5HLIA

Structure of disulfide formed abfr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
149
structure length
146
Chain Sequence
b'QSNMKQEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLPDTTEYDETKYVFEELEQTLKHLIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR family transcriptional regulator
publication title Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
total genus 55
structure length 146
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hliA00
1Z1DA 1FWZA 1R5HA 2ZXJA 2HFHA 1FZPB 3QP5A 5DCFA 4CICA 5D4SA 2VXZA 3HOSA 2DQRA 3C3WA 3CLOA 1YLFA 2IRFG 1TQMA 1HKSA 4GCVA 2EJRA 4O3MA 5EEHA 2ZNZA 3T1BA 3WTUC 1Z7UA 2D45A 2Q8KA 2FQ3A 4ZH4F 4A0YA 3B73A 4L9VA 1R1UA 2LSOA 2NRAC 2QM3A 3FZVA 5CVJA 4HX7A 4Y17A 3WODF 5CLSA 4OIOF 2P7CB 2CG4A 1KGSA 2QVOA 2GA1A 4BAYA 3NQOA 4B09A 1SMTA 3CDHA 5E18F 2KIMA 2XAGA 2CO5A 1E2XA 2A3SA 2ZMEA 5LRRA 2PQ8A 4Q4ZF 2UXNA 4UNOA 4YFXF 3TDZC 1W7PD 4BHCA 1HXDA 2ZFWA 1FNNA 3ABTA 3TO9A 4R1HA 2DLLA 4MHGA 4EM2A 2W25A 3FMQA 5BPDA 4R8HA 2RN7A 2ZBKA 5JI6A 4A0XA 2ADUA 1R23A 4L0ZB 2VBZA 3WTZA 1REPC 2ZJ2A 3HRSA 5E17F 1ZGAA 3BDDA 4HZFA 3ZMDA 2XKPA 2IA0A 4EJTA 1XD7A 3EYYA 1IRFA 4Q47A 5KVRA 3MQ0A 4KN4X 3PQKA 1O7FA 2D1HA 1G4DA 4ZYGA 4BYYA 3K1MA 1ODDA 3E5XA 5H6RA 2V1DA 3E5QA 4MEXF 5HS7A 2E1CA 1L0OC 4LK1F 1O7LA 4EMSA 1ZG1A 4ESJA 1ON1A 3T8TA 2M87A 5CVRA 4P5OA 4WK8F 4P9UA 2H27A 3QPHA 5E1ZB 2K4JA 2G7UA 1HKQA 5LEJA 1QNTA 2IA2A 2QBYB 3J7AO 2PI0A 3JTHA 1XDUA 2CYYA 2M1BA 2PBIA 2YSRA 5DUKA 2W57A 2WV0A 3T8RA 4O5VA 4HOBA 5LLQA 1L3LA 5CJ9A 2ESNA 3BPVA 3VEPA 3FX3A 4MEYF 3ECHA 1LNWA 1ZAOA 1STZA 2OD5A 2O61A 1IN5A 4CXFA 5H6QA 1LDJA 2M30A 2FMYA 2MLKA 4QWQA 1BM9A 1LJ9A 2TDXA 2D1VA 3I59A 1W7PB 1IAWA 4HBLA 3U9GA 1T98A 4M6XA 3C1DA 1IN8A 5HS8A 2FU4A 4M6YA 3C18A 3HRUA 1YFHA 3PFIA 3Q5FA 4EJOA 3ELKA 1FY7A 3IWFA 1DPRA 3L00A 1WKMA 2HEOA 4HDUA 1J5YA 3BWGA 3DPTA 1U3EM 2H94A 1G3WA 2D2WA 5ICFA 1IN7A 3DKWA 3DQVC 5KK1A 1OPCA 3E6MA 1QPMA 3W6JB 1F9NA 2A68F 1O3QA 4EJWA 2ESHA 4BHBA 4U0YA 3DV8A 2P5LC 2Z33A 2OBPA 3KP4A 3GWZA 1XSDA 3O6BB 1GHCA 2MA3A 2PMHA 3FXUA 2F5CA 3GFMA 2HOEA 1ZH5A 1Z05A 3WTWC 1X3UA 2YPRA 2ACJA 1XGNA 2Z9OA 4ZZLA 3NRVA 2ZMEB 2OQRA 4PCQA 5LHHA 2OZ6A 4IRHA 1WI9A 3LA7A 5JHUA 3MWMA 5HDGA 4WCGA 2A6HF 3IKVA 4A2UA 3J80K 2EFPA 2L3DA 3I53A 4P96A 2R3SA 3G73A 4LGWA 1ZARA 2Q0OA 2QQAA 4IPAA 4G6DA 1U5TC 1ZYRF 1MJBA 2L4AA 5BOXA 1WSUA 3L2CA 4KDPA 3LSTA 1CGPA 3GUDA 3K9TA 4AWXB 2P7VB 1PUEE 3LWFA 3SHFA 4I02A 4I98B 1KU9A 3GEZA 4PGHA 2K02A 4HF2A 3RI4A 1YIOA 2YX7A 2A61A 4U0WA 1B4AA 3I71A 3WTSC 1JXSA 1FBSA 4LLGF 5BS6A 3K69A 1ZGJA 4A6DA 4HX8A 3M9AA 3P9KA 1FSHA 2DK5A 1A04A 5DEQA 2F5DA 2XIGA 3FMRA 1F5TA 4MNUA 2BBYA 2O03A 1QO0D 4LMYA 5ILUA 3F22A 3ZN1A 1MKMA 1XGSA 2QYOA 3ABUA 4IXAA 5E1WA 1KU3A 3L9FA 1U8RA 2V79A 3ISPA 3ZMZA 2KJCA 4EGYA 3JAMK 3T5XA 5CVUA 5FD5A 