5HLIA

Structure of disulfide formed abfr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
149
structure length
146
Chain Sequence
QSNMKQEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLPDTTEYDETKYVFEELEQTLKHLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
molecule keywords MarR family transcriptional regulator
total genus 55
structure length 146
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hliA00
2A6HF 3GZ5A 5DYMA 1FYLA 5DEQA 2XHKA 1Z91A 1O3RA 2OQRA 1PP7U 1Z1DA 1IN5A 1H0MA 5LEKA 2A07F 3KP5A 1IF1A 4I7HA 5L3CA 2ZO4A 2X0LA 5BQTA 4HF2A 1FBQA 4UHTA 3NRVA 2HDCA 1I6XA 2H6CA 4RAZA 1IN4A 3JTHA 3D5LA 2IPQX 2F5DA 2VXZA 4HOBA 5TJJA 1MDMB 4Y13A 1XSVA 4U7DA 5ILVA 5HVQC 2Z3YA 2VE9A 4CZZA 5EEGA 1KYWA 2NNNA 3Q5FA 3TOBA 2HQRA 1ZAOA 3CUQA 3V7SA 4F7ZA 2HOEA 4KFCA 3WTSC 3KP3A 2FSWA 3GWZA 3CUOA 3HHGA 1H9GA 1YO5C 3K1NA 4N9HA 2W24A 3E3VA 2CYYA 2O0YA 4JQFA 1DP7P 3K0LA 4WXCA 3JAMK 4XBFA 4P9FA 3ZMTA 4ZYDA 5JFRA 3CJNA 2FBHA 1IRGA 1YQAA 4KMFA 3CTAA 2M45A 5CYVA 4AD9A 1G3SA 2W84A 3TGNA 1FP1D 4UVCA 1B1BA 5D5VB 4U0WA 1ZH5A 1IN6A 4HX7A 2EK5A 1MJAA 3BPVA 5BPDA 3R6SA 2EWNA 4A6DA 3CO6C 4LK0F 4P96A 4ENMA 3ELKA 3I0TA 2IA0A 3CUQC 4EGYA 1XCBA 2E7XA 3WU1B 3QRFF 4ZYGA 2XKPA 4KNYA 4ZYHA 3KP7A 4MNUA 4TV7A 5HS7A 4EGZA 2P7CB 2XROA 1WSUA 1O3SA 2M8EA 2F5EA 3MCZA 3AAFA 4IHTA 2RNJA 4MQVA 2RQPA 1ZARA 2LF8A 2DK5A 2QYOA 4IVNA 2YX7A 4HA8A 3WTZA 5D8LB 3G73A 1H9TA 1YFHA 2JT1A 5ICGA 2WV0A 1SFXA 3DFGA 5D8KB 1C0WA 3QP6A 4M6YA 3DP7A 3IWFA 5H6RA 2CO5A 1D8KA 2CQKA 1HW1A 5E17F 5LGUA 5LEJA 2EV5A 2E1NA 4I0BA 2DU9A 5JI6A 2H94A 4UNOA 5HDGA 5K1YA 4UUVA 3ECOA 2P6SA 2OQGA 4B8XA 2A5YB 1B59A 3ZPLA 5LRRA 4MGRA 3V8JA 1HW5A 1XB4A 3CUQB 1U6GA 5LBQA 4LGWA 2NAZA 2O8XA 3PQJA 3E6BA 1Z7UA 1ZRDA 3F8MA 3BZ6A 1ODDA 3V4GA 1KU3A 2P5VA 3FMRA 1HSTA 2PBIA 2XVCA 5DD8A 1LDKB 4L9JA 4QWQA 3BJAA 2QWWA 3F3XA 3T5XA 4Y15A 1O7LA 2FOKA 4CGZA 3F8FA 2ESHA 2A69F 3PQKA 1MDMA 2RDPA 3O2PE 4LLNA 4OINF 1W7PA 2V79A 2C6YA 4EJUA 2LKPA 2QENA 3N4MA 3KP4A 1TLHB 2L3DA 4LJZF 3HTUA 2F5FA 2HS5A 2VBYA 4GXOA 5F64A 3TQNA 2DI3A 1RNLA 1ZRCA 2BYVE 2VOOA 5ERIA 3L7WA 2GXBA 4RGUA 4O3MA 4HV6A 3RPUA 5CLSA 5JHUA 3WTTC 4XLPF 3HUGA 2UXXA 1T38A 1YYVA 1K6OA 4MTEA 3WTVC 3K1MA 3GFLA 4UVAA 1WRJA 3TO9A 1SFUA 3T1BA 1IRFA 4HZFA 3I54A 4LG0A 5FGMA 3Q9SA 1TNSA 1IXCA 2GWRA 5CJ9A 3VODA 2FQ3A 3RIRA 3FX3A 2M5WA 3FM3A 2L4MA 3VEPA 5J6XA 4KN7X 2FEZA 5HDKA 5A2QZ 1YW9A 3I59A 3I64A 4IPAA 2PLYA 3MZYA 4UXNA 4Q5SF 4RAYA 1J9IA 3FXQA 1V3FA 2XUBA 2JPCA 1UHWA 2PEXA 4ESBA 3BWGA 3KZYA 3F23A 1RUOA 1FP2A 4ENKA 4A5NA 4ETSA 1G3WA 4OOIA 4EM1A 1QGPA 1JE8A 1R23A 2VN2A 4UV8A 4CHUA 3FXRA 3M1EA 4L0YB 4MEYF 2D2WA 1SD4A 2RKHA 4PZJA 2YPRA 1R5GA 5H20A 1OR7A 2DW4A 1KQ8A 4Z2YA 5HLHA 1JXSA 2GA1A 5DCMA 2XRNA 4HDUA 2MH2A 1FSHA 2KIUA 1AOYA 3EETA 2QQBA 3S2WA 5J8FA 2EA4A 1BI1A 1I1SA 4R8HA 3ERED 4R79A 1G6NA 4FT8A 1D8JA 3MQ0A 5JVTA 4CDGA 1STZA 3KLOA 2MBFA 5E1XA 5D4RA 2A6EF 2PJPA 1IW7F 1TQPA 1FX7A 4ZYEA 2OU2A 3IKVA 1MJBA 3VOEA 3GVAA 3LAJA 1TBXA 4ON0A 2E1CA 3TO6A 2L02A 5E20A 4G7OF 3DPTA 2Q2EA 1F1ZA 2IJLA 3T0YA 1BM9A 5E18F 1DDNA 3P9IA 3V7CA 1GVJA 2V6CA 2FBKA 2QBYA 2H09A 3HTSB 2IVMA 1XGMA 2V9VA 3HOTA 2ELHA 1DUXC 5LHHA 1R22A 3GFIA 3T8RA 5ICFA 3QU6A 4WF2A 2V1XA 3COAC 2XAGA 1XSXA 1HQCA 2FMYA 2BBYA 2KJBA 3JW4A 1O3TA 1KU2A 1OYWA 3I53A 2ZNZA 1UCRA 4HF0A 2M1BA 2ZMEB 3VB2A 3R4KA 4O6JA 3L2CA 4L9TA 1ZG1A 4OMZA 4EM0B 3CO7C 3ML6A 4E70A 3F6VA 1USSA 1U3EM 2P6TA 5L3DA 3WGGA 4U0VA 5DV5A 1ON2A 3EDPA 1B9MA 2K02A 1R1VA 3QU3A 4LLLA 3F6OA 5D6FA 5DDGA 4S05A 1I1GA 4IRGA 5FD5A 3H92A 3FXUA 2MC3A 2JSCA 1EH8A 4A0ZA 4NB5A 4L9NA 1ULYA 2RC4A 1YLFA 3LA7A 1R1TA 5ICEA 1HKTA 2K86A 1OKRA 4IJAA 2HYGD 3RKXA 3QP5A 4D0PA 4ESJA 3E5XA 2CSOA 1K78B 2DLLA 2VBWA 1FYMA 2PI0A 4A0YA 2ZMEA 2OA4A 2R3SA 2G9WA 5FB2A 4BHCA 1BI3A 1K78A 1XDUA 2OD5A 5FLXZ 1O57A 2HGCA 1IZ1A 3RDIA 5HLGA 3M8EA 4A6EA 1P4WA 1LJ9A 3LA3A 3WE3A 3J81K 1ZG5A 1TTYA 3B02A 3TOAA 4ESFA 1PUEE 3KP6A 2L01A 1R7JA 2DTRA 1J2XA 4RB2C 3RJPA 4N9IA 4KN4X 3EYYA 4HLYA 2PG4A 5L3FA 1U5TA 2EJRA 2DQRA 3FHZA 3CDHA 2XAFA 3K9TA 5D5UB 4M72A 1YIOA 3TDUC 2YSRA 4IHSA 1R58A 2FMLA 3GW2A 3P9CA 4L0ZB 2XGXA 2ADUA 1CF7B 1RIOH 4AIJA 1KU7A 3C1DA 2HEOA 3PFIA 2MH9A 1U2WA 3E5UA 3ULQB 3EUHA 1Z6RA 4HW0A 3SZTA 4KIFA 4KYWA 3R0JA 4RS8A 1PDNC 3QPTA 4HBLA 4WX9A 4HF1A 5IT9Z 5E8IA 4MQ9F 1HKSA 4YFXF 1LEBA 2DK8A 2VONA 2IW5A 3FWEA 4MHGA 1L0OC 1YS6A 2P8TA 5D5WB 4ZH4F 3L9FA 2Q0OA 1JGSA 3MEXA 1J75A 3R61A 5K5RA 4XSZF 1E2XA 1FNNA 4GCVA 3HSEA 1DPRA 1T39A 1REPC 2DAOA 3BP8A 3L09A 3DEUA 4YIFA 1QQIA 2KIMA 2BV6A 3HRTA 1G3YA 5LHIA 1OYIA 3T8TA 1IN7A 2DPUA 1BOAA 1T2KA 1GHCA 5BPIA 3QAHA 3J81Z 2ZXJA 1BJAA 2NS0A 3DPLC 1SMTA 4EJTA 2VT3A 4PGGA 1BN5A 4LB5A 1TW3A 1OPCA 1B6AA 4G6QA 4CYDA 4L5JA 4EVIA 4YG2F 2QZ8A 2QQ9A 2LF7A 3HRMA 4BHBA 2VBXA 3P7NA 3BY6A 2ZNYA 4P5OA 4OIQF 4WXDA 3EQLF 4CO8A 2EV6A 2STWA 1HSJA 3GF2A 1J59A 2WTEA 4LLGF 3FF5A 1TQIA 3ABTA 4WCGA 1F4KA 4G9YA 3GO5A 2Y75A 3GUDA 2ZKZA 4XRFA 2HQNA 1P4AA 2JTVA 5L3GA 3V8KA 5KK1A 2KIFA 1S29A 1SAXA 2AS5F 2EFOA 1Q1HA 1XGSA 1ZGAA 4I0AA 3F8CA 1P92A 2Z99A 2NYXA 2EFQA 2EFNA 3CLOA 4HV5A 2A68F 3HRSA 4OIPF 4LG0B 3M9AA 1T0FA 4Q4ZF 1QO0D 1W7PB 2Y48A 3GLXA 4I02A 5BMZA 1FBUA 4KDPA 4WXHA 2D1VA 1R1UA 4IRIA 5EEHA 3FM5A 1KA8A 1SD5A 1W4MA 3IWZA 2P5KA 4Y17A 1XMKA 2OBPA 2YR2A 1SMYF 3I59B 1S6LA 1ZLKA 1HKQA 4BH9A 3WG9A 4U88A 2IT0A 3C18A 4XLNF 4DNCA 2L54A 1FLIA 2Z33A 1D5VA 4LFUA 2IRFG 3ZN0A 4GYIA 5AIQA 2QLZA 2FRHA 2MLGA 3BJOA 3H3UA 5CVVA 4GYGA 3B73A 1W5SA 2PQ8A 2D45A 1Y0UA 1IXSB 2VE8A 1QZYA 1ZHFA 4I98B 3R0AA 2WWYA 1FC3A 1P2FA 4PDKA 4NHJA 2DPDA 1R00A 2M30A 3IHUA 3DQVC 4AIHA 2UXNA 1HW2A 2A61A 3RYRA 4KICA 3U1DA 2LNBA 3HSRA 1YW7A 2FXAA 4HQMA 2WC2A 3RPQA 2RGVA 3WTUC 4BHPA 5FFXA 3HHHA 1O7FA 2FNAA 4EMSA 4G8XA 2YU3A 1AWCA 1BC7C 3I58A 2J5OA 3G3ZA 2IA2A 3HIFA 3HSFA 4BYYA 2DT5A 1W5TA 5H6QA 3GX4X 2RN7A 5LGNA 2MLKA 3GYHX 2W85A 4A5MA 5LHGA 1HBXG 3WGIA 2UZKA 1MKMA 4KT5C 2H27A 5K5OA 5BS6A 5FFZA 2HWVA 2V1UA 2GZWA 4OIRF 4RB0A 1IN8A 4RGRA 3SXYA 3HOSA 3BDDA 3LWFA 5DCFA 1FZPB 3IRRA 4FHTA 3BPXA 4BNCA 1SD7A 3GFMA 3WE2A 2XV4S 3MZHA 1T98A 2OZUA 2HTJA 2O3FA 3ECHA 3OOPA 1YG2A 2QQAA 3LA2A 2HKOA 3M7GA 2PMHA 1RI7A 4DQ2A 3I5UA 4P55A 1IAWA 1Z6TA 2RVCA 3KCCA 1U8RA 2RV8A 2O03A 3ROUA 1F9NA 4RB3C 4CXFA 3LQQA 1E17A 5HS9A 2JZYA 5FD6A 4ASNA 4HQEA 1MD0A 3N97A 5ILSA 1LNWA 2FNPA 4M9ZA 4OIOF 2G7HA 2UWMA 1YW8A 3WU0A 2CG4A 4ENJA 2GXGA 2MA3A 1D3YA 2TDXA 3C7JA 3BJ6A 5LLQA 4UVBA 4QLCU 3L00A 3KEOA 4EJWA 1YS7A 3P9KA 3KFWX 3OV8A 3FMQA 5HDNA 3REOA 1QNTA 2ZBKA 1TW2A 2IP2A 1B4AA 4HYEA 3K2ZA 3JAMZ 3SZPA 3ZMDA 2R7DA 2VT2A 4KUMA 1WKMA 1SD6A 1KQ9A 2PN6A 2COMA 3WGHA 4HAMA 1NHAA 4U7BA 2Y0MA 2ZFWA 3H3ZA 5F6FA 4L9VA 1WQ2A 4IF4A 3V8LA 5ED4A 3GFJA 1XGOA 1TQMA 4HX8A 2Z9OA 1Z05A 5TRDA 1UFMA 2KKOA 1B9NA 1QPMA 4EV0A 1FPQA 3IRQA 3NEUA 3JSPA 4JBAA 1BI2A 1I27A 2W57A 4N0BA 2NRAC 2M87A 4JK1X 5IT3A 1S3JA 4G6DA 2Z5UA 4KMUX 1T6SA 5HS8A 5E8GA 2OAZA 4HLXA 1ZRFA 3LQRA 2NNYA 4Q47A 2QBYB 2DFIA 3ZP5A 3FMSA 3MAJA 1LDDA 3JSOA 1XDSA 3C3WA 2MD5A 3SHFA 2GIVA 1GXPA 1USTA 2FE3A 2XASA 1ZLJA 4EM2A 3DKWA 5F1RA 3MWMA 4NQWA 4ZZDA 1ZYRF 1J5YA 1U5TB 2XAHA 1CGPA 1SFEA 4FX0A 1QZZA 1U78A 1XN7A 2CW0F 2LSOA 5DUIA 2EB7A 5JR3A 4RB1A 4A0XA 1I5ZA 1BIBA 3E6MA 1UHMA 3F8NA 5E1WA 2ZCWA 4LB6B 3Q9VA 5CVJA 3QPHA 3BROA 4H0EA 1K79A 5ICCA 2FU4A 3WTYC 2R7FA 2PMUA 5L3EA 3DXJF 1JHHA 4OU0A 2G7UA 2O6GE 2A3SA 2VC0A 4I01A 3I71A 1FWZA 2QUFA 2DBBA 1EH7A 5DD4A 4GO1A 1W7PD 1FOKA 2K4JA 2ISYA 5FLXK 3ISPA 2XAJA 1XSDA 1P4XA 3O6BB 1HXDA 2QVOA 3K69A 2V1DA 3RTRA 1J7KA 2HTSA 2B0LA 4G7HF 1S7OA 1TNTA 3E6DA 1FBSA 3K1PA 3F21A 3GZ6A 5LRSA 3U2RA 1ZREA 1K7AA 1L3LA 5CVRA 4YFNF 4RGSA 3ZMSA 3GEZA 3ZN1A 1FT9A 3W6KB 3MFKA 3KP2A 1BIAA 1EH6A 1LB2A 4O5VA 4P9UA 4MTDA 2KRFA 1RUNA 4LD5A 2HZTA 4Q48A 4CICA 4RGXA 2EV0A 3KE2A 3KLNA 2HKXA 2JPBA 2CGPA 1IUYA 3HRUA 2XAQA 4IRHA 2FBIA 4WK8F 3E97A 2P5LC 5IT9K 3W6JB 3WODF 4PCQA 1G4DA 2DQLA 4M9SA 4KIGA 2ACJA 1F5TA 3FZVA 2K4BA 3F22A 3E6CC 1U5TC 4BXUA 2FA5A 1GXQA 4ZZLA 3J80K 4KIBA 1P6RA 3J80Z 2XIGA 4I2OA 2PFBA 1DPUA 1MZBA 2BEOA 1VTNC 1LQ1A 3SFZA 1ZG3A 5AIPA 1FY7A 4LK1F 3I4PA 4MEXF 4BQAA 3TKYA 5L3BA 6PAXA 1O3QA 2W25A 2CWEA 1MJ9A 3R60A 3KZZA 1OYYA 1UB9A 5LGTA 4YFKF 3RI4A 4G94A 1XGNA 3LFKA 4I09A 3LAPA 5A2QK 4R1HA 1KQ0A 2H6BA 5CVUA 4OMYA 1MGTA 2O61A 2HR3A 2EFPA 3QOPA 1CF7A 4M74A 2STTA 4BAYA 4M71A 2EA2A 3LSTA 5HLIA 4A2UA 3IL2A 1A04A 1WI9A 3ABUA 4HX4A 4GGGA 3RKYA 3M8FA 4PGHA 5FO5A 4L5IA 1WWXA 2X4HA 5DUKA 1YTYA 1PP8F 1G3TA 2GAUA 2K27A 3BOQA 3ZQ7A 2GQQA 1KGSA 3IKTA 4U0YA 3JTGA 5E1ZB 5J8CA 1S7AA 2ISZA 2VODA 3KEQA 3RKWA 5K5QA 1XD7A 3F72A 3J7AO 2OZ6A 4EQQA 1R36A 2P7VB 1LDJA 2J5PA 1XCVA 5D4SA 4G7ZF 1XMAA 4UV9A 4AVPA 5BOXA 5DCMB 1OMIA 3V7RA 4M9XA 4AWXB 4S04A 4XSXF 1KYZA 5ILUA 4HDVA 3WTXC 2DO7A 3U9GA 2BE5F 3SQNA 4FX4A 1FSEA 5HOOA 5CVIA 1LVAA 2F2EA 1BBYA 2P4WA 2XKOA 2GA2A 1ZN2A 3ZMVA 1RZ4A 4M73A 1ONVA 1J0RA 1KU9A 3GXOA 1JHFA 1S8NA 5AONA 2VOPA 1X3UA 4L18B 2HYFA 3E5QA 2BGCA 2VC1A 3ZMZA 3EYIA 1QBJA 2EFWA 1EV7A 2K7LA 1Z9CA 2L4AA 4B09A 4LMYA 2HFHA 4A12A 2QM3A 2YX4A 2LDUA 5D5XB 2FF4A 2VBZA 3F8BA 4KA4A 3VFZA 2ZJ2A 3RYPA 2KJCA 4AIKA 2E7WA 1LEAA 2IA1A 2JRTA 1ZGJA 2CFXA 4ENNA 1ON1A 1FYKA 1BI0A 4WWCA 3KETA 4EJOA 5KVRA 3HYIA 2D1HA 3D0SA 3IC7A 2ESNA 2AXLA 4M6XA 3O3KA 3TDZC 4YIIA 3DF8A 2ETHA 3WTWC 3ZMUA 3NQOA 3TO7A 1IXRC 1R5HA 1V4RA 5D6EA 4EJVA 2Q8KA 4IXAA 2F5CA 1BC8C 4K2EA 3DV8A
chains in the Genus database with same CATH superfamily
2A6HF 1D0ZA 3GZ5A 3GBGA 5DYMA 1FYLA 5DEQA 4HSTA 2XHKA 1Z91A 3GTGJ 1O3RA 2OQRA 1PP7U 3CD6I 2KZGA 1Z1DA 1IN5A 1H0MA 2ID6A 5LEKA 4D7NA 2W00A 2A07F 2VPRA 4BBRJ 4XIDA 3KP5A 1IF1A 4I7HA 5L3CA 3U21A 1ORKA 2ZO4A 3ZOBA 4FQGA 2X0LA 5BQTA 4HF2A 2CJJA 3I56I 1WPKA 1FBQA 4UHTA 1MMDA 1SVMA 3NRVA 2HDCA 4XLCA 1I6XA 4NDLA 2H6CA 3BR5A 4RAZA 1IN4A 4PFPA 2CUJA 3JTHA 3D5LA 2VQGA 2IPQX 3SFIA 4XMYA 1IRXA 2F5DA 2VXZA 4HOBA 5TJJA 2DYRH 4A3IJ 1TWHJ 1MDMB 1EJ9A 5C4XJ 2F4MB 3A01A 4Y13A 1XSVA 4U7DA 5ILVA 2E2JJ 1OCCH 5HVQC 4A3GJ 2F4IA 2MC4A 1PUFB 2MFZA 2L9RA 1WVRA 2Z3YA 1X4OA 2VE9A 4CZZA 5EEGA 1KYWA 2NNNA 3Q5FA 1XG1A 3TOBA 3OS1A 3BR6A 1YHQI 2HQRA 1ZAOA 3CUQA 2I10A 3V7SA 3GTQJ 4F7ZA 3AG2H 3A02A 2HOEA 4E4HA 3K4JA 3WTSC 3KP3A 4E7SA 4KFCA 2FSWA 3QQAA 1MMNA 3FXJA 1OFCX 2XSJC 3GWZA 3CUOA 3HHGA 4E7ZA 3C2BA 1H9GA 2XPUA 1YO5C 3BTIA 3K1NA 4N9HA 2CUFA 2O7OA 2W24A 1RPWA 2R7SA 2XC7A 1A5JA 3HEFA 3E3VA 4U87A 4BQOA 4QSHA 2CYYA 1H8AC 3VYSB 2O0YA 4JQFA 1DP7P 3H3VK 1UG0A 2EQRA 4M3EA 2R7XA 3K0LA 4WXCA 3JAMK 4XBFA 4XICA 3BG9A 4P9FA 1MMSA 3ZMTA 4ZYDA 2MGQA 5JFRA 3CJNA 2KDZA 2FBHA 1IRGA 3EUAA 1YQAA 2BY2A 4KMFA 3AL0C 3CTAA 2M45A 5CYVA 5DM6F 1OCTC 5B5EC 3SYTA 4AD9A 2NVUB 1G3SA 2W84A 3TGNA 1FP1D 2PJRA 4BACA 4UVCA 1B1BA 5D5VB 5F08A 4GFBA 4U0WA 1ZH5A 2R5YB 1IN6A 4HX7A 2EK5A 1MJAA 3BPVA 3RCOA 4B47A 5BPDA 3R6SA 2EWNA 3ABKH 1VQ6I 2XSDC 4A6DA 4QPQA 1Z3XA 3CCVI 3CO6C 3BC8A 1UZCA 4XKVA 2NXNB 3BTLA 3OL3A 4MO7A 1N25A 4S0HB 4LK0F 4P96A 4ENMA 2B63J 3ELKA 1SAUA 3I0TA 4RAFA 5FKOA 2WAQA 2IA0A 3CUQC 5J1RA 3CMAI 1K6YA 4EGYA 3HOUJ 1XCBA 2E7XA 3WU1B 3CDLA 1ITYA 4X0GA 1A31A 3QRFF 1G8XA 4ZYGA 1YITI 2XKPA 4KNYA 3ESWB 4ZYHA 3KP7A 5LD2C 3LSMA 2ECBA 2GOXB 4MNUA 4TV7A 3HOYJ 1G2HA 5HS7A 4EGZA 2VJIA 1OLTA 2P7CB 4AU7A 1VFCA 2Z2SB 4IL6C 2XROA 2R92J 1WSUA 2DOAA 1O3SA 3FKIJ 2IS2A 3CZ6A 2M8EA 2F5EA 3MCZA 3AAFA 2XAUA 4IHTA 2CW7A 2RNJA 4MQVA 2OC6A 2RQPA 1ZARA 2LF8A 2DK5A 2QYOA 4IVNA 2YX7A 4HA8A 3WTZA 1T8IA 4E7LA 9ANTA 2LK2A 2UV1A 1UG2A 5D8LB 3OS2A 3G73A 1H9TA 1D0XA 1YFHA 2JT1A 5ICGA 2WV0A 1SFXA 3DFGA 3IH4A 5D8KB 1C0WA 3QP6A 2PMZN 5C3EJ 4M6YA 1FTTA 3DP7A 3IWFA 5H6RA 2CO5A 1D8KA 2CQKA 1HW1A 1BC8C 2KL4A 5E17F 5LGUA 3FXKA 5LEJA 2EV5A 2H8WA 2E1NA 3GMEA 2HOAA 2DU9A 