0S N;  1P2F A;  1MW7 A;  3R61 A;  4XKC A;  4E7Z A;  1JI8 A;  2QKL B;  3EYY A;  5TGT A;  1SFK A;  4ESB A;  3RKX A;  1VZ0 A;  1SD6 A;  3P7N A;  1D5V A;  1BIA A;  5K5Q A;  4FT8 A;  3BJO A;  1UG2 A;  4YFN F;  3PFI A;  2GA1 A;  4WXH A;  5JLX A;  5DM7 F;  3M3Y J;  2EV6 A;  3PFY A;  5FB2 A;  1VQ9 I;  3P9I A;  3H9G A;  3ABK H;  1IXC A;  2ELH A;  3W3C A;  2IVM A;  4G6Q A;  5CKT A;  3WU2 C;  1HF0 A;  2ZJR F;  4RGS A;  2NOJ B;  1FSE A;  3HOW J;  2R7S A;  3M07 A;  2XKP A;  4HF1 A;  5L3C A;  4GDF A;  5E1Z B;  1V54 H;  1K83 J;  3HPH A;  4YG2 F;  2DOF A;  1HLV A;  3M1E A;  2Q1Z B;  4UUS A;  1UHM A;  3E5X A;  2X48 A;  2V9V A;  2HFH A;  1YRN A;  3BJA A;  4B1R A;  4ESF A;  1Z77 A;  3AFH A;  2Q2E A;  1ZGJ A;  3TBI A;  2H6B A;  2KDO A;  3VDX A;  2HGC A;  1Z6T A;  5HNH A;  4EV0 A;  4YII A;  3U9G A;  5LD2 C;  1O4X A;  1H9G A;  1KA8 A;  2WAQ N;  3GTL J;  4NQW B;  2MD0 A;  1AKH A;  4ENN A;  4ZYH A;  3FF5 A;  3CMM A;  2ZNY A;  4XR6 A;  2LF8 A;  1YTY A;  1UCR A;  1QZE A;  3WTV C;  4UNO A;  2K85 A;  5DS9 A;  4R79 A;  4LK1 F;  5F0H A;  2JVG A;  2FQ4 A;  3HEF A;  3HJE A;  1GXQ A;  3QPL A;  4DIQ A;  1SVM A;  1IJW C;  2E71 A;  3Q9V A;  2FE3 A;  3AAF A;  2EFQ A;  1BJA A;  2JMW A;  4AYB N;  3IAM 2;  2LKX A;  2ZJQ F;  1QNT A;  1W7P A;  2XAS A;  3HOX J;  5C3E J;  5TJJ A;  3V7S A;  2V1U A;  1W5C C;  3FXL A;  2E1M B;  3G71 I;  3DKX A;  1VQN I;  2R5Y A;  2KQR A;  4UVC A;  3SQN A;  1Y1W J;  2DTZ A;  3HIF A;  3M9A A;  1VQP I;  2K4B A;  3QP5 A;  2M1B A;  3ZP5 A;  3WTX C;  2VT2 A;  2OA4 A;  2DA1 A;  3VOE A;  3KYC B;  3JRI A;  3UKG A;  2XAG A;  4XOR A;  3GWZ A;  3MAJ A;  4M3F A;  3C2G A;  4ZZD A;  2A05 A;  4C3H J;  5K7F A;  4J19 A;  1ZLK A;  4G7O F;  2DAO A;  1ENH A;  1YW8 A;  5IP7 J;  4GCV A;  2A69 F;  3JRF A;  4Q5S F;  1YIT I;  3WE2 A;  3F6V A;  2P5L C;  4YFK F;  3IP4 B;  2EB7 A;  4XOP A;  3OIO A;  4UVB A;  1LVA A;  4ETS A;  1B6A A;  2DMN A;  3L2R A;  1DGR M;  3AG3 H;  4HLY A;  5IYC J;  2V6E A;  2KKO A;  1BI1 A;  3OV8 A;  2IBD A;  2VOO A;  4IHX A;  2L9N A;  1ZYR F;  4HST A;  3TO7 A;  5CVR A;  4LG0 A;  4HF0 A;  2GM4 A;  4IPA A;  2O9L A;  2RDP A;  1SFU A;  1Z0X A;  3TED A;  1KZH A;  4NNJ A;  5ILU A;  4D7M A;  5LGN A;  3CCV I;  3SEQ A;  2H6C A;  3GTP J;  2NVY J;  1SMY F;  3QU3 A;  3G2B A;  4BH9 A;  4EJV A;  3I0T A;  1Z21 A;  5HNF A;  4BXF A;  3E6M A;  2HYG D;  2I5U A;  3KP3 A;  5J6X A;  2A6E F;  3C7J A;  4CGZ A;  4Y33 A;  3M7G A;  2XPV A;  2M5W A;  1MDM A;  1ZK8 A;  3I53 A;  4M9X A;  1MJ9 A;  1BA5 A;  1EH6 A;  3A1Y A;  2EA4 A;  1FTT A;  5C44 J;  4PCQ A;  2EWN A;  1XMK A;  2JRT A;  2JA5 J;  3GXO A;  2WY7 Q;  4WF2 A;  2KRH A;  2QSG X;  2K27 A;  4ZDO A;  4IHW A;  3RPU D;  1OKR A;  1SAU A;  1B9N A;  4GYI A;  2LY2 A;  3DU5 A;  1YHQ I;  2LC2 A;  1Z6R A;  2K86 A;  3MCZ A;  4ENJ A;  1YX3 A;  2A6T A;  4D0P A;  5J1R A;  2Y30 A;  2AO9 A;  1ZH5 A;  3HB9 A;  1IZ1 A;  4A3E J;  2PQ8 A;  3GW2 A;  1MND A;  2KIQ A;  2WAD A;  4ENM A;  2LF7 A;  5TIS C;  3U1K A;  2VON A;  1ITY A;  3O8G A;  4BXU A;  4IJA A;  1TNT A;  2M8E A;  4B8X A;  4E7J A;  1KQ0 A;  3K70 D;  3JCU C;  4DQ2 A;  1IC8 A;  2XAU A;  3WHC A;  3FMR A;  2RQQ A;  9ANT A;  1Y6I A;  1IW7 F;  2DDA A;  3LA2 A;  4FET A;  4N9I A;  1X19 A;  4UV8 A;  3GZ6 A;  1EH8 A;  2PBI A;  4CSW A;  2E36 A;  3PQJ A;  1S72 I;  2BY0 A;  3RQ4 A;  1VQM I;  3GF2 A;  4II3 A;  3S1N J;  2QSH X;  4KIT B;  2R7D A;  3TO6 A;  4GYG A;  4CCO A;  5DTD A;  2CV0 A;  3CCQ I;  2D45 A;  2BW3 B;  2ZXW H;  3MMY B;  3TW7 A;  3HBL A;  5GTH C;  3HTS B;  2ZME C;  5L3B A;  3F72 A;  1YW7 A;  2R5Z A;  4R1H A;  3I55 I;  3IRR A;  1U78 A;  3TP0 A;  3CUQ A;  1T39 A;  3FK6 A;  1UG0 A;  1XCB A;  1TNS A;  3DTE A;  1TQP A;  2VLA A;  2L9V A;  2AQF A;  5FD5 A;  1RUO A;  5IOY A;  1RC9 A;  4FE4 A;  4IHV A;  3VWB A;  2CW0 F;  3LQQ A;  4HV5 A;  3K4B A;  3ZCO A;  2QF7 A;  4HYE A;  3F0C A;  2VJ4 A;  3FM3 A;  4QSH A;  2Y2Z A;  1Z7U A;  4KN4 X;  4GFB A;  2MH9 A;  3HRS A;  4U0W A;  3CCR I;  4BEH B;  1WGX A;  1WJB A;  5K5O A;  3ZXS A;  4HEA 2;  4ZC3 A;  4QWQ A;  4IRH A;  5KAI C;  4IKF A;  4XKB A;  2LK2 A;  4UUT A;  1ORK A;  2XF6 A;  2FOW A;  3MKZ A;  1U8R A;  4RDU A;  2JTV A;  2XAF A;  2YU3 A;  1T56 A;  3JTH A;  4A0Y A;  4TV7 A;  1JT6 A;  3M8F A;  1RR8 C;  1C0W A;  3K2Z A;  3FK7 A;  2FU4 A;  1OPC A;  3KLN A;  1F5T A;  2DJN A;  3KEY A;  1FC3 A;  2DDB A;  2HOA A;  1TWH J;  2M34 A;  1R1T A;  4HQM A;  1D1B A;  3FKJ A;  1K78 A;  2OTL I;  3CJN A;  4B3X A;  1OYW A;  5D5V B;  4L9T A;  1BM9 A;  4RB3 C;  2KRF A;  4RAZ A;  3OR2 C;  5DDG A;  4UB6 C;  3RPQ A;  1JTY A;  1OFC X;  2HVR A;  3DKW A;  3I9V 2;  5CLS A;  3OYD A;  2DQR A;  1ZRF A;  3NQO A;  1R9T J;  3IKV A;  3RIR A;  4I6Z A;  2PG4 A;  1U3E M;  1VQ7 I;  1Z3Y A;  2LSO A;  3RCO A;  2DA5 A;  3EPZ A;  2QM3 A;  4PJM A;  1DU6 A;  3PJR A;  1D0Z A;  2ZXH A;  4F52 A;  3F23 A;  2OBP A;  1LEB A;  2LKP A;  1GUU A;  5J47 A;  2PI0 A;  2L2O A;  1JJ8 C;  2JQ7 A;  1DPR A;  3I5U A;  2DMT A;  3KEQ A;  4JP0 A;  4UY8 I;  3L9F A;  1U9N A;  2BHY A;  2R4G A;  4C3I J;  3HXL A;  4BKX A;  1ON1 A;  3OYG A;  2XB5 A;  3HKZ N;  2F5C A;  3GFJ A;  3JRG A;  2HWV A;  3HL2 A;  3HPG A;  4Q48 A;  1HW1 A;  1A6Q A;  1R58 A;  2JUG A;  3LSG