5FB2A 2ELHA 2DTRA 3HOTA 1XDSA 3LAPA 2FBIA 4HQMA 1K78B 2HYGD 4BNCA 1JHFA 2BV6A 4MTEA 5EEGA 4HDVA 1IUYA 2XVCA 1J59A 1FLIA 3CO7C 3K1PA 4GXOA 3I59B 1DPUA 4PGGA 3BJAA 2DO7A 3HSEA 2MLGA 2DK8A 2QWWA 2E1NA 2EA2A 5TRDA 3TDUC 4LG0A 1P6RA 1T0FA 1SFEA 2DT5A 1BI1A 3MCZA 3JW4A 4KIBA 1I1GA 5LGTA 3V7RA 3ZPLA 1OYYA 3K1NA 4CDGA 4LB6B 3V8LA 3WE2A 2HS5A 3V8JA 2NNNA 3HRMA 3KFWX 4UUVA 4HQEA 1J0RA 3O3KA 4XLPF 1FYLA 2GXBA 1O3SA 4HAMA 5JFRA 3AAFA 4WWCA 4M9XA 1PP7U 3F21A 2DU9A 1R1TA 2P6SA 2F5FA 2FBKA 1IZ1A 5L3FA 3FM5A 3I5UA 4FT8A 1LEBA 4A5MA 3RYRA 3HUGA 4R79A 2C6YA 1D8JA 4F7ZA 5ICGA 2E7XA 2XV4S 1T38A 2ZO4A 1FBQA 4ENNA 2B0LA 3IC7A 3BZ6A 4HX4A 2GWRA 4RGRA 3HRTA 5HOOA 3F3XA 4L9JA 1YTYA 1I27A 2H6BA 2LNBA 3EETA 2LF7A 2XAHA 3KEQA 3IWZA 2VBWA 4ENKA 2XRNA 4KA4A 4YIFA 2G9WA 3FMSA 3OOPA 1BI3A 2VODA 3RYPA 2LF8A 2V6CA 4JQFA 3OV8A 3M8FA 3EQLF 1TBXA 4LK0F 4TV7A 4KUMA 3D5LA 2O3FA 3GFLA 3P7NA 3JSPA 2XUBA 4S04A 5H20A 4IHTA 4XRFA 1OR7A 2EFNA 3L7WA 4GYGA 2UZKA 3E97A 1RNLA 3WTVC 5FLXZ 3TO7A 1XB4A 5HS9A 5HLIA 2L02A 2VT3A 5CVVA 2WTEA 3SFZA 3I64A 1YW8A 2WC2A 4RGXA 3I58A 5ED4A 1C0WA 5LEKA 3IHUA 5IT3A 2IP2A 3V4GA 4UVBA 3ZMTA 2QUFA 2Z99A 3HYIA 3GZ6A 4I2OA 5ILSA 4K2EA 2J5PA 1RIOH 1XSXA 1WRJA 4HLXA 3N4MA 4FHTA 2XGXA 2VE9A 3ROUA 3H3ZA 2YR2A 1H9GA 1TLHB 3ZMUA 1SFXA 2RGVA 1Z6TA 2ISZA 3F72A 2AXLA 1GXQA 4U88A 2DPDA 2HQRA 3TO6A 4RS8A 2PN6A 2RVCA 3HHGA 2AS5F 1MJAA 1ZREA 2M8EA 3HTUA 4M71A 1J9IA 5F6FA 5HVQC 1KQ0A 5AIPA 3MAJA 5K5OA 3HTSB 1FBUA 2FOKA 2QQ9A 3ECOA 2Z3YA 1IN4A 3R0AA 2V9VA 3R61A 4LG0B 1O3RA 2EK5A 5HLHA 2WWYA 4ESBA 3DEUA 4OOIA 1MGTA 2P5KA 1SD5A 2VBYA 5L3CA 4FX0A 1Z9CA 4HF0A 4WXCA 4N0BA 3EDPA 1U78A 1I1SA 4XSZF 4ESFA 2JSCA 2P4WA 2GIVA 4WXHA 3RKYA 3I0TA 1P92A 4FX4A 4UVCA 4A5NA 5D4RA 1KU2A 4OMYA 2FNAA 4EQQA 1O57A 1K78A 1NHAA 4RGUA 1TNSA 5D6EA 4QLCU 2G7HA 4N9HA 2EFOA 4XSXF 2NNYA 5AONA 1G3YA 1GVJA 2VN2A 3LFKA 5E8IA 1U6GA 1USSA 5HLGA 3LA2A 4Y13A 1J2XA 3E5UA 3F8NA 3FF5A 1AOYA 1ZG3A 2EWNA 2P5VA 2NS0A 2DFIA 3KZYA 2W84A 1EH6A 2IPQX 2Y48A 3SZTA 4NHJA 1P4AA 5LHIA 2GXGA 3KZZA 2CWEA 3KLOA 5IT9Z 5FD6A 5K5RA 1DDNA 1BOAA 4KICA 4AIJA 1OMIA 4PZJA 1HSTA 2DQLA 1FT9A 3N97A 3RDIA 4L5IA 1IF1A 4YFKF 5E8GA 3F8BA 4IHSA 2UWMA 3E3VA 3IKTA 1BIAA 3BPXA 4AIHA 3BOQA 3P9CA 1CF7A 1TQIA 1MDMA 4P55A 3F8CA 1DUXC 3EUHA 3QP6A 3ML6A 3W6KB 3KP3A 3KCCA 4A0ZA 3Q9VA 2YX4A 5LRSA 1QZZA 2RV8A 3GW2A 1E17A 4BH9A 2PG4A 3S2WA 6PAXA 3ULQB 1KYWA 2V1XA 1FYKA 2VOOA 2OU2A 1F4KA 4BQAA 3M8EA 2HTSA 4OIRF 1B6AA 2LKPA 3CUQA 3GLXA 2STTA 3LQRA 2JZYA 3FXRA 2QQBA 1TQPA 2QZ8A 3I54A 4L0YB 4P9FA 2XHKA 2CGPA 1UB9A 2W24A 4OINF 3L09A 4D0PA 1OYIA 2PMUA 3VB2A 1FC3A 2X0LA 3WGIA 1HBXG 5LBQA 1YYVA 3CUOA 2VC1A 3DFGA 2MH2A 5FFZA 1T39A 4HF1A 5K5QA 1J75A 2FE3A 4LJZF 1Z6RA 4B8XA 1R5GA 2O0YA 1PDNC 2E7WA 3K0LA 1KA8A 4M9ZA 4UVAA 3QU3A 3GFIA 2EFWA 1D3YA 1B59A 1VTNC 3KP5A 