4I0BA 5JI6A 2H94A 4UNOA 2DA7A 5HDGA 5K1YA 1MBHA 2BVLA 2WADA 4UUVA 3ECOA 5IPAA 2OTJI 2P6SA 4XRSG 3AFHA 4ZJZA 2OQGA 4DBQA 1I6HJ 2BHZA 4Z6YA 4B8XA 2A5YB 1B59A 3ZPLA 1MNMC 2GIZA 1MH3A 5LRRA 1MBEA 2LVSA 3VPRA 3PO2J 1W36D 2VKEA 3ZQCA 4YRVA 4LITA 4IO9F 2DA2A 1IV8A 4MGRA 3V8JA 2VKVA 1HW5A 4DOZA 1KONA 3CMYA 1XB4A 2CFOA 2LBFA 5IYDJ 3NWSA 5DTDA 3CUQB 1U6GA 4AYBA 5LBQA 4DZPA 4LGWA 2NAZA 2O8XA 3PQJA 3E6BA 4E7JA 2Y69H 3PNTA 1Z7UA 1ZRDA 4G12A 2HQ5A 3K4NA 3OYBA 2CRGA 1E3PA 3F8MA 1WI3A 1MNEA 1ODDA 3BZ6A 3LFUA 3V4GA 3HM5A 2NS8A 1KU3A 2P5VA 3TEDA 5KAFC 4BE0A 3FMRA 1HSTA 2PBIA 2XVCA 1VQ9I 5DD8A 4B3AA 4CZCA 1LDKB 4B1RA 3H5RA 2ME6A 3OMYA 4L9JA 3JRBA 1K83J 5F0HA 4QWQA 3BJAA 3IV5A 3PSFA 2IXSA 2QWWA 3F3XA 3T5XA 4Y15A 1O7LA 1W5CC 4AM3A 2FOKA 4CGZA 3PUBA 3F8FA 2EH3A 5FKLA 2ESHA 4XLEA 3SDBA 4BJ5C 2A69F 4UUSB 1ETVA 2KP6A 1V5FA 4FTHA 3PQKA 1QVTA 3K10A 1MDMA 2RDPA 2K9NA 3O2PE 4OINF 4LLNA 1W7PA 3ERMA 2V79A 4Y7NJ 4PK4A 4EJUA 1OCPA 2LKPA 2QENA 4BDZA 3N4MA 1TC3C 2C6YA 2RQQA 2VKHA 5CKTA 3KP4A 3MVPA 4X1EA 1TLHB 1X2MA 3MKWB 2L3DA 4LJZF 3HTUA 3HG9A 1TWFJ 4HNVA 2OJED 2DMTA 2F5FA 1E3HA 2KDOA 2X48A 2HS5A 2DOEA 2Y2ZA 4B3XA 1VQKI 2P0WA 1ZK8A 2VBYA 3H5NA 2QGUA 4RLFA 3BTJA 4GXOA 5F64A 3TQNA 2DI3A 1RNLA 2K85A 3NWTA 5GAEJ 2YU9J 3ZQQA 3MKYB 3GTPJ 1FOXA 1TWCJ 2O5RA 1ZRCA 1YJ9I 1QU3A 2BYVE 2NVYJ 3E7LA 1H89C 2VOOA 4IEJA 5ERIA 3L7WA 3LSRA 1V55H 4HRIA 3MMYB 2GXBA 3M07A 4RGUA 1NG7A 2L9SA 2K9SA 3DKYA 4O3MA 3VYUB 2NVTJ 4HV6A 2CMPA 3RPUA 4DIQA 5CLSA 2VL8A 3G1MA 5JHUA 3G2BA 3E1SA 3WTTC 2XGCA 1E3OC 3CJRB 4XLPF 3H9QA 3HUGA 2UXXA 1T38A 1E0EA 1YYVA 1K6OA 4MTEA 3WTVC 3K1MA 4XORA 3GFLA 3E0JB 4AC0A 2EZHA 3ZQGA 4FETA 4ITVA 2MSYA 3OSGA 3MKLA 4UVAA 2B9SA 3ASOH 3OYHA 1WRJA 3TO9A 1SFUA 2TCTA 3VSKA 3T1BA 5E79C 2DFHA 3OYLA 3CCJI 1IRFA 3OR2C 1T95A 3H1CA 4HZFA 4ZTJA 3I54A 2MD0A 3BG3A 4A3KJ 4LG0A 1B72B 3G1LA 4EATA 2FOWA 3DEEA 5FGMA 3Q9SA 1TNSA 2K9LA 2KQRA 3QOEA 4M3FA 2ELJA 1IXCA 2GWRA 2ELKA 3S93A 2VLAA 3PIOF 5CJ9A 1TWGJ 2DA1A 3VODA 5HNFA 2FQ3A 2IS1A 3RIRA 4IOCF 3FX3A 2M5WA 3FM3A 2L4MA 2F4OB 5M5YJ 3VEPA 1K61A 1Y8RB 5J6XA 4KN7X 2FEZA 5HDKA 5A2QZ 5GAGJ 3LSKA 1YW9A 1LFUP 2N8GA 1ZR4A 3I59A 3I64A 4L5EA 4IPAA 2CV0A 2PLYA 2KPMA 3S14J 3MZYA 4UXNA 4Q5SF 4RAYA 1XX5A 4OAZA 1J9IA 3FXQA 4CCLA 1V3FA 2XUBA 4BBSJ 2JPCA 1UHWA 2PEXA 4ESBA 2CU7A 3K4CA 4YEJA 1NH3A 1V5EA 4XKBA 4UUSA 5HODA 3ONQA 3BWGA 3KZYA 3F23A 4J00A 3KEYA 1W36C 1RUOA 1FP2A 4KT6A 1F36A 2OUMA 3FKJA 4ENKA 2QQ8A 1ZR2A 1LUJB 2FQ4A 3SZGA 4A5NA 1MSFC 2DDAA 2FD5A 2EZKA 4ETSA 1G3WA 3ZCOA 2WBMA 3HOZJ 2BY3A 4OOIA 4EM1A 2LTPA 1P9QC 3O8GA 3HGYA 3FBIB 1QGPA 1JE8A 1R23A 2LLKA 2VN2A 4UV8A 4CHUA 3FXRA 1S7EA 4E7KA 3M1EA 1Z21A 4L0YB 2KRHA 4ZDPA 4MEYF 3RQ4A 2D2WA 1ZELA 5EDNA 1SD4A 2RKHA 4PZJA 2JA8J 4D9JA 2YPRA 1MH4A 1R5GA 5H20A 3QPLA 3AG3H 1OR7A 2DW4A 1KQ8A 1LE8A 4Z2YA 4A3DJ 5HLHA 1R9TJ 1JXSA 2GA1A 3A03A 2XRNA 5DCMA 4CYCA 3L2QA 4A3FJ 3GTKJ 2ZMEC 4HDUA 2MH2A 3CF2A 1FSHA 2KIUA 1AOYA 3EETA 3CJQB 3CJTB 2QQBA 1ETWA 3LOCA 3S2WA 1GV2A 2EA4A 1BI1A 1J09A 5J8FA 3RSNA 2DFEA 1I1SA 4R8HA 5J1UA 3ERED 4R79A 1G6NA 2PMZA 1FOYA 4FT8A 2KMUA 2M2EA 5E3OA 1OJLA 1D8JA 3MQ0A 5JVTA 4CDGA 1STZA 3KLOA 2MBFA 5E1XA 5D4RA 2A6EF 2PJPA 1IW7F 1TQPA 2LKXA 4IHYA 1RESA 1FX7A 4ZYEA 5FRMA 2OU2A 3IKVA 1MJBA 2EIJH 3VOEA 1D1BA 2HOSA 3GVAA 3LAJA 2M34A 1HCRA 1W0UA 1TBXA 2IGOA 2E71A 4ON0A 2BVMA 3TO6A 2L02A 2E1CA 2E1MB 3OL4A 5E20A 2IGMA 4G7OF 3DPTA 2Q2EA 1F1ZA 2IJLA 2CUEA 2VJJA 3T0YA 3CP2A 1BM9A 5E18F 3RKQA 1ZTRA 3S8PA 1RR8C 2L7KA 5EZGA 1DDNA 3P9IA 3V7CA 1GVJA 2V6CA 2FBKA 4XLAA 4FE4A 2QBYA 2H09A 3HTSB 2IVMA 1XGMA 2V9VA 3HOTA 2ELHA 3HPHA 1DUXC 5LHHA 1OCZH 2V7FA 2HDDA 2LREA 1R22A 1ETQA 1U9NA 3GFIA 3T8RA 4DYCA 5ICFA 3QU6A 4WF2A 2V1XA 1X1CA 1JT6A 4DGWB 3COAC 2XAGA 1LE8B 1XSXA 1HQCA 2FMYA 3K2AA 3K4LA 4QIWN 2BBYA 2KJBA 4V19K 2G0EA 4HEA2 3OYGA 2M4GA 2L0KA 3JW4A 1O3TA 1KU2A 1EA3A 2Y0SA 4C2UA 1OYWA 3I53A 2ZNZA 2VJ4A 3U1KA 1UCRA 4XKCA 1O4XA 4HF0A 3MD2A 1X1BA 2M1BA 2ZMEB 3VB2A 3R4KA 1JKPC 4O6JA 5HLTA 3L2CA 3DBRB 2WY7Q 3VSLA 1A35A 4L9TA 3RPUD 1ZG1A 4OMZA 3M8JA 4EM0B 4W97A 3CO7C 3ML6A 4E70A 3F6VA 1USSA 1U3EM 3TW7A 2P6TA 1GVDA 3EPZA 3LSHA 4JYKA 4U0VA 5DV5A 1ON2A 3EDPA 1B9MA 5L3DA 3WGGA 2K02A 2ZJQF 1R1VA 3HPGA 3QU3A 4LLLA 3F6OA 5D6FA 5DDGA 4N4OB 4S05A 1I1GA 1JUPA 2HI3A 4IRGA 5FD5A 4RM3A 5EG0A 1OR7C 3H92A 1FJLA 3FXUA 2AQEA 4CCNA 4P1WA 2COBA 3TW6A 1S72I 2MC3A 2JSCA 4RLQA 1EH8A 5EJCA 2V26A 2ZXHA 1R4NB 4A0ZA 4NB5A 4L9NA 1ULYA 2RC4A 5J4YA 5J47A 5GP9A 1YLFA 2VI6A 3FDYA 3LA7A 1R1TA 5ICEA 1AHDP 2LRDA 1R5ID 1HKTA 2NVQJ 2K86A 1OKRA 3HOWJ 2X6XA 3PO3J 2OF7A 1FIPA 2HQAA 4M3DA 2R7QA 1MMGA 1VI0A 4IJAA 2HYGD 5K7HA 3AKZA 3RKXA 2LYCA 4DW6A 3KPHA 3QP5A 5F04A 4J01A 2E5NA 4D0PA 4ESJA 3E5XA 1WJEA 2CSOA 2E19A 3S32A 1K78B 2HPMA 1RRJA 3HXLA 2DLLA 3S2HJ 4RAGA 3D5SC 5TGTA 1H88C 2VBWA 1FYMA 2PI0A 1BJZA 3JRDA 5DM7F 1G59A 3KIOA 2HZDA 2K40A 4A0YA 3A01B 4BQNA 3DLAA 2ZMEA 2OA4A 2GBYA 2R3SA 2G9WA 5FB2A 1EF4A 4BHCA 1BI3A 1XDUA 1K78A 2LC2A 2OD5A 5FLXZ 1O57A 2K3PA 2HGCA 1TZLA 2XPVA 1IZ1A 1JI8A 1I3QJ 2DCEA 4KISA 1X2NA 4RDUA 3RDIA 5HLGA 3M8EA 4A6EA 1P4WA 5IYBJ 3NARA 1LJ9A 3LA3A 3WE3A 5EG0B 3DWLE 3J81K 1ZG5A 1HOMA 1TTYA 3B02A 4LOCA 3C2HA 3TOAA 1D5YA 2ZFUA 1MMAA 1R6RA 4ESFA 3IP4B 1MSEC 2BW3B 1PUEE 3KP6A 4CA0A 2L01A 3ZXSA 2AQFA 1R7JA 2DTRA 4JP0A 1VQ7I 2DXIA 1J2XA 4CCJA 4RB2C 1WJBA 2VB6A 5J1YA 3TP0A 1DGWY 2VPLA 3RJPA 4ZTFA 3K7AJ 2XF6A 4N9IA 4KN4X 2ECCA 3EYYA 4HLYA 2PG4A 4M6VA 1UHSA 1U5TA 5L3FA 2EJRA 2E2IJ 2DQRA 4BQQA 3FHZA 1VZ0A 3CDHA 2DA5A 2XAFA 3K9TA 5D5UB 4M72A 1YIOA 2HVRA 1NK2P 3TDUC 2QKLB 4XM3A 2YSRA 4IHSA 5JHFA 3CCEI 2VQCA 1R58A 2FMLA 2VKDA 3GW2A 2ZSHB 3P9CA 2XGXA 4L0ZB 2ADUA 1N75A 5F1JA 4Y4RA 1YOVB 1CF7B 1RIOH 4AIJA 1KU7A 3C1DA 2HEOA 3PFIA 2MH9A 1U2WA 3E5UA 3ULQB 3EUHA 1YE9A 1Z6RA 4HW0A 3SZTA 2TRTA 4KIFA 4OAYA 4KYWA 3R0JA 5LFAA 4RS8A 1PDNC 3QPTA 2QCOA 4HBLA 4WX9A 4HF1A 2M0MA 4FCYA 5IT9Z 2E36A 5E8IA 4MQ9F 2R93J 4XN0A 1HKSA 3HB9A 2MG4A 4YFXF 3KYCB 3VWBA 1LEBA 2Q1ZB 2HU9A 4IX7A 1UAAA 4MFEA 2DK8A 4RMNA 2VONA 2IW5A 3DTEA 1APLC 2AHQA 3FWEA 4MHGA 1L0OC 1YS6A 2P8TA 2V9KA 3SDGA 5D5WB 1YIJI 3O8HA 4ZH4F 3L9FA 1IG7A 2Q0OA 4FISA 1JGSA 3MEXA 1J75A 2IS4A 3R61A 5K5RA 2JRMA 4XSZF 1E2XA 3QYFA 1FNNA 4GCVA 5K7FA 2JSPA 3OIPA 1QVUA 3ZR8X 3HSEA 2R7RA 2JA7J 1DPRA 2OCCH 3CMEI 5IP9J 1IDYA 1T39A 3DCFA 5B66C 1XMXA 2EIKH 1X4PA 2ZB9A 1B8IA 5HNHA 1REPC 2DAOA 1SFKA 3CCUI 3BP8A 3L09A 5M3MJ 2MW8A 3DEUA 3B6AA 3JRIA 1Z7LA 3Q3SA 4YIFA 1QQIA 2FX0A 2KIMA 2DOFA 3LNQA 3I4NJ 2BV6A 1YI2I 3HRTA 1G3YA 5LHIA 1OYIA 2O9LA 4BY1J 3RQIA 1ETYA 3FK6A 4PSXA 2NOGA 3T8TA 1Y1WJ 1IN7A 2E60A 2DPUA 1Z77A 1BOAA 2LBFB 2H1KA 1T2KA 1GHCA 2R4GA 5BPIA 3QAHA 3J81Z 4EEFG 2ZXJA 2L2OA 4BJTA 1BJAA 3P5JA 3S1MJ 3BR3A 3LMMA 2NS0A 2X6WA 4UY8I 3DPLC 1SMTA 4EJTA 2VT3A 4PGGA 2R7VA 1S5LC 3PIPF 1BN5A 4LB5A 1TW3A 2EINH 1AKHA 3I55I 1FTZA 4PJNA 1WJDA 1OPCA 1B6AA 4G6QA 4CYDA 1A6IA 4L5JA 4EVIA 4YG2F 2QZ8A 1U9OA 2QQ9A 1JUMA 1Y39A 3OIQA 4PJJA 2PX9A 2LF7A 3HRMA 2DN0A 4BHBA 2VBXA 1Y1VJ 2LH9A 5FLVA 3P7NA 2X6OA 1NG6A 3BY6A 2ZNYA 1D0YA 3BZCA 4P5OA 4OIQF 4WXDA 4E6KG 3EQLF 4CO8A 1A6QA 2HVQA 4II3A 5EZHA 1SC7A 2EV6A 3CQZJ 1OQYA 2P81A 3LSGA 2STWA 1HSJA 3TBIA 2KHMA 1IRZA 3GF2A 1FMVA 1HDPA 2LKSA 2JK3A 1J59A 4IHXA 2WTEA 4LLGF 3OYCA 3OYAA 3FF5A 1TQIA 3ABTA 4WCGA 4V2GA 1F4KA 4G9YA 5IOYA 3GUDA 2Y75A 3GO5A 2ZKZA 4XRFA 2HQNA 1P4AA 5EGOB 2JTVA 3G6EI 5L3GA 3V8KA 5KK1A 3QPSA 2KIFA 1S29A 1SAXA 3OYMA 2LY1A 2NVXJ 4BXFA 2AS5F 2EFOA 1Q1HA 1XGSA 1ZGAA 2B7EA 4I0AA 3F8CA 4ANJA 2WAFA 1P92A 2Z99A 2NYXA 2EFQA 2EFNA 3CLOA 4HV5A 2A68F 5IY5H 3HRSA 4OIPF 4LG0B 1PVEA 2M7BA 3L1PA 1VNDA 1I3AA 3GLLA 3M9AA 4BEHB 4BXXJ 5EGOA 1T0FA 1R71A 3JCUC 4Q4ZF 2W4SA 1K4SA 1QO0D 2R5ZA 3ABLH 1W7PB 2Y48A 3GLXA 4JX6A 3OWTA 1LFBA 4I02A 1FBUA 2DA3A 3KX2A 4D5CA 5BMZA 4KDPA 3MN2A 4WXHA 3LSIA 2D1VA 1BL0A 1R1UA 2XB0X 3JRAA 2IEKA 1RETA 4IRIA 2OCEA 3BQYA 5EEHA 1QPIA 2L7MP 3G71I 3FM5A 2MYSA 1D1AA 2W48A 1KA8A 1SD5A 1W4MA 3IWZA 2P5KA 4Y17A 3SEQA 4D7MA 3L2RA 1XMKA 2OBPA 2YR2A 1SMYF 3I59B 1S6LA 1ZLKA 4CCOA 1HKQA 2YS9A 4BH9A 4B44A 2Y31A 3WG9A 3CLQA 2X1EA 5KAIC 4U88A 4BU2A 2IT0A 3C18A 4XLNF 4DNCA 1OISA 3DTIA 2DODA 3VYRB 4A3MJ 2L54A 3F9KA 1FLIA 2HOTA 2Z33A 4KITB 1D5VA 1BW6A 4LFUA 2Z16A 1HLVA 3ZN0A 4GYIA 4KJZA 5AIQA 2QLZA 2IRFG 2FRHA 2MLGA 3CCYA 3BJOA 3H3UA 5CVVA 1M1EB 2BW3A 4GYGA 3B73A 5K7ZA 3OSFA 1W5SA 2PQ8A 2D45A 2DMPA 1AKHB 3MZ8A 1Y0UA 1JTXA 1IXSB 4NBQA 2VE8A 4PFOA 1RR7A 4CUGA 4DJAA 1QZYA 1ZHFA 4I98B 3QYBA 2XDVA 3R0AA 4C9YA 2WWYA 1FC3A 1P2FA 4PDKA 4NHJA 2DPDA 1R00A 2M30A 1SFOJ 1F43A 1ETOA 1VQOI 3IHUA 3DQVC 3PUFA 2K9QA 4AIHA 2UXNA 1HW2A 3KZIC 3SEZA 2A61A 2GXAA 3IH3A 4KICA 3RYRA 3U1DA 2KIQA 2LNBA 3HSRA 1YW7A 2FXAA 2WY8Q 4HQMA 2WC2A 3RPQA 1WZ2A 2RGVA 3WTUC 1IUFA 2HVSA 4ABZA 4BHPA 5FFXA 3HOVJ 2CW8A 5JLXA 2BY0A 3HHHA 2ZJRF 1O7FA 2FNAA 4EMSA 3HGGA 4G8XA 2YU3A 1AWCA 3HKZN 2JWTA 4PJ0C 1BC7C 2WV1A 3BR2A 3I58A 4XOPA 1K4TA 2J5OA 3G3ZA 2IA2A 3HIFA 4V2FA 2X51A 3PNYA 1MW7A 3HSFA 4BYYA 2DT5A 1NTCA 2D5VA 1W5TA 3HZJA 5H6QA 5KHDA 4PUSA 3GX4X 2RN7A 3RZDJ 1LPQA 5LGNA 2X9DA 2MLKA 3GYHX 2HNHA 2W85A 2DMUA 4A5MA 5LHGA 4RBOA 1HBXG 3WGIA 2UZKA 1MKMA 4KT5C 2H27A 5K5OA 5BS6A 4GRIA 3J7ZI 1TT5B 5FFZA 2HWVA 3AG4H 2V1UA 2GZWA 4OIRF 4RB0A 2LY2A 1IN8A 4RGRA 4YIRX 3SXYA 4A3CJ 4MIMA 3HOSA 4NC6A 3BDDA 4BKXA 1BR2A 3LWFA 5DCFA 1FZPB 1YRNA 2NS7A 4IKFA 3IRRA 4FHTA 1FMWA 1IGNA 5BNGA 3BPXA 4BNCA 1SD7A 3GFMA 3OR1C 4X6AJ 3GCMA 4UUTA 1HDDC 3WE2A 2XV4S 3MZHA 1T98A 3IAM2 1QA6A 1TT0A 2OZUA 2HTJA 2O3FA 3ECHA 3BG7A 3OOPA 4QPOA 3C2GA 1RKTA 3J7YJ 1YG2A 2XGDA 4Y33A 2QQAA 3LA2A 2A6TA 4BDYA 4E7IA 3M4OJ 2HKOA 2XF5A 3M7GA 2PMHA 1GLNA 5GAHJ 4DYRA 5B3SH 3OYJA 1RI7A 4DQ2A 1CQTA 1NK3P 2H1LA 3I5UA 1EKEA 3D1NI 5E3LA 4XOTA 3A0BC 2E34A 2X1CA 4N4NB 4P55A 1IAWA 1Z6TA 2RVCA 3JREA 2GOMA 5E3MA 3BTCA 3KCCA 4PSWA 3B6CA 5FLMJ 1U8RA 3W2WA 2GM4A 2RV8A 2O03A 2EILH 4UB6C 3ROUA 1F9NA 4RB3C 1V54H 1I50J 4CXFA 3FBNB 4ZDOA 3LQQA 1E17A 5HS9A 2JZYA 5FD6A 4AIDA 3FIWA 1RKWA 4ASNA 4HQEA 1MD0A 5J4VA 1IJWC 3N97A 5ILSA 1LNWA 1IDZA 2FNPA 4M9ZA 4OIOF 4XQFA 2L7ZA 2G7HA 2UWMA 1YW8A 2KRCA 3WU0A 2CG4A 3K70C 1LFPA 4BY7J 4ENJA 2F5VA 2GXGA 2MA3A 1D3YA 2W82A 2TDXA 3C7JA 2E1MC 3BJ6A 5LLQA 3G4SI 1IO2A 1Z3YA 3LSJA 5EYRA 4UVBA 1Z0XA 3L00A 3KEOA 4QLCU 2DT6A 4EJWA 1YS7A 2PJRB 1R4MB 2EZIA 3P9KA 3KFWX 3OV8A 2R0QC 3FMQA 5HDNA 3REOA 1QNTA 4I6ZA 3F0CA 5GADJ 2DFFA 3PJRA 2XPWA 5F0FA 4BEHA 1SANA 2V1NA 3DBHB 3S2DJ 2ZBKA 1TW2A 2L5QA 2Y0SN 3CF5F 2IP2A 4IHVA 1B4AA 1X3ZB 4HYEA 2KLOA 1TP4A 3K2ZA 3JAMZ 4PJLA 3SZPA 3H9GA 2JVHA 2R7DA 3ZMDA 2VT2A 2KZVA 2IBDA 4KUMA 3JRFA 1WGXA 1Q1VA 3Q0VA 2VQHA 2CQQA 2QF7A 3VDXA 1MIJA 1WKMA 1SD6A 5GTHC 2UUZA 1KQ9A 2R7UA 2PN6A 2COMA 3GTJJ 1AU7A 4XR6A 3WGHA 3DTKA 4HAMA 1NHAA 3HOXJ 1U8BA 4U7BA 2M4KA 2DJIA 2Y0MA 4C30A 2ZFWA 2K3FA 3H3ZA 5F6FA 4L9VA 1WQ2A 2FJ1A 3K6GA 4IF4A 3V8LA 5ED4A 1JKRC 3GFJA 1XGOA 1TQMA 4HX8A 5M5WJ 2L9VA 2Z9OA 1AA7A 1Z05A 2R7WA 5TRDA 1UFMA 1Y56A 4MFDA 2KKOA 3FXMA 4IQJA 1W0TA 1B9NA 1QPMA 2JVGA 4EV0A 2KT0A 1FPQA 3IRQA 3IUOA 4CH7A 1D1CA 2DYSH 4BUPA 1JKOC 3NEUA 4FASD 3JSPA 3H0DA 2R7OA 1JJ6C 4JBAA 1BI2A 1I27A 2W57A 3W2AA 1VF9A 4N0BA 1WH7A 2NRAC 2M87A 2ZXIA 1I39A 2OV7A 3DEWA 4JK1X 1T56A 4F55A 4XLHA 5IT3A 1S3JA 1UMQA 5GPCA 2LR8A 4G6DA 2DTZA 2MABA 2Z5UA 3FXOA 4JX5A 4KMUX 1T6SA 2QSGX 3WU2C 5HS8A 1FOWA 3K4BA 5E8GA 2OAZA 4HLXA 4BE2A 2R5ZB 1ZRFA 3LQRA 2NNYA 4FE7A 3S16J 3BG6A 5H2FC 3KYDB 2HXOA 4NNJA 3I4MJ 2VQLA 4Q47A 4J19A 2L7FP 2BHYA 4XKWA 3S3MA 4BE1A 4OWRB 2QBYB 2VUMJ 2DFIA 3ZP5A 1DGRM 2BXZA 2LP0A 3FMSA 1XPXA 1SVOA 3MAJA 1ETXA 5GTIC 2Y9YA 1LDDA 2V4JC 3IAS2 5JLWA 3SJMA 4XNFA 3JSOA 1XDSA 2CUZA 3K4MA 1WCMJ 3C3WA 2MD5A 2ZC2A 2WB1A 3SHFA 3DLLF 5F0CA 3TMOA 