A;  3K4N A;  5HDK A;  5F6F A;  2HVS A;  4I99 C;  1B9M A;  2VJI A;  1DUX C;  4BAY A;  3BP8 A;  2P8T A;  1TC3 C;  5DEQ A;  4L9J A;  1A6I A;  1Z7L A;  4S0H B;  2FD5 A;  2K4J A;  2M45 A;  1VF9 A;  2ZSI B;  5EZH A;  2JN6 A;  4IOC F;  1RIO H;  1A04 A;  4I7H A;  1AU7 A;  1K6Y A;  2RV8 A;  1ONV A;  3E7L A;  4RA2 A;  3HKZ A;  4XN3 A;  2Q2E B;  1PUF A;  4OMZ A;  2DI3 A;  3EUH A;  1GDT A;  3WTZ A;  5JVG F;  1KU7 A;  1JHH A;  2JK3 A;  2F4I A;  2JA2 A;  2ZC2 A;  3B6C A;  4IOA F;  4HPQ A;  1RKT A;  3DTI A;  3S32 A;  4V19 K;  1O7F A;  1HQC A;  2L02 A;  1MBF A;  2KIS A;  1WQ2 A;  2IJL A;  4BHC A;  3H9Q A;  5ILV A;  1EH7 A;  4G6T B;  2R7X A;  5CVJ A;  1OR7 A;  4A3K J;  2H94 A;  2VBY A;  3BR3 A;  3KZY A;  2BBY A;  1ZTR A;  5IOZ A;  3KP4 A;  3P9K A;  2W4S A;  3KZI C;  2ISZ A;  4FIS A;  3M8E A;  1RNL A;  2BY2 A;  5LFA A;  3AKZ A;  4V2F A;  3ZQH A;  3PSF A;  3HOT A;  2A68 F;  3DEE A;  4B3A A;  3B73 A;  3J7Y J;  4OMY A;  4XRM A;  1G3W A;  2DFI A;  1F1Z A;  2NS8 A;  3I3L A;  1REP C;  4F3Q A;  4ESJ A;  5IYD J;  5E1X A;  3IC7 A;  3V8J A;  1B8I A;  4BQN A;  5CVU A;  5F1R A;  2HDD A;  3I4P A;  3H92 A;  3HHG A;  2FXA A;  3OYE A;  3H5N A;  2FF4 A;  3TMO A;  1BR1 A;  3PSI A;  1CF7 A;  3HOY J;  3FIW A;  3OL4 A;  4XOT A;  1ERD A;  3MVP A;  4F55 A;  4ZTF A;  3ZMD A;  4LFU A;  2X6W A;  3ZMV A;  4KIS A;  1I1S A;  5KAF C;  1TL8 A;  4GRI A;  4U88 A;  2OAZ A;  5BPI A;  3SEZ A;  3FM5 A;  4U7D A;  3RKW A;  2XVC A;  3S15 J;  3Q0U A;  1XPX A;  2DK8 A;  2AHQ A;  3HRT A;  1IRG A;  4NB5 A;  2VPL A;  1IN7 A;  2HOE A;  3O2P E;  4HLX A;  3V7C A;  2VAS A;  3F8B A;  2L54 A;  2WV0 A;  3TO9 A;  2H8W A;  3ABU A;  2O8X A;  4E7L A;  3J80 K;  2DFH A;  1E17 A;  1MSE C;  1XX5 A;  1X2N A;  4H4K C;  1LEA A;  2PMH A;  4I01 A;  2F48 A;  1X1D A;  3GME A;  3OIP A;  2OU2 A;  2XF5 A;  2ZNZ A;  2ETH A;  5J8C A;  3WG7 H;  4XSX F;  3ECO A;  3ZN1 A;  4BDY A;  3GTK J;  3KYD B;  4N9H A;  4AIJ A;  5HS9 A;  1PYV A;  3OYN A;  3K4J A;  4KIG A;  1XN7 A;  2HQR A;  3BG3 A;  1OMI A;  2JPB A;  3DU6 A;  2DLL A;  3H35 A;  2XGD A;  1H9T A;  2XGC A;  4KN7 X;  1PUF B;  3DKY A;  2QQA A;  5E8G A;  1B72 A;  2DU9 A;  4IRG A;  5EEG A;  1R7J A;  1HW2 A;  4BGD A;  3OL3 A;  3HG9 A;  5FKL A;  2VXZ A;  3BR5 A;  5DCF A;  3T5X A;  4CO8 A;  2VT3 A;  3H1C A;  1GVJ A;  3SDB A;  4M3B A;  1VQ5 I;  4UUS B;  3JR9 A;  1R22 A;  1OCP A;  1P7J A;  1Q1V A;  1UFM A;  4E6K G;  4E7S A;  4M3E A;  1FYL A;  2QUF A;  1BR2 A;  3H0G J;  1MZB A;  2COM A;  1YRN B;  3FX3 A;  2CUF A;  3EUH C;  3K4K A;  1MMN A;  4BHB A;  1TWG J;  2MGQ A;  1SAX A;  2FQ3 A;  5KNL A;  2L4M A;  4HSR A;  3BLY A;  3OYC A;  4DYQ A;  1RES A;  3JAM K;  1JT0 A;  3GFM A;  4UVA A;  2XF7 A;  4AWX B;  4OAZ A;  4X1E A;  1WVR A;  2A5W A;  5FD6 A;  4CHU A;  4NQW A;  3B6A A;  1R71 A;  2F4O B;  1P92 A;  5FO5 A;  3BG9 A;  4GXO A;  2B63 J;  3CLQ A;  2XRN A;  2AXL A;  4WXC A;  4I09 A;  1SVO A;  1ETX A;  2G7H A;  2A3S A;  2ID6 A;  4LJZ F;  5GAE J;  1QPI A;  4K2E A;  3I56 I;  1FT9 A;  1EF4 A;  1D1C A;  1P9Q C;  2LH9 A;  1T0F C;  5HLI A;  4IF4 A;  4U0Y A;  3FKI J;  5H6Q A;  1NH3 A;  5HS8 A;  1PP8 F;  1UAA A;  5J1Y A;  1U6G A;  4P9U A;  3I54 A;  3CMA I;  1OIS A;  1XCV A;  3OYH A;  2DK5 A;  2DO7 A;  1G4D A;  1MKM A;  2CRG A;  2C6Y A;  2YU9 J;  3RYR A;  2JVH A;  4H0E A;  3G6E I;  2ECC A;  2IEK A;  2X4H A;  3DCF A;  3S2W A;  1BN5 A;  4EVI A;  3LSK A;  2GXA A;  1ETK A;  1R5I D;  2FNP A;  2UXN A;  4BU2 A;  4DYR A;  3ERM A;  3Q5F A;  3FXQ A;  3R4K A;  1ZLJ A;  4FQG A;  5DV5 A;  4BQO A;  2EV0 A;  1HOM A;  4Y13 A;  3J81 K;  1T33 A;  3CJT B;  1W0T A;  3ZMU A;  1X4P A;  4CZC A;  1W0U A;  1MBE A;  2DPU A;  2M0C A;  5A2Q K;  3IWF A;  3TW6 A;  2VUM J;  3FBI B;  1F36 A;  1Y8R B;  2LVS A;  3OYI A;  1Z3X A;  3LA7 A;  1S3J A;  1LKX A;  3T8T A;  3HRU A;  5DM6 F;  2HOT A;  1SVL A;  3GUD A;  1RKW A;  4FTH A;  3OSF A;  1WJ5 A;  2ELJ A;  5FRM A;  3BPV A;  1YX5 A;  2VQC A;  1VQ4 I;  3MD2 A;  5B3S H;  3MKW B;  3FMS A;  4A93 J;  3RSN A;  2DW4 A;  1L0O C;  3D0S A;  3G3Z A;  4BEH A;  3IH4 A;  3CTA A;  4RGX A;  4A69 C;  5H2F C;  4A3M J;  3CP2 A;  2ZO4 A;  3OS2 A;  4M73 A;  3HRM A;  1DU0 A;  1QZZ A;  2VKH A;  4G12 A;  3QWL A;  2KIF A;  2EIN H;  2HOS A;  2HQN A;  2Y0M A;  1I27 A;  3GTG J;  1I1G A;  3A02 A;  4WK8 F;  2AS5 F;  3CDL A;  2X0L A;  3CO6 C;  4EAT A;  2IGN A;  2OC6 A;  2AXT C;  3VOD A;  3S17 J;  1RR7 A;  3OS1 A;  2BVM A;  3LMM A;  3A01 A;  3IH3 A;  2HXI A;  1XS9 A;  1FEX A;  1WI3 A;  2H27 A;  3AG1 H;  2K9S A;  3QOP A;  1OCZ H;  4P55 A;  1G2H A;  2O5R A;  1FOX A;  5KVR A;  4HF2 A;  3KLO A;  4Y17 A;  5B5E C;  3SFZ A;  5BMZ A;  2L7M P;  1T98 A;  3BWG A;  3LOC A;  2QYO A;  2GXB A;  3N4M A;  5JFR A;  2UZK A;  1Y0U A;  1O7L A;  2RC4 A;  1GHC A;  4D5C A;  5KHD A;  1D5Y A;  4PK4 A;  1Z67 A;  5F0C A;  4Y3O A;  1FIA A;  4KIC A;  3RPU A;  2WC2 A;  3CDH A;  2HDC A;  4XLC A;  1R5G A;  3ZQF A;  2E2I J;  1FOY A;  3E97 A;  4XLN F;  2R7Z J;  2K3P A;  2VOD A;  3ABL H;  3EYI A;  3K1P A;  2JA7 J;  2QSF X;  1WPK A;  1O3S A;  2E7W A;  3IAS 2;  5KCM A;  3TL4 X;  3FXU A;  3MWM A;  4B4C A;  2Z5U A;  1QHG A;  2HEO A;  5J4V A;  4PZJ A;  3T1B A;  2GAU A;  5LBQ A;  2X6O A;  1X1C A;  