2M45A 4KNYA 1D5VA 3E6BA 5BQTA 4OIPF 1W5SA 1ZG5A 2VONA 2OZUA 2F2EA 3QRFF 2FNPA 2KIUA 2BEOA 1FP1D 5F1RA 4L5JA 5HDKA 3BJOA 2L4MA 4AVPA 5L3BA 2EFQA 2DW4A 2GA2A 1U2WA 4I0AA 1I6XA 3REOA 4L9NA 2BE5F 3LAJA 4G6QA 2MD5A 2RDPA 2VT2A 4LLLA 4WX9A 3LQQA 2L54A 3HIFA 5L3EA 5E20A 1XCBA 4UV9A 5ICCA 3JSOA 3RPUA 1UCRA 2FXAA 5CYVA 5F64A 2HZTA 3ZMVA 2R7DA 4EV0A 4HLYA 5TJJA 1J7KA 4KT5C 1LEAA 4G7ZF 1XCVA 3D0SA 5LGUA 1T2KA 2RKHA 4XLNF 5BPIA 4L9TA 2IT0A 2IA1A 2BGCA 3VFZA 3T0YA 2A5YB 1IXSB 4RB1A 3J81Z 2JPBA 1BC8C 5FLXK 2GAUA 2MC3A 3M7GA 2MBFA 2RC4A 3DXJF 4BXUA 4I01A 5A2QZ 3ZP5A 3V8KA 1ON2A 3J80Z 1ZLJA 2IJLA 5DD4A 1ZHFA 1R00A 2NAZA 4RAZA 1BJAA 4KFCA 4G94A 5L3DA 5D5XB 1UHWA 4IRGA 3ERED 1S8NA 5ICEA 1FPQA 1SMYF 3F8MA 1QQIA 1Y0UA 4A12A 1DP7P 3FWEA 1KQ9A 4DNCA 1CF7B 1MDMB 1BI2A 4LFUA 3DP7A 4HV5A 4O6JA 4JBAA 5E1XA 2STWA 2A07F 1B1BA 4I0BA 3CJNA 4ENMA 2KJBA 3GO5A 4EM0B 4EGZA 1HW1A 1W4MA 2ZKZA 3KE2A 3TQNA 1T6SA 1IN6A 1F1ZA 3DF8A 3CUQB 3H3UA 2ZNYA 4RB3C 1R22A 3VOEA 5FGMA 1JE8A 3P9IA 4LD5A 1W5TA 2M5WA 2CW0F 2PEXA 3WTTC 4Q5SF 2XASA 5K1YA 5L3GA 3Q9SA 3SXYA 1RUOA 4M74A 3O2PE 1USTA 3FM3A 3IRQA 2RQPA 1H0MA 5LHGA 2OA4A 2K4BA 1AWCA 2VOPA 1S3JA 3U1DA 4OMZA 3JAMZ 4NQWA 1OYWA 5FFXA 1SD4A 4Q48A 2Z5UA 2H6CA 1P4WA 4U0VA 4I09A 2JPCA 2W85A 4IRIA 4ASNA 1FX7A 4A6EA 3R6SA 2HWVA 5DYMA 3C7JA 2H09A 3GVAA 3R60A 3WU1B 1H9TA 2COMA 2XAFA 1Z91A 3QPTA 1XGOA 2ZCWA 1LB2A 5J8FA 5IT9K 1SFUA 2FF4A 1B9MA 1P2FA 4WF2A 4RB0A 1XMAA 3QOPA 3GF2A 3WU0A 5D5UB 1QGPA 2XKOA 3GFJA 3V7SA 2PJPA 3GYHX 4HA8A 1R7JA 4CHUA 1TNTA 2A6EF 1U5TA 5DDGA 2F5EA 1ULYA 2MH9A 4EM1A 2CSOA 5J8CA 2XROA 4IF4A 4MQVA 2HDCA 2EV5A 5LGNA 1MJ9A 1IRGA 4IVNA 2A69F 1ZN2A 2HYFA 4KN7X 3TGNA 3EYIA 4GGGA 1SD6A 4HYEA 2RNJA 3M1EA 1D8KA 4EVIA 4UXNA 3CTAA 4NB5A 1LDKB 3LA3A 3TOAA 3U2RA 3HHHA 3E6CC 3QU6A 1PP8F 1SAXA 2J5OA 2CFXA 2LDUA 1TTYA 2V1UA 4ZYHA 1TW3A 4M72A 4ETSA 5DCMA 1ZRDA 4KMUX 3MEXA 1BC7C 1IXRC 1P4XA 4MTDA 4S05A 2JT1A 4KIGA 2QENA 1BI0A 1TW2A 3MFKA 2VE8A 5JR3A 1YQAA 1BIBA 2EV0A 3K2ZA 1RUNA 1ZRFA 5D8LB 1UFMA 4XBFA 2IVMA 1XMKA 3RPQA 3FXQA 4EJVA 2FMLA 5DD8A 3BP8A 4ZYDA 2GQQA 2XAJA 1QBJA 1B9NA 1S29A 1FSEA 2VBXA 3F6VA 3NEUA 1KQ8A 5D6FA 1QZYA 3PQJA 4HV6A 3RJPA 1Q1HA 4KIFA 4YIIA 4CZZA 1HW5A 1K79A 1YW7A 4YFNF 2CQKA 1KU7A 3KP7A 3QAHA 1OKRA 4G7HF 3GXOA 2KIFA 3VODA 3V7CA 3KP2A 2P6TA 3GX4X 3H92A 4AIKA 4RAYA 3WTXC 2KRFA 2K27A 4WXDA 2XAQA 2YU3A 5ILVA 2GZWA 2FBHA 1FYMA 3SZPA 5AIQA 1G3TA 1KYZA 3IRRA 1HW2A 2FRHA 1UHMA 4JK1X 4G9YA 3ZQ7A 1EV7A 1HSJA 3FHZA 3J81K 3R4KA 5J6XA 1MD0A 4ON0A 1S6LA 2K7LA 5DUIA 4UV8A 1G3SA 2FEZA 4M9SA 3DPLC 2X4HA 5A2QK 5DV5A 1BN5A 5BMZA 2ETHA 1JGSA 4N9IA 3R0JA 2HKOA 2ISYA 2HKXA 4YG2F 2Y75A 4M73A 2HR3A 2QLZA 1R36A 2L01A 2PLYA 1EH8A 4GYIA 1U5TB 4GO1A 1YO5C 1K7AA 2JRTA 2HQNA 1WWXA 4H0EA 4ENJA 2KKOA 3RTRA 3BROA 4E70A 1S7OA 3ZN0A 1G6NA 1XGMA 4MGRA 