1ZQ3P 1JT0A 2XF7A 4GDFA 2X85A 3FHNA 4LG3A 2JUCA 3L2UA 1X1AA 3HJEA 2GIVA 1GXPA 1USTA 2FE3A 4DBRA 2XASA 1ZLJA 2K9MA 3CP8A 4IHWA 4EM2A 1JTYA 3BQZA 3DKWA 1U0JA 3ZGKA 5FJ8J 1YX3A 3MWMA 5F1RA 4NQWA 2CQ7A 4ZZDA 1ZYRF 1J5YA 1W1WE 2XRLA 5CQEA 1U5TB 2XAHA 1CGPA 1SFEA 2BXYA 4FX0A 1MBGA 4II2A 1DU6A 1VQ4I 1T08B 2I5UA 1QZZA 4G6TB 3BG5A 1U78A 1XN7A 1X19A 2CW0F 2LSOA 5DUIA 2EB7A 5JR3A 4RB1A 4A0XA 1I5ZA 5IP7J 2DJNA 2XB5A 3A1YA 1BIBA 3E6MA 3ZRGA 2JJ7A 1UHMA 3BCBA 3F8NA 4AUXA 5E1WA 2ZCWA 4LB6B 3WG7H 2BZTA 3Q9VA 5CVJA 3QPHA 4C3HJ 3DBLB 2M7AA 1X1PA 3BROA 2EPFA 4RA2A 2WAQN 4H0EA 1K79A 2FUG2 2M9HA 2VJ5A 4IQ4A 5ICCA 1VQPI 4E7HA 2FU4A 3WTYC 2R7FA 2IGKA 2PMUA 3CC7I 3H36A 3CESA 1KZHA 5L3EA 3DXJF 1JHHA 3OYFA 3UNGC 4W1UA 4OU0A 3RZOJ 2G7UA 2O6GE 2A3SA 1VQNI 3LSPA 2VC0A 4I01A 3UKGA 1IC8A 2M8GX 3I71A 3KYLA 1QZEA 1FWZA 2QUFA 2DBBA 4A93J 1EH7A 1OCOH 3H35A 2A05A 5DD4A 4GO1A 1SVLA 1W7PD 1FOKA 1Z67A 2K4JA 2ISYA 5FLXK 3ISPA 2XAJA 1XSDA 3ZQLA 1P4XA 3A0HC 4A69C 2WB1N 4HG2A 4LIUA 3OS0A 1UELB 4MLOA 3OOUA 1GV5A 3L2VA 3O6BB 1HC8A 1FEXA 1HXDA 3FK7A 1VQLI 1VQ8I 2QVOA 3K69A 2V1DA 3RTRA 1J7KA 1RC9A 2HTSA 2CH0A 2B0LA 3CDIA 4B48A 2JUGA 4G7HF 2QKMB 1S7OA 1TNTA 1BOBA 3E6DA 3HUGB 1FBSA 1JJ8C 1P7JA 3K1PA 2I8DA 3F21A 3GZ6A 5LRSA 2DT7B 2KISA 1SEUA 3U2RA 1ZREA 1K7AA 4BL0B 1L3LA 2M0CA 2EIMH 5CVRA 3JR9A 4YFNF 4RGSA 1ZGWA 3AG1H 3ZMSA 3GEZA 1WJ5A 1VQ5I 2Y9ZA 3PL8A 3ZN1A 4Y3OA 1N78A 1FT9A 1ACIA 2Z1DA 5B1AH 3W6KB 3MFKA 3KP2A 3W3CA 1BIAA 1EH6A 1LB2A 4O5VA 3G1OA 4NQWB 5J40A 4P9UA 4MTDA 3DU6A 2E2HJ 1ZKGA 2KRFA 1RUNA 4LD5A 2HZTA 4Q48A 1GUUA 4CICA 4RGXA 2EV0A 3KE2A 3CCQI 3IH2A 3KLNA 3NAUA 4XN3A 2HKXA 2JPBA 2CGPA 1IUYA 2CS3A 2ZXWH 3HRUA 2XAQA 4IRHA 1IV6A 2VXDA 2FBIA 4WK8F 3E97A 2P5LC 5IT9K 1DP3A 3W6JB 5FKMA 4F52A 1GDTA 3DU5A 4F91B 3WODF 4PCQA 2DDBA 5CQGA 1G4DA 3D5RC 3JRGA 5JVGF 3H9JA 1LVKA 2BY1A 2DQLA 4M9SA 1FIAA 2F48A 3BLYA 2NOJB 3LL7A 4KIGA 2ACJA 1F5TA 3QWLA 3FZVA 2X6YA 3WHBA 2K4BA 3I3LA 3N05A 4C2TA 3F22A 3E6CC 3S3OA 2ME0A 2QEXI 1MBJA 1U5TC 2DA4A 3K4KA 4BXUA 4HNTA 2FA5A 2V6EA 1GXQA 2HXIA 2OTLI 4PJMA 2QSHX 2WA0A 4ZZLA 3J80K 1WJFA 2VIXA 4KIBA 2E35A 3HC7A 1P6RA 3J80Z 2XIGA 4XL9A 2E5ZA 1V5GA 4I2OA 1BA5A 2PFBA 1DU0A 1DPUA 1MZBA 2BEOA 1VTNC 3PM1A 4AVZA 1LQ1A 3SFZA 1ZG3A 2LMDA 5AIPA 2V9PA 3X2QH 1Y8QB 3A4CA 1FY7A 4LK1F 2HPIA 2CV2A 3I4PA 3TP3A 4MEXF 3GZNB 5C4JJ 4BQAA 1BW5A 4JX4A 5GPAA 3TKYA 5FRNA 1X3WB 3GTLJ 5L3BA 2JQ7A 1A36A 3PSIA 2M3AA 2OPTA 3QYEA 3ZQIA 4YELA 1B8IB 3DPUA 1O3QA 5EEAA 6PAXA 1YJNI 2W25A 3VYTB 3I9V2 2CWEA 1MJ9A 1N77A 2JN6A 3OYDA 3R60A 3ABMH 3M3YJ 3KZZA 1OYYA 1UB9A 5LGTA 4YFKF 3RI4A 4G94A 1XGNA 4UB8C 4I99C 3LFKA 5IYCJ 4I09A 3QODA 2DMNA 3S15J 3LAPA 1YJWI 4I76A 5A2QK 4R1HA 3S1RJ 1KQ0A 2LOOA 2JA5J 2H6BA 5CVUA 4OMYA 1MGTA 4HPQA 4D5FA 3J7AY 2O61A 2CV1A 3BR1A 1HA8A 2HR3A 5M3FJ 1T0FC 2EFPA 1QHGA 3QOPA 4NC8A 4B4CA 2CQNA 5DS9A 2EBIA 3TL4X 1JUSA 3L2WA 1CF7A 4M74A 2STTA 4BAYA 4M71A 2EA2A 1PYVA 2IAIA 3LSTA 5HLIA 4A2UA 2LY9A 4F93B 4XLFA 1WJCA 3IL2A 1POGA 1A04A 1WI9A 4XRMA 3ABUA 2O8KA 4Y52J 3W2VA 4HX4A 4GGGA 3RKYA 3OIOA 3M8FA 2RNGA 2X1DA 4PGHA 5FO5A 4L5IA 2XGEA 1WWXA 3FISA 4BS9A 2X4HA 2L9NA 2Q2EB 5DUKA 2GAUA 1G3TA 1YTYA 1PP8F 2K27A 3BOQA 3ZQ7A 2GQQA 1Y0NA 1KGSA 1WJAA 4F3QA 3WHCA 4U0YA 3IKTA 2ZSIB 1OCRH 1PUFA 4CCKA 3JTGA 5E1ZB 4A3JJ 5J8CA 5B1BH 1S7AA 1Y6IA 5M5XJ 3MKZA 2ISZA 2VODA 3KEQA 1T33A 3RKWA 5K5QA 1XD7A 3F72A 2DA6A 4NC7A 5FKNA 3J7AO 4LIVA 5J3LA 1QHHD 2LFBA 4JOMA 2OZ6A 4RM2A 4XONA 1WFXA 4EQQA 2ID3A 2LD5A 3OYIA 4DZJA 5FKKA 1R36A 2P7VB 3OY9A 3V42A 1LDJA 1YX5A 3HKZA 2HDWA 2J5PA 2QA4I 1VQMI 4ZC3A 1TWAJ 1XCVA 1P7IA 2AXTC 5D4SA 3BCAA 5EF6A 4G7ZF 4IOAF 1XMAA 4UV9A 5IP6A 2EZLA 3BR0A 2JA2A 4M3BA 4AVPA 5BOXA 5DCMB 5IOZA 1OMIA 2LG4A 3EUKL 3V7RA 4BJ6C 4M9XA 4AWXB 4S04A 4XSXF 1KYZA 5ILUA 4HDVA 2IS6A 2QSFX 3WTXC 2DO7A 4C3JJ 3U9GA 4M3GA 2F6CA 4HSRA 5KCMA 1TL8A 1DQUA 2BE5F 3SQNA 3S17J 4FX4A 3S1QJ 1FSEA 1ETKA 3HL2A 1B72A 5HOOA 5CVIA 5TISC 2W1OA 1LVAA 4B43A 4C2MJ 2F2EA 2JA6J 1BBYA 1S9HA 2P4WA 2DMQA 2XKOA 2GA2A 3BZKA 1ZN2A 3ZMVA 3CCMI 3CCRI 1RZ4A 4M73A 1ONVA 1J0RA 1KU9A 3GTOJ 3GXOA 2Y30A 1JHFA 1S8NA 5AONA 3HDDA 2VOPA 1X3UA 2KFDA 4L18B 2HYFA 3E5QA 2BGCA 3W6VA 1BR1A 2VC1A 3ZMZA 1XC5A 3EYIA 4C3IJ 5CPRB 3BT9A 1XTAA 1ERDA 1QBJA 5KNLA 3CCSI 2EFWA 1EV7A 2K7LA 4CYCB 1WH5A 4ZDLA 5F27A 1Z9CA 2L4AA 4B09A 2ZJPF 2W7NA 1GT0C 4LMYA 3CC2I 2HFHA 3PNVA 4A12A 2QM3A 2HYJA 4XRSA 3ZQFA 2RAEA 2YX4A 3PFYA 2LDUA 5D5XB 3K70D 2FF4A 3H0GJ 4F92B 5E3NA 1ENHA 2VBZA 2GLOA 3F8BA 2RREA 2K5CA 3DKXA 4KA4A 3VFZA 3Q0WA 1UJ8A 1JGGA 2ZJ2A 3RYPA 2KJCA 4ZYAA 4AIKA 2E7WA 2H8RA 1LEAA 1WHUA 4CSWA 3OYEA 2IA1A 2JRTA 1ZGJA 4A3LJ 4H4KC 2R5YA 3FXLA 3GTMJ 2R7ZJ 3ZQHA 1BR4A 3JRHA 2WAEA 2CFXA 4ENNA 2A5WA 3S3NA 3AL0B 1ON1A 3JRCA 4QTRA 1MBFA 4DYQA 1BI0A 1X1DA 2YUSA 4WWCA 3KETA 3M1CA 3OYKA 1FYKA 4EJOA 5KVRA 3HBLA 2VASA 4A3EJ 4AYBN 3UR3C 3HYIA 4NUBA 2D1HA 3D0SA 1MBKA 3Q0UA 4IZZA 1XS9A 3IC7A 3H5AA 2ESNA 2AXLA 3CCLI 1PJRA 4M6XA 4A3BJ 3EUHC 3O3KA 3OYNA 3TDZC 5C44J 4YIIA 4XK4A 3DF8A 2ETHA 5FROA 2JMWA 1QRYA 3WTWC 2BOLA 3ASNH 3ZMUA 3CMMA 3NQOA 1R49A 3TO7A 3CC4I 1LKXA 1IXRC 2ICWG 2E1OA 3S1NJ 1JKQC 4D1QA 1R5HA 1V4RA 5D6EA 1HF0A 2CQXA 2IGNA 4BGDA 2AO9A 4CCMA 2R7TA 1YRNB 3A2KA 4EJVA 1X58A 2Q8KA 4IXAA 2F5CA 1MNDA 4K2EA 4HNUA 3DV8A
chains in the Genus database with same CATH topology
2A6HF 3GZ5A 5DYMA 1FYLA 5DEQA 2XHKA 1Z91A 1O3RA 2OQRA 1PP7U 1Z1DA 1IN5A 1H0MA 5LEKA 2A07F 3KP5A 1IF1A 4I7HA 5L3CA 2ZO4A 2X0LA 5BQTA 4HF2A 1FBQA 4UHTA 3NRVA 2HDCA 1I6XA 2H6CA 4RAZA 1IN4A 3JTHA 3D5LA 2IPQX 2F5DA 2VXZA 4HOBA 5TJJA 1MDMB 4Y13A 1XSVA 4U7DA 5ILVA 5HVQC 2Z3YA 2VE9A 4CZZA 5EEGA 1KYWA 2NNNA 3Q5FA 3TOBA 2HQRA 1ZAOA 3CUQA 3V7SA 4F7ZA 2HOEA 4KFCA 3WTSC 3KP3A 2FSWA 3GWZA 3CUOA 3HHGA 1H9GA 1YO5C 3K1NA 4N9HA 2W24A 3E3VA 2CYYA 2O0YA 4JQFA 1DP7P 3K0LA 4WXCA 3JAMK 4XBFA 4P9FA 3ZMTA 4ZYDA 5JFRA 3CJNA 2FBHA 1IRGA 1YQAA 4KMFA 3CTAA 2M45A 5CYVA 4AD9A 1G3SA 2W84A 3TGNA 1FP1D 4UVCA 1B1BA 5D5VB 4U0WA 1ZH5A 1IN6A 4HX7A 2EK5A 1MJAA 3BPVA 5BPDA 3R6SA 2EWNA 4A6DA 3CO6C 4LK0F 4P96A 4ENMA 3ELKA 3I0TA 2IA0A 3CUQC 4EGYA 1XCBA 2E7XA 3WU1B 3QRFF 4ZYGA 2XKPA 4KNYA 4ZYHA 3KP7A 4MNUA 4TV7A 5HS7A 4EGZA 2P7CB 2XROA 1WSUA 1O3SA 2M8EA 2F5EA 3MCZA 3AAFA 4IHTA 2RNJA 4MQVA 2RQPA 1ZARA 2LF8A 2DK5A 2QYOA 4IVNA 2YX7A 4HA8A 3WTZA 5D8LB 3G73A 1H9TA 1YFHA 2JT1A 5ICGA 2WV0A 1SFXA 3DFGA 5D8KB 1C0WA 3QP6A 4M6YA 3DP7A 3IWFA 5H6RA 2CO5A 1D8KA 2CQKA 1HW1A 5E17F 5LGUA 5LEJA 2EV5A 2E1NA 4I0BA 2DU9A 5JI6A 2H94A 4UNOA 5HDGA 5K1YA 4UUVA 3ECOA 2P6SA 2OQGA 4B8XA 2A5YB 1B59A 3ZPLA 5LRRA 4MGRA 3V8JA 1HW5A 1XB4A 3CUQB 1U6GA 5LBQA 4LGWA 2NAZA 2O8XA 3PQJA 3E6BA 1Z7UA 1ZRDA 3F8MA 3BZ6A 1ODDA 3V4GA 1KU3A 2P5VA 3FMRA 1HSTA 2PBIA 2XVCA 5DD8A 1LDKB 4L9JA 4QWQA 3BJAA 2QWWA 3F3XA 3T5XA 4Y15A 1O7LA 2FOKA 4CGZA 3F8FA 2ESHA 2A69F 3PQKA 1MDMA 2RDPA 3O2PE 4LLNA 4OINF 1W7PA 2V79A 2C6YA 4EJUA 2LKPA 2QENA 3N4MA 3KP4A 1TLHB 2L3DA 4LJZF 3HTUA 2F5FA 2HS5A 2VBYA 4GXOA 5F64A 3TQNA 2DI3A 1RNLA 1ZRCA 2BYVE 2VOOA 5ERIA 3L7WA 2GXBA 4RGUA 4O3MA 4HV6A 3RPUA 5CLSA 5JHUA 3WTTC 4XLPF 3HUGA 2UXXA 1T38A 1YYVA 1K6OA 4MTEA 3WTVC 3K1MA 3GFLA 4UVAA 1WRJA 3TO9A 1SFUA 3T1BA 1IRFA 4HZFA 3I54A 4LG0A 5FGMA 3Q9SA 1TNSA 1IXCA 2GWRA 5CJ9A 3VODA 2FQ3A 3RIRA 3FX3A 2M5WA 3FM3A 2L4MA 3VEPA 5J6XA 4KN7X 2FEZA 5HDKA 5A2QZ 1YW9A 3I59A 3I64A 4IPAA 2PLYA 3MZYA 4UXNA 4Q5SF 4RAYA 1J9IA 3FXQA 1V3FA 2XUBA 2JPCA 1UHWA 2PEXA 4ESBA 3BWGA 3KZYA 3F23A 1RUOA 1FP2A 4ENKA 4A5NA 4ETSA 1G3WA 4OOIA 4EM1A 1QGPA 1JE8A 1R23A 2VN2A 4UV8A 4CHUA 3FXRA 3M1EA 4L0YB 4MEYF 2D2WA 1SD4A 2RKHA 4PZJA 2YPRA 1R5GA 5H20A 1OR7A 2DW4A 1KQ8A 4Z2YA 5HLHA 1JXSA 2GA1A 5DCMA 2XRNA 4HDUA 2MH2A 1FSHA 2KIUA 1AOYA 3EETA 2QQBA 3S2WA 5J8FA 2EA4A 1BI1A 1I1SA 4R8HA 3ERED 4R79A 1G6NA 4FT8A 1D8JA 3MQ0A 5JVTA 4CDGA 1STZA 3KLOA 2MBFA 5E1XA 5D4RA 2A6EF 2PJPA 1IW7F 1TQPA 1FX7A 4ZYEA 2OU2A 3IKVA 1MJBA 3VOEA 3GVAA 3LAJA 1TBXA 4ON0A 2E1CA 3TO6A 2L02A 5E20A 4G7OF 3DPTA 2Q2EA 1F1ZA 2IJLA 3T0YA 1BM9A 5E18F 1DDNA 3P9IA 3V7CA 1GVJA 2V6CA 2FBKA 2QBYA 2H09A 3HTSB 2IVMA 1XGMA 2V9VA 3HOTA 2ELHA 1DUXC 5LHHA 1R22A 3GFIA 3T8RA 5ICFA 3QU6A 4WF2A 2V1XA 3COAC 2XAGA 1XSXA 1HQCA 2FMYA 2BBYA 2KJBA 3JW4A 1O3TA 1KU2A 1OYWA 3I53A 2ZNZA 1UCRA 4HF0A 2M1BA 2ZMEB 3VB2A 3R4KA 4O6JA 3L2CA 4L9TA 1ZG1A 4OMZA 4EM0B 3CO7C 3ML6A 4E70A 3F6VA 1USSA 1U3EM 2P6TA 5L3DA 3WGGA 4U0VA 5DV5A 1ON2A 3EDPA 1B9MA 2K02A 1R1VA 3QU3A 4LLLA 3F6OA 5D6FA 5DDGA 4S05A 1I1GA 4IRGA 5FD5A 3H92A 3FXUA 2MC3A 2JSCA 1EH8A 4A0ZA 4NB5A 4L9NA 1ULYA 2RC4A 1YLFA 3LA7A 1R1TA 5ICEA 1HKTA 2K86A 1OKRA 4IJAA 2HYGD 3RKXA 3QP5A 4D0PA 4ESJA 3E5XA 2CSOA 1K78B 2DLLA 2VBWA 1FYMA 2PI0A 4A0YA 2ZMEA 2OA4A 2R3SA 2G9WA 5FB2A 4BHCA 1BI3A 1K78A 1XDUA 2OD5A 5FLXZ 1O57A 2HGCA 1IZ1A 3RDIA 5HLGA 3M8EA 4A6EA 1P4WA 1LJ9A 3LA3A 3WE3A 3J81K 1ZG5A 1TTYA 3B02A 3TOAA 4ESFA 1PUEE 3KP6A 2L01A 1R7JA 2DTRA 1J2XA 4RB2C 3RJPA 4N9IA 4KN4X 3EYYA 4HLYA 2PG4A 5L3FA 1U5TA 2EJRA 2DQRA 3FHZA 3CDHA 2XAFA 3K9TA 5D5UB 4M72A 1YIOA 3TDUC 2YSRA 4IHSA 1R58A 2FMLA 3GW2A 3P9CA 4L0ZB 2XGXA 2ADUA 1CF7B 1RIOH 4AIJA 1KU7A 3C1DA 2HEOA 3PFIA 2MH9A 1U2WA 3E5UA 3ULQB 3EUHA 1Z6RA 4HW0A 3SZTA 4KIFA 4KYWA 3R0JA 4RS8A 1PDNC 3QPTA 4HBLA 4WX9A 4HF1A 5IT9Z 5E8IA 4MQ9F 1HKSA 4YFXF 1LEBA 2DK8A 2VONA 2IW5A 3FWEA 4MHGA 1L0OC 1YS6A 2P8TA 5D5WB 4ZH4F 3L9FA 2Q0OA 1JGSA 3MEXA 1J75A 3R61A 5K5RA 4XSZF 1E2XA 1FNNA 4GCVA 3HSEA 1DPRA 1T39A 1REPC 2DAOA 3BP8A 3L09A 3DEUA 4YIFA 1QQIA 2KIMA 2BV6A 3HRTA 1G3YA 5LHIA 1OYIA 3T8TA 1IN7A 2DPUA 1BOAA 1T2KA 1GHCA 5BPIA 3QAHA 3J81Z 2ZXJA 1BJAA 2NS0A 3DPLC 1SMTA 4EJTA 2VT3A 4PGGA 1BN5A 4LB5A 1TW3A 1OPCA 1B6AA 4G6QA 4CYDA 4L5JA 4EVIA 4YG2F 2QZ8A 2QQ9A 2LF7A 3HRMA 4BHBA 2VBXA 3P7NA 3BY6A 2ZNYA 4P5OA 4OIQF 4WXDA 3EQLF 4CO8A 2EV6A 2STWA 1HSJA 3GF2A 1J59A 2WTEA 4LLGF 3FF5A 1TQIA 3ABTA 4WCGA 1F4KA 4G9YA 3GO5A 2Y75A 3GUDA 2ZKZA 4XRFA 2HQNA 1P4AA 2JTVA 5L3GA 3V8KA 5KK1A 2KIFA 1S29A 1SAXA 2AS5F 2EFOA 1Q1HA 1XGSA 1ZGAA 4I0AA 3F8CA 1P92A 2Z99A 2NYXA 2EFQA 2EFNA 3CLOA 4HV5A 2A68F 3HRSA 4OIPF 4LG0B 3M9AA 1T0FA 4Q4ZF 1QO0D 1W7PB 2Y48A 3GLXA 4I02A 5BMZA 1FBUA 4KDPA 4WXHA 2D1VA 1R1UA 4IRIA 5EEHA 3FM5A 1KA8A 1SD5A 1W4MA 3IWZA 2P5KA 4Y17A 1XMKA 2OBPA 2YR2A 1SMYF 3I59B 1S6LA 1ZLKA 1HKQA 4BH9A 3WG9A 4U88A 2IT0A 3C18A 4XLNF 4DNCA 2L54A 1FLIA 2Z33A 1D5VA 4LFUA 2IRFG 3ZN0A 4GYIA 5AIQA 2QLZA 2FRHA 2MLGA 3BJOA 3H3UA 5CVVA 4GYGA 3B73A 1W5SA 2PQ8A 2D45A 1Y0UA 1IXSB 2VE8A 1QZYA 1ZHFA 4I98B 3R0AA 2WWYA 1FC3A 1P2FA 4PDKA 4NHJA 2DPDA 1R00A 2M30A 3IHUA 3DQVC 4AIHA 2UXNA 1HW2A 2A61A 3RYRA 4KICA 3U1DA 2LNBA 3HSRA 1YW7A 2FXAA 4HQMA 2WC2A 3RPQA 2RGVA 3WTUC 4BHPA 5FFXA 3HHHA 1O7FA 2FNAA 4EMSA 4G8XA 2YU3A 1AWCA 1BC7C 3I58A 2J5OA 3G3ZA 2IA2A 3HIFA 3HSFA 4BYYA 2DT5A 1W5TA 5H6QA 3GX4X 2RN7A 5LGNA 2MLKA 3GYHX 2W85A 4A5MA 5LHGA 1HBXG 3WGIA 2UZKA 1MKMA 4KT5C 2H27A 5K5OA 5BS6A 5FFZA 2HWVA 2V1UA 2GZWA 4OIRF 4RB0A 1IN8A 4RGRA 3SXYA 3HOSA 3BDDA 3LWFA 5DCFA 1FZPB 3IRRA 4FHTA 3BPXA 4BNCA 1SD7A 3GFMA 3WE2A 2XV4S 3MZHA 1T98A 2OZUA 2HTJA 2O3FA 3ECHA 3OOPA 1YG2A 2QQAA 3LA2A 2HKOA 3M7GA 2PMHA 1RI7A 4DQ2A 3I5UA 4P55A 1IAWA 1Z6TA 2RVCA 3KCCA 1U8RA 2RV8A 2O03A 3ROUA 1F9NA 4RB3C 4CXFA 3LQQA 1E17A 5HS9A 2JZYA 5FD6A 4ASNA 4HQEA 1MD0A 3N97A 5ILSA 1LNWA 2FNPA 4M9ZA 4OIOF 2G7HA 2UWMA 1YW8A 3WU0A 2CG4A 4ENJA 2GXGA 2MA3A 1D3YA 2TDXA 3C7JA 3BJ6A 5LLQA 4UVBA 4QLCU 3L00A 3KEOA 4EJWA 1YS7A 3P9KA 3KFWX 3OV8A 3FMQA 5HDNA 3REOA 1QNTA 2ZBKA 1TW2A 2IP2A 1B4AA 4HYEA 3K2ZA 3JAMZ 3SZPA 3ZMDA 2R7DA 2VT2A 4KUMA 1WKMA 1SD6A 1KQ9A 2PN6A 2COMA 3WGHA 4HAMA 1NHAA 4U7BA 2Y0MA 2ZFWA 3H3ZA 5F6FA 4L9VA 1WQ2A 4IF4A 3V8LA 5ED4A 3GFJA 1XGOA 1TQMA 4HX8A 2Z9OA 1Z05A 5TRDA 1UFMA 2KKOA 1B9NA 1QPMA 4EV0A 