1AHD P;  5E20 A;  4ITV A;  3TP3 A;  2RRE A;  3ASN H;  3LWF A;  1T38 A;  1VQO I;  1CGP A;  1KYW A;  1P4W A;  2BGC A;  2Z16 A;  1HBX G;  1B8I B;  4C2M J;  1OLT A;  2O0Y A;  2PFB A;  3IHU A;  4HNT A;  4S05 A;  1FMV A;  3S1Q J;  3K6G A;  2DPD A;  4RM2 A;  3COA C;  4NBQ A;  4A5M A;  3S14 J;  2W85 A;  4F91 B;  2P4W A;  3OS0 A;  1HA8 A;  2HQA A;  3HUG A;  2FUG 2;  2I8D A;  1FIP A;  1FYM A;  4M6X A;  4II2 A;  3H36 A;  2M7A A;  2FJ1 A;  3HTU A;  1MH3 A;  1ZRD A;  5J1U A;  3CZ6 A;  3L09 A;  5J3L A;  4Y52 J;  1NTC A;  1SFX A;  3WU0 A;  3J7A O;  1HKQ A;  4B47 A;  1V4R A;  3REO A;  3ZQQ A;  3DP7 A;  3LSI A;  1U8B A;  1ZN2 A;  4XKW A;  2VE9 A;  2HDW A;  4DZJ A;  3A03 A;  5GAG J;  2P5K A;  4QTR A;  2KIM A;  2IAI A;  1AKH B;  1FJL A;  3F8M A;  3I71 A;  1MBJ A;  1ODD A;  5IPA A;  3WE3 A;  3JW4 A;  4L9V A;  4OIO F;  3CCJ I;  1YYV A;  1TW3 A;  3KE2 A;  1ULY A;  3HOS A;  4EGY A;  1QGP A;  2CQK A;  4I76 A;  2DCE A;  2Y9Y A;  1PJR A;  1T95 A;  2VN2 A;  3QPT A;  2A5Y B;  1T08 B;  4L9N A;  4L0Z B;  2JA8 J;  2H1L A;  3PUB A;  2BYV E;  4ABZ A;  2IXS A;  2CJJ A;  2VKD A;  3GBG A;  2L4A A;  3DBR B;  3A0B C;  1VQ8 I;  2ZFW A;  1O3Q A;  2E5N A;  2W1O A;  3S2D J;  1YIJ I;  1SMT A;  1Y56 A;  3BR6 A;  3DBL B;  1IV8 A;  2MBF A;  4O6J A;  4P96 A;  2XPW A;  4XIC A;  3J81 Z;  3OR1 C;  3OYA A;  1WJA A;  2CQN A;  2HKX A;  3ZN0 A;  2OPT A;  3K1M A;  4FCY A;  5ICF A;  2NVQ J;  2R5Y B;  5JLW A;  5TRD A;  2XGE A;  2VC0 A;  2YPR A;  3JRE A;  3CD6 I;  1S9H A;  4BL0 B;  4PDK A;  3VYS B;  2QQ8 A;  1WHU A;  1OCO H;  1R00 A;  5F04 A;  2HKO A;  1OCT C;  4A6D A;  4G9Y A;  5ICE A;  4L0Y B;  4IHS A;  3HDD A;  4BNC A;  4JX6 A;  1V5F A;  1PVE A;  4ON0 A;  4LLL A;  2Z1D A;  3FZV A;  2F6C A;  2WWY A;  2NVT J;  1ZEL A;  2NS0 A;  1EKE A;  1OCR H;  2BXZ A;  2K7L A;  2ECB A;  1SFO J;  3RDI A;  1UZC A;  4L5E A;  5K7H A;  2WA0 A;  3S3M A;  1LDK B;  4HDU A;  1KON A;  3QAH A;  1BC8 C;  4FX4 A;  1O3T A;  2K9L A;  2EZL A;  2H8R A;  4MO7 A;  3ERE D;  2YUS A;  4YEJ A;  3R6S A;  2GOX B;  2NNN A;  3M1C A;  5EYR A;  2OCC H;  3DPT A;  4CCM A;  2LFB A;  4LG0 B;  3SZT A;  5E3M A;  1ZAR A;  3A2K A;  1UST A;  2JT1 A;  4ZDP A;  2W00 A;  4IHY A;  3F21 A;  2BE5 F;  4B48 A;  1TWA J;  4E7I A;  3DBH B;  4PFP A;  6PAX A;  2DYR H;  1J75 A;  5J8F A;  4XN0 A;  3CUQ C;  1XSV A;  5LRS A;  5H6R A;  2CG4 A;  2QEN A;  4IQ4 A;  4BUP A;  5B1A H;  3WU1 B;  4MQV A;  2VE8 A;  3SYT A;  1VQK I;  4BJ5 C;  2R93 J;  2CGP A;  3K10 A;  1U0J A;  4A3I J;  4A6E A;  2OCE A;  5LGU A;  1U5T B;  3G1M A;  3K70 C;  4QLC U;  1BC7 C;  4XNF A;  5E3N A;  2MD5 A;  2OD5 A;  4A5N A;  2TCT A;  1EA3 A;  1MD0 A;  3Q9S A;  1N77 A;  1UHW A;  2XAJ A;  4AUX A;  1HDD C;  2VQG A;  3K4C A;  3H3Z A;  4HNV A;  3CUO A;  4U0V A;  2STW A;  4AU7 A;  5K1Y A;  2IA2 A;  2CMP A;  2IGM A;  1L3L A;  2R92 J;  3PIP F;  3WGH A;  3QU6 A;  2LBF B;  4XLE A;  1GVD A;  2XGX A;  4CH7 A;  1GT0 C;  3AG2 H;  4GO1 A;  1P4A A;  2WB1 A;  1G3T A;  2LKS A;  3I4N J;  4A3B J;  1VQ6 I;  1SAN A;  1OYY A;  2VJ5 A;  2YX7 A;  3C18 A;  1UJ8 A;  1YE9 A;  3ELK A;  4G8X A;  4AID A;  4DNC A;  5D4S A;  3MN2 A;  4N4N B;  2LNB A;  1IRF A;  1OJL A;  5EG0 B;  3VFZ A;  1LFB A;  3FBN B;  1YLF A;  3BCA A;  3KEO A;  4LB6 B;  3FHN A;  4FHT A;  3CC2 I;  1IN5 A;  2VKE A;  4ANJ A;  2R7R A;  3KYL A;  2X1C A;  4CYD A;  2F5F A;  4AC0 A;  5ICC A;  2LD5 A;  3JSP A;  3PO3 J;  3N05 A;  2QA4 I;  1B4A A;  1BIB A;  2L9R A;  1TWF J;  1GV2 A;  1QZY A;  2R7U A;  3BDD A;  4BS9 A;  4HAM A;  5CJ9 A;  1JJ6 C;  5ED4 A;  2ZSH B;  2DT7 B;  1WI9 A;  1VTN C;  3P5J A;  4CCN A;  2LLK A;  3GZN B;  3WTW C;  3LAJ A;  2RN7 A;  2VC1 A;  5M5Y J;  5FLV A;  3W6J B;  5D5U B;  2IA0 A;  2OQR A;  3JRA A;  2EA2 A;  2ACJ A;  3WGG A;  4Q47 A;  2E5Z A;  2CUJ A;  4LLN A;  2YR2 A;  1JUM A;  4R8H A;  2R7V A;  2HYJ A;  4A0X A;  5EEA A;  3OYK A;  1IRZ A;  1WSU A;  3U21 A;  5D5X B;  3HHH A;  1GLN A;  3A01 B;  2Z9O A;  1TLH B;  2PMZ A;  2V1N A;  1I6X A;  2RKH A;  3NAR A;  3MQ0 A;  5DCM B;  2FML A;  3IKT A;  5HOD A;  3F3X A;  3OY9 A;  3DEU A;  4IL6 C;  3WOD F;  1E3H A;  4BHP A;  4OIQ F;  2IT0 A;  1TQM A;  1DP3 A;  2Y9Z A;  4CCL A;  1KQ8 A;  1IN6 A;  4W97 A;  5HDN A;  1XGO A;  5FLX Z;  3OSG A;  1W36 C;  3G1O A;  4PGH A;  2KZG A;  2CYY A;  4MTE A;  2JWT A;  1K78 B;  1QVT A;  4NDL A;  1YW9 A;  2ESN A;  1DGW Y;  2OQG A;  1S7O A;  1JGG A;  1X3W B;  3GVA A;  4NC8 A;  4C9Y A;  4F92 B;  4B09 A;  2LTP A;  3LFU A;  4BQQ A;  4PUS A;  5FLM J;  1STZ A;  3QOE A;  3BG5 A;  2EBI A;  2XKO A;  1K7A A;  3RZD J;  5L3F A;  1LPQ A;  2OZU A;  3MKY B;  2XAH A;  2K5C A;  2DOA A;  1TW2 A;  3GZ5 A;  3PNV A;  1KU9 A;  4BJ6 C;  1P6R A;  1DDN A;  1VI0 A;  4CDG A;  1R49 A;  3I59 B;  1FX7 A;  1IUY A;  3M4O J;  2MW8 A;  3BG6 A;  5IP6 A;  3FXJ A;  4XK4 A;  1G6N A;  2ZFU A;  2BV6 A;  5LRR A;  5E3L A;  4ZJZ A;  3ROU A;  3WTY C;  4RAG A;  4LLG F;  5EJC A;  2DFE A;  2XB0 X;  1N78 A;  3GLL A;  2I10 A;  4G7H F;  2FBK A;  1UHS A;  5LHH A;  3CES A;  1HST A;  2ZB9 A;  2DA4 A;  2CH0 A;  1YJN I;  2LRD A;  2XAQ A;  2K40 A;  1HW5 A;  2QLZ A;  4W1U A;  3C2H A;  3TQN A;  1D8J A;  3EQL F;  4YIF A;  3SZG A;  3VSK A;  4UB8 C;  4DBR A;  1I3Q J;  3ZQG