4U7BA 4I7HA 5D5WB 2Q2EA 2VC0A 3JTGA 1ZRCA 5ERIA 3MZYA 1V4RA 2EA4A 3WGHA 4IJAA 1WQ2A 3ZMSA 1ONVA 2HTJA 5FO5A 1HKTA 4RGSA 2Y0MA 4DQ2A 2EV6A 5CVIA 2R7FA 1YW9A 4BHPA 1I5ZA 3COAC 4HW0A 3B02A 1R1VA 1LVAA 2PFBA 1R58A 1V3FA 1S7AA 3RIRA 4MQ9F 2HGCA 4CO8A 4KYWA 1RI7A 5DCMB 1FOKA 2O6GE 2OQGA 3RKXA 4PDKA 3HSFA 2OAZA 3BY6A 1O3TA 1SD7A 4AD9A 3KP6A 2O8XA 1FP2A 3GZ5A 1LQ1A 5D8KB 2JTVA 3F23A 3F6OA 3E6DA 4Z2YA 2K86A 3BJ6A 1IW7F 3KETA 1ZLKA 2FA5A 2NYXA 1GXPA 1K6OA 4KMFA 3WGGA 2BYVE 4G7OF 2P8TA 1JHHA 2DI3A 2DBBA 3WE3A 3KEOA 2IW5A 1MZBA 1XSVA 4UHTA 1XN7A 2FSWA 3RKWA 4Y15A 2EB7A 1HQCA 2QBYA 5D5VB 3HSRA 4CGZA 4OU0A 3SQNA 4ZZDA 1EH7A 4ZYEA 4U7DA 1RZ4A 4EJUA 4OIQF 1YS6A 2DPUA 4RB2C 1LDDA 2DAOA 3MZHA 5HDNA 3F8FA 4CYDA 3TKYA 1YG2A 5JVTA 4LLNA 1YS7A 3CO6C 3G3ZA 3I4PA 1IXCA 3CUQC 3WG9A 3KLNA 1W7PA 4L18B 4LB5A 3TOBA 4G8XA 3WTYC 1BBYA 3IL2A 2UXXA
chains in the Genus database with same CATH superfamily
2X6OA 3GTOJ 2X85A 3ABKH 4PFPA 1Z1DA 1H88C 1QHGA 1ZR4A 3K4MA 4AUXA 1FWZA 3HPGA 3ZQQA 1SAUA 1R5HA 4PJMA 2ZXJA 2HFHA 1FZPB 3QP5A 5DCFA 4CICA 3QYFA 2VXZA 5D4SA 4XN0A 2DQRA 3HOSA 1VQOI 3C3WA 1AA7A 3CLOA 1YLFA 1JTXA 1A6QA 3I3LA 2IRFG 1TQMA 4E4HA 5FKNA 4S0HB 1WJCA 5BNGA 2HPIA 3CCMI 5EDNA 1HKSA 2E5NA 4GCVA 2EJRA 4O3MA 1OCZH 5EEHA 1VQ9I 2HQ5A 2ZNZA 3T1BA 3WTUC 3BTLA 1Z7UA 2D45A 2IS4A 1YJWI 2Q8KA 2DA7A 2FQ3A 3JCUC 3JRGA 4ZH4F 3ESWB 1W1WE 4NBQA 4GDFA 2M7AA 4HNUA 4A0YA 3NWTA 3B73A 4L9VA 2E2HJ 1KZHA 3VSLA 1R1UA 4UUSA 2LSOA 2NRAC 2QM3A 3FZVA 5CVJA 1GDTA 4HX7A 4Y17A 3WODF 1B72A 5CLSA 4OIOF 2P7CB 1IV8A 2CG4A 2JVGA 4C9YA 1VF9A 5M5YJ 4IQ4A 1KGSA 2QVOA 1MBFA 2GA1A 2DODA 2WAFA 4BAYA 4HSTA 2QKMB 3NQOA 4XM3A 4B09A 1SMTA 3CDHA 5E18F 2E35A 2KIMA 3PUBA 4XN3A 2MW8A 2XAGA 2CO5A 1E2XA 2XB0X 2A3SA 1RKWA 2Z2SB 5DM7F 2ZMEA 5LRRA 2Q2EB 2PQ8A 2L7FP 1LFBA 1YOVB 4Q4ZF 3I9V2 1Y56A 2JMWA 1WGXA 2UXNA 4YFXF 4UNOA 1MW7A 3TDZC 4BACA 2KMUA 1Z77A 1W7PD 4BHCA 1HXDA 2Y0SA 1VQ8I 1WJBA 3BZCA 2ZFWA 2DOEA 1FNNA 2KT0A 3ABTA 3TO9A 2LFBA 4IX7A 4R1HA 2DLLA 2R7QA 4MHGA 4EM2A 3FK6A 1QA6A 2W25A 4C30A 3FMQA 5BPDA 4R8HA 2R92J 1IUFA 1RR7A 4CCKA 2RN7A 2ZBKA 1RC9A 5JI6A 4A0XA 2ADUA 3OR2C 3DTEA 1R23A 4YELA 4L0ZB 2VBZA 2L9VA 2QKLB 3WTZA 4DBRA 1REPC 3PNYA 2ZJ2A 3HRSA 3SYTA 5E17F 2OUMA 1ZGAA 3BDDA 4HZFA 3ZMDA 1WH5A 2XKPA 2IA0A 2I5UA 2XSJC 4EJTA 1GUUA 1XD7A 4F55A 3EYYA 2R7WA 1IRFA 2OV7A 4Q47A 5KVRA 3MQ0A 3A1YA 4KN4X 1BJZA 5C3EJ 3PQKA 4AU7A 3PNTA 1Y39A 1O7FA 2D1HA 3VYSB 3LSGA 1G4DA 1OCCH 4DJAA 1OCOH 4ZYGA 4BYYA 3K1MA 4E7HA 3SFIA 2KPMA 3X2QH 1WJ5A 3FXLA 2L0KA 4HRIA 4BKXA 1ODDA 4E7ZA 1MBGA 3E5XA 5H6RA 2V1DA 4L5EA 3E5QA 1X3WB 4MEXF 4XICA 5HS7A 4HSRA 4XORA 2E1CA 1L0OC 4LK1F 1O7LA 4EMSA 1ZG1A 1QHHD 4QSHA 4ESJA 1QZEA 1MBKA 1ON1A 4BJ6C 3IUOA 3A01B 1IDZA 4DOZA 2NS8A 3T8TA 3HOYJ 2KHMA 2M87A 2KRHA 5CVRA 1JUPA 4P5OA 4WK8F 1YJ9I 3QYBA 1E3HA 