1FPQA 3IRQA 3NEUA 3JSPA 4JBAA 1BI2A 1I27A 2W57A 4N0BA 2NRAC 2M87A 4JK1X 5IT3A 1S3JA 4G6DA 2Z5UA 4KMUX 1T6SA 5HS8A 5E8GA 2OAZA 4HLXA 1ZRFA 3LQRA 2NNYA 4Q47A 2QBYB 2DFIA 3ZP5A 3FMSA 3MAJA 1LDDA 3JSOA 1XDSA 3C3WA 2MD5A 3SHFA 2GIVA 1GXPA 1USTA 2FE3A 2XASA 1ZLJA 4EM2A 3DKWA 5F1RA 3MWMA 4NQWA 4ZZDA 1ZYRF 1J5YA 1U5TB 2XAHA 1CGPA 1SFEA 4FX0A 1QZZA 1U78A 1XN7A 2CW0F 2LSOA 5DUIA 2EB7A 5JR3A 4RB1A 4A0XA 1I5ZA 1BIBA 3E6MA 1UHMA 3F8NA 5E1WA 2ZCWA 4LB6B 3Q9VA 5CVJA 3QPHA 3BROA 4H0EA 1K79A 5ICCA 2FU4A 3WTYC 2R7FA 2PMUA 5L3EA 3DXJF 1JHHA 4OU0A 2G7UA 2O6GE 2A3SA 2VC0A 4I01A 3I71A 1FWZA 2QUFA 2DBBA 1EH7A 5DD4A 4GO1A 1W7PD 1FOKA 2K4JA 2ISYA 5FLXK 3ISPA 2XAJA 1XSDA 1P4XA 3O6BB 1HXDA 2QVOA 3K69A 2V1DA 3RTRA 1J7KA 2HTSA 2B0LA 4G7HF 1S7OA 1TNTA 3E6DA 1FBSA 3K1PA 3F21A 3GZ6A 5LRSA 3U2RA 1ZREA 1K7AA 1L3LA 5CVRA 4YFNF 4RGSA 3ZMSA 3GEZA 3ZN1A 1FT9A 3W6KB 3MFKA 3KP2A 1BIAA 1EH6A 1LB2A 4O5VA 4P9UA 4MTDA 2KRFA 1RUNA 4LD5A 2HZTA 4Q48A 4CICA 4RGXA 2EV0A 3KE2A 3KLNA 2HKXA 2JPBA 2CGPA 1IUYA 3HRUA 2XAQA 4IRHA 2FBIA 4WK8F 3E97A 2P5LC 5IT9K 3W6JB 3WODF 4PCQA 1G4DA 2DQLA 4M9SA 4KIGA 2ACJA 1F5TA 3FZVA 2K4BA 3F22A 3E6CC 1U5TC 4BXUA 2FA5A 1GXQA 4ZZLA 3J80K 4KIBA 1P6RA 3J80Z 2XIGA 4I2OA 2PFBA 1DPUA 1MZBA 2BEOA 1VTNC 1LQ1A 3SFZA 1ZG3A 5AIPA 1FY7A 4LK1F 3I4PA 4MEXF 4BQAA 3TKYA 5L3BA 6PAXA 1O3QA 2W25A 2CWEA 1MJ9A 3R60A 3KZZA 1OYYA 1UB9A 5LGTA 4YFKF 3RI4A 4G94A 1XGNA 3LFKA 4I09A 3LAPA 5A2QK 4R1HA 1KQ0A 2H6BA 5CVUA 4OMYA 1MGTA 2O61A 2HR3A 2EFPA 3QOPA 1CF7A 4M74A 2STTA 4BAYA 4M71A 2EA2A 3LSTA 5HLIA 4A2UA 3IL2A 1A04A 1WI9A 3ABUA 4HX4A 4GGGA 3RKYA 3M8FA 4PGHA 5FO5A 4L5IA 1WWXA 2X4HA 5DUKA 1YTYA 1PP8F 1G3TA 2GAUA 2K27A 3BOQA 3ZQ7A 2GQQA 1KGSA 3IKTA 4U0YA 3JTGA 5E1ZB 5J8CA 1S7AA 2ISZA 2VODA 3KEQA 3RKWA 5K5QA 1XD7A 3F72A 3J7AO 2OZ6A 4EQQA 1R36A 2P7VB 1LDJA 2J5PA 1XCVA 5D4SA 4G7ZF 1XMAA 4UV9A 4AVPA 5BOXA 5DCMB 1OMIA 3V7RA 4M9XA 4AWXB 4S04A 4XSXF 1KYZA 5ILUA 4HDVA 3WTXC 2DO7A 3U9GA 2BE5F 3SQNA 4FX4A 1FSEA 5HOOA 5CVIA 1LVAA 2F2EA 1BBYA 2P4WA 2XKOA 2GA2A 1ZN2A 3ZMVA 1RZ4A 4M73A 1ONVA 1J0RA 1KU9A 3GXOA 1JHFA 1S8NA 5AONA 2VOPA 1X3UA 4L18B 2HYFA 3E5QA 2BGCA 2VC1A 3ZMZA 3EYIA 1QBJA 2EFWA 1EV7A 2K7LA 1Z9CA 2L4AA 4B09A 4LMYA 2HFHA 4A12A 2QM3A 2YX4A 2LDUA 5D5XB 2FF4A 2VBZA 3F8BA 4KA4A 3VFZA 2ZJ2A 3RYPA 2KJCA 4AIKA 2E7WA 1LEAA 2IA1A 2JRTA 1ZGJA 2CFXA 4ENNA 1ON1A 1FYKA 1BI0A 4WWCA 3KETA 4EJOA 5KVRA 3HYIA 2D1HA 3D0SA 3IC7A 2ESNA 2AXLA 4M6XA 3O3KA 3TDZC 4YIIA 3DF8A 2ETHA 3WTWC 3ZMUA 3NQOA 3TO7A 1IXRC 1R5HA 1V4RA 5D6EA 4EJVA 2Q8KA 4IXAA 2F5CA 1BC8C 4K2EA 3DV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6H F;  3GZ5 A;  5DYM A;  1FYL A;  5DEQ A;  2XHK A;  1Z91 A;  1O3R A;  2OQR A;  1PP7 U;  1Z1D A;  1IN5 A;  1H0M A;  5LEK A;  2A07 F;  3KP5 A;  1IF1 A;  4I7H A;  5L3C A;  2ZO4 A;  2X0L A;  5BQT A;  4HF2 A;  1FBQ A;  4UHT A;  3NRV A;  2HDC A;  1I6X A;  2H6C A;  4RAZ A;  1IN4 A;  3JTH A;  3D5L A;  2IPQ X;  2F5D A;  2VXZ A;  4HOB A;  5TJJ A;  1MDM B;  4Y13 A;  1XSV A;  4U7D A;  5ILV A;  5HVQ C;  2Z3Y A;  2VE9 A;  4CZZ A;  5EEG A;  1KYW A;  2NNN A;  3Q5F A;  3TOB A;  2HQR A;  1ZAO A;  3CUQ A;  3V7S A;  4F7Z A;  2HOE A;  4KFC A;  3WTS C;  3KP3 A;  2FSW A;  3GWZ A;  3CUO A;  3HHG A;  1H9G A;  1YO5 C;  3K1N A;  4N9H A;  2W24 A;  3E3V A;  2CYY A;  2O0Y A;  4JQF A;  1DP7 P;  3K0L A;  4WXC A;  3JAM K;  4XBF A;  4P9F A;  3ZMT A;  4ZYD A;  5JFR A;  3CJN A;  2FBH A;  1IRG A;  1YQA A;  4KMF A;  3CTA A;  2M45 A;  5CYV A;  4AD9 A;  1G3S A;  2W84 A;  3TGN A;  1FP1 D;  4UVC A;  1B1B A;  5D5V B;  4U0W A;  1ZH5 A;  1IN6 A;  4HX7 A;  2EK5 A;  1MJA A;  3BPV A;  5BPD A;  3R6S A;  2EWN A;  4A6D A;  3CO6 C;  4LK0 F;  4P96 A;  4ENM A;  3ELK A;  3I0T A;  2IA0 A;  3CUQ C;  4EGY A;  1XCB A;  2E7X A;  3WU1 B;  3QRF F;  4ZYG A;  2XKP A;  4KNY A;  4ZYH A;  3KP7 A;  4MNU A;  4TV7 A;  5HS7 A;  4EGZ A;  2P7C B;  2XRO A;  1WSU A;  1O3S A;  2M8E A;  2F5E A;  3MCZ A;  3AAF A;  4IHT A;  2RNJ A;  4MQV A;  2RQP A;  1ZAR A;  2LF8 A;  2DK5 A;  2QYO A;  4IVN A;  2YX7 A;  4HA8 A;  3WTZ A;  5D8L B;  3G73 A;  1H9T A;  1YFH A;  2JT1 A;  5ICG A;  2WV0 A;  1SFX A;  3DFG A;  5D8K B;  1C0W A;  3QP6 A;  4M6Y A;  3DP7 A;  3IWF A;  5H6R A;  2CO5 A;  1D8K A;  2CQK A;  1HW1 A;  5E17 F;  5LGU A;  5LEJ A;  2EV5 A;  2E1N A;  4I0B A;  2DU9 A;  5JI6 A;  2H94 A;  4UNO A;  5HDG A;  5K1Y A;  4UUV A;  3ECO A;  2P6S A;  2OQG A;  4B8X A;  2A5Y B;  1B59 A;  3ZPL A;  5LRR A;  4MGR A;  3V8J A;  1HW5 A;  1XB4 A;  3CUQ B;  1U6G A;  5LBQ A;  4LGW A;  2NAZ A;  2O8X A;  3PQJ A;  3E6B A;  1Z7U A;  1ZRD A;  3F8M A;  3BZ6 A;  1ODD A;  3V4G A;  1KU3 A;  2P5V A;  3FMR A;  1HST A;  2PBI A;  2XVC A;  5DD8 A;  1LDK B;  4L9J A;  4QWQ A;  3BJA A;  2QWW A;  3F3X A;  3T5X A;  4Y15 A;  1O7L A;  2FOK A;  4CGZ A;  3F8F A;  2ESH A;  2A69 F;  3PQK A;  1MDM A;  2RDP A;  3O2P E;  4LLN A;  4OIN F;  1W7P A;  2V79 A;  2C6Y A;  4EJU A;  2LKP A;  2QEN A;  3N4M A;  3KP4 A;  1TLH B;  2L3D A;  4LJZ F;  3HTU A;  2F5F A;  2HS5 A;  2VBY A;  4GXO A;  5F64 A;  3TQN A;  2DI3 A;  1RNL A;  1ZRC A;  2BYV E;  2VOO A;  5ERI A;  3L7W A;  2GXB A;  4RGU A;  4O3M A;  4HV6 A;  3RPU A;  5CLS A;  5JHU A;  3WTT C;  4XLP F;  3HUG A;  2UXX A;  1T38 A;  1YYV A;  1K6O A;  4MTE A;  3WTV C;  3K1M A;  3GFL A;  4UVA A;  1WRJ A;  3TO9 A;  1SFU A;  3T1B A;  1IRF A;  4HZF A;  3I54 A;  4LG0 A;  5FGM A;  3Q9S A;  1TNS A;  1IXC A;  2GWR A;  5CJ9 A;  3VOD A;  2FQ3 A;  3RIR A;  3FX3 A;  2M5W A;  3FM3 A;  2L4M A;  3VEP A;  5J6X A;  4KN7 X;  2FEZ A;  5HDK A;  5A2Q Z;  1YW9 A;  3I59 A;  3I64 A;  4IPA A;  2PLY A;  3MZY A;  4UXN A;  4Q5S F;  4RAY A;  1J9I A;  3FXQ A;  1V3F A;  2XUB A;  2JPC A;  1UHW A;  2PEX A;  4ESB A;  3BWG A;  3KZY A;  3F23 A;  1RUO A;  1FP2 A;  4ENK A;  4A5N A;  4ETS A;  1G3W A;  4OOI A;  4EM1 A;  1QGP A;  1JE8 A;  1R23 A;  2VN2 A;  4UV8 A;  4CHU A;  3FXR A;  3M1E A;  4L0Y B;  4MEY F;  2D2W A;  1SD4 A;  2RKH A;  4PZJ A;  2YPR A;  1R5G A;  5H20 A;  1OR7 A;  2DW4 A;  1KQ8 A;  4Z2Y A;  5HLH A;  1JXS A;  2GA1 A;  5DCM A;  2XRN A;  4HDU A;  2MH2 A;  1FSH A;  2KIU A;  1AOY A;  3EET A;  2QQB A;  3S2W A;  5J8F A;  2EA4 A;  1BI1 A;  1I1S A;  4R8H A;  3ERE D;  4R79 A;  1G6N A;  4FT8 A;  1D8J A;  3MQ0 A;  5JVT A;  4CDG A;  1STZ A;  3KLO A;  2MBF A;  5E1X A;  5D4R A;  2A6E F;  2PJP A;  1IW7 F;  1TQP A;  1FX7 A;  4ZYE A;  2OU2 A;  3IKV A;  1MJB A;  3VOE A;  3GVA A;  3LAJ A;  1TBX A;  4ON0 A;  2E1C A;  3TO6 A;  2L02 A;  5E20 A;  4G7O F;  3DPT A;  2Q2E A;  1F1Z A;  2IJL A;  3T0Y A;  1BM9 A;  5E18 F;  1DDN A;  3P9I A;  3V7C A;  1GVJ A;  2V6C A;  2FBK A;  2QBY A;  2H09 A;  3HTS B;  2IVM A;  1XGM A;  2V9V A;  3HOT A;  2ELH A;  1DUX C;  5LHH A;  1R22 A;  3GFI A;  3T8R A;  5ICF A;  3QU6 A;  4WF2 A;  2V1X A;  3COA C;  2XAG A;  1XSX A;  1HQC A;  2FMY A;  2BBY A;  2KJB A;  3JW4 A;  1O3T A;  1KU2 A;  1OYW A;  3I53 A;  2ZNZ A;  1UCR A;  4HF0 A;  2M1B A;  2ZME B;  3VB2 A;  3R4K A;  4O6J A;  3L2C A;  4L9T A;  1ZG1 A;  4OMZ A;  4EM0 B;  3CO7 C;  3ML6 A;  4E70 A;  3F6V A;  1USS A;  1U3E M;  2P6T A;  5L3D A;  3WGG A;  4U0V A;  5DV5 A;  1ON2 A;  3EDP A;  1B9M A;  2K02 A;  1R1V A;  3QU3 A;  4LLL A;  3F6O A;  5D6F A;  5DDG A;  4S05 A;  1I1G A;  4IRG A;  5FD5 A;  3H92 A;  3FXU A;  2MC3 A;  2JSC A;  1EH8 A;  4A0Z A;  4NB5 A;  4L9N A;  1ULY A;  2RC4 A;  1YLF A;  3LA7 A;  1R1T A;  5ICE A;  1HKT A;  2K86 A;  1OKR A;  4IJA A;  2HYG D;  3RKX A;  3QP5 A;  4D0P A;  4ESJ A;  3E5X A;  2CSO A;  1K78 B;  2DLL A;  2VBW A;  1FYM A;  2PI0 A;  4A0Y A;  2ZME A;  2OA4 A;  2R3S A;  2G9W A;  5FB2 A;  4BHC A;  1BI3 A;  1K78 A;  1XDU A;  2OD5 A;  5FLX Z;  1O57 A;  2HGC A;  1IZ1 A;  3RDI A;  5HLG A;  3M8E A;  4A6E A;  1P4W A;  1LJ9 A;  3LA3 A;  3WE3 A;  3J81 K;  1ZG5 A;  1TTY A;  3B02 A;  3TOA A;  4ESF A;  1PUE E;  3KP6 A;  2L01 A;  1R7J A;  2DTR A;  1J2X A;  4RB2 C;  3RJP A;  4N9I A;  4KN4 X;  3EYY A;  4HLY A;  2PG4 A;  5L3F A;  1U5T A;  2EJR A;  2DQR A;  3FHZ A;  3CDH A;  2XAF A;  3K9T A;  5D5U B;  4M72 A;  1YIO A;  3TDU C;  2YSR A;  4IHS A;  1R58 A;  2FML A;  3GW2 A;  3P9C A;  4L0Z B;  2XGX A;  2ADU A;  1CF7 B;  1RIO H;  4AIJ A;  1KU7 A;  3C1D A;  2HEO A;  3PFI A;  2MH9 A;  1U2W A;  3E5U A;  3ULQ B;  3EUH A;  1Z6R A;  4HW0 A;  3SZT A;  4KIF A;  4KYW A;  3R0J A;  4RS8 A;  1PDN C;  3QPT A;  4HBL A;  4WX9 A;  4HF1 A;  5IT9 Z;  5E8I A;  4MQ9 F;  1HKS A;  4YFX F;  1LEB A;  2DK8 A;  2VON A;  2IW5 A;  3FWE A;  4MHG A;  1L0O C;  1YS6 A;  2P8T A;  5D5W B;  4ZH4 F;  3L9F A;  2Q0O A;  1JGS A;  3MEX A;  1J75 A;  3R61 A;  5K5R A;  4XSZ F;  1E2X A;  1FNN A;  4GCV A;  3HSE A;  1DPR A;  1T39 A;  1REP C;  2DAO A;  3BP8 A;  3L09 A;  3DEU A;  4YIF A;  1QQI A;  2KIM A;  2BV6 A;  3HRT A;  1G3Y A;  5LHI A;  1OYI A;  3T8T A;  1IN7 A;  2DPU A;  1BOA A;  1T2K A;  1GHC A;  5BPI A;  3QAH A;  3J81 Z;  2ZXJ A;  1BJA A;  2NS0 A;  3DPL C;  1SMT A;  4EJT A;  2VT3 A;  4PGG A;  1BN5 A;  4LB5 A;  1TW3 A;  1OPC A;  1B6A A;  4G6Q A;  4CYD A;  4L5J A;  4EVI A;  4YG2 F;  2QZ8 A;  2QQ9 A;  2LF7 A;  3HRM A;  4BHB A;  2VBX A;  3P7N A;  3BY6 A;  2ZNY A;  4P5O A;  4OIQ F;  4WXD A;  3EQL F;  4CO8 A;  2EV6 A;  2STW A;  1HSJ A;  3GF2 A;  1J59 A;  2WTE A;  4LLG F;  3FF5 A;  1TQI A;  3ABT A;  4WCG A;  1F4K A;  4G9Y A;  3GO5 A;  2Y75 A;  3GUD A;  2ZKZ A;  4XRF A;  2HQN A;  1P4A A;  2JTV A;  5L3G A;  3V8K A;  5KK1 A;  2KIF A;  1S29 A;  1SAX A;  2AS5 F;  2EFO A;  1Q1H A;  1XGS A;  1ZGA A;  4I0A A;  3F8C A;  1P92 A;  2Z99 A;  2NYX A;  2EFQ A;  2EFN A;  3CLO A;  4HV5 A;  2A68 F;  3HRS A;  4OIP F;  4LG0 B;  3M9A A;  1T0F A;  4Q4Z F;  1QO0 D;  1W7P B;  2Y48 A;  3GLX A;  4I02 A;  5BMZ A;  1FBU A;  4KDP A;  4WXH A;  2D1V A;  1R1U A;  4IRI A;  5EEH A;  3FM5 A;  1KA8 A;  1SD5 A;  1W4M A;  3IWZ A;  2P5K A;  4Y17 A;  1XMK A;  2OBP A;  2YR2 A;  1SMY F;  3I59 B;  1S6L A;  1ZLK A;  1HKQ A;  4BH9 A;  3WG9 A;  4U88 A;  2IT0 A;  3C18 A;  4XLN F;  4DNC A;  2L54 A;  1FLI A;  2Z33 A;  1D5V A;  4LFU A;  2IRF G;  3ZN0 A;  4GYI A;  5AIQ A;  2QLZ A;  2FRH A;  2MLG A;  3BJO A;  3H3U A;  5CVV A;  4GYG A;  3B73 A;  1W5S A;  2PQ8 A;  2D45 A;  1Y0U A;  1IXS B;  2VE8 A;  1QZY A;  1ZHF A;  4I98 B;  3R0A A;  2WWY A;  1FC3 A;  1P2F A;  4PDK A;  4NHJ A;  2DPD A;  1R00 A;  2M30 A;  3IHU A;  3DQV C;  4AIH A;  2UXN A;  1HW2 A;  2A61 A;  3RYR A;  4KIC A;  3U1D A;  2LNB A;  3HSR A;  1YW7 A;  2FXA A;  4HQM A;  2WC2 A;  3RPQ A;  2RGV A;  3WTU C;  4BHP A;  5FFX A;  3HHH A;  1O7F A;  2FNA A;  4EMS A;  4G8X A;  2YU3 A;  1AWC A;  1BC7 C;  3I58 A;  2J5O A;  3G3Z A;  2IA2 A;  3HIF A;  3HSF A;  4BYY A;  2DT5 A;  1W5T A;  5H6Q A;  3GX4 X;  2RN7 A;  5LGN A;  2MLK A;  3GYH X;  2W85 A;  4A5M A;  5LHG A;  1HBX G;  3WGI A;  2UZK A;  1MKM A;  4KT5 C;  2H27 A;  5K5O A;  5BS6 A;  5FFZ A;  2HWV A;  2V1U A;  2GZW A;  4OIR F;  4RB0 A;  1IN8 A;  4RGR A;  3SXY A;  3HOS A;  3BDD A;  3LWF A;  5DCF A;  1FZP B;  3IRR A;  4FHT A;  3BPX A;  4BNC A;  1SD7 A;  3GFM A;  3WE2 A;  2XV4 S;  3MZH A;  1T98 A;  2OZU A;  2HTJ A;  2O3F A;  3ECH A;  3OOP A;  1YG2 A;  2QQA A;  3LA2 A;  2HKO A;  3M7G A;  2PMH A;  1RI7 A;  4DQ2 A;  3I5U A;  4P55 A;  1IAW A;  1Z6T A;  2RVC A;  3KCC A;  1U8R A;  2RV8 A;  2O03 A;  3ROU A;  1F9N A;  4RB3 C;  4CXF A;  3LQQ A;  1E17 A;  5HS9 A;  2JZY A;  5FD6 A;  4ASN A;  4HQE A;  1MD0 A;  3N97 A;  5ILS A;  1LNW A;  2FNP A;  4M9Z A;  4OIO F;  2G7H A;  2UWM A;  1YW8 A;  3WU0 A;  2CG4 A;  4ENJ A;  2GXG A;  2MA3 A;  1D3Y A;  2TDX A;  3C7J A;  3BJ6 A;  5LLQ A;  4UVB A;  4QLC U;  3L00 A;  3KEO A;  4EJW A;  1YS7 A;  3P9K