A;  3CDI A;  4OIN F;  3BTJ A;  3S1M J;  1KGS A;  5EF6 A;  3GTJ J;  2F4M B;  2OF7 A;  2E1N A;  1H0M A;  4DJA A;  2WY8 Q;  4XLH A;  3DEW A;  3V4G A;  2L5Q A;  1FYK A;  4A2U A;  5CQG A;  3L2C A;  3G73 A;  3BQY A;  1E3O C;  4L18 B;  1KQ9 A;  5EGO A;  3TKY A;  4IX7 A;  3HM5 A;  4HX4 A;  3PO2 J;  5IT9 Z;  5DCM A;  2BOL A;  4P1W A;  1D0X A;  2MLK A;  4EJO A;  1UB9 A;  3IWZ A;  1X1P A;  4O3M A;  4CCK A;  1LFP A;  3GLX A;  3DQV C;  1PDN C;  1MH4 A;  2VL8 A;  3I58 A;  3MFK A;  1ZHF A;  2GLO A;  4I98 B;  3DLA A;  3W2A A;  2V79 A;  4M9S A;  1MMG A;  4Y4R A;  5HVQ C;  4KMU X;  2JUC A;  2NRA C;  2VJJ A;  3E5U A;  2X9D A;  2E35 A;  3U2R A;  1AWC A;  3DTK A;  2JA6 J;  3ASO H;  1J09 A;  3HGY A;  5D8K B;  2K3F A;  1S7E A;  1HSJ A;  1KU2 A;  5FRN A;  4AIK A;  1FMW A;  4I02 A;  2KIU A;  3KET A;  5LHG A;  5FFZ A;  2W7N A;  1R5H A;  1RET A;  3L2W A;  5HLG A;  2HYF A;  1XSD A;  5JHF A;  2K9N A;  1U5T A;  3AL0 B;  2N8G A;  2FX0 A;  3WHB A;  2ISY A;  5M5X J;  1P4X A;  4KFC A;  2L0K A;  3RTR A;  1WH7 A;  2V1X A;  3H5R A;  5LHI A;  4IHT A;  1TQI A;  2CWE A;  4N0B A;  1LJ9 A;  4XQF A;  1JUS A;  2VXD A;  3W6V A;  4JX5 A;  1S5L C;  2D1H A;  2DA6 A;  3V8K A;  2XHK A;  1Y8Q B;  1W4M A;  3E6D A;  2RNG A;  2R7T A;  1IDY A;  1LE8 B;  1JKP C;  3K9T A;  2RQP A;  2DA3 A;  4M9Z A;  3J80 Z;  3S16 J;  2O7O A;  1JKR C;  1JHF A;  2BXY A;  4KUM A;  1YOV B;  1V55 H;  1HDP A;  2DQL A;  3HSE A;  1MBG A;  2FRH A;  2CS3 A;  4A12 A;  3O6B B;  4XL9 A;  3OIQ A;  1MMD A;  4L5J A;  3CO7 C;  2HPI A;  2VPR A;  1SD7 A;  3VYR B;  3HOU J;  2EFP A;  2LR8 A;  3FMQ A;  4PSW A;  1FBU A;  1A5J A;  1WJF A;  5DYM A;  2CU7 A;  4MEX F;  2HTS A;  1QU3 A;  1D1A A;  2EFN A;  4OU0 A;  3VEP A;  4JOM A;  2ZCW A;  3BT9 A;  4GGG A;  1BBY A;  2O8K A;  1ZRC A;  3MZ8 A;  2G9W A;  3BY6 A;  2Z2S B;  3Q3S A;  3HGG A;  1F4K A;  3IUO A;  4XRS G;  4RGR A;  1T8I A;  2CW8 A;  1ETW A;  2EPF A;  2M9H A;  3ZOB A;  1A35 A;  3JRH A;  4DGW B;  1B59 A;  2NOG A;  1IXS B;  3NRV A;  1TBX A;  3KPH A;  3S3N A;  3WGI A;  1S29 A;  4N4O B;  1E0E A;  1YI2 I;  3LST A;  1ZGW A;  1YJW I;  5L3D A;  1BI3 A;  3CP8 A;  2UXX A;  4PJ0 C;  1ZQ3 P;  2HZD A;  4LGW A;  4ZZL A;  1V3F A;  2M3A A;  3E6B A;  4XLA A;  3V8L A;  5JVT A;  2DBB A;  2EFO A;  5E18 F;  2UWM A;  5FRO A;  1KYZ A;  1MBH A;  2X1D A;  2A07 F;  5FKN A;  2G0E A;  5LEK A;  4G7Z F;  1LFU P;  1S6L A;  1X1A A;  1SFE A;  3FXK A;  3F8N A;  3ML6 A;  1X1B A;  3ZPL A;  4KT5 C;  2Y48 A;  4QPO A;  1FSH A;  3K2A A;  1FWZ A;  2IA1 A;  2Q0O A;  3PNT A;  4XKV A;  4Q4Z F;  4HW0 A;  4EQQ A;  3O3K A;  1ZKG A;  1MIJ A;  2VQL A;  4LIT A;  4IVN A;  1M1E B;  3U1D A;  3IV5 A;  1IF1 A;  2CV1 A;  2Q8K A;  3WG9 A;  4BE0 A;  1APL C;  1R4M B;  3OMY A;  5IYB J;  3V7R A;  4ZYE A;  4CZZ A;  3FDY A;  2JSP A;  1TZL A;  2E19 A;  2YX4 A;  3DFG A;  4EMS A;  4PGG A;  2MC3 A;  3P9C A;  4IXA A;  2DMP A;  5IT9 K;  1VFC A;  1YJ9 I;  2XIG A;  4RAY A;  5EDN A;  3Q0V A;  2DMQ A;  2HXO A;  2JJ7 A;  1XDU A;  1XG1 A;  1QPM A;  1J7K A;  3F8F A;  2V26 A;  1XC5 A;  2BZT A;  2MLG A;  1JUP A;  4RM3 A;  2GBY A;  4ZYG A;  4WCG A;  1BJZ A;  2G7U A;  1HKT A;  2PLY A;  4J01 A;  4BY7 J;  1DP7 P;  3QQA A;  1HKS A;  1J0R A;  3BTI A;  2DOD A;  5ERI A;  2O03 A;  3RQI A;  3J7Z I;  2QBY A;  1FOK A;  2IS6 A;  2LMD A;  1LDD A;  1X3U A;  2QVO A;  2CQ7 A;  1IG7 A;  3ZRG A;  3GFL A;  3EUA A;  1YS7 A;  2L9S A;  2JZY A;  1BL0 A;  3KIO A;  3MEX A;  4G6D A;  3S3O A;  4X6A J;  4HQE A;  1EV7 A;  2E60 A;  4KIB A;  4LG3 A;  3DPL C;  5E8I A;  2MFZ A;  1SD4 A;  5IP9 J;  2BY3 A;  3BC8 A;  3ZQL A;  1W7P D;  3S93 A;  2P0W A;  2Z99 A;  1MJB A;  3PNY A;  4EGZ A;  4G94 A;  4RLF A;  2OZ6 A;  2PJP A;  1IXR C;  5GAH J;  2M87 A;  3TDZ C;  1UEL B;  3ZR8 X;  2QQ9 A;  2STT A;  1R23 A;  2M8G X;  4DBQ A;  3D5S C;  3OYM A;  2TRT A;  3G1L A;  3HZJ A;  4A3J J;  1BI0 A;  2LOO A;  4A3F J;  3HSF A;  3LNQ A;  2VOP A;  4IRI A;  4A3G J;  1HCR A;  5D5W B;  5GPA A;  5GPC A;  1HC8 A;  5F27 A;  2LDU A;  2ZME A;  4YRV A;  1VQL I;  3T8R A;  5AON A;  1K4S A;  1AOY A;  2NS7 A;  1XMX A;  1YIO A;  1H8A C;  2OUM A;  2EH3 A;  4ZYA A;  2M4G A;  1Z9C A;  4XID A;  1ON2 A;  2JRM A;  1EJ9 A;  1MGT A;  2V9K A;  2VKV A;  3GFI A;  4MHG A;  1ETV A;  3E0J B;  1FBS A;  4M6Y A;  4Y7N J;  2KP6 A;  4HNU A;  2LY1 A;  2EIM H;  2W57 A;  5FKO A;  2XSD C;  3K4L A;  3WTS C;  2E2H J;  3I59 A;  1H88 C;  1XDS A;  2WBM A;  1W1W E;  2Y31 A;  1JKO C;  2E2J J;  5E17 F;  3ZMZ A;  1FY7 A;  1QO0 D;  5HS7 A;  3CCM I;  2BY1 A;  1W36 D;  4MIM A;  1D3Y A;  3MKL A;  2O61 A;  4IO9 F;  1N25 A;  5KK1 A;  4DZP A;  1MNM C;  1TWC J;  1JXS A;  2FOK A;  2M7B A;  1WJE A;  1FOW A;  2WTE A;  2ZKZ A;  3H3U A;  2VI6 A;  1POG A;  4BAC A;  1MJA A;  3H3V K;  4M3G A;  2EQR A;  3PM1 A;  4CYC A;  4FAS D;  2X51 A;  4MNU A;  3J7A Y;  2F5D A;  4HZF A;  3PUF A;  1X4O A;  4BE1 A;  2HVQ A;  2QBY B;  1T6S A;  2DTR A;  3BZ6 A;  3QYF A;  3H0D A;  5J4Y A;  1MDM B;  2XDV A;  2ME6 A;  2EZH A;  1WJC A;  1NHA A;  3K7A J;  2FSW A;  1O3R A;  3RKY A;  3W2W A;  1BR4 A;  5K7Z A;  5F64 A;  1J5Y A;  2XRL A;  1LQ1 A;  3BCB A;  1Z1D A;  1WRJ A;  2LYC A;  4F93 B;  3SFI A;  2KPM A;  1Q1H A;  3ONQ A;  2M4K A;  