1IO2A 3DBRB 4P9UA 2H27A 2O5RA 4OWRB 5EGOA 3QPHA 5E1ZB 1S9HA 3PNVA 1ETXA 2OCEA 1BA5A 1FEXA 2K4JA 4E7IA 2G7UA 1HKQA 5LEJA 5FROA 2D5VA 1QNTA 2IA2A 2QBYB 2DDAA 3J7AO 2PI0A 4RLQA 3JTHA 2QA4I 1XDUA 2CYYA 2M1BA 2PBIA 4ZC3A 2YSRA 5DUKA 2W57A 2CRGA 2WV0A 3CMYA 3T8RA 4B44A 3U1KA 4O5VA 1Z67A 4HOBA 3BG6A 5LLQA 1L3LA 1QPIA 1FTZA 2X51A 5CJ9A 2ESNA 3BPVA 3VEPA 1R71A 2FUG2 4XOTA 3FX3A 4MEYF 4JX5A 3ECHA 2HU9A 3CJRB 1LNWA 4N4OB 2VPLA 1ZAOA 2DFFA 1STZA 2OD5A 2O61A 1IN5A 4BDYA 4CXFA 5H6QA 5FLMJ 1LDJA 2M30A 2LY2A 3PIPF 2FMYA 3BR6A 2MLKA 4QWQA 5HLTA 1BM9A 1LJ9A 4CCNA 2TDXA 3C2GA 2D1VA 3I59A 1W7PB 1IAWA 3IH2A 3H1CA 1DU6A 4HBLA 3U9GA 1T98A 4M6XA 2OPTA 3C1DA 1IN8A 5HS8A 2IEKA 3SEQA 2L2OA 2CQXA 2FU4A 2Q1ZB 4M6YA 3C18A 3HRUA 1YFHA 3FXKA 4BXFA 3PFIA 3Q5FA 2AXTC 1I6HJ 4EJOA 3OYEA 3RKQA 1X2MA 1FY7A 3ELKA 3GTLJ 1TL8A 2JJ7A 3IWFA 4IO9F 4BE0A 4I6ZA 1DPRA 4ZDOA 2HOAA 3L00A 1WKMA 2HEOA 3FBNB 4HDUA 1J5YA 3BWGA 3CCRI 3O8GA 3DPTA 1U3EM 2O9LA 5E3OA 2H94A 1G3WA 4IQJA 3UNGC 2D2WA 1S5LC 2WY8Q 5LFAA 5FLVA 1U9OA 5ICFA 1IN7A 1ORKA 2EZHA 3DKWA 3DQVC 5KK1A 2CJJA 1OPCA 3E6MA 1QPMA 2ID6A 3B6CA 1F9NA 3W6JB 4BL0B 1UHSA 2A68F 1MSEC 3RZDJ 1O3QA 4EJWA 2ESHA 4BHBA 2G0EA 4U0YA 3DV8A 2P5LC 4BQQA 2KDOA 2ZSIB 1VQ4I 2W4SA 4XQFA 2Z33A 2CW8A 2OBPA 2XGDA 4HNTA 3KP4A 2BVLA 4BY7J 3GWZA 4UUSB 1MH4A 1XSDA 1X1PA 3QODA 3HC7A 1B72B 3O6BB 1D0XA 1GHCA 2MA3A 2PMHA 3FXUA 3M4OJ 1TWGJ 1IRZA 2F5CA 1ZR2A 3GFMA 2HOEA 1ZH5A 1Z05A 3WTWC 1X3UA 2YPRA 1NG6A 2ACJA 1U8BA 1GVDA 1XGNA 2Z9OA 3H5NA 2V6EA 4ZZLA 3OIQA 1MNEA 3NRVA 2ZMEB 4JOMA 1IC8A 2BY2A 2OQRA 4YIRX 4OAZA 3IV5A 4PCQA 5LHHA 2OZ6A 2LRDA 2IGKA 4BDZA 4IRHA 4A3MJ 3Q3SA 1WI9A 3NAUA 3LA7A 3CZ6A 5JHUA 3MWMA 5HDGA 4XKCA 4WCGA 2A6HF 3IKVA 3ZOBA 1QVUA 4A2UA 3J80K 1LFUP 1OFCX 2EFPA 4ZDPA 2L3DA 9ANTA 1OCPA 3I53A 4P96A 2R3SA 3G73A 5DM6F 4LGWA 1ZARA 2ID3A 3AG4H 2Q0OA 4RM3A 2QQAA 4IPAA 2QEXI 4D1QA 4G6DA 2E1OA 1U5TC 3IH3A 1ZYRF 3AG1H 4KJZA 1DGRM 1MJBA 2L4AA 5BOXA 1WSUA 4W1UA 1X4OA 4J19A 4A3KJ 1BR4A 5E3MA 3L2CA 4KDPA 3LSTA 1X1BA 1CGPA 3CCVI 3GUDA 3LSJA 3K9TA 4AWXB 2P7VB 1PUEE 2X1EA 4RA2A 3LWFA 2VJJA 3SHFA 2JUCA 2MABA 4I02A 2QGUA 3FISA 4I98B 1KU9A 3GTKJ 2M4KA 3GEZA 4PGHA 1YITI 2EIKH 2K02A 1H89C 1FTTA 4QPQA 1N77A 4HF2A 3RI4A 1UELB 1YIOA 1MSFC 2YX7A 4XNFA 2A61A 4U0WA 3ASOH 1B4AA 5J1YA 2EBIA 2NOJB 3I71A 5F08A 3WTSC 3A2KA 1JXSA 3H5AA 1FBSA 4KITB 2LKXA 4LLGF 1X19A 2FD5A 3ZQHA 5BS6A 1VQPI 2VJIA 2HZDA 3LSHA 4CCJA 2V4JC 4PUSA 2JA6J 1ZKGA 4LG3A 3K69A 1ZGJA 2VQGA 5B1BH 3JR9A 4A6DA 3H3VK 3AG3H 4H4KC 4HX8A 3PIOF 1ETQA 1MH3A 3M9AA 3P9KA 1FSHA 2DK5A 1A04A 2K9QA 4HNVA 2LC2A 2N8GA 4FQGA 2CS3A 4C3IJ 5DEQA 3CCLI 2F5DA 2XIGA 3FMRA 2AQEA 3JRCA 4RM2A 5EGOB 1F5TA 2CU7A 1V55H 4MNUA 2JA8J 2BBYA 1EA3A 2QQ8A 2Z16A 4A3JJ 2O03A 2OJED 1JGGA 1QO0D 4LMYA 5DS9A 3IP4B 5ILUA 1I39A 3BR1A 3ZN1A 1MKMA 3F22A 3CQZJ 