A;  3KFW X;  3OV8 A;  3FMQ A;  5HDN A;  3REO A;  1QNT A;  2ZBK A;  1TW2 A;  2IP2 A;  1B4A A;  4HYE A;  3K2Z A;  3JAM Z;  3SZP A;  3ZMD A;  2R7D A;  2VT2 A;  4KUM A;  1WKM A;  1SD6 A;  1KQ9 A;  2PN6 A;  2COM A;  3WGH A;  4HAM A;  1NHA A;  4U7B A;  2Y0M A;  2ZFW A;  3H3Z A;  5F6F A;  4L9V A;  1WQ2 A;  4IF4 A;  3V8L A;  5ED4 A;  3GFJ A;  1XGO A;  1TQM A;  4HX8 A;  2Z9O A;  1Z05 A;  5TRD A;  1UFM A;  2KKO A;  1B9N A;  1QPM A;  4EV0 A;  1FPQ A;  3IRQ A;  3NEU A;  3JSP A;  4JBA A;  1BI2 A;  1I27 A;  2W57 A;  4N0B A;  2NRA C;  2M87 A;  4JK1 X;  5IT3 A;  1S3J A;  4G6D A;  2Z5U A;  4KMU X;  1T6S A;  5HS8 A;  5E8G A;  2OAZ A;  4HLX A;  1ZRF A;  3LQR A;  2NNY A;  4Q47 A;  2QBY B;  2DFI A;  3ZP5 A;  3FMS A;  3MAJ A;  1LDD A;  3JSO A;  1XDS A;  3C3W A;  2MD5 A;  3SHF A;  2GIV A;  1GXP A;  1UST A;  2FE3 A;  2XAS A;  1ZLJ A;  4EM2 A;  3DKW A;  5F1R A;  3MWM A;  4NQW A;  4ZZD A;  1ZYR F;  1J5Y A;  1U5T B;  2XAH A;  1CGP A;  1SFE A;  4FX0 A;  1QZZ A;  1U78 A;  1XN7 A;  2CW0 F;  2LSO A;  5DUI A;  2EB7 A;  5JR3 A;  4RB1 A;  4A0X A;  1I5Z A;  1BIB A;  3E6M A;  1UHM A;  3F8N A;  5E1W A;  2ZCW A;  4LB6 B;  3Q9V A;  5CVJ A;  3QPH A;  3BRO A;  4H0E A;  1K79 A;  5ICC A;  2FU4 A;  3WTY C;  2R7F A;  2PMU A;  5L3E A;  3DXJ F;  1JHH A;  4OU0 A;  2G7U A;  2O6G E;  2A3S A;  2VC0 A;  4I01 A;  3I71 A;  1FWZ A;  2QUF A;  2DBB A;  1EH7 A;  5DD4 A;  4GO1 A;  1W7P D;  1FOK A;  2K4J A;  2ISY A;  5FLX K;  3ISP A;  2XAJ A;  1XSD A;  1P4X A;  3O6B B;  1HXD A;  2QVO A;  3K69 A;  2V1D A;  3RTR A;  1J7K A;  2HTS A;  2B0L A;  4G7H F;  1S7O A;  1TNT A;  3E6D A;  1FBS A;  3K1P A;  3F21 A;  3GZ6 A;  5LRS A;  3U2R A;  1ZRE A;  1K7A A;  1L3L A;  5CVR A;  4YFN F;  4RGS A;  3ZMS A;  3GEZ A;  3ZN1 A;  1FT9 A;  3W6K B;  3MFK A;  3KP2 A;  1BIA A;  1EH6 A;  1LB2 A;  4O5V A;  4P9U A;  4MTD A;  2KRF A;  1RUN A;  4LD5 A;  2HZT A;  4Q48 A;  4CIC A;  4RGX A;  2EV0 A;  3KE2 A;  3KLN A;  2HKX A;  2JPB A;  2CGP A;  1IUY A;  3HRU A;  2XAQ A;  4IRH A;  2FBI A;  4WK8 F;  3E97 A;  2P5L C;  5IT9 K;  3W6J B;  3WOD F;  4PCQ A;  1G4D A;  2DQL A;  4M9S A;  4KIG A;  2ACJ A;  1F5T A;  3FZV A;  2K4B A;  3F22 A;  3E6C C;  1U5T C;  4BXU A;  2FA5 A;  1GXQ A;  4ZZL A;  3J80 K;  4KIB A;  1P6R A;  3J80 Z;  2XIG A;  4I2O A;  2PFB A;  1DPU A;  1MZB A;  2BEO A;  1VTN C;  1LQ1 A;  3SFZ A;  1ZG3 A;  5AIP A;  1FY7 A;  4LK1 F;  3I4P A;  4MEX F;  4BQA A;  3TKY A;  5L3B A;  6PAX A;  1O3Q A;  2W25 A;  2CWE A;  1MJ9 A;  3R60 A;  3KZZ A;  1OYY A;  1UB9 A;  5LGT A;  4YFK F;  3RI4 A;  4G94 A;  1XGN A;  3LFK A;  4I09 A;  3LAP A;  5A2Q K;  4R1H A;  1KQ0 A;  2H6B A;  5CVU A;  4OMY A;  1MGT A;  2O61 A;  2HR3 A;  2EFP A;  3QOP A;  1CF7 A;  4M74 A;  2STT A;  4BAY A;  4M71 A;  2EA2 A;  3LST A;  5HLI A;  4A2U A;  3IL2 A;  1A04 A;  1WI9 A;  3ABU A;  4HX4 A;  4GGG A;  3RKY A;  3M8F A;  4PGH A;  5FO5 A;  4L5I A;  1WWX A;  2X4H A;  5DUK A;  1YTY A;  1PP8 F;  1G3T A;  2GAU A;  2K27 A;  3BOQ A;  3ZQ7 A;  2GQQ A;  1KGS A;  3IKT A;  4U0Y A;  3JTG A;  5E1Z B;  5J8C A;  1S7A A;  2ISZ A;  2VOD A;  3KEQ A;  3RKW A;  5K5Q A;  1XD7 A;  3F72 A;  3J7A O;  2OZ6 A;  4EQQ A;  1R36 A;  2P7V B;  1LDJ A;  2J5P A;  1XCV A;  5D4S A;  4G7Z F;  1XMA A;  4UV9 A;  4AVP A;  5BOX A;  5DCM B;  1OMI A;  3V7R A;  4M9X A;  4AWX B;  4S04 A;  4XSX F;  1KYZ A;  5ILU A;  4HDV A;  3WTX C;  2DO7 A;  3U9G A;  2BE5 F;  3SQN A;  4FX4 A;  1FSE A;  5HOO A;  5CVI A;  1LVA A;  2F2E A;  1BBY A;  2P4W A;  2XKO A;  2GA2 A;  1ZN2 A;  3ZMV A;  1RZ4 A;  4M73 A;  1ONV A;  1J0R A;  1KU9 A;  3GXO A;  1JHF A;  1S8N A;  5AON A;  2VOP A;  1X3U A;  4L18 B;  2HYF A;  3E5Q A;  2BGC A;  2VC1 A;  3ZMZ A;  3EYI A;  1QBJ A;  2EFW A;  1EV7 A;  2K7L A;  1Z9C A;  2L4A A;  4B09 A;  4LMY A;  2HFH A;  4A12 A;  2QM3 A;  2YX4 A;  2LDU A;  5D5X B;  2FF4 A;  2VBZ A;  3F8B A;  4KA4 A;  3VFZ A;  2ZJ2 A;  3RYP A;  2KJC A;  4AIK A;  2E7W A;  1LEA A;  2IA1 A;  2JRT A;  1ZGJ A;  2CFX A;  4ENN A;  1ON1 A;  1FYK A;  1BI0 A;  4WWC A;  3KET A;  4EJO A;  5KVR A;  3HYI A;  2D1H A;  3D0S A;  3IC7 A;  2ESN A;  2AXL A;  4M6X A;  3O3K A;  3TDZ C;  4YII A;  3DF8 A;  2ETH A;  3WTW C;  3ZMU A;  3NQO A;  3TO7 A;  1IXR C;  1R5H A;  1V4R A;  5D6E A;  4EJV A;  2Q8K A;  4IXA A;  2F5C A;  1BC8 C;  4K2E A;  3DV8 A; 
#chains in the Genus database with same CATH topology
 2A6H F;  1D0Z A;  3GZ5 A;  3GBG A;  5DYM A;  1FYL A;  5DEQ A;  4HST A;  2XHK A;  1Z91 A;  3GTG J;  1O3R A;  2OQR A;  1PP7 U;  3CD6 I;  2KZG A;  1Z1D A;  1IN5 A;  1H0M A;  2ID6 A;  5LEK A;  4D7N A;  2W00 A;  2A07 F;  2VPR A;  4BBR J;  4XID A;  3KP5 A;  1IF1 A;  4I7H A;  5L3C A;  3U21 A;  1ORK A;  2ZO4 A;  3ZOB A;  4FQG A;  2X0L A;  5BQT A;  4HF2 A;  2CJJ A;  3I56 I;  1WPK A;  1FBQ A;  4UHT A;  1MMD A;  1SVM A;  3NRV A;  2HDC A;  4XLC A;  1I6X A;  4NDL A;  2H6C A;  3BR5 A;  4RAZ A;  1IN4 A;  4PFP A;  2CUJ A;  3JTH A;  3D5L A;  2VQG A;  2IPQ X;  3SFI A;  4XMY A;  1IRX A;  2F5D A;  2VXZ A;  4HOB A;  5TJJ A;  2DYR H;  4A3I J;  1TWH J;  1MDM B;  1EJ9 A;  5C4X J;  2F4M B;  3A01 A;  4Y13 A;  1XSV A;  4U7D A;  5ILV A;  2E2J J;  1OCC H;  5HVQ C;  4A3G J;  2F4I A;  2MC4 A;  1PUF B;  2MFZ A;  2L9R A;  1WVR A;  2Z3Y A;  1X4O A;  2VE9 A;  4CZZ A;  5EEG A;  1KYW A;  2NNN A;  3Q5F A;  1XG1 A;  3TOB A;  3OS1 A;  3BR6 A;  1YHQ I;  2HQR A;  1ZAO A;  3CUQ A;  2I10 A;  3V7S A;  3GTQ J;  4F7Z A;  3AG2 H;  3A02 A;  2HOE A;  4E4H A;  3K4J A;  3WTS C;  3KP3 A;  4E7S A;  4KFC A;  2FSW A;  3QQA A;  1MMN A;  3FXJ A;  1OFC X;  2XSJ C;  3GWZ A;  3CUO A;  3HHG A;  4E7Z A;  3C2B A;  1H9G A;  2XPU A;  1YO5 C;  3BTI A;  3K1N A;  4N9H A;  2CUF A;  2O7O A;  2W24 A;  1RPW A;  2R7S A;  2XC7 A;  1A5J A;  3HEF A;  3E3V A;  4U87 A;  4BQO A;  4QSH A;  2CYY A;  1H8A C;  3VYS B;  2O0Y A;  4JQF A;  1DP7 P;  3H3V K;  1UG0 A;  2EQR A;  4M3E A;  2R7X A;  3K0L A;  4WXC A;  3JAM K;  4XBF A;  4XIC A;  3BG9 A;  4P9F A;  1MMS A;  3ZMT A;  4ZYD A;  2MGQ A;  5JFR A;  3CJN A;  2KDZ A;  2FBH A;  1IRG A;  3EUA A;  1YQA A;  2BY2 A;  4KMF A;  3AL0 C;  3CTA A;  2M45 A;  5CYV A;  5DM6 F;  1OCT C;  5B5E C;  3SYT A;  4AD9 A;  2NVU B;  1G3S A;  2W84 A;  3TGN A;  1FP1 D;  2PJR A;  4BAC A;  4UVC A;  1B1B A;  5D5V B;  5F08 A;  4GFB A;  4U0W A;  1ZH5 A;  2R5Y B;  1IN6 A;  4HX7 A;  2EK5 A;  1MJA A;  3BPV A;  3RCO A;  4B47 A;  5BPD A;  3R6S A;  2EWN A;  3ABK H;  1VQ6 I;  2XSD C;  4A6D A;  4QPQ A;  1Z3X A;  3CCV I;  3CO6 C;  3BC8 A;  1UZC A;  4XKV A;  2NXN B;  3BTL A;  3OL3 A;  4MO7 A;  1N25 A;  4S0H B;  4LK0 F;  4P96 A;  4ENM A;  2B63 J;  3ELK A;  1SAU A;  3I0T A;  4RAF A;  5FKO A;  2WAQ A;  2IA0 A;  3CUQ C;  5J1R A;  3CMA I;  1K6Y A;  4EGY A;  3HOU J;  1XCB A;  2E7X A;  3WU1 B;  3CDL A;  1ITY A;  4X0G A;  1A31 A;  3QRF F;  1G8X A;  4ZYG A;  1YIT I;  2XKP A;  4KNY A;  3ESW B;  4ZYH A;  3KP7 A;  5LD2 C;  3LSM A;  2ECB A;  2GOX B;  4MNU A;  4TV7 A;  3HOY J;  1G2H A;  5HS7 A;  4EGZ A;  2VJI A;  1OLT A;  2P7C B;  4AU7 A;  1VFC A;  2Z2S B;  4IL6 C;  2XRO A;  2R92 J;  1WSU A;  2DOA A;  1O3S A;  3FKI J;  2IS2 A;  3CZ6 A;  2M8E A;  2F5E A;  3MCZ A;  3AAF A;  2XAU A;  4IHT A;  2CW7 A;  2RNJ A;  4MQV A;  2OC6 A;  2RQP A;  1ZAR A;  2LF8 A;  2DK5 A;  2QYO A;  4IVN A;  2YX7 A;  4HA8 A;  3WTZ A;  1T8I A;  4E7L A;  9ANT A;  2LK2 A;  2UV1 A;  1UG2 A;  5D8L B;  3OS2 A;  3G73 A;  1H9T A;  1D0X A;  1YFH A;  2JT1 A;  5ICG A;  2WV0 A;  1SFX A;  3DFG A;  3IH4 A;  5D8K B;  1C0W A;  3QP6 A;  2PMZ N;  5C3E J;  4M6Y A;  1FTT A;  3DP7 A;  3IWF A;  5H6R A;  2CO5 A;  1D8K A;  2CQK A;  1HW1 A;  1BC8 C;  2KL4 A;  5E17 F;  5LGU A;  3FXK A;  5LEJ A;  2EV5 A;  2H8W A;  2E1N A;  3GME A;  2HOA A;  2DU9 A;  4I0B A;  5JI6 A;  2H94 A;  4UNO A;  2DA7 A;  5HDG A;  5K1Y A;  1MBH A;  2BVL A;  2WAD A;  4UUV A;  3ECO A;  5IPA A;  2OTJ I;  2P6S A;  4XRS G;  3AFH A;  4ZJZ A;  2OQG A;  4DBQ A;  1I6H J;  2BHZ A;  4Z6Y A;  4B8X A;  2A5Y B;  1B59 A;  3ZPL A;  1MNM C;  2GIZ A;  1MH3 A;  5LRR A;  1MBE A;  2LVS A;  3VPR A;  3PO2 J;  1W36 D;  2VKE A;  3ZQC A;  4YRV A;  4LIT A;  4IO9 F;  2DA2 A;  1IV8 A;  4MGR A;  3V8J A;  2VKV A;  1HW5 A;  4DOZ A;  1KON A;  3CMY A;  1XB4 A;  2CFO A;  2LBF A;  5IYD J;  3NWS A;  5DTD A;  3CUQ B;  1U6G A;  4AYB A;  5LBQ A;  4DZP A;  4LGW A;  2NAZ A;  2O8X A;  3PQJ A;  3E6B A;  4E7J A;  2Y69 H;  3PNT A;  1Z7U A;  1ZRD A;  4G12 A;  2HQ5 A;  3K4N A;  3OYB A;  2CRG A;  1E3P A;  3F8M A;  1WI3 A;  1MNE A;  1ODD A;  3BZ6 A;  3LFU A;  3V4G A;  3HM5 A;  2NS8 A;  1KU3 A;  2P5V A;  3TED A;  5KAF C;  4BE0 A;  3FMR A;  1HST A;  2PBI A;  2XVC A;  1VQ9 I;  5DD8 A;  4B3A A;  4CZC A;  1LDK B;  4B1R A;  3H5R A;  2ME6 A;  3OMY A;  4L9J A;  3JRB A;  1K83 J;  5F0H A;  4QWQ A;  3BJA A;  3IV5 A;  3PSF A;  2IXS A;  2QWW A;  3F3X A;  3T5X A;  4Y15 A;  1O7L A;  1W5C C;  4AM3 A;  2FOK A;  4CGZ A;  3PUB A;  3F8F A;  2EH3 A;  5FKL A;  2ESH A;  4XLE A;  3SDB A;  4BJ5 C;  2A69 F;  4UUS B;  1ETV A;  2KP6 A;  1V5F A;  4FTH A;  3PQK A;  1QVT A;  3K10 A;  1MDM A;  2RDP A;  2K9N A;  3O2P E;  4OIN F;  4LLN A;  1W7P A;  3ERM A;  2V79 A;  4Y7N J;  4PK4 A;  4EJU A;  1OCP A;  2LKP A;  2QEN A;  4BDZ A;  3N4M A;  1TC3 C;  2C6Y A;  2RQQ A;  2VKH A;  5CKT A;  3KP4 A;  3MVP A;  4X1E A;  1TLH B;  1X2M A;  3MKW B;  2L3D A;  4LJZ F;  3HTU A;  3HG9 A;  1TWF J;  4HNV A;  2OJE D;  2DMT A;  2F5F A;  1E3H A;  2KDO A;  2X48 A;  2HS5 A;  2DOE A;  2Y2Z A;  4B3X A;  1VQK I;  2P0W A;  1ZK8 A;  2VBY A;  3H5N A;  2QGU A;  4RLF A;  3BTJ A;  4GXO A;  5F64 A;  3TQN A;  2DI3 A;  1RNL A;  2K85 A;  3NWT A;  5GAE J;  2YU9 J;  3ZQQ A;  3MKY B;  3GTP J;  1FOX A;  1TWC J;  2O5R A;  1ZRC A;  1YJ9 I;  1QU3 A;  2BYV E;  2NVY J;  3E7L A;  1H89 C;  2VOO A;  4IEJ A;  5ERI A;  3L7W A;  3LSR A;  1V55 H;  4HRI A;  3MMY B;  2GXB A;  3M07 A;  4RGU A;  1NG7 A;  2L9S A;  2K9S A;  3DKY A;  4O3M A;  3VYU B;  2NVT J;  4HV6 A;  2CMP A;  3RPU A;  4DIQ A;  5CLS A;  2VL8 A;  3G1M A;  5JHU A;  3G2B A;  3E1S A;  3WTT C;  2XGC A;  1E3O C;  3CJR B;  4XLP F;  3H9Q A;  3HUG A;  2UXX A;  1T38 A;  1E0E A;  1YYV A;  1K6O A;  4MTE A;  3WTV C;  3K1M A;  4XOR A;  3GFL A;  3E0J B;  4AC0 A;  2EZH A;  3ZQG A;  4FET A;  4ITV A;  2MSY A;  3OSG A;  3MKL A;  4UVA A;  2B9S A;  3ASO H;  3OYH A;  1WRJ A;  3TO9 A;  1SFU A;  2TCT A;  3VSK A;  3T1B A;  5E79 C;  2DFH A;  3OYL A;  3CCJ I;  1IRF A;  3OR2 C;  1T95 A;  3H1C A;  4HZF A;  4ZTJ A;  3I54 A;  2MD0 A;  3BG3 A;  4A3K J;  4LG0 A;  1B72 B;  3G1L A;  4EAT A;  2FOW A;  3DEE A;  5FGM A;  3Q9S A;  1TNS A;  2K9L A;  2KQR A;  3QOE A;  4M3F A;  2ELJ A;  1IXC A;  2GWR A;  2ELK A;  3S93 A;  2VLA A;  3PIO F;  5CJ9 A;  1TWG J;  2DA1 A;  3VOD A;  5HNF A;  2FQ3 A;  2IS1 A;  3RIR A;  4IOC F;  3FX3 A;  2M5W A;  3FM3 A;  2L4M A;  2F4O B;  5M5Y J;  3VEP A;  1K61 A;  1Y8R B;  5J6X A;  4KN7 X;  2FEZ A;  5HDK A;  5A2Q Z;  5GAG J;  3LSK A;  1YW9 A;  1LFU P;  2N8G A;  1ZR4 A;  3I59 A;  3I64 A;  4L5E A;  4IPA A;  2CV0 A;  2PLY A;  2KPM A;  3S14 J;  3MZY A;  4UXN A;  4Q5S F;  4RAY A;  1XX5 A;  4OAZ A;  1J9I A;  3FXQ A;  4CCL A;  1V3F A;  2XUB A;  4BBS J;  2JPC A;  1UHW A;  2PEX A;  4ESB A;  2CU7 A;  3K4C A;  4YEJ A;  1NH3 A;  1V5E A;  4XKB A;  4UUS A;  5HOD A;  3ONQ A;  3BWG A;  3KZY A;  3F23 A;  4J00 A;  3KEY A;  1W36 C;  1RUO A;  1FP2 A;  4KT6 A;  1F36 A;  2OUM A;  3FKJ A;  4ENK A;  2QQ8 A;  1ZR2 A;  1LUJ B;  2FQ4 A;  3SZG A;  4A5N A;  1MSF C;  2DDA A;  2FD5 A;  2EZK A;  4ETS A;  1G3W A;  3ZCO A;  2WBM A;  3HOZ J;  2BY3 A;  4OOI A;  4EM1 A;  2LTP A;  1P9Q C;  3O8G A;  3HGY A;  3FBI