1ZGA A;  4YFX F;  3OYF A;  4B43 A;  4RB1 A;  5FKK A;  1MBK A;  3SHF A;  4CA0 A;  4XM3 A;  2X6X A;  4U87 A;  4S04 A;  4XON A;  5JHU A;  2JPC A;  3A0H C;  3GEZ A;  2CQX A;  3LQR A;  4LOC A;  4A3D J;  1YO5 C;  3D5L A;  1R6R A;  1PUE E;  3CJQ B;  3LSH A;  2KJB A;  2Z3Y A;  4EJU A;  2PEX A;  2YSR A;  2ICW G;  1JE8 A;  5LEJ A;  3HOZ J;  4RB2 C;  5IT3 A;  3S1R J;  4M72 A;  2QGU A;  3F22 A;  2ADU A;  2R7F A;  1ZRE A;  2IS2 A;  5CVI A;  3PQK A;  2OJE D;  3L1P A;  2E34 A;  3AG4 H;  4FX0 A;  1WZ2 A;  1U5T C;  2QKM B;  1W5T A;  1TT5 B;  5HOO A;  2ZME B;  3FXO A;  3K4M A;  5FGM A;  4UV9 A;  1IN4 A;  2IPQ X;  1RPW A;  4L5I A;  3RJP A;  3SJM A;  3LFK A;  1LVK A;  5CPR B;  1OQY A;  3HSR A;  2MC4 A;  4JQF A;  2LG4 A;  4HV6 A;  2R5Z B;  5HLT A;  1K6O A;  4NC7 A;  2DA2 A;  1U9O A;  3LSR A;  3LSJ A;  2KHM A;  5H20 A;  2KJC A;  2CUZ A;  1XTA A;  2BHZ A;  5CQE A;  5BNG A;  3L00 A;  3LSM A;  2UV1 A;  3TDU C;  2HPM A;  3K69 A;  5LLQ A;  4DW6 A;  1XD7 A;  5DUI A;  3DV8 A;  1E2X A;  2J5O A;  1GXP A;  3ZQI A;  2X6Y A;  3L2V A;  3LL7 A;  2W48 A;  1IGN A;  2RGV A;  4C2U A;  2P7C B;  2QCO A;  1JGS A;  4XSZ F;  5FFX A;  4JYK A;  1NK2 P;  3DXJ F;  2GA2 A;  2L3D A;  3QPS A;  4P5O A;  2ZXI A;  4BBR J;  4AM3 A;  3IH2 A;  5BOX A;  2W84 A;  2EZK A;  2UUZ A;  4E7H A;  4A3L J;  5B66 C;  4Y15 A;  1X58 A;  2KZV A;  3S8P A;  2FBH A;  1YQA A;  2L01 A;  2Y75 A;  3FXM A;  4M74 A;  5CYV A;  5D4R A;  2H1K A;  5DUK A;  3L2Q A;  4BXX J;  4XMY A;  1R36 A;  4XLP F;  1W7P B;  2CFO A;  1Y1V J;  4ZTJ A;  3SZP A;  2V7F A;  1NG6 A;  4RS8 A;  4UXN A;  2P7V B;  4BY1 J;  1JTX A;  1FBQ A;  1S8N A;  4P9F A;  1ACI A;  3VSL A;  1O57 A;  4LB5 A;  3QYE A;  2V9P A;  3CC7 I;  1X2M A;  2IP2 A;  4ZDL A;  4ASN A;  2CUE A;  3EUK L;  4AVP A;  3CF5 F;  3RI4 A;  2IS1 A;  3EDP A;  3FXR A;  3NAU A;  1BOB A;  4F7Z A;  3IRQ A;  4M3D A;  2W82 A;  4RB0 A;  4EM0 B;  3A4C A;  4EJW A;  3UR3 C;  3KP5 A;  1Z05 A;  3Q0W A;  1JKQ C;  2R7Q A;  3S2H J;  1QBJ A;  1F43 A;  4MTD A;  2E7X A;  2V1D A;  3R60 A;  2WB1 N;  3JRC A;  2YS9 A;  2PJR B;  3JTG A;  1P7I A;  2HZT A;  2VBW A;  5AIP A;  3CJR B;  4QPQ A;  2PN6 A;  1T2K A;  4OIP F;  2LY9 A;  3WTT C;  2W24 A;  4KYW A;  1R1V A;  3GCM A;  5EGO B;  2ME0 A;  4BYY A;  1GV5 A;  2X85 A;  1QHH D;  1YFH A;  4JX4 A;  4KIF A;  2ZJP F;  1B72 B;  3EET A;  4C3J J;  2TDX A;  4WXD A;  4ZH4 F;  2QQB A;  4BDZ A;  2LP0 A;  3VYU B;  2NAZ A;  3QRF F;  2KMU A;  1WCM J;  4NC6 A;  1ZR2 A;  3KCC A;  1QVU A;  2LBF A;  4WX9 A;  1QA6 A;  3CQZ J;  3BR0 A;  2M2E A;  1OCC H;  2WV1 A;  3DPU A;  5L3E A;  2KFD A;  3FIS A;  2QEX I;  2EIJ H;  1SD5 A;  2WAQ A;  3KX2 A;  1A31 A;  1ETY A;  5F1J A;  3OOU A;  2V6C A;  1LDJ A;  1IRX A;  1WJD A;  1XMA A;  3ABM H;  3KFW X;  4LIV A;  3N97 A;  1LB2 A;  3AL0 C;  4NHJ A;  4AD9 A;  4KDP A;  2R3S A;  2AQE A;  2HQ5 A;  4I0A A;  2D5V A;  5EG0 A;  4EM1 A;  4KMF A;  1NK3 P;  2DOE A;  2WAF A;  5DD4 A;  1TP4 A;  1G3S A;  2GZW A;  1IAW A;  2VQH A;  4AVZ A;  3O8H A;  3ZMS A;  3NEU A;  2HS5 A;  5BQT A;  1MMS A;  1XGN A;  4DYC A;  2RVC A;  4EEF G;  3CCL I;  1J59 A;  1LE8 A;  3MZY A;  4I2O A;  2XUB A;  1H89 C;  3OWT A;  1SEU A;  2PX9 A;  1HXD A;  4LK0 F;  3KZZ A;  1BOA A;  1U2W A;  2D2W A;  1WH5 A;  5EZG A;  3ULQ B;  3SXY A;  1AA7 A;  2KRC A;  3TGN A;  1DPU A;  1FP1 D;  4JBA A;  1OYI A;  2D1V A;  3ECH A;  2R7O A;  4KT6 A;  2EFW A;  4M6V A;  5ICG A;  3DLL F;  3NWS A;  2XRO A;  1YG2 A;  2B9S A;  2Y0S A;  1R1U A;  1VND A;  3PL8 A;  1BI2 A;  3W2V A;  3QYB A;  4MLO A;  3BTC A;  4HX7 A;  2PMZ N;  1ZG3 A;  3ESW B;  5D6F A;  1UMQ A;  5J40 A;  3F6O A;  2GIV A;  3F8C A;  2CSO A;  5BS6 A;  3JRB A;  1J9I A;  5JI6 A;  3KP2 A;  2NYX A;  1ZR4 A;  1TT0 A;  2JSC A;  2W25 A;  4MFE A;  2XSJ C;  5HDG A;  1FTZ A;  2GIZ A;  2L7F P;  2E1C A;  2R7W A;  4XLF A;  1MMA A;  3C1D A;  4ENK A;  3BOQ A;  1ZAO A;  3BJ6 A;  1QRY A;  2BW3 A;  4XRF A;  1S7A A;  4M71 A;  5F0F A;  3GTQ J;  2ID3 A;  4AYB A;  1IV6 A;  2COB A;  3CUQ B;  3UNG C;  4LMY A;  5GTI C;  2OTJ I;  2RNJ A;  1FNN A;  3ZMT A;  3HC7 A;  4EM2 A;  2NNY A;  1FLI A;  3BPX A;  4X0G A;  2J5P A;  1MSF C;  1LUJ B;  1W5S A;  2P5V A;  5C4J J;  1TTY A;  2F5V A;  4D9J A;  5CVV A;  3RZO J;  3ZQC A;  3C3W A;  3WTU C;  2MG4 A;  1XGM A;  3R0J A;  4C2T A;  2MA3 A;  3HOV J;  3OYB A;  3T0Y A;  2FMY A;  3H5A A;  3LSP A;  3K0L A;  2O6G E;  2XPU A;  3GO5 A;  1B1B A;  3JRD A;  1IO2 A;  1D0Y A;  3BG7 A;  1F9N A;  5M3M J;  1DQU A;  3TOA A;  1NG7 A;  4JK1 X;  1N75 A;  2VBX A;  4BBS J;  3BR1 A;  3QP6 A;  1FP2 A;  4D7N A;  4BJT A;  2Y69 H;  3C2B A;  1K61 A;  1RUN A;  3W6K B;  5GP9 A;  2FBI A;  4J00 A;  5C4X J;  2PMU A;  3FWE A;  2HR3 A;  4HG2 A;  2HU9 A;  1XSX A;  3RYP A;  5GAD J;  3E5Q A;  3OOP A;  4QIW N;  4BE2 A;  4LIU A;  2MSY A;  1IUF A;  4DOZ A;  4D1Q A;  2DMU A;  3SDG A;  2H09 A;  3BZC A;  4E7K A;  2CV2 A;  2IRF G;  4PSX A;  1I39 A;  1V5G A;  2HTJ A;  2DYS H;  2MYS A;  2BEO A;  4CCJ A;  2GOM A;  4KA4 A;  2CFX A;  5FLX K;  4MFD A;  4HOB A;  1Y0N A;  2CO5 A;  4IZZ A;  3CME I;  2EJR A;  4UHT A;  2IW5 A;  2BVL A;  3I64 A;  2DFF A;  4RBO A;  3DWL E;  4OWR B;  2KT0 A;  3CCS I;  2ELK A;  4HBL A;  5ILS A;  3JSO A;  2IGO