4FETA 3B6AA 2NOGA 1XGSA 2QYOA 3ABUA 4IXAA 5E1WA 1KU3A 2GXAA 3L9FA 1U8RA 1SVMA 1WVRA 2V79A 3ISPA 3ZMZA 3G6EI 4IOCF 3GTGJ 3S1MJ 3S15J 3OYKA 2HOSA 2KJCA 4XLCA 5GAGJ 4ZJZA 4EGYA 3Q0UA 3JAMK 3T5XA 5J47A 3OYLA 5CVUA 5IPAA 5IP7J 1LE8A 5FD5A 1BW5A 1HOMA 5FB2A 3KYLA 2ELHA 2DOFA 2DTRA 5C4JJ 3HOTA 1XDSA 2WB1N 3D5SC 3LAPA 2FBIA 4HQMA 1K78B 2JVHA 5F0CA 2HYGD 4BNCA 1JHFA 2BV6A 4MTEA 3ZQIA 5EEGA 4B47A 4HDVA 1IUYA 2DJIA 3RCOA 2VUMJ 2XVCA 1J59A 1FLIA 3P5JA 3CO7C 3K1PA 4II2A 4GXOA 3HEFA 3I59B 3G71I 1HC8A 1DPUA 1VZ0A 4PGGA 3BJAA 2DO7A 3HSEA 2MLGA 4XMYA 5CQEA 3SDGA 2DK8A 2QWWA 3HKZA 3U21A 4DIQA 1P9QC 1IG7A 2E1NA 2EA2A 1D5YA 5TRDA 3OYIA 5J40A 3M1CA 2CQ7A 2CH0A 2OCCH 4B3AA 1S7EA 3TDUC 4LG0A 1A6IA 1P6RA 1T0FA 3OL4A 1UJ8A 1SFEA 2DT5A 1BI1A 3MCZA 1D0YA 1TWFJ 4MFEA 2HDDA 4A3EJ 3ERMA 3JW4A 4KIBA 1I1GA 3H36A 5LGTA 3PO3J 3V7RA 3ZPLA 1X3ZB 5IOZA 1OYYA 2KZVA 3K1NA 3RSNA 4CDGA 4LB6B 2ELKA 2NVTJ 1ETYA 3V8LA 3WE2A 4DZPA 2WA0A 3KPHA 2HS5A 3V8JA 3LSPA 2NNNA 3HRMA 3KFWX 3DKYA 4UUVA 3AL0B 2HPMA 4HQEA 1JUSA 1J0RA 3O3KA 4XLPF 1RRJA 1PYVA 1FYLA 2GXBA 5FKMA 4M3EA 1O3SA 4HAMA 5JFRA 3AAFA 1T56A 4WWCA 2E2JJ 1PJRA 1PVEA 4M9XA 4MO7A 1PP7U 1FOXA 1U0JA 4IKFA 4KT6A 2XB5A 3OMYA 3PL8A 4RAFA 3F21A 4A3IJ 2DU9A 3VWBA 3QWLA 3EPZA 1WJDA 1K4SA 1R1TA 3KIOA 1HDDC 2P6SA 1OISA 2F5FA 2FBKA 1IZ1A 5L3FA 3FM5A 3I5UA 4RMNA 3W2WA 2IBDA 1S72I 2M0CA 1X58A 2EZKA 1MBJA 4ZTFA 4FT8A 1LEBA 4A5MA 3RYRA 3HUGA 4R79A 3K70D 1EKEA 2Y0SN 1SEUA 4C3JJ 2C6YA 1JKOC 1D8JA 4F7ZA 1P7IA 3H0GJ 2CV2A 2R0QC 4PJJA 5ICGA 2E7XA 2XV4S 4BGDA 1T38A 2CV1A 2VJ4A 5GPCA 2ZO4A 1I50J 3K4LA 1FBQA 1FJLA 2MC4A 3ZQFA 3MKWB 4ENNA 4AIDA 2AHQA 2B0LA 3IC7A 2OC6A 4CCLA 3BZ6A 4HX4A 4QIWN 2GWRA 4RGRA 3FXJA 3HRTA 5HOOA 3F3XA 4L9JA 1YTYA 1ETKA 2JUGA 1I27A 3CC4I 2H6BA 4E7LA 2LNBA 3EETA 3D1NI 2LF7A 1X1DA 2NXNB 2XRLA 2XAHA 3SJMA 3KEQA 3IWZA 1XC5A 2VBWA 3LSKA 4ENKA 5CPRB 2HVRA 5IP6A 2XRNA 2JWTA 2EPFA 3JRHA 2E1MC 2MG4A 1HF0A 3OWTA 4KA4A 4IEJA 4YIFA 1IV6A 4IZZA 2G9WA 1FIPA 3FMSA 1MBHA 3OOPA 1BI3A 3OYFA 2VODA 2R93J 3RYPA 3K4BA 4NUBA 2LF8A 3A4CA 2V6CA 4JQFA 3SEZA 3OV8A 2YUSA 5EZGA 3HGGA 1WH7A 5EF6A 3M8FA 3EQLF 1TBXA 1UG2A 4LK0F 4TV7A 4KUMA 3A03A 3L2UA 3D5LA 3GLLA 2R7VA 2O3FA 2BY1A 5GTHC 2ZJQF 3BR0A 3GFLA 3P7NA 2A6TA 5E79C 3CCUI 3JSPA 2XUBA 4S04A 5H20A 3LSIA 4XRFA 5JVGF 4IHTA 4FCYA 1R9TJ 1OR7A 1BR2A 2LYCA 2EFNA 1TT0A 3L7WA 4GYGA 2UZKA 3E97A 2VXDA 1RNLA 2Y69H 3WTVC 5FLXZ 3TBIA 3TO7A 3K10A 1JUMA 1AHDP 4DYRA 2ZXHA 3DTKA 1XB4A 5GPAA 4NC6A 5HS9A 2L02A 2F4MB 2VT3A 5CVVA 2WTEA 5HLIA 3SFZA 3MKLA 3I64A 1YW8A 2WC2A 4RGXA 4LOCA 2V1NA 3I58A 5ED4A 1C0WA 5LEKA 3IHUA 2AQFA 2CQQA 1Y1WJ 4U87A 2W48A 1JJ8C 1H8AC 5IT3A 2L9SA 2IP2A 5EYRA 3V4GA 3OYCA 4UVBA 1TWHJ 3ZMTA 2QUFA 2Z99A 3HYIA 3GZ6A 4I2OA 3TMOA 1UMQA 1X4PA 3K70C 5ILSA 3H0DA 4DZJA 4MLOA 2V26A 2CQNA 2HI3A 2AO9A 1LE8B 3J7ZI 