B;  1QGP A;  1JE8 A;  1R23 A;  2LLK A;  2VN2 A;  4UV8 A;  4CHU A;  3FXR A;  1S7E A;  4E7K A;  3M1E A;  1Z21 A;  4L0Y B;  2KRH A;  4ZDP A;  4MEY F;  3RQ4 A;  2D2W A;  1ZEL A;  5EDN A;  1SD4 A;  2RKH A;  4PZJ A;  2JA8 J;  4D9J A;  2YPR A;  1MH4 A;  1R5G A;  5H20 A;  3QPL A;  3AG3 H;  1OR7 A;  2DW4 A;  1KQ8 A;  1LE8 A;  4Z2Y A;  4A3D J;  5HLH A;  1R9T J;  1JXS A;  2GA1 A;  3A03 A;  2XRN A;  5DCM A;  4CYC A;  3L2Q A;  4A3F J;  3GTK J;  2ZME C;  4HDU A;  2MH2 A;  3CF2 A;  1FSH A;  2KIU A;  1AOY A;  3EET A;  3CJQ B;  3CJT B;  2QQB A;  1ETW A;  3LOC A;  3S2W A;  1GV2 A;  2EA4 A;  1BI1 A;  1J09 A;  5J8F A;  3RSN A;  2DFE A;  1I1S A;  4R8H A;  5J1U A;  3ERE D;  4R79 A;  1G6N A;  2PMZ A;  1FOY A;  4FT8 A;  2KMU A;  2M2E A;  5E3O A;  1OJL A;  1D8J A;  3MQ0 A;  5JVT A;  4CDG A;  1STZ A;  3KLO A;  2MBF A;  5E1X A;  5D4R A;  2A6E F;  2PJP A;  1IW7 F;  1TQP A;  2LKX A;  4IHY A;  1RES A;  1FX7 A;  4ZYE A;  5FRM A;  2OU2 A;  3IKV A;  1MJB A;  2EIJ H;  3VOE A;  1D1B A;  2HOS A;  3GVA A;  3LAJ A;  2M34 A;  1HCR A;  1W0U A;  1TBX A;  2IGO A;  2E71 A;  4ON0 A;  2BVM A;  3TO6 A;  2L02 A;  2E1C A;  2E1M B;  3OL4 A;  5E20 A;  2IGM A;  4G7O F;  3DPT A;  2Q2E A;  1F1Z A;  2IJL A;  2CUE A;  2VJJ A;  3T0Y A;  3CP2 A;  1BM9 A;  5E18 F;  3RKQ A;  1ZTR A;  3S8P A;  1RR8 C;  2L7K A;  5EZG A;  1DDN A;  3P9I A;  3V7C A;  1GVJ A;  2V6C A;  2FBK A;  4XLA A;  4FE4 A;  2QBY A;  2H09 A;  3HTS B;  2IVM A;  1XGM A;  2V9V A;  3HOT A;  2ELH A;  3HPH A;  1DUX C;  5LHH A;  1OCZ H;  2V7F A;  2HDD A;  2LRE A;  1R22 A;  1ETQ A;  1U9N A;  3GFI A;  3T8R A;  4DYC A;  5ICF A;  3QU6 A;  4WF2 A;  2V1X A;  1X1C A;  1JT6 A;  4DGW B;  3COA C;  2XAG A;  1LE8 B;  1XSX A;  1HQC A;  2FMY A;  3K2A A;  3K4L A;  4QIW N;  2BBY A;  2KJB A;  4V19 K;  2G0E A;  4HEA 2;  3OYG A;  2M4G A;  2L0K A;  3JW4 A;  1O3T A;  1KU2 A;  1EA3 A;  2Y0S A;  4C2U A;  1OYW A;  3I53 A;  2ZNZ A;  2VJ4 A;  3U1K A;  1UCR A;  4XKC A;  1O4X A;  4HF0 A;  3MD2 A;  1X1B A;  2M1B A;  2ZME B;  3VB2 A;  3R4K A;  1JKP C;  4O6J A;  5HLT A;  3L2C A;  3DBR B;  2WY7 Q;  3VSL A;  1A35 A;  4L9T A;  3RPU D;  1ZG1 A;  4OMZ A;  3M8J A;  4EM0 B;  4W97 A;  3CO7 C;  3ML6 A;  4E70 A;  3F6V A;  1USS A;  1U3E M;  3TW7 A;  2P6T A;  1GVD A;  3EPZ A;  3LSH A;  4JYK A;  4U0V A;  5DV5 A;  1ON2 A;  3EDP A;  1B9M A;  5L3D A;  3WGG A;  2K02 A;  2ZJQ F;  1R1V A;  3HPG A;  3QU3 A;  4LLL A;  3F6O A;  5D6F A;  5DDG A;  4N4O B;  4S05 A;  1I1G A;  1JUP A;  2HI3 A;  4IRG A;  5FD5 A;  4RM3 A;  5EG0 A;  1OR7 C;  3H92 A;  1FJL A;  3FXU A;  2AQE A;  4CCN A;  4P1W A;  2COB A;  3TW6 A;  1S72 I;  2MC3 A;  2JSC A;  4RLQ A;  1EH8 A;  5EJC A;  2V26 A;  2ZXH A;  1R4N B;  4A0Z A;  4NB5 A;  4L9N A;  1ULY A;  2RC4 A;  5J4Y A;  5J47 A;  5GP9 A;  1YLF A;  2VI6 A;  3FDY A;  3LA7 A;  1R1T A;  5ICE A;  1AHD P;  2LRD A;  1R5I D;  1HKT A;  2NVQ J;  2K86 A;  1OKR A;  3HOW J;  2X6X A;  3PO3 J;  2OF7 A;  1FIP A;  2HQA A;  4M3D A;  2R7Q A;  1MMG A;  1VI0 A;  4IJA A;  2HYG D;  5K7H A;  3AKZ A;  3RKX A;  2LYC A;  4DW6 A;  3KPH A;  3QP5 A;  5F04 A;  4J01 A;  2E5N A;  4D0P A;  4ESJ A;  3E5X A;  1WJE A;  2CSO A;  2E19 A;  3S32 A;  1K78 B;  2HPM A;  1RRJ A;  3HXL A;  2DLL A;  3S2H J;  4RAG A;  3D5S C;  5TGT A;  1H88 C;  2VBW A;  1FYM A;  2PI0 A;  1BJZ A;  3JRD A;  5DM7 F;  1G59 A;  3KIO A;  2HZD A;  2K40 A;  4A0Y A;  3A01 B;  4BQN A;  3DLA A;  2ZME A;  2OA4 A;  2GBY A;  2R3S A;  2G9W A;  5FB2 A;  1EF4 A;  4BHC A;  1BI3 A;  1XDU A;  1K78 A;  2LC2 A;  2OD5 A;  5FLX Z;  1O57 A;  2K3P A;  2HGC A;  1TZL A;  2XPV A;  1IZ1 A;  1JI8 A;  1I3Q J;  2DCE A;  4KIS A;  1X2N A;  4RDU A;  3RDI A;  5HLG A;  3M8E A;  4A6E A;  1P4W A;  5IYB J;  3NAR A;  1LJ9 A;  3LA3 A;  3WE3 A;  5EG0 B;  3DWL E;  3J81 K;  1ZG5 A;  1HOM A;  1TTY A;  3B02 A;  4LOC A;  3C2H A;  3TOA A;  1D5Y A;  2ZFU A;  1MMA A;  1R6R A;  4ESF A;  3IP4 B;  1MSE C;  2BW3 B;  1PUE E;  3KP6 A;  4CA0 A;  2L01 A;  3ZXS A;  2AQF A;  1R7J A;  2DTR A;  4JP0 A;  1VQ7 I;  2DXI A;  1J2X A;  4CCJ A;  4RB2 C;  1WJB A;  2VB6 A;  5J1Y A;  3TP0 A;  1DGW Y;  2VPL A;  3RJP A;  4ZTF A;  3K7A J;  2XF6 A;  4N9I A;  4KN4 X;  2ECC A;  3EYY A;  4HLY A;  2PG4 A;  4M6V A;  1UHS A;  1U5T A;  5L3F A;  2EJR A;  2E2I J;  2DQR A;  4BQQ A;  3FHZ A;  1VZ0 A;  3CDH A;  2DA5 A;  2XAF A;  3K9T A;  5D5U B;  4M72 A;  1YIO A;  2HVR A;  1NK2 P;  3TDU C;  2QKL B;  4XM3 A;  2YSR A;  4IHS A;  5JHF A;  3CCE I;  2VQC A;  1R58 A;  2FML A;  2VKD A;  3GW2 A;  2ZSH B;  3P9C A;  2XGX A;  4L0Z B;  2ADU A;  1N75 A;  5F1J A;  4Y4R A;  1YOV B;  1CF7 B;  1RIO H;  4AIJ A;  1KU7 A;  3C1D A;  2HEO A;  3PFI A;  2MH9 A;  1U2W A;  3E5U A;  3ULQ B;  3EUH A;  1YE9 A;  1Z6R A;  4HW0 A;  3SZT A;  2TRT A;  4KIF A;  4OAY A;  4KYW A;  3R0J A;  5LFA A;  4RS8 A;  1PDN C;  3QPT A;  2QCO A;  4HBL A;  4WX9 A;  4HF1 A;  2M0M A;  4FCY A;  5IT9 Z;  2E36 A;  5E8I A;  4MQ9 F;  2R93 J;  4XN0 A;  1HKS A;  3HB9 A;  2MG4 A;  4YFX F;  3KYC B;  3VWB A;  1LEB A;  2Q1Z B;  2HU9 A;  4IX7 A;  1UAA A;  4MFE A;  2DK8 A;  4RMN A;  2VON A;  2IW5 A;  3DTE A;  1APL C;  2AHQ A;  3FWE A;  4MHG A;  1L0O C;  1YS6 A;  2P8T A;  2V9K A;  3SDG A;  5D5W B;  1YIJ I;  3O8H A;  4ZH4 F;  3L9F A;  1IG7 A;  2Q0O A;  4FIS A;  1JGS A;  3MEX A;  1J75 A;  2IS4 A;  3R61 A;  5K5R A;  2JRM A;  4XSZ F;  1E2X A;  3QYF A;  1FNN A;  4GCV A;  5K7F A;  2JSP A;  3OIP A;  1QVU A;  3ZR8 X;  3HSE A;  2R7R A;  2JA7 J;  1DPR A;  2OCC H;  3CME I;  5IP9 J;  1IDY A;  1T39 A;  3DCF A;  5B66 C;  1XMX A;  2EIK H;  1X4P A;  2ZB9 A;  1B8I A;  5HNH A;  1REP C;  2DAO A;  1SFK A;  3CCU I;  3BP8 A;  3L09 A;  5M3M J;  2MW8 A;  3DEU A;  3B6A A;  3JRI A;  1Z7L A;  3Q3S A;  4YIF A;  1QQI A;  2FX0 A;  2KIM A;  2DOF A;  3LNQ A;  3I4N J;  2BV6 A;  1YI2 I;  3HRT A;  1G3Y A;  5LHI A;  1OYI A;  2O9L A;  4BY1 J;  3RQI A;  1ETY A;  3FK6 A;  4PSX A;  2NOG A;  3T8T A;  1Y1W J;  1IN7 A;  2E60 A;  2DPU A;  1Z77 A;  1BOA A;  2LBF B;  2H1K A;  1T2K A;  1GHC A;  2R4G A;  5BPI A;  3QAH A;  3J81 Z;  4EEF G;  2ZXJ A;  2L2O A;  4BJT A;  1BJA A;  3P5J A;  3S1M J;  3BR3 A;  3LMM A;  2NS0 A;  2X6W A;  4UY8 I;  3DPL C;  1SMT A;  4EJT A;  2VT3 A;  4PGG A;  2R7V A;  1S5L C;  3PIP F;  1BN5 A;  4LB5 A;  1TW3 A;  2EIN H;  1AKH A;  3I55 I;  1FTZ A;  4PJN A;  1WJD A;  1OPC A;  1B6A A;  4G6Q A;  4CYD A;  1A6I A;  4L5J A;  4EVI A;  4YG2 F;  2QZ8 A;  1U9O A;  2QQ9 A;  1JUM A;  1Y39 A;  3OIQ A;  4PJJ A;  2PX9 A;  2LF7 A;  3HRM A;  2DN0 A;  4BHB A;  2VBX A;  1Y1V J;  2LH9 A;  5FLV A;  3P7N A;  2X6O A;  1NG6 A;  3BY6 A;  2ZNY A;  1D0Y A;  3BZC A;  4P5O A;  4OIQ F;  4WXD A;  4E6K G;  3EQL F;  4CO8 A;  1A6Q A;  2HVQ A;  4II3 A;  5EZH A;  1SC7 A;  2EV6 A;  3CQZ J;  1OQY A;  2P81 A;  3LSG A;  2STW A;  1HSJ A;  3TBI A;  2KHM A;  1IRZ A;  3GF2 A;  1FMV A;  1HDP A;  2LKS A;  2JK3 A;  1J59 A;  4IHX A;  2WTE A;  4LLG F;  3OYC A;  3OYA A;  3FF5 A;  1TQI A;  3ABT A;  4WCG A;  4V2G A;  1F4K A;  4G9Y A;  5IOY A;  3GUD A;  2Y75 A;  3GO5 A;  2ZKZ A;  4XRF A;  2HQN A;  1P4A A;  5EGO B;  2JTV A;  3G6E I;  5L3G A;  3V8K A;  5KK1 A;  3QPS A;  2KIF A;  1S29 A;  1SAX A;  3OYM A;  2LY1 A;  2NVX J;  4BXF A;  2AS5 F;  2EFO A;  1Q1H A;  1XGS A;  1ZGA A;  2B7E A;  4I0A A;  3F8C A;  4ANJ A;  2WAF A;  1P92 A;  2Z99 A;  2NYX A;  2EFQ A;  2EFN A;  3CLO A;  4HV5 A;  2A68 F;  5IY5 H;  3HRS A;  4OIP F;  4LG0 B;  1PVE A;  2M7B A;  3L1P A;  1VND A;  1I3A A;  3GLL A;  3M9A A;  4BEH B;  4BXX J;  5EGO A;  1T0F A;  1R71 A;  3JCU C;  4Q4Z F;  2W4S A;  1K4S A;  1QO0 D;  2R5Z A;  3ABL H;  1W7P B;  2Y48 A;  3GLX A;  4JX6 A;  3OWT A;  1LFB A;  4I02 A;  1FBU A;  2DA3 A;  3KX2 A;  4D5C A;  5BMZ A;  4KDP A;  3MN2 A;  4WXH A;  3LSI A;  2D1V A;  1BL0 A;  1R1U A;  2XB0 X;  3JRA A;  2IEK A;  1RET A;  4IRI A;  2OCE A;  3BQY A;  5EEH A;  1QPI A;  2L7M P;  3G71 I;  3FM5 A;  2MYS A;  1D1A A;  2W48 A;  1KA8 A;  1SD5 A;  1W4M A;  3IWZ A;  2P5K A;  4Y17 A;  3SEQ A;  4D7M A;  3L2R A;  1XMK A;  2OBP A;  2YR2 A;  1SMY F;  3I59 B;  1S6L A;  1ZLK A;  4CCO A;  1HKQ A;  2YS9 A;  4BH9 A;  4B44 A;  2Y31 A;  3WG9 A;  3CLQ A;  2X1E A;  5KAI C;  4U88 A;  4BU2 A;  2IT0 A;  3C18 A;  4XLN F;  4DNC A;  1OIS A;  3DTI A;  2DOD A;  3VYR B;  4A3M J;  2L54 A;  3F9K A;  1FLI A;  2HOT A;  2Z33 A;  4KIT B;  1D5V A;  1BW6 A;  4LFU A;  2Z16 A;  1HLV A;  3ZN0 A;  4GYI A;  4KJZ A;  5AIQ A;  2QLZ A;  2IRF G;  2FRH A;  2MLG A;  3CCY A;  3BJO A;  3H3U A;  5CVV A;  1M1E B;  2BW3 A;  4GYG A;  3B73 A;  5K7Z A;  3OSF A;  1W5S A;  2PQ8 A;  2D45 A;  2DMP A;  1AKH B;  3MZ8 A;  1Y0U A;  1JTX A;  1IXS B;  4NBQ A;  2VE8 A;  4PFO A;  1RR7 A;  4CUG A;  4DJA A;  1QZY A;  1ZHF A;  4I98 B;  3QYB A;  2XDV A;  3R0A A;  4C9Y A;  2WWY A;  1FC3 A;  1P2F A;  4PDK A;  4NHJ A;  2DPD A;  1R00 A;  2M30 A;  1SFO J;  1F43 A;  1ETO A;  1VQO I;  3IHU A;  3DQV C;  3PUF A;  2K9Q A;  4AIH A;  2UXN A;  1HW2 A;  3KZI C;  3SEZ A;  2A61 A;  2GXA A;  3IH3 A;  4KIC A;  3RYR A;  3U1D A;  2KIQ A;  2LNB A;  3HSR A;  1YW7 A;  2FXA A;  2WY8 Q;  4HQM A;  2WC2 A;  3RPQ A;  1WZ2 A;  2RGV A;  3WTU C;  1IUF A;  2HVS A;  4ABZ A;  4BHP A;  5FFX A;  3HOV J;  2CW8 A;  5JLX A;  2BY0 A;  3HHH A;  2ZJR F;  1O7F A;  2FNA A;  4EMS A;  3HGG A;  4G8X A;  2YU3 A;  1AWC A;  3HKZ N;  2JWT A;  4PJ0 C;  1BC7 C;  2WV1 A;  3BR2 A;  3I58 A;  4XOP A;  1K4T A;  2J5O A;  3G3Z A;  2IA2 A;  3HIF A;  4V2F A;  2X51 A;  3PNY A;  1MW7 A;  3HSF A;  4BYY A;  2DT5 A;  1NTC A;  2D5V A;  1W5T A;  3HZJ A;  5H6Q A;  5KHD A;  4PUS A;  3GX4 X;  2RN7 A;  3RZD J;  1LPQ A;  5LGN A;  2X9D A;  2MLK A;  3GYH X;  2HNH A;  2W85 A;  2DMU A;  4A5M A;  5LHG A;  4RBO A;  1HBX G;  3WGI A;  2UZK A;  1MKM A;  4KT5 C;  2H27 A;  5K5O A;  5BS6 A;  4GRI A;  3J7Z I;  1TT5 B;  5FFZ A;  2HWV A;  3AG4 H;  2V1U A;  2GZW A;  4OIR F;  4RB0 A;  2LY2 A;  1IN8 A;  4RGR A;  4YIR X;  3SXY A;  4A3C J;  4MIM A;  3HOS A;  4NC6 A;  3BDD A;  4BKX A;  1BR2 A;  3LWF A;  5DCF A;  1FZP B;  1YRN A;  2NS7 A;  4IKF A;  3IRR A;  4FHT A;  1FMW A;  1IGN A;  5BNG A;  3BPX A;  4BNC A;  1SD7 A;  3GFM A;  3OR1 C;  4X6A J;  3GCM A;  4UUT A;  1HDD C;  3WE2 A;  2XV4 S;  3MZH A;  1T98 A;  3IAM 2;  1QA6 A;  1TT0 A;  2OZU A;  2HTJ A;  2O3F A;  3ECH A;  3BG7 A;  3OOP A;  4QPO A;  3C2G A;  1RKT A;  3J7Y J;  1YG2 A;  2XGD A;  4Y33 A;  2QQA A;  3LA2 A;  2A6T A;  4BDY A;  4E7I A;  3M4O J;  2HKO A;  2XF5 A;  3M7G A;  2PMH A;  1GLN A;  5GAH J;  4DYR A;  5B3S H;  3OYJ A;  1RI7 A;  4DQ2 A;  1CQT A;  1NK3 P;  2H1L A;  3I5U A;  1EKE A;  3D1N I;  5E3L A;  4XOT A;  3A0B C;  2E34 A;  2X1C A;  4N4N B;  4P55 A;  1IAW A;  1Z6T A;  2RVC A;  3JRE A;  2GOM A;  5E3M A;  3BTC A;  3KCC A;  4PSW A;  3B6C A;  5FLM J;  1U8R A;  3W2W A;  2GM4 A;  2RV8 A;  2O03 A;  2EIL H;  4UB6 C;  3ROU A;  1F9N A;  4RB3 C;  1V54 H;  1I50 J;  4CXF A;  3FBN B;  4ZDO A;  3LQQ A;  1E17 A;  5HS9 A;  2JZY A;  5FD6 A;  4AID A;  3FIW A;  1RKW A;  4ASN A;  4HQE A;  1MD0 A;  5J4V A;  1IJW C;  3N97 A;  5ILS A;  1LNW A;  1IDZ A;  2FNP A;  4M9Z A;  4OIO F;  4XQF A;  2L7Z A;  2G7H A;  2UWM A;  1YW8 A;  2KRC A;  3WU0 A;  2CG4 A;  3K70 C;  1LFP A;  4BY7 J;  4ENJ A;  2F5V A;  2GXG A;  2MA3 A;  1D3Y A;  2W82 A;  2TDX A;  3C7J A;  2E1M C;  3BJ6 A;  5LLQ A;  3G4S I;  1IO2 A;  1Z3Y A;  3LSJ A;  5EYR A;  4UVB A;  1Z0X A;  3L00 A;  3KEO A;  4QLC U;  2DT6 A;  4EJW A;  1YS7 A;  2PJR B;  1R4M B;  2EZI A;  3P9K A;  3KFW X;  3OV8 A;  2R0Q C;  3FMQ A;  5HDN A;  3REO A;  1QNT A;  4I6Z A;  3F0C A;  5GAD J;  2DFF A;  3PJR A;  2XPW A;  5F0F A;  4BEH A;  1SAN