A;  2O3F A;  3CF2 A;  2KLO A;  3LA3 A;  4WWC A;  1E3P A;  3F9K A;  4A3C J;  3TOB A;  3JAM Z;  2F5E A;  4OAY A;  4XRS A;  2E1M C;  1G8X A;  4B44 A;  4CIC A;  4OOI A;  2X1E A;  5M5W J;  2ESH A;  2M30 A;  3IL2 A;  2VB6 A;  4CUG A;  4D5F A;  4LD5 A;  4Z2Y A;  1RI7 A;  1R4N B;  2GWR A;  3ABT A;  5JR3 A;  3HYI A;  4IEJ A;  2OV7 A;  2EIL H;  2GXG A;  4E4H A;  3KP7 A;  4EJT A;  3LAP A;  3QPH A;  1MNE A;  4PJN A;  2KDZ A;  3OYJ A;  3CCU I;  1X3Z B;  3G4S I;  2VBZ A;  4PJJ A;  3CLO A;  1T0F A;  5E1W A;  1K4T A;  1I5Z A;  3HUG B;  1FPQ A;  2EZI A;  1WFX A;  2FEZ A;  1WKM A;  2L7Z A;  4E70 A;  3R0A A;  1I50 J;  3FHZ A;  3DF8 A;  2VIX A;  2M0M A;  3NWT A;  2GQQ A;  2MH2 A;  4HX8 A;  2P81 A;  1WWX A;  3GTM J;  1RZ4 A;  1XGS A;  2Z33 A;  1CQT A;  5HLH A;  4IQJ A;  1J2X A;  3VPR A;  3X2Q H;  1SC7 A;  3M8J A;  1FZP B;  3PIO F;  1KU3 A;  4KNY A;  1IDZ A;  2K9M A;  2HI3 A;  2LRE A;  2F2E A;  5FKM A;  2DXI A;  1ZG1 A;  2FNA A;  1V5E A;  5D8L B;  3CCY A;  4Z6Y A;  4U7B A;  2DN0 A;  4O5V A;  4RGU A;  1LNW A;  2QWW A;  4YIR X;  2ZXJ A;  1ZG5 A;  1G59 A;  2PJR A;  1USS A;  1YS6 A;  1BW6 A;  3CMY A;  2CW7 A;  3V42 A;  5IY5 H;  4I0B A;  4RLQ A;  5DD8 A;  2IS4 A;  3GX4 X;  5FJ8 J;  3BQZ A;  3BTL A;  2EIK H;  3OYL A;  4PFO A;  5AIQ A;  1A36 A;  3KP6 A;  4HA8 A;  2EK5 A;  3VYT B;  2EV5 A;  1Z91 A;  2IGK A;  2FA5 A;  4C30 A;  2NVU B;  3GYH X;  2R0Q C;  2K02 A;  1RRJ A;  3K1N A;  2HNH A;  4FE7 A;  4MEY F;  3L7W A;  3QOD A;  1Y39 A;  5D6E A;  2WAE A;  4RAF A;  4XBF A;  5M3F J;  4BQA A;  2DT6 A;  4V2G A;  3ZGK A;  3MZH A;  3B02 A;  3RKQ A;  1XB4 A;  2CQQ A;  4CYC B;  4PJL A;  2DJI A;  4ZYD A;  3E6C C;  1G3Y A;  2E1O A;  3L2U A;  4KJZ A;  1OR7 C;  1ETQ A;  5A2Q Z;  1QQI A;  1I3A A;  3D5R C;  2MAB A;  2NXN B;  5BPD A;  4YEL A;  2ZJ2 A;  1I6H J;  4RMN A;  4OIR F;  3BZK A;  5K5R A;  5B1B H;  3CC4 I;  1CF7 B;  3ISP A;  3ZQ7 A;  1BW5 A;  5F08 A;  3D1N I;  2P6S A;  3E1S A;  1IN8 A;  3CCE I;  2QZ8 A;  5E3O A;  2B0L A;  2DA7 A;  2XC7 A;  2B7E A;  3BRO A;  5EEH A;  3I4M J;  2L7K A;  5LGT A;  5E79 C;  3VB2 A;  1K79 A;  2RAE A;  1D8K A;  4AIH A;  3BR2 A;  4MQ9 F;  4CXF A;  4MGR A;  2KL4 A;  5L3G A;  4HRI A;  2XV4 S;  2A61 A;  2K9Q A;  3GTO J;  4A0Z A;  2V4J C;  3H9J A;  2P6T A;  4UUV A;  2ZBK A; 
#chains in the Genus database with same CATH homology
 2DT5 A;  3E3V A;  2A6H F;  1PP7 U;  4HDV A;  1P2F A;  3R61 A;  3EYY A;  4ESB A;  3RKX A;  3P7N A;  1SD6 A;  1D5V A;  1BIA A;  5K5Q A;  4FT8 A;  3BJO A;  4YFN F;  3PFI A;  2GA1 A;  4WXH A;  2EV6 A;  5FB2 A;  3P9I A;  1IXC A;  2ELH A;  2IVM A;  4G6Q A;  4RGS A;  1FSE A;  2XKP A;  4HF1 A;  5L3C A;  5E1Z B;  4YG2 F;  3M1E A;  1UHM A;  3E5X A;  2V9V A;  2HFH A;  3BJA A;  4ESF A;  2Q2E A;  1ZGJ A;  2H6B A;  2HGC A;  1Z6T A;  4EV0 A;  4YII A;  3U9G A;  1H9G A;  1KA8 A;  4ENN A;  4ZYH A;  3FF5 A;  2ZNY A;  2LF8 A;  1YTY A;  1UCR A;  3WTV C;  4UNO A;  4R79 A;  4LK1 F;  1GXQ A;  3Q9V A;  2FE3 A;  3AAF A;  2EFQ A;  1BJA A;  1QNT A;  1W7P A;  2XAS A;  5TJJ A;  3V7S A;  2V1U A;  4UVC A;  3SQN A;  3HIF A;  3M9A A;  2K4B A;  3QP5 A;  2M1B A;  3ZP5 A;  3WTX C;  2VT2 A;  2OA4 A;  3VOE A;  2XAG A;  3GWZ A;  3MAJ A;  1ZLK A;  4ZZD A;  4G7O F;  2DAO A;  1YW8 A;  4GCV A;  2A69 F;  4Q5S F;  3WE2 A;  3F6V A;  2P5L C;  4YFK F;  2EB7 A;  4UVB A;  1LVA A;  4ETS A;  1B6A A;  4HLY A;  2KKO A;  1BI1 A;  3OV8 A;  2VOO A;  1ZYR F;  3TO7 A;  5CVR A;  4LG0 A;  4HF0 A;  4IPA A;  2RDP A;  1SFU A;  5ILU A;  5LGN A;  2H6C A;  1SMY F;  3QU3 A;  4EJV A;  4BH9 A;  3I0T A;  3E6M A;  2HYG D;  3KP3 A;  5J6X A;  2A6E F;  3C7J A;  4CGZ A;  3M7G A;  1MDM A;  2M5W A;  3I53 A;  4M9X A;  1MJ9 A;  1EH6 A;  2EA4 A;  4PCQ A;  2EWN A;  1XMK A;  2JRT A;  3GXO A;  4WF2 A;  2K27 A;  1OKR A;  1B9N A;  4GYI A;  1Z6R A;  4ENJ A;  2K86 A;  3MCZ A;  4D0P A;  1ZH5 A;  1IZ1 A;  2PQ8 A;  3GW2 A;  4ENM A;  2LF7 A;  2VON A;  4BXU A;  4IJA A;  1TNT A;  2M8E A;  4B8X A;  1KQ0 A;  4DQ2 A;  3FMR A;  3LA2 A;  1IW7 F;  4N9I A;  4UV8 A;  3GZ6 A;  1EH8 A;  2PBI A;  3PQJ A;  3GF2 A;  2R7D A;  3TO6 A;  4GYG A;  2D45 A;  3HTS B;  5L3B A;  3F72 A;  1YW7 A;  4R1H A;  3IRR A;  1U78 A;  3CUQ A;  1T39 A;  1XCB A;  1TNS A;  1TQP A;  5FD5 A;  1RUO A;  2CW0 F;  3LQQ A;  4HV5 A;  4HYE A;  3FM3 A;  1Z7U A;  4KN4 X;  2MH9 A;  3HRS A;  4U0W A;  5K5O A;  4QWQ A;  4IRH A;  1U8R A;  2JTV A;  2XAF A;  2YU3 A;  3JTH A;  4A0Y A;  4TV7 A;  3M8F A;  1C0W A;  3K2Z A;  2FU4 A;  1OPC A;  3KLN A;  1F5T A;  1FC3 A;  1R1T A;  4HQM A;  1K78 A;  3CJN A;  1OYW A;  5D5V B;  4L9T A;  1BM9 A;  4RB3 C;  2KRF A;  4RAZ A;  5DDG A;  3RPQ A;  3DKW A;  5CLS A;  1ZRF A;  2DQR A;  3NQO A;  3IKV A;  3RIR A;  2PG4 A;  1U3E M;  2LSO A;  2QM3 A;  3F23 A;  2OBP A;  1LEB A;  2LKP A;  2PI0 A;  1DPR A;  3I5U A;  3KEQ A;  3L9F A;  1ON1 A;  2F5C A;  3GFJ A;  2HWV A;  4Q48 A;  1HW1 A;  1R58 A;  5HDK A;  5F6F A;  1B9M A;  1DUX C;  4BAY A;  3BP8 A;  2P8T A;  5DEQ A;  4L9J A;  2K4J A;  2M45 A;  1RIO H;  1A04 A;  4I7H A;  2RV8 A;  1ONV A;  4OMZ A;  2DI3 A;  3EUH A;  3WTZ A;  1KU7 A;  1JHH A;  1O7F A;  1HQC A;  2L02 A;  1WQ2 A;  2IJL A;  4BHC A;  5ILV A;  1EH7 A;  5CVJ A;  1OR7 A;  2H94 A;  2VBY