3DEWA 4K2EA 2J5PA 4XRMA 4DBQA 1RIOH 1XSXA 2FOWA 5HNHA 1WRJA 4HLXA 4JX4A 2DFEA 3N4MA 1NTCA 2V9KA 4FHTA 2XGXA 2VE9A 3ROUA 2DA6A 3H3ZA 2BZTA 2YR2A 1H9GA 2DA1A 2LLKA 1TLHB 3ZMUA 1GV5A 1SFXA 2RGVA 1Z6TA 3AG2H 2ISZA 3F72A 2AXLA 1GXQA 4U88A 2DPDA 1PUFB 2HQRA 3TO6A 2VQHA 1I3QJ 5GADJ 3MZ8A 4RS8A 2PN6A 2RVCA 3HHGA 2AS5F 1MJAA 2EIJH 1ZREA 3FK7A 2M8EA 3HTUA 4M71A 2ZXWH 1J9IA 2MSYA 4XL9A 5F6FA 3DU5A 5HVQC 1KQ0A 5AIPA 4BQNA 3MAJA 3JRDA 4IOAF 5K5OA 3HTSB 1FBUA 2FOKA 4XKBA 1Y0NA 2QQ9A 4Y7NJ 3BT9A 1ETOA 2WBMA 2EIMH 3ECOA 2Z3YA 1IN4A 3R0AA 2V9VA 3R61A 4LG0B 1O3RA 3TP3A 2EK5A 2DFHA 5IYBJ 5HLHA 2WWYA 4ESBA 3DEUA 4OOIA 1MGTA 2P5KA 3ABLH 1SD5A 2VBYA 3W2VA 5L3CA 4FX0A 1Z9CA 2K9LA 4HF0A 3FKJA 4WXCA 4N0BA 3C2HA 2HXIA 3EDPA 1WCMJ 3E0JB 4RAGA 1U78A 1I1SA 3KYDB 3S16J 1A35A 3OS2A 3S1QJ 4XSZF 4ESFA 3CMEI 3GTQJ 2JSCA 2P4WA 2GIVA 4WXHA 3RKYA 3H9GA 1JJ6C 3I0TA 1P92A 4FX4A 1VQMI 4UVCA 4NC8A 4KISA 4LITA 4D5CA 3EUAA 4HG2A 4A5NA 2R4GA 5D4RA 1KU2A 4OMYA 2FNAA 4EQQA 1O57A 1K78A 1NHAA 1VNDA 1TNSA 2DA5A 4RGUA 5D6EA 4QLCU 2G7HA 4A69C 2W82A 2LH9A 4N9HA 4IHWA 2EFOA 1Y8QB 4XSXF 2NNYA 5AONA 1G3YA 4IHVA 4A3CJ 1GVJA 1JT6A 1VQLI 2VN2A 3LFKA 5E8IA 1U6GA 1USSA 5HLGA 3LA2A 4PSXA 4Y13A 3KYCB 1J2XA 3HUGB 3ONQA 3S32A 3E5UA 2Y9ZA 3F8NA 3FF5A 3LFUA 2E19A 1AOYA 1TWAJ 1ZG3A 1T95A 2EWNA 2P5VA 4HEA2 3RQ4A 2NS0A 2DFIA 3KZYA 2W84A 1EH6A 1IRXA 4XIDA 2IPQX 4BEHA 5HNFA 2Y48A 3SZTA 1GV2A 4NHJA 1P4AA 5LHIA 5J4YA 2GXGA 3KZZA 3ZXSA 1G59A 2CWEA 3DTIA 3OR1C 2LG4A 2ICWG 3KLOA 1T33A 1YIJI 5IT9Z 3S2HJ 5FD6A 5KHDA 4E7SA 2QSGX 5K5RA 2R5ZA 1DDNA 4YRVA 1BOAA 4KICA 3ZQCA 4AIJA 4ABZA 2O8KA 2LVSA 1OMIA 3BTCA 4PZJA 5K7FA 1HSTA 1R5ID 2LKSA 5J1UA 2ZXIA 3H9QA 4JYKA 2DQLA 2JA5J 1FT9A 4II3A 2K9SA 4M3BA 3WHBA 3N97A 2IAIA 3RDIA 4PSWA 3CMMA 4XOPA 4XKWA 2NVUB 3LSRA 4L5IA 1IF1A 4YFKF 2WV1A 4FE7A 5E8GA 3F8BA 2FX0A 2PJRA 4IHSA 2UWMA 3E3VA 3IKTA 2ZMEC 2LY1A 1BIAA 3BPXA 4AIHA 1DP3A 2XAUA 3BOQA 3P9CA 4AVZA 1CF7A 1TQIA 4W97A 1MDMA 4P55A 2JK3A 2LK2A 3OSGA 3KZIC 3F8CA 2Y9YA 2R7SA 1DUXC 1LKXA 3EUHA 3TP0A 3QP6A 4BU2A 3ML6A 4X1EA 4RBOA 3W6KB 3KP3A 3VYRB 2F6CA 3CC7I 3KCCA 2HDWA 3QQAA 4A0ZA 1XS9A 3Q9VA 2YX4A 5LRSA 1QZZA 1K61A 2RV8A 3GW2A 4NC7A 2VL8A 2EINH 2VASA 1E17A 2CFOA 4Z6YA 4BH9A 2PG4A 4I99C 3S2WA 2VKVA 3DLAA 3AKZA 6PAXA 3ULQB 1KYWA 2EILH 2V1XA 1FYKA 2VOOA 2IGMA 3SZGA 2OU2A 4XONA 3OSFA 1F4KA 3JRBA 4RDUA 4BQAA 3M8EA 2CMPA 2HTSA 1E0EA 4OIRF 1B6AA 2DT7B 2V7FA 2LKPA 2X9DA 3L2WA 3CUQA 1GLNA 3GLXA 2CW7A 3LQRA 2STTA 1F43A 1E3OC 3HPHA 2JZYA 2VI6A 4CA0A 2X6XA 3OYGA 3FXRA 2IGNA 3D5RC 4XK4A 2QQBA 1TQPA 2QZ8A 3HL2A 5FRMA 3I54A 4L0YB 4P9FA 2VB6A 2GOXB 2ZFUA 4UB6C 2XHKA 2CGPA 1VQ6I 3VSKA 3S8PA 3MKZA 1JKQC 1D0ZA 1UB9A 2W24A 3Q0VA 2OF7A 4OINF 2PX9A 3L09A 4HPQA 4D0PA 2LBFA 1OYIA 2PMUA 1APLC 1E3PA 1V5GA 4XRSG 3VB2A 1FC3A 2X0LA 4YEJA 1SVOA 2JSPA 