A;  2V1N A;  3DBH B;  3S2D J;  2ZBK A;  1TW2 A;  2L5Q A;  2Y0S N;  3CF5 F;  2IP2 A;  4IHV A;  1B4A A;  1X3Z B;  4HYE A;  2KLO A;  1TP4 A;  3K2Z A;  3JAM Z;  4PJL A;  3SZP A;  3H9G A;  2JVH A;  2R7D A;  3ZMD A;  2VT2 A;  2KZV A;  2IBD A;  4KUM A;  3JRF A;  1WGX A;  1Q1V A;  3Q0V A;  2VQH A;  2CQQ A;  2QF7 A;  3VDX A;  1MIJ A;  1WKM A;  1SD6 A;  5GTH C;  2UUZ A;  1KQ9 A;  2R7U A;  2PN6 A;  2COM A;  3GTJ J;  1AU7 A;  4XR6 A;  3WGH A;  3DTK A;  4HAM A;  1NHA A;  3HOX J;  1U8B A;  4U7B A;  2M4K A;  2DJI A;  2Y0M A;  4C30 A;  2ZFW A;  2K3F A;  3H3Z A;  5F6F A;  4L9V A;  1WQ2 A;  2FJ1 A;  3K6G A;  4IF4 A;  3V8L A;  5ED4 A;  1JKR C;  3GFJ A;  1XGO A;  1TQM A;  4HX8 A;  5M5W J;  2L9V A;  2Z9O A;  1AA7 A;  1Z05 A;  2R7W A;  5TRD A;  1UFM A;  1Y56 A;  4MFD A;  2KKO A;  3FXM A;  4IQJ A;  1W0T A;  1B9N A;  1QPM A;  2JVG A;  4EV0 A;  2KT0 A;  1FPQ A;  3IRQ A;  3IUO A;  4CH7 A;  1D1C A;  2DYS H;  4BUP A;  1JKO C;  3NEU A;  4FAS D;  3JSP A;  3H0D A;  2R7O A;  1JJ6 C;  4JBA A;  1BI2 A;  1I27 A;  2W57 A;  3W2A A;  1VF9 A;  4N0B A;  1WH7 A;  2NRA C;  2M87 A;  2ZXI A;  1I39 A;  2OV7 A;  3DEW A;  4JK1 X;  1T56 A;  4F55 A;  4XLH A;  5IT3 A;  1S3J A;  1UMQ A;  5GPC A;  2LR8 A;  4G6D A;  2DTZ A;  2MAB A;  2Z5U A;  3FXO A;  4JX5 A;  4KMU X;  1T6S A;  2QSG X;  3WU2 C;  5HS8 A;  1FOW A;  3K4B A;  5E8G A;  2OAZ A;  4HLX A;  4BE2 A;  2R5Z B;  1ZRF A;  3LQR A;  2NNY A;  4FE7 A;  3S16 J;  3BG6 A;  5H2F C;  3KYD B;  2HXO A;  4NNJ A;  3I4M J;  2VQL A;  4Q47 A;  4J19 A;  2L7F P;  2BHY A;  4XKW A;  3S3M A;  4BE1 A;  4OWR B;  2QBY B;  2VUM J;  2DFI A;  3ZP5 A;  1DGR M;  2BXZ A;  2LP0 A;  3FMS A;  1XPX A;  1SVO A;  3MAJ A;  1ETX A;  5GTI C;  2Y9Y A;  1LDD A;  2V4J C;  3IAS 2;  5JLW A;  3SJM A;  4XNF A;  3JSO A;  1XDS A;  2CUZ A;  3K4M A;  1WCM J;  3C3W A;  2MD5 A;  2ZC2 A;  2WB1 A;  3SHF A;  3DLL F;  5F0C A;  3TMO A;  1ZQ3 P;  1JT0 A;  2XF7 A;  4GDF A;  2X85 A;  3FHN A;  4LG3 A;  2JUC A;  3L2U A;  1X1A A;  3HJE A;  2GIV A;  1GXP A;  1UST A;  2FE3 A;  4DBR A;  2XAS A;  1ZLJ A;  2K9M A;  3CP8 A;  4IHW A;  4EM2 A;  1JTY A;  3BQZ A;  3DKW A;  1U0J A;  3ZGK A;  5FJ8 J;  1YX3 A;  3MWM A;  5F1R A;  4NQW A;  2CQ7 A;  4ZZD A;  1ZYR F;  1J5Y A;  1W1W E;  2XRL A;  5CQE A;  1U5T B;  2XAH A;  1CGP A;  1SFE A;  2BXY A;  4FX0 A;  1MBG A;  4II2 A;  1DU6 A;  1VQ4 I;  1T08 B;  2I5U A;  1QZZ A;  4G6T B;  3BG5 A;  1U78 A;  1XN7 A;  1X19 A;  2CW0 F;  2LSO A;  5DUI A;  2EB7 A;  5JR3 A;  4RB1 A;  4A0X A;  1I5Z A;  5IP7 J;  2DJN A;  2XB5 A;  3A1Y A;  1BIB A;  3E6M A;  3ZRG A;  2JJ7 A;  1UHM A;  3BCB A;  3F8N A;  4AUX A;  5E1W A;  2ZCW A;  4LB6 B;  3WG7 H;  2BZT A;  3Q9V A;  5CVJ A;  3QPH A;  4C3H J;  3DBL B;  2M7A A;  1X1P A;  3BRO A;  2EPF A;  4RA2 A;  2WAQ N;  4H0E A;  1K79 A;  2FUG 2;  2M9H A;  2VJ5 A;  4IQ4 A;  5ICC A;  1VQP I;  4E7H A;  2FU4 A;  3WTY C;  2R7F A;  2IGK A;  2PMU A;  3CC7 I;  3H36 A;  3CES A;  1KZH A;  5L3E A;  3DXJ F;  1JHH A;  3OYF A;  3UNG C;  4W1U A;  4OU0 A;  3RZO J;  2G7U A;  2O6G E;  2A3S A;  1VQN I;  3LSP A;  2VC0 A;  4I01 A;  3UKG A;  1IC8 A;  2M8G X;  3I71 A;  3KYL A;  1QZE A;  1FWZ A;  2QUF A;  2DBB A;  4A93 J;  1EH7 A;  1OCO H;  3H35 A;  2A05 A;  5DD4 A;  4GO1 A;  1SVL A;  1W7P D;  1FOK A;  1Z67 A;  2K4J A;  2ISY A;  5FLX K;  3ISP A;  2XAJ A;  1XSD A;  3ZQL A;  1P4X A;  3A0H C;  4A69 C;  2WB1 N;  4HG2 A;  4LIU A;  3OS0 A;  1UEL B;  4MLO A;  3OOU A;  1GV5 A;  3L2V A;  3O6B B;  1HC8 A;  1FEX A;  1HXD A;  3FK7 A;  1VQL I;  1VQ8 I;  2QVO A;  3K69 A;  2V1D A;  3RTR A;  1J7K A;  1RC9 A;  2HTS A;  2CH0 A;  2B0L A;  3CDI A;  4B48 A;  2JUG A;  4G7H F;  2QKM B;  1S7O A;  1TNT A;  1BOB A;  3E6D A;  3HUG B;  1FBS A;  1JJ8 C;  1P7J A;  3K1P A;  2I8D A;  3F21 A;  3GZ6 A;  5LRS A;  2DT7 B;  2KIS A;  1SEU A;  3U2R A;  1ZRE A;  1K7A A;  4BL0 B;  1L3L A;  2M0C A;  2EIM H;  5CVR A;  3JR9 A;  4YFN F;  4RGS A;  1ZGW A;  3AG1 H;  3ZMS A;  3GEZ A;  1WJ5 A;  1VQ5 I;  2Y9Z A;  3PL8 A;  3ZN1 A;  4Y3O A;  1N78 A;  1FT9 A;  1ACI A;  2Z1D A;  5B1A H;  3W6K B;  3MFK A;  3KP2 A;  3W3C A;  1BIA A;  1EH6 A;  1LB2 A;  4O5V A;  3G1O A;  4NQW B;  5J40 A;  4P9U A;  4MTD A;  3DU6 A;  2E2H J;  1ZKG A;  2KRF A;  1RUN A;  4LD5 A;  2HZT A;  4Q48 A;  1GUU A;  4CIC A;  4RGX A;  2EV0 A;  3KE2 A;  3CCQ I;  3IH2 A;  3KLN A;  3NAU A;  4XN3 A;  2HKX A;  2JPB A;  2CGP A;  1IUY A;  2CS3 A;  2ZXW H;  3HRU A;  2XAQ A;  4IRH A;  1IV6 A;  2VXD A;  2FBI A;  4WK8 F;  3E97 A;  2P5L C;  5IT9 K;  1DP3 A;  3W6J B;  5FKM A;  4F52 A;  1GDT A;  3DU5 A;  4F91 B;  3WOD F;  4PCQ A;  2DDB A;  5CQG A;  1G4D A;  3D5R C;  3JRG A;  5JVG F;  3H9J A;  1LVK A;  2BY1 A;  2DQL A;  4M9S A;  1FIA A;  2F48 A;  3BLY A;  2NOJ B;  3LL7 A;  4KIG A;  2ACJ A;  1F5T A;  3QWL A;  3FZV A;  2X6Y A;  3WHB A;  2K4B A;  3I3L A;  3N05 A;  4C2T A;  3F22 A;  3E6C C;  3S3O A;  2ME0 A;  2QEX I;  1MBJ A;  1U5T C;  2DA4 A;  3K4K A;  4BXU A;  4HNT A;  2FA5 A;  2V6E A;  1GXQ A;  2HXI A;  2OTL I;  4PJM A;  2QSH X;  2WA0 A;  4ZZL A;  3J80 K;  1WJF A;  2VIX A;  4KIB A;  2E35 A;  3HC7 A;  1P6R A;  3J80 Z;  2XIG A;  4XL9 A;  2E5Z A;  1V5G A;  4I2O A;  1BA5 A;  2PFB A;  1DU0 A;  1DPU A;  1MZB A;  2BEO A;  1VTN C;  3PM1 A;  4AVZ A;  1LQ1 A;  3SFZ A;  1ZG3 A;  2LMD A;  5AIP A;  2V9P A;  3X2Q H;  1Y8Q B;  3A4C A;  1FY7 A;  4LK1 F;  2HPI A;  2CV2 A;  3I4P A;  3TP3 A;  4MEX F;  3GZN B;  5C4J J;  4BQA A;  1BW5 A;  4JX4 A;  5GPA A;  3TKY A;  5FRN A;  1X3W B;  3GTL J;  5L3B A;  2JQ7 A;  1A36 A;  3PSI A;  2M3A A;  2OPT A;  3QYE A;  3ZQI A;  4YEL A;  1B8I B;  3DPU A;  1O3Q A;  5EEA A;  6PAX A;  1YJN I;  2W25 A;  3VYT B;  3I9V 2;  2CWE A;  1MJ9 A;  1N77 A;  2JN6 A;  3OYD A;  3R60 A;  3ABM H;  3M3Y J;  3KZZ A;  1OYY A;  1UB9 A;  5LGT A;  4YFK F;  3RI4 A;  4G94 A;  1XGN A;  4UB8 C;  4I99 C;  3LFK A;  5IYC J;  4I09 A;  3QOD A;  2DMN A;  3S15 J;  3LAP A;  1YJW I;  4I76 A;  5A2Q K;  4R1H A;  3S1R J;  1KQ0 A;  2LOO A;  2JA5 J;  2H6B A;  5CVU A;  4OMY A;  1MGT A;  4HPQ A;  4D5F A;  3J7A Y;  2O61 A;  2CV1 A;  3BR1 A;  1HA8 A;  2HR3 A;  5M3F J;  1T0F C;  2EFP A;  1QHG A;  3QOP A;  4NC8 A;  4B4C A;  2CQN A;  5DS9 A;  2EBI A;  3TL4 X;  1JUS A;  3L2W A;  1CF7 A;  4M74 A;  2STT A;  4BAY A;  4M71 A;  2EA2 A;  1PYV A;  2IAI A;  3LST A;  5HLI A;  4A2U A;  2LY9 A;  4F93 B;  4XLF A;  1WJC A;  3IL2 A;  1POG A;  1A04 A;  1WI9 A;  4XRM A;  3ABU A;  2O8K A;  4Y52 J;  3W2V A;  4HX4 A;  4GGG A;  3RKY A;  3OIO A;  3M8F A;  2RNG A;  2X1D A;  4PGH A;  5FO5 A;  4L5I A;  2XGE A;  1WWX A;  3FIS A;  4BS9 A;  2X4H A;  2L9N A;  2Q2E B;  5DUK A;  2GAU A;  1G3T A;  1YTY A;  1PP8 F;  2K27 A;  3BOQ A;  3ZQ7 A;  2GQQ A;  1Y0N A;  1KGS A;  1WJA A;  4F3Q A;  3WHC A;  4U0Y A;  3IKT A;  2ZSI B;  1OCR H;  1PUF A;  4CCK A;  3JTG A;  5E1Z B;  4A3J J;  5J8C A;  5B1B H;  1S7A A;  1Y6I A;  5M5X J;  3MKZ A;  2ISZ A;  2VOD A;  3KEQ A;  1T33 A;  3RKW A;  5K5Q A;  1XD7 A;  3F72 A;  2DA6 A;  4NC7 A;  5FKN A;  3J7A O;  4LIV A;  5J3L A;  1QHH D;  2LFB A;  4JOM A;  2OZ6 A;  4RM2 A;  4XON A;  1WFX A;  4EQQ A;  2ID3 A;  2LD5 A;  3OYI A;  4DZJ A;  5FKK A;  1R36 A;  2P7V B;  3OY9 A;  3V42 A;  1LDJ A;  1YX5 A;  3HKZ A;  2HDW A;  2J5P A;  2QA4 I;  1VQM I;  4ZC3 A;  1TWA J;  1XCV A;  1P7I A;  2AXT C;  5D4S A;  3BCA A;  5EF6 A;  4G7Z F;  4IOA F;  1XMA A;  4UV9 A;  5IP6 A;  2EZL A;  3BR0 A;  2JA2 A;  4M3B A;  4AVP A;  5BOX A;  5DCM B;  5IOZ A;  1OMI A;  2LG4 A;  3EUK L;  3V7R A;  4BJ6 C;  4M9X A;  4AWX B;  4S04 A;  4XSX F;  1KYZ A;  5ILU A;  4HDV A;  2IS6 A;  2QSF X;  3WTX C;  2DO7 A;  4C3J J;  3U9G A;  4M3G A;  2F6C A;  4HSR A;  5KCM A;  1TL8 A;  1DQU A;  2BE5 F;  3SQN A;  3S17 J;  4FX4 A;  3S1Q J;  1FSE A;  1ETK A;  3HL2 A;  1B72 A;  5HOO A;  5CVI A;  5TIS C;  2W1O A;  1LVA A;  4B43 A;  4C2M J;  2F2E A;  2JA6 J;  1BBY A;  1S9H A;  2P4W A;  2DMQ A;  2XKO A;  2GA2 A;  3BZK A;  1ZN2 A;  3ZMV A;  3CCM I;  3CCR I;  1RZ4 A;  4M73 A;  1ONV A;  1J0R A;  1KU9 A;  3GTO J;  3GXO A;  2Y30 A;  1JHF A;  1S8N A;  5AON A;  3HDD A;  2VOP A;  1X3U A;  2KFD A;  4L18 B;  2HYF A;  3E5Q A;  2BGC A;  3W6V A;  1BR1 A;  2VC1 A;  3ZMZ A;  1XC5 A;  3EYI A;  4C3I J;  5CPR B;  3BT9 A;  1XTA A;  1ERD A;  1QBJ A;  5KNL A;  3CCS I;  2EFW A;  1EV7 A;  2K7L A;  4CYC B;  1WH5 A;  4ZDL A;  5F27 A;  1Z9C A;  2L4A A;  4B09 A;  2ZJP F;  2W7N A;  1GT0 C;  4LMY A;  3CC2 I;  2HFH A;  3PNV A;  4A12 A;  2QM3 A;  2HYJ A;  4XRS A;  3ZQF A;  2RAE A;  2YX4 A;  3PFY A;  2LDU A;  5D5X B;  3K70 D;  2FF4 A;  3H0G J;  4F92 B;  5E3N A;  1ENH A;  2VBZ A;  2GLO A;  3F8B A;  2RRE A;  2K5C A;  3DKX A;  4KA4 A;  3VFZ A;  3Q0W A;  1UJ8 A;  1JGG A;  2ZJ2 A;  3RYP A;  2KJC A;  4ZYA A;  4AIK A;  2E7W A;  2H8R A;  1LEA A;  1WHU A;  4CSW A;  3OYE A;  2IA1 A;  2JRT A;  1ZGJ A;  4A3L J;  4H4K C;  2R5Y A;  3FXL A;  3GTM J;  2R7Z J;  3ZQH A;  1BR4 A;  3JRH A;  2WAE A;  2CFX A;  4ENN A;  2A5W A;  3S3N A;  3AL0 B;  1ON1 A;  3JRC A;  4QTR A;  1MBF A;  4DYQ A;  1BI0 A;  1X1D A;  2YUS A;  4WWC A;  3KET A;  3M1C A;  3OYK A;  1FYK A;  4EJO A;  5KVR A;  3HBL A;  2VAS A;  4A3E J;  4AYB N;  3UR3 C;  3HYI A;  4NUB A;  2D1H A;  3D0S A;  1MBK A;  3Q0U A;  4IZZ A;  1XS9 A;  3IC7 A;  3H5A A;  2ESN A;  2AXL A;  3CCL I;  1PJR A;  4M6X A;  4A3B J;  3EUH C;  3O3K A;  3OYN A;  3TDZ C;  5C44 J;  4YII A;  4XK4 A;  3DF8 A;  2ETH A;  5FRO A;  2JMW A;  1QRY A;  3WTW C;  2BOL A;  3ASN H;  3ZMU A;  3CMM A;  3NQO A;  1R49 A;  3TO7 A;  3CC4 I;  1LKX A;  1IXR C;  2ICW G;  2E1O A;  3S1N J;  1JKQ C;  4D1Q A;  1R5H A;  1V4R A;  5D6E A;  1HF0 A;  2CQX A;  2IGN A;  4BGD A;  2AO9 A;  4CCM A;  2R7T A;  1YRN B;  3A2K A;  4EJV A;  1X58 A;  2Q8K A;  4IXA A;  2F5C A;  1MND A;  4K2E A;  4HNU A;  3DV8 A; 
#chains in the Genus database with same CATH homology
 2A6H F;  3GZ5 A;  5DYM A;  1FYL A;  5DEQ A;  2XHK A;  1Z91 A;  1O3R A;  2OQR A;  1PP7 U;  1Z1D A;  1IN5 A;  1H0M A;  5LEK A;  2A07 F;  3KP5 A;  1IF1 A;  4I7H A;  5L3C A;  2ZO4 A;  2X0L A;  5BQT A;  4HF2 A;  1FBQ A;  4UHT A;  3NRV A;  2HDC A;  1I6X A;  2H6C A;  4RAZ A;  1IN4 A;  3JTH A;  3D5L A;  2IPQ X;  2F5D A;  2VXZ A;  4HOB A;  5TJJ A;  1MDM B;  4Y13 A;  1XSV A;  4U7D A;  5ILV A;  5HVQ C;  2Z3Y A;  2VE9 A;  4CZZ A;  5EEG A;  1KYW A;  2NNN A;  3Q5F A;  3TOB A;  2HQR A;  1ZAO A;  3CUQ A;  3V7S A;  4F7Z A;  2HOE A;  4KFC A;  3WTS C;  3KP3 A;  2FSW A;  3GWZ A;  3CUO A;  3HHG A;  1H9G A;  1YO5 C;  3K1N A;  4N9H A;  2W24 A;  3E3V A;  2CYY A;  2O0Y A;  4JQF A;  1DP7 P;  3K0L A;  4WXC A;  3JAM K;  4XBF A;  4P9F A;  3ZMT A;  4ZYD A;  5JFR A;  3CJN A;  2FBH A;  1IRG A;  1YQA A;  4KMF A;  3CTA A;  2M45 A;  5CYV A;  4AD9 A;  1G3S A;  2W84 A;  3TGN A;  1FP1 D;  4UVC A;  1B1B A;  5D5V B;  4U0W A;  1ZH5 A;  1IN6 A;  4HX7 A;  2EK5 A;  1MJA A;  3BPV A;  5BPD A;  3R6S A;  2EWN A;  4A6D A;  3CO6 C;  4LK0 F;  4P96 A;  4ENM A;  3ELK A;  3I0T A;  2IA0 A;  3CUQ C;  4EGY A;  1XCB A;  2E7X A;  3WU1 B;  3QRF F;  4ZYG A;  2XKP A;  4KNY A;  4ZYH A;  3KP7 A;  4MNU A;  4TV7 A;  5HS7 A;  4EGZ A;  2P7C B;  2XRO A;  1WSU A;  1O3S A;  2M8E A;  2F5E A;  3MCZ A;  3AAF A;  4IHT A;  2RNJ A;  4MQV A;  2RQP A;  1ZAR A;  2LF8 A;  2DK5 A;  2QYO A;  4IVN A;  2YX7 A;  4HA8 A;  3WTZ A;  5D8L B;  3G73 A;  1H9T A;  1YFH A;  2JT1 A;  5ICG A;  2WV0 A;  1SFX A;  3DFG A;  5D8K B;  1C0W A;  3QP6 A;  4M6Y A;  3DP7 A;  3IWF A;  5H6R A;  2CO5 A;  1D8K A;  2CQK A;  1HW1 A;  5E17 F;  5LGU A;  5LEJ A;  2EV5 A;  2E1N A;  4I0B A;  2DU9 A;  5JI6 A;  2H94 A;  4UNO A;  5HDG A;  5K1Y A;  4UUV