A;  3KZY A;  2BBY A;  3KP4 A;  3P9K A;  2ISZ A;  3M8E A;  1RNL A;  3HOT A;  2A68 F;  3B73 A;  4OMY A;  1G3W A;  2DFI A;  1F1Z A;  1REP C;  4ESJ A;  5E1X A;  3IC7 A;  3V8J A;  5CVU A;  5F1R A;  3I4P A;  3H92 A;  3HHG A;  2FXA A;  2FF4 A;  1CF7 A;  3ZMD A;  4LFU A;  1I1S A;  3ZMV A;  4U88 A;  2OAZ A;  5BPI A;  3FM5 A;  4U7D A;  3RKW A;  2XVC A;  2DK8 A;  3HRT A;  1IRG A;  4NB5 A;  1IN7 A;  2HOE A;  3O2P E;  4HLX A;  3V7C A;  3F8B A;  2L54 A;  2WV0 A;  3TO9 A;  3ABU A;  2O8X A;  3J80 K;  1E17 A;  1LEA A;  2PMH A;  4I01 A;  2OU2 A;  2ZNZ A;  5J8C A;  2ETH A;  4XSX F;  3ECO A;  3ZN1 A;  4N9H A;  4AIJ A;  5HS9 A;  4KIG A;  1XN7 A;  2HQR A;  1OMI A;  2JPB A;  2DLL A;  1H9T A;  4KN7 X;  2QQA A;  5E8G A;  2DU9 A;  4IRG A;  5EEG A;  1R7J A;  1HW2 A;  2VXZ A;  5DCF A;  3T5X A;  4CO8 A;  2VT3 A;  1GVJ A;  1R22 A;  1UFM A;  1FYL A;  2QUF A;  1MZB A;  2COM A;  3FX3 A;  4BHB A;  1SAX A;  2FQ3 A;  2L4M A;  3JAM K;  3GFM A;  4UVA A;  4AWX B;  5FD6 A;  4CHU A;  4NQW A;  1P92 A;  5FO5 A;  4GXO A;  2XRN A;  2AXL A;  4WXC A;  4I09 A;  2G7H A;  2A3S A;  4LJZ F;  4K2E A;  1FT9 A;  4U0Y A;  5HLI A;  4IF4 A;  5H6Q A;  5HS8 A;  1PP8 F;  1U6G A;  4P9U A;  3I54 A;  1XCV A;  1G4D A;  2DO7 A;  2DK5 A;  1MKM A;  2C6Y A;  3RYR A;  4H0E A;  2X4H A;  3S2W A;  4EVI A;  1BN5 A;  2FNP A;  2UXN A;  3Q5F A;  3FXQ A;  3R4K A;  1ZLJ A;  5DV5 A;  2EV0 A;  4Y13 A;  3J81 K;  3ZMU A;  2DPU A;  5A2Q K;  3IWF A;  3LA7 A;  1S3J A;  3T8T A;  3HRU A;  3GUD A;  3BPV A;  3FMS A;  2DW4 A;  1L0O C;  3D0S A;  3G3Z A;  3CTA A;  4RGX A;  2ZO4 A;  4M73 A;  3HRM A;  1QZZ A;  2KIF A;  2HQN A;  2Y0M A;  1I27 A;  1I1G A;  4WK8 F;  2AS5 F;  2X0L A;  3CO6 C;  3VOD A;  2H27 A;  3QOP A;  4P55 A;  5KVR A;  4HF2 A;  3KLO A;  4Y17 A;  3SFZ A;  5BMZ A;  1T98 A;  3BWG A;  2QYO A;  2GXB A;  3N4M A;  5JFR A;  2UZK A;  1Y0U A;  1O7L A;  2RC4 A;  1GHC A;  4KIC A;  3RPU A;  2WC2 A;  3CDH A;  2HDC A;  1R5G A;  3E97 A;  4XLN F;  2VOD A;  3EYI A;  3K1P A;  1O3S A;  2E7W A;  3FXU A;  3MWM A;  2Z5U A;  2HEO A;  4PZJ A;  3T1B A;  2GAU A;  5LBQ A;  5E20 A;  3LWF A;  1T38 A;  1CGP A;  1KYW A;  1P4W A;  2BGC A;  1HBX G;  2O0Y A;  2PFB A;  3IHU A;  4S05 A;  2DPD A;  3COA C;  4A5M A;  2W85 A;  2P4W A;  3HUG A;  1FYM A;  4M6X A;  3HTU A;  1ZRD A;  3L09 A;  1SFX A;  3WU0 A;  3J7A O;  1HKQ A;  1V4R A;  3REO A;  3DP7 A;  1ZN2 A;  2VE9 A;  2P5K A;  2KIM A;  3F8M A;  3I71 A;  1ODD A;  3WE3 A;  3JW4 A;  4L9V A;  4OIO F;  1YYV A;  1TW3 A;  3KE2 A;  1ULY A;  3HOS A;  4EGY A;  1QGP A;  2CQK A;  2VN2 A;  3QPT A;  2A5Y B;  4L9N A;  4L0Z B;  2BYV E;  2L4A A;  2ZFW A;  1O3Q A;  1SMT A;  2MBF A;  4O6J A;  4P96 A;  3J81 Z;  2HKX A;  3ZN0 A;  3K1M A;  5ICF A;  5TRD A;  2VC0 A;  2YPR A;  4PDK A;  1R00 A;  2HKO A;  4A6D A;  4G9Y A;  5ICE A;  4L0Y B;  4IHS A;  4BNC A;  4ON0 A;  4LLL A;  3FZV A;  2WWY A;  2NS0 A;  2K7L A;  3RDI A;  1LDK B;  4HDU A;  3QAH A;  1BC8 C;  4FX4 A;  1O3T A;  3ERE D;  3R6S A;  2NNN A;  3DPT A;  4LG0 B;  3SZT A;  1ZAR A;  1UST A;  2JT1 A;  3F21 A;  2BE5 F;  6PAX A;  1J75 A;  5J8F A;  3CUQ C;  1XSV A;  5LRS A;  5H6R A;  2CG4 A;  2QEN A;  3WU1 B;  4MQV A;  2VE8 A;  2CGP A;  4A6E A;  5LGU A;  1U5T B;  1BC7 C;  4QLC U;  2MD5 A;  2OD5 A;  4A5N A;  1MD0 A;  3Q9S A;  1UHW A;  2XAJ A;  3H3Z A;  3CUO A;  4U0V A;  2STW A;  5K1Y A;  2IA2 A;  1L3L A;  3WGH A;  3QU6 A;  2XGX A;  4GO1 A;  1P4A A;  1G3T A;  1OYY A;  2YX7 A;  3C18 A;  4G8X A;  3ELK A;  4DNC A;  5D4S A;  2LNB A;  1IRF A;  3VFZ A;  1YLF A;  3KEO A;  4LB6 B;  4FHT A;  1IN5 A;  4CYD A;  2F5F A;  5ICC A;  3JSP A;  1B4A A;  1BIB A;  1QZY A;  3BDD A;  5CJ9 A;  4HAM A;  5ED4 A;  1WI9 A;  1VTN C;  3WTW C;  3LAJ A;  2RN7 A;  2VC1 A;  3W6J B;  5D5U B;  2IA0 A;  2OQR A;  2EA2 A;  2ACJ A;  3WGG A;  4Q47 A;  4LLN A;  2YR2 A;  4R8H A;  4A0X A;  1WSU A;  5D5X B;  3HHH A;  2Z9O A;  1TLH B;  1I6X A;  2RKH A;  3MQ0 A;  5DCM B;  2FML A;  3IKT A;  3F3X A;  3DEU A;  3WOD F;  4BHP A;  4OIQ F;  2IT0 A;  1TQM A;  1KQ8 A;  1IN6 A;  5HDN A;  1XGO A;  5FLX Z;  4PGH A;  4MTE A;  2CYY A;  1K78 B;  1YW9 A;  2ESN A;  2OQG A;  1S7O A;  3GVA A;  4B09 A;  1STZ A;  2XKO A;  1K7A A;  5L3F A;  2OZU A;  2XAH A;  1TW2 A;  3GZ5 A;  1KU9 A;  1P6R A;  1DDN A;  4CDG A;  3I59 B;  1FX7 A;  1IUY A;  1G6N A;  2BV6 A;  5LRR A;  3ROU A;  3WTY C;  4LLG F;  4G7H F;  2FBK A;  5LHH A;  1HST A;  2XAQ A;  1HW5 A;  2QLZ A;  3TQN A;  1D8J A;  3EQL F;  4YIF A;  4OIN F;  1KGS A;  2E1N A;  1H0M A;  3V4G A;  1FYK A;  4A2U A;  3L2C A;  3G73 A;  4L18 B;  1KQ9 A;  3TKY A;  4HX4 A;  5IT9 Z;  5DCM A;  2MLK A;  4EJO A;  1UB9 A;  3IWZ A;  4O3M A;  3GLX A;  3DQV C;  1PDN C;  3I58 A;  3MFK A;  1ZHF A;  4I98 B;  2V79 A;  4M9S A;  5HVQ C;  4KMU X;  2NRA C;  3E5U A;  3U2R A;  1AWC A;  5D8K B;  1HSJ A;  1KU2 A;  4AIK A;  4I02 A;  3KET A;  2KIU A;  5LHG A;  5FFZ A;  1R5H A;  5HLG A;  2HYF A;  1XSD A;  1U5T A;  4KFC A;  2ISY A;  1P4X A;  3RTR A;  2V1X A;  5LHI A;  4IHT A;  1TQI A;  2CWE A;  4N0B A;  1LJ9 A;  2D1H A;  3V8K A;  2XHK A;  1W4M A;  3E6D A;  3K9T A;  2RQP A;  4M9Z A;  3J80 Z;  1JHF A;  4KUM A;  2DQL A;  3HSE A;  2FRH A;  4A12 A;  3O6B B;  4L5J A;  3CO7 C;  1SD7 A;  