4P1WA 3WGIA 1W36D 1HBXG 2XPUA 3G1LA 3BG9A 5LBQA 2HVQA 2ZC2A 1YYVA 3CUOA 3HM5A 1P7JA 2WAQA 1V5EA 2VC1A 4PFOA 4X6AJ 3DFGA 2MH2A 1EJ9A 3DCFA 5FFZA 2PMZA 1T39A 4CCOA 4HF1A 3HG9A 4BJTA 5K5QA 1J75A 2FE3A 4LJZF 1G8XA 4D9JA 1Z6RA 4B8XA 1R5GA 2O0YA 2LY9A 1PDNC 1M1EB 3HKZN 2E7WA 4A3FJ 3CP2A 3K0LA 4ITVA 1SC7A 1KA8A 4M9ZA 4UVAA 5TISC 1IGNA 3QU3A 1D1BA 3GFIA 2EFWA 1D3YA 1B59A 3OYBA 1VTNC 5C44J 3KP5A 5J1RA 1XTAA 2M45A 5EZHA 2A5WA 4KNYA 1D5VA 3E6BA 5BQTA 4OIPF 4FASD 1W5SA 1ZG5A 2VONA 1DQUA 2F2EA 2OZUA 4CUGA 3QRFF 5KCMA 2FNPA 2KIUA 1NK3P 2VKDA 2BEOA 1BL0A 1KONA 2DDBA 5JHFA 3S3OA 1FP1D 5F1RA 2IXSA 3HBLA 4L5JA 5HDKA 3BJOA 1JT0A 3G1OA 3CESA 3KX2A 2L4MA 4AVPA 5L3BA 3J7AY 4UB8C 3MD2A 4EATA 1XX5A 4C2TA 3OYJA 2EFQA 2DW4A 2GA2A 3I56I 1U2WA 4I0AA 3PFYA 4X0GA 3CLQA 3G4SI 1I3AA 1I6XA 2KP6A 1TWCJ 3REOA 2O7OA 4A3GJ 4L9NA 5IYDJ 2BE5F 2HQAA 3LAJA 4G6QA 2MD5A 2RDPA 4XLHA 2F4OB 2VT2A 4BBSJ 1JTYA 1JI8A 5KNLA 4LLLA 4WX9A 2BY3A 3LQQA 3IH4A 4AYBA 1N78A 2L54A 3HIFA 5L3EA 5E20A 2KQRA 1XCBA 4UV9A 5ICCA 3JSOA 3RPUA 1ETWA 5M3MJ 1UCRA 2FXAA 1VQNI 2DMQA 5CYVA 5F64A 1B8IA 3ZQLA 1OQYA 2HZTA 3ZMVA 2R7DA 4EV0A 4HLYA 1PUFA 5TJJA 4PJLA 1J7KA 2ME6A 3HB9A 4KT5C 3GCMA 1LEAA 5FRNA 2K40A 4G7ZF 3DEEA 1XCVA 3D0SA 5LGUA 3VYTB 3FKIJ 3FHNA 1K4TA 1T2KA 2RKHA 4XLNF 5BPIA 4L9TA 5B3SH 2IT0A 2IA1A 2BGCA 2Z1DA 3VFZA 4B1RA 3FXOA 3T0YA 2A5YB 3S93A 1IXSB 4RB1A 3J81Z 2F4IA 2JPBA 2MD0A 4RLFA 1BC8C 4XLEA 4BBRJ 5FLXK 2RAEA 2GAUA 4Y52J 3TL4X 2MC3A 4BEHB 3S3MA 3M7GA 2MBFA 2L5QA 4FISA 2RC4A 2NS7A 3DXJF 2XSDC 4UUTA 4BXUA 2KIQA 2M0MA 2XPVA 4I01A 3W3CA 5A2QZ 2R5ZB 3ZP5A 3V8KA 1ON2A 2R7TA 2HXOA 3ZRGA 3OL3A 1ZLJA 3J80Z 2IJLA 5DD4A 1ZHFA 2IS1A 1R00A 3BG7A 2NAZA 4RAZA 1K6YA 1BJAA 3CCEI 4KFCA 4G94A 5L3DA 5D5XB 3M8JA 3K7AJ 1UHWA 4IRGA 1VQ7I 3OYDA 1Z0XA 1N75A 3ERED 1S8NA 2Y31A 2JA7J 2PJRB 5ICEA 5FJ8J 1FPQA 5B1AH 1SMYF 2B7EA 3F8MA 2KDZA 1QQIA 1Y0UA 2K5CA 4A12A 3IAS2 2ZSHB 2E2IJ 1DP7P 1WZ2A 2Y2ZA 3FWEA 1KQ9A 3ASNH 4DNCA 3LMMA 4ZDLA 1CF7B 1MDMB 1BI2A 2OTJI 1XMXA 4LFUA 2XDVA 3DP7A 5IOYA 5H2FC 5CKTA 1ETVA 2XC7A 2DMTA 4HV5A 3CP8A 3MN2A 4O6JA 2L7ZA 4JBAA 5E1XA 2STWA 2A07F 1B1BA 1QRYA 4I76A 2M2EA 4JX6A 3A0BC 4I0BA 3CJNA 1LUJB 5J3LA 2E60A 2KLOA 3N05A 4E7JA 3RZOJ 5F27A 4A3LJ 3FXMA 4ENMA 3CCYA 2KJBA 3GO5A 4EM0B 5DTDA 4EGZA 1HW1A 2F5VA 1RESA 1W4MA 2ZKZA 3KE2A 3TQNA 1T6SA 3PO2J 1IN6A 3BCAA 1F1ZA 3K6GA 3MMYB 4F93B 2DJNA 3DF8A 3CUQB 3H3UA 2ZNYA 3K4CA 4RB3C 1NK2P 4DYQA 2UV1A 1R22A 3VOEA 2JN6A 5FGMA 1JE8A 3S1RJ 3P9IA 3CDLA 4LD5A 4E6KG 1RR8C 2R7ZJ 5GAHJ 4JP0A 2WADA 5F1JA 3JRIA 1W5TA 2F48A 3UKGA 3GTMJ 2M5WA 2CW0F 2LTPA 2PEXA 3WTTC 1W5CC 3LNQA 2XASA 5K1YA 4Q5SF 2DYRH 5L3GA 3Q9SA 3SXYA 1RUOA 4M74A 2E5ZA 4C3HJ 3O2PE 1LVKA 1GT0C 2XGEA 4BXXJ 1ZQ3P 1USTA 3FM3A 4LIUA 4CYCA 3IRQA 3LSMA 3K2AA 2RQPA 2LBFB 1H0MA 2ECCA 5LHGA 1WJEA 2OA4A 4DYCA 1UG0A 