A;  3ECO A;  2P6S A;  2OQG A;  4B8X A;  2A5Y B;  1B59 A;  3ZPL A;  5LRR A;  4MGR A;  3V8J A;  1HW5 A;  1XB4 A;  3CUQ B;  1U6G A;  5LBQ A;  4LGW A;  2NAZ A;  2O8X A;  3PQJ A;  3E6B A;  1Z7U A;  1ZRD A;  3F8M A;  3BZ6 A;  1ODD A;  3V4G A;  1KU3 A;  2P5V A;  3FMR A;  1HST A;  2PBI A;  2XVC A;  5DD8 A;  1LDK B;  4L9J A;  4QWQ A;  3BJA A;  2QWW A;  3F3X A;  3T5X A;  4Y15 A;  1O7L A;  2FOK A;  4CGZ A;  3F8F A;  2ESH A;  2A69 F;  3PQK A;  1MDM A;  2RDP A;  3O2P E;  4LLN A;  4OIN F;  1W7P A;  2V79 A;  2C6Y A;  4EJU A;  2LKP A;  2QEN A;  3N4M A;  3KP4 A;  1TLH B;  2L3D A;  4LJZ F;  3HTU A;  2F5F A;  2HS5 A;  2VBY A;  4GXO A;  5F64 A;  3TQN A;  2DI3 A;  1RNL A;  1ZRC A;  2BYV E;  2VOO A;  5ERI A;  3L7W A;  2GXB A;  4RGU A;  4O3M A;  4HV6 A;  3RPU A;  5CLS A;  5JHU A;  3WTT C;  4XLP F;  3HUG A;  2UXX A;  1T38 A;  1YYV A;  1K6O A;  4MTE A;  3WTV C;  3K1M A;  3GFL A;  4UVA A;  1WRJ A;  3TO9 A;  1SFU A;  3T1B A;  1IRF A;  4HZF A;  3I54 A;  4LG0 A;  5FGM A;  3Q9S A;  1TNS A;  1IXC A;  2GWR A;  5CJ9 A;  3VOD A;  2FQ3 A;  3RIR A;  3FX3 A;  2M5W A;  3FM3 A;  2L4M A;  3VEP A;  5J6X A;  4KN7 X;  2FEZ A;  5HDK A;  5A2Q Z;  1YW9 A;  3I59 A;  3I64 A;  4IPA A;  2PLY A;  3MZY A;  4UXN A;  4Q5S F;  4RAY A;  1J9I A;  3FXQ A;  1V3F A;  2XUB A;  2JPC A;  1UHW A;  2PEX A;  4ESB A;  3BWG A;  3KZY A;  3F23 A;  1RUO A;  1FP2 A;  4ENK A;  4A5N A;  4ETS A;  1G3W A;  4OOI A;  4EM1 A;  1QGP A;  1JE8 A;  1R23 A;  2VN2 A;  4UV8 A;  4CHU A;  3FXR A;  3M1E A;  4L0Y B;  4MEY F;  2D2W A;  1SD4 A;  2RKH A;  4PZJ A;  2YPR A;  1R5G A;  5H20 A;  1OR7 A;  2DW4 A;  1KQ8 A;  4Z2Y A;  5HLH A;  1JXS A;  2GA1 A;  5DCM A;  2XRN A;  4HDU A;  2MH2 A;  1FSH A;  2KIU A;  1AOY A;  3EET A;  2QQB A;  3S2W A;  5J8F A;  2EA4 A;  1BI1 A;  1I1S A;  4R8H A;  3ERE D;  4R79 A;  1G6N A;  4FT8 A;  1D8J A;  3MQ0 A;  5JVT A;  4CDG A;  1STZ A;  3KLO A;  2MBF A;  5E1X A;  5D4R A;  2A6E F;  2PJP A;  1IW7 F;  1TQP A;  1FX7 A;  4ZYE A;  2OU2 A;  3IKV A;  1MJB A;  3VOE A;  3GVA A;  3LAJ A;  1TBX A;  4ON0 A;  2E1C A;  3TO6 A;  2L02 A;  5E20 A;  4G7O F;  3DPT A;  2Q2E A;  1F1Z A;  2IJL A;  3T0Y A;  1BM9 A;  5E18 F;  1DDN A;  3P9I A;  3V7C A;  1GVJ A;  2V6C A;  2FBK A;  2QBY A;  2H09 A;  3HTS B;  2IVM A;  1XGM A;  2V9V A;  3HOT A;  2ELH A;  1DUX C;  5LHH A;  1R22 A;  3GFI A;  3T8R A;  5ICF A;  3QU6 A;  4WF2 A;  2V1X A;  3COA C;  2XAG A;  1XSX A;  1HQC A;  2FMY A;  2BBY A;  2KJB A;  3JW4 A;  1O3T A;  1KU2 A;  1OYW A;  3I53 A;  2ZNZ A;  1UCR A;  4HF0 A;  2M1B A;  2ZME B;  3VB2 A;  3R4K A;  4O6J A;  3L2C A;  4L9T A;  1ZG1 A;  4OMZ A;  4EM0 B;  3CO7 C;  3ML6 A;  4E70 A;  3F6V A;  1USS A;  1U3E M;  2P6T A;  5L3D A;  3WGG A;  4U0V A;  5DV5 A;  1ON2 A;  3EDP A;  1B9M A;  2K02 A;  1R1V A;  3QU3 A;  4LLL A;  3F6O A;  5D6F A;  5DDG A;  4S05 A;  1I1G A;  4IRG A;  5FD5 A;  3H92 A;  3FXU A;  2MC3 A;  2JSC A;  1EH8 A;  4A0Z A;  4NB5 A;  4L9N A;  1ULY A;  2RC4 A;  1YLF A;  3LA7 A;  1R1T A;  5ICE A;  1HKT A;  2K86 A;  1OKR A;  4IJA A;  2HYG D;  3RKX A;  3QP5 A;  4D0P A;  4ESJ A;  3E5X A;  2CSO A;  1K78 B;  2DLL A;  2VBW A;  1FYM A;  2PI0 A;  4A0Y A;  2ZME A;  2OA4 A;  2R3S A;  2G9W A;  5FB2 A;  4BHC A;  1BI3 A;  1K78 A;  1XDU A;  2OD5 A;  5FLX Z;  1O57 A;  2HGC A;  1IZ1 A;  3RDI A;  5HLG A;  3M8E A;  4A6E A;  1P4W A;  1LJ9 A;  3LA3 A;  3WE3 A;  3J81 K;  1ZG5 A;  1TTY A;  3B02 A;  3TOA A;  4ESF A;  1PUE E;  3KP6 A;  2L01 A;  1R7J A;  2DTR A;  1J2X A;  4RB2 C;  3RJP A;  4N9I A;  4KN4 X;  3EYY A;  4HLY A;  2PG4 A;  5L3F A;  1U5T A;  2EJR A;  2DQR A;  3FHZ A;  3CDH A;  2XAF A;  3K9T A;  5D5U B;  4M72 A;  1YIO A;  3TDU C;  2YSR A;  4IHS A;  1R58 A;  2FML A;  3GW2 A;  3P9C A;  4L0Z B;  2XGX A;  2ADU A;  1CF7 B;  1RIO H;  4AIJ A;  1KU7 A;  3C1D A;  2HEO A;  3PFI A;  2MH9 A;  1U2W A;  3E5U A;  3ULQ B;  3EUH A;  1Z6R A;  4HW0 A;  3SZT A;  4KIF A;  4KYW A;  3R0J A;  4RS8 A;  1PDN C;  3QPT A;  4HBL A;  4WX9 A;  4HF1 A;  5IT9 Z;  5E8I A;  4MQ9 F;  1HKS A;  4YFX F;  1LEB A;  2DK8 A;  2VON A;  2IW5 A;  3FWE A;  4MHG A;  1L0O C;  1YS6 A;  2P8T A;  5D5W B;  4ZH4 F;  3L9F A;  2Q0O A;  1JGS A;  3MEX A;  1J75 A;  3R61 A;  5K5R A;  4XSZ F;  1E2X A;  1FNN A;  4GCV A;  3HSE A;  1DPR A;  1T39 A;  1REP C;  2DAO A;  3BP8 A;  3L09 A;  3DEU A;  4YIF A;  1QQI A;  2KIM A;  2BV6 A;  3HRT A;  1G3Y A;  5LHI A;  1OYI A;  3T8T A;  1IN7 A;  2DPU A;  1BOA A;  1T2K A;  1GHC A;  5BPI A;  3QAH A;  3J81 Z;  2ZXJ A;  1BJA A;  2NS0 A;  3DPL C;  1SMT A;  4EJT A;  2VT3 A;  4PGG A;  1BN5 A;  4LB5 A;  1TW3 A;  1OPC A;  1B6A A;  4G6Q A;  4CYD A;  4L5J A;  4EVI A;  4YG2 F;  2QZ8 A;  2QQ9 A;  2LF7 A;  3HRM A;  4BHB A;  2VBX A;  3P7N A;  3BY6 A;  2ZNY A;  4P5O A;  4OIQ F;  4WXD A;  3EQL F;  4CO8 A;  2EV6 A;  2STW A;  1HSJ A;  3GF2 A;  1J59 A;  2WTE A;  4LLG F;  3FF5 A;  1TQI A;  3ABT A;  4WCG A;  1F4K A;  4G9Y A;  3GO5 A;  2Y75 A;  3GUD A;  2ZKZ A;  4XRF A;  2HQN A;  1P4A A;  2JTV A;  5L3G A;  3V8K A;  5KK1 A;  2KIF A;  1S29 A;  1SAX A;  2AS5 F;  2EFO A;  1Q1H A;  1XGS A;  1ZGA A;  4I0A A;  3F8C A;  1P92 A;  2Z99 A;  2NYX A;  2EFQ A;  2EFN A;  3CLO A;  4HV5 A;  2A68 F;  3HRS A;  4OIP F;  4LG0 B;  3M9A A;  1T0F A;  4Q4Z F;  1QO0 D;  1W7P B;  2Y48 A;  3GLX A;  4I02 A;  5BMZ A;  1FBU A;  4KDP A;  4WXH A;  2D1V A;  1R1U A;  4IRI A;  5EEH A;  3FM5 A;  1KA8 A;  1SD5 A;  1W4M A;  3IWZ A;  2P5K A;  4Y17 A;  1XMK A;  2OBP A;  2YR2 A;  1SMY F;  3I59 B;  1S6L A;  1ZLK A;  1HKQ A;  4BH9 A;  3WG9 A;  4U88 A;  2IT0 A;  3C18 A;  4XLN F;  4DNC A;  2L54 A;  1FLI A;  2Z33 A;  1D5V A;  4LFU A;  2IRF G;  3ZN0 A;  4GYI A;  5AIQ A;  2QLZ A;  2FRH A;  2MLG A;  3BJO A;  3H3U A;  5CVV A;  4GYG A;  3B73 A;  1W5S A;  2PQ8 A;  2D45 A;  1Y0U A;  1IXS B;  2VE8 A;  1QZY A;  1ZHF A;  4I98 B;  3R0A A;  2WWY A;  1FC3 A;  1P2F A;  4PDK A;  4NHJ A;  2DPD A;  1R00 A;  2M30 A;  3IHU A;  3DQV C;  4AIH A;  2UXN A;  1HW2 A;  2A61 A;  3RYR A;  4KIC A;  3U1D A;  2LNB A;  3HSR A;  1YW7 A;  2FXA A;  4HQM A;  2WC2 A;  3RPQ A;  2RGV A;  3WTU C;  4BHP A;  5FFX A;  3HHH A;  1O7F A;  2FNA A;  4EMS A;  4G8X A;  2YU3 A;  1AWC A;  1BC7 C;  3I58 A;  2J5O A;  3G3Z A;  2IA2 A;  3HIF A;  3HSF A;  4BYY A;  2DT5 A;  1W5T A;  5H6Q A;  3GX4 X;  2RN7 A;  5LGN A;  2MLK A;  3GYH X;  2W85 A;  4A5M A;  5LHG A;  1HBX G;  3WGI A;  2UZK A;  1MKM A;  4KT5 C;  2H27 A;  5K5O A;  5BS6 A;  5FFZ A;  2HWV A;  2V1U A;  2GZW A;  4OIR F;  4RB0 A;  1IN8 A;  4RGR A;  3SXY A;  3HOS A;  3BDD A;  3LWF A;  5DCF A;  1FZP B;  3IRR A;  4FHT A;  3BPX A;  4BNC A;  1SD7 A;  3GFM A;  3WE2 A;  2XV4 S;  3MZH A;  1T98 A;  2OZU A;  2HTJ A;  2O3F A;  3ECH A;  3OOP A;  1YG2 A;  2QQA A;  3LA2 A;  2HKO A;  3M7G A;  2PMH A;  1RI7 A;  4DQ2 A;  3I5U A;  4P55 A;  1IAW A;  1Z6T A;  2RVC A;  3KCC A;  1U8R A;  2RV8 A;  2O03 A;  3ROU A;  1F9N A;  4RB3 C;  4CXF A;  3LQQ A;  1E17 A;  5HS9 A;  2JZY A;  5FD6 A;  4ASN A;  4HQE A;  1MD0 A;  3N97 A;  5ILS A;  1LNW A;  2FNP A;  4M9Z A;  4OIO F;  2G7H A;  2UWM A;  1YW8 A;  3WU0 A;  2CG4 A;  4ENJ A;  2GXG A;  2MA3 A;  1D3Y A;  2TDX A;  3C7J A;  3BJ6 A;  5LLQ A;  4UVB A;  4QLC U;  3L00 A;  3KEO A;  4EJW A;  1YS7 A;  3P9K A;  3KFW X;  3OV8 A;  3FMQ A;  5HDN A;  3REO A;  1QNT A;  2ZBK A;  1TW2 A;  2IP2 A;  1B4A A;  4HYE A;  3K2Z A;  3JAM Z;  3SZP A;  3ZMD A;  2R7D A;  2VT2 A;  4KUM A;  1WKM A;  1SD6 A;  1KQ9 A;  2PN6 A;  2COM A;  3WGH A;  4HAM A;  1NHA A;  4U7B A;  2Y0M A;  2ZFW A;  3H3Z A;  5F6F A;  4L9V A;  1WQ2 A;  4IF4 A;  3V8L A;  5ED4 A;  3GFJ A;  1XGO A;  1TQM A;  4HX8 A;  2Z9O A;  1Z05 A;  5TRD A;  1UFM A;  2KKO A;  1B9N A;  1QPM A;  4EV0 A;  1FPQ A;  3IRQ A;  3NEU A;  3JSP A;  4JBA A;  1BI2 A;  1I27 A;  2W57 A;  4N0B A;  2NRA C;  2M87 A;  4JK1 X;  5IT3 A;  1S3J A;  4G6D A;  2Z5U A;  4KMU X;  1T6S A;  5HS8 A;  5E8G A;  2OAZ A;  4HLX A;  1ZRF A;  3LQR A;  2NNY A;  4Q47 A;  2QBY B;  2DFI A;  3ZP5 A;  3FMS A;  3MAJ A;  1LDD A;  3JSO A;  1XDS A;  3C3W A;  2MD5 A;  3SHF A;  2GIV A;  1GXP A;  1UST A;  2FE3 A;  2XAS A;  1ZLJ A;  4EM2 A;  3DKW A;  5F1R A;  3MWM A;  4NQW A;  4ZZD A;  1ZYR F;  1J5Y A;  1U5T B;  2XAH A;  1CGP A;  1SFE A;  4FX0 A;  1QZZ A;  1U78 A;  1XN7 A;  2CW0 F;  2LSO A;  5DUI A;  2EB7 A;  5JR3 A;  4RB1 A;  4A0X A;  1I5Z A;  1BIB A;  3E6M A;  1UHM A;  3F8N A;  5E1W A;  2ZCW A;  4LB6 B;  3Q9V A;  5CVJ A;  3QPH A;  3BRO A;  4H0E A;  1K79 A;  5ICC A;  2FU4 A;  3WTY C;  2R7F A;  2PMU A;  5L3E A;  3DXJ F;  1JHH A;  4OU0 A;  2G7U A;  2O6G E;  2A3S A;  2VC0 A;  4I01 A;  3I71 A;  1FWZ A;  2QUF A;  2DBB A;  1EH7 A;  5DD4 A;  4GO1 A;  1W7P D;  1FOK A;  2K4J A;  2ISY A;  5FLX K;  3ISP A;  2XAJ A;  1XSD A;  1P4X A;  3O6B B;  1HXD A;  2QVO A;  3K69 A;  2V1D A;  3RTR A;  1J7K A;  2HTS A;  2B0L A;  4G7H F;  1S7O A;  1TNT A;  3E6D A;  1FBS A;  3K1P A;  3F21 A;  3GZ6 A;  5LRS A;  3U2R A;  1ZRE A;  1K7A A;  1L3L A;  5CVR A;  4YFN F;  4RGS A;  3ZMS A;  3GEZ A;  3ZN1 A;  1FT9 A;  3W6K B;  3MFK A;  3KP2 A;  1BIA A;  1EH6 A;  1LB2 A;  4O5V A;  4P9U A;  4MTD A;  2KRF A;  1RUN A;  4LD5 A;  2HZT A;  4Q48 A;  4CIC A;  4RGX A;  2EV0 A;  3KE2 A;  3KLN A;  2HKX A;  2JPB A;  2CGP A;  1IUY A;  3HRU A;  2XAQ A;  4IRH A;  2FBI A;  4WK8 F;  3E97 A;  2P5L C;  5IT9 K;  3W6J B;  3WOD F;  4PCQ A;  1G4D A;  2DQL A;  4M9S A;  4KIG A;  2ACJ A;  1F5T A;  3FZV A;  2K4B A;  3F22 A;  3E6C C;  1U5T C;  4BXU A;  2FA5 A;  1GXQ A;  4ZZL A;  3J80 K;  4KIB A;  1P6R A;  3J80 Z;  2XIG A;  4I2O A;  2PFB A;  1DPU A;  1MZB A;  2BEO A;  1VTN C;  1LQ1 A;  3SFZ A;  1ZG3 A;  5AIP A;  1FY7 A;  4LK1 F;  3I4P A;  4MEX F;  4BQA A;  3TKY A;  5L3B A;  6PAX A;  1O3Q A;  2W25 A;  2CWE A;  1MJ9 A;  3R60 A;  3KZZ A;  1OYY A;  1UB9 A;  5LGT A;  4YFK F;  3RI4 A;  4G94 A;  1XGN A;  3LFK A;  4I09 A;  3LAP A;  5A2Q K;  4R1H A;  1KQ0 A;  2H6B A;  5CVU A;  4OMY A;  1MGT A;  2O61 A;  2HR3 A;  2EFP A;  3QOP A;  1CF7 A;  4M74 A;  2STT A;  4BAY A;  4M71 A;  2EA2 A;  3LST A;  5HLI A;  4A2U A;  3IL2 A;  1A04 A;  1WI9 A;  3ABU A;  4HX4 A;  4GGG A;  3RKY A;  3M8F A;  4PGH A;  5FO5 A;  4L5I A;  1WWX A;  2X4H A;  5DUK A;  1YTY A;  1PP8 F;  1G3T A;  2GAU A;  2K27 A;  3BOQ A;  3ZQ7 A;  2GQQ A;  1KGS A;  3IKT A;  4U0Y A;  3JTG A;  5E1Z B;  5J8C A;  1S7A A;  2ISZ A;  2VOD A;  3KEQ A;  3RKW A;  5K5Q A;  1XD7 A;  3F72 A;  3J7A O;  2OZ6 A;  4EQQ A;  1R36 A;  2P7V B;  1LDJ A;  2J5P A;  1XCV A;  5D4S A;  4G7Z F;  1XMA A;  4UV9 A;  4AVP A;  5BOX A;  5DCM B;  1OMI A;  3V7R A;  4M9X A;  4AWX B;  4S04 A;  4XSX F;  1KYZ A;  5ILU A;  4HDV A;  3WTX C;  2DO7 A;  3U9G A;  2BE5 F;  3SQN A;  4FX4 A;  1FSE A;  5HOO A;  5CVI A;  1LVA A;  2F2E A;  1BBY A;  2P4W A;  2XKO A;  2GA2 A;  1ZN2 A;  3ZMV A;  1RZ4 A;  4M73 A;  1ONV A;  1J0R A;  1KU9 A;  3GXO A;  1JHF A;  1S8N A;  5AON A;  2VOP A;  1X3U A;  4L18 B;  2HYF A;  3E5Q A;  2BGC A;  2VC1 A;  3ZMZ A;  3EYI A;  1QBJ A;  2EFW A;  1EV7 A;  2K7L A;  1Z9C A;  2L4A A;  4B09 A;  4LMY A;  2HFH A;  4A12 A;  2QM3 A;  2YX4 A;  2LDU A;  5D5X B;  2FF4 A;  2VBZ A;  3F8B A;  4KA4 A;  3VFZ A;  2ZJ2 A;  3RYP A;  2KJC A;  4AIK A;  2E7W A;  1LEA A;  2IA1 A;  2JRT A;  1ZGJ A;  2CFX A;  4ENN A;  1ON1 A;  1FYK A;  1BI0 A;  4WWC A;  3KET A;  4EJO A;  5KVR A;  3HYI A;  2D1H A;  3D0S A;  3IC7 A;  2ESN A;  2AXL A;  4M6X A;  3O3K A;  3TDZ C;  4YII A;  3DF8 A;  2ETH A;  3WTW C;  3ZMU A;  3NQO A;  3TO7 A;  1IXR C;  1R5H A;  1V4R A;  5D6E A;  4EJV A;  2Q8K A;  4IXA A;  2F5C A;  1BC8 C;  4K2E A;  3DV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...