2EFP A;  3FMQ A;  1FBU A;  5DYM A;  4MEX F;  2HTS A;  2EFN A;  4OU0 A;  3VEP A;  2ZCW A;  4GGG A;  1BBY A;  1ZRC A;  2G9W A;  3BY6 A;  1F4K A;  4RGR A;  1B59 A;  1IXS B;  3NRV A;  1TBX A;  3WGI A;  1S29 A;  3LST A;  5L3D A;  1BI3 A;  2UXX A;  4LGW A;  4ZZL A;  1V3F A;  3E6B A;  3V8L A;  5JVT A;  2DBB A;  2EFO A;  5E18 F;  2UWM A;  1KYZ A;  2A07 F;  5LEK A;  4G7Z F;  1S6L A;  1SFE A;  3F8N A;  3ML6 A;  3ZPL A;  4KT5 C;  2Y48 A;  1FSH A;  1FWZ A;  2IA1 A;  2Q0O A;  4Q4Z F;  4HW0 A;  4EQQ A;  3O3K A;  4IVN A;  3U1D A;  1IF1 A;  2Q8K A;  3WG9 A;  3V7R A;  4ZYE A;  4CZZ A;  2YX4 A;  3DFG A;  4EMS A;  4PGG A;  2MC3 A;  3P9C A;  4IXA A;  5IT9 K;  2XIG A;  4RAY A;  1XDU A;  1QPM A;  1J7K A;  3F8F A;  2MLG A;  4ZYG A;  4WCG A;  1HKT A;  2G7U A;  2PLY A;  1DP7 P;  1HKS A;  1J0R A;  5ERI A;  2QBY A;  2O03 A;  1FOK A;  1LDD A;  1X3U A;  2QVO A;  3GFL A;  1YS7 A;  2JZY A;  3MEX A;  4G6D A;  4HQE A;  1EV7 A;  4KIB A;  3DPL C;  5E8I A;  1SD4 A;  1W7P D;  2Z99 A;  1MJB A;  4EGZ A;  4G94 A;  2PJP A;  2OZ6 A;  1IXR C;  2M87 A;  3TDZ C;  2STT A;  2QQ9 A;  1R23 A;  1BI0 A;  3HSF A;  2VOP A;  4IRI A;  5D5W B;  2LDU A;  2ZME A;  3T8R A;  5AON A;  1AOY A;  1YIO A;  1Z9C A;  1ON2 A;  1MGT A;  3GFI A;  4MHG A;  1FBS A;  4M6Y A;  2W57 A;  3WTS C;  5E17 F;  3I59 A;  1XDS A;  3ZMZ A;  1FY7 A;  1QO0 D;  5HS7 A;  1D3Y A;  2O61 A;  5KK1 A;  1JXS A;  2FOK A;  2ZKZ A;  2WTE A;  3H3U A;  1MJA A;  4MNU A;  2F5D A;  4HZF A;  2QBY B;  1T6S A;  2DTR A;  3BZ6 A;  1MDM B;  1NHA A;  2FSW A;  1O3R A;  3RKY A;  5F64 A;  1J5Y A;  1LQ1 A;  1Z1D A;  1WRJ A;  1Q1H A;  4YFX F;  1ZGA A;  4RB1 A;  3SHF A;  4S04 A;  5JHU A;  2JPC A;  3GEZ A;  3LQR A;  1YO5 C;  3D5L A;  1PUE E;  2KJB A;  2Z3Y A;  4EJU A;  2PEX A;  2YSR A;  1JE8 A;  5LEJ A;  4RB2 C;  5IT3 A;  4M72 A;  3F22 A;  2ADU A;  2R7F A;  1ZRE A;  5CVI A;  3PQK A;  4FX0 A;  1U5T C;  1W5T A;  5HOO A;  2ZME B;  5FGM A;  4UV9 A;  1IN4 A;  2IPQ X;  4L5I A;  3RJP A;  3LFK A;  3HSR A;  4JQF A;  4HV6 A;  1K6O A;  5H20 A;  2KJC A;  3L00 A;  3TDU C;  3K69 A;  5LLQ A;  1XD7 A;  5DUI A;  3DV8 A;  1E2X A;  2J5O A;  1GXP A;  2RGV A;  2P7C B;  1JGS A;  4XSZ F;  5FFX A;  3DXJ F;  2GA2 A;  2L3D A;  4P5O A;  5BOX A;  2W84 A;  4Y15 A;  2FBH A;  1YQA A;  2L01 A;  2Y75 A;  4M74 A;  5CYV A;  5D4R A;  5DUK A;  1R36 A;  4XLP F;  1W7P B;  3SZP A;  4RS8 A;  4UXN A;  2P7V B;  1FBQ A;  1S8N A;  4P9F A;  1O57 A;  4LB5 A;  2IP2 A;  4ASN A;  4AVP A;  3RI4 A;  3EDP A;  3FXR A;  4F7Z A;  3IRQ A;  4RB0 A;  4EM0 B;  4EJW A;  3KP5 A;  1Z05 A;  1QBJ A;  4MTD A;  2E7X A;  2V1D A;  3R60 A;  3JTG A;  2HZT A;  2VBW A;  5AIP A;  1T2K A;  2PN6 A;  4OIP F;  3WTT C;  2W24 A;  4KYW A;  1R1V A;  4BYY A;  1YFH A;  4KIF A;  3EET A;  2TDX A;  4WXD A;  4ZH4 F;  2QQB A;  2NAZ A;  3QRF F;  3KCC A;  4WX9 A;  5L3E A;  1SD5 A;  2V6C A;  1LDJ A;  3N97 A;  1XMA A;  1LB2 A;  3KFW X;  4NHJ A;  4AD9 A;  4KDP A;  2R3S A;  4I0A A;  4KMF A;  4EM1 A;  5DD4 A;  1G3S A;  2GZW A;  1IAW A;  3ZMS A;  3NEU A;  2HS5 A;  5BQT A;  1XGN A;  2RVC A;  1J59 A;  4I2O A;  3MZY A;  2XUB A;  1HXD A;  4LK0 F;  3KZZ A;  1BOA A;  1U2W A;  2D2W A;  3ULQ B;  3SXY A;  3TGN A;  1DPU A;  1FP1 D;  4JBA A;  1OYI A;  2D1V A;  3ECH A;  2EFW A;  5ICG A;  2XRO A;  1YG2 A;  1R1U A;  1BI2 A;  4HX7 A;  1ZG3 A;  5D6F A;  3F6O A;  2GIV A;  3F8C A;  2CSO A;  5BS6 A;  1J9I A;  5JI6 A;  3KP2 A;  2NYX A;  2JSC A;  2W25 A;  5HDG A;  2E1C A;  3C1D A;  4ENK A;  3BOQ A;  1ZAO A;  3BJ6 A;  4XRF A;  1S7A A;  4M71 A;  3CUQ B;  4LMY A;  2RNJ A;  1FNN A;  3ZMT A;  4EM2 A;  2NNY A;  1FLI A;  3BPX A;  2J5P A;  1W5S A;  2P5V A;  1TTY A;  5CVV A;  3C3W A;  3WTU C;  3R0J A;  1XGM A;  2MA3 A;  3T0Y A;  2FMY A;  2O6G E;  3K0L A;  3GO5 A;  1B1B A;  1F9N A;  3TOA A;  4JK1 X;  2VBX A;  3QP6 A;  1FP2 A;  1RUN A;  3W6K B;  2FBI A;  2PMU A;  3RYP A;  2HR3 A;  3FWE A;  1XSX A;  3E5Q A;  3OOP A;  2H09 A;  2IRF G;  2HTJ A;  2BEO A;  4KA4 A;  2CFX A;  5FLX K;  4HOB A;  2CO5 A;  2EJR A;  4UHT A;  2IW5 A;  3I64 A;  4HBL A;  5ILS A;  3JSO A;  2O3F A;  3LA3 A;  4WWC A;  3TOB A;  3JAM Z;  2F5E A;  4CIC A;  4OOI A;  2ESH A;  2M30 A;  3IL2 A;  4LD5 A;  4Z2Y A;  1RI7 A;  2GWR A;  3ABT A;  5JR3 A;  3HYI A;  2GXG A;  3KP7 A;  4EJT A;  3LAP A;  3QPH A;  2VBZ A;  3CLO A;  1T0F A;  5E1W A;  1I5Z A;  1FPQ A;  2FEZ A;  1WKM A;  4E70 A;  3R0A A;  3FHZ A;  3DF8 A;  2GQQ A;  2MH2 A;  4HX8 A;  1WWX A;  1RZ4 A;  1XGS A;  2Z33 A;  5HLH A;  1J2X A;  1FZP B;  1KU3 A;  4KNY A;  2F2E A;  1ZG1 A;  2FNA A;  5D8L B;  4U7B A;  4RGU A;  4O5V A;  1ZG5 A;  1LNW A;  2QWW A;  2ZXJ A;  1USS A;  1YS6 A;  4I0B A;  5DD8 A;  3GX4 X;  5AIQ A;  3KP6 A;  4HA8 A;  2EK5 A;  2EV5 A;  1Z91 A;  2FA5 A;  3GYH X;  2K02 A;  3K1N A;  4MEY F;  3L7W A;  5D6E A;  4XBF A;  4BQA A;  3MZH A;  3B02 A;  1XB4 A;  4ZYD A;  3E6C C;  1G3Y A;  5A2Q Z;  1QQI A;  5BPD A;  2ZJ2 A;  4OIR F;  5K5R A;  1CF7 B;  3ISP A;  3ZQ7 A;  2P6S A;  1IN8 A;  2QZ8 A;  2B0L A;  3BRO A;  5EEH A;  5LGT A;  3VB2 A;  1K79 A;  1D8K A;  4AIH A;  4MQ9 F;  4CXF A;  4MGR A;  5L3G A;  2XV4 S;  2A61 A;  4A0Z A;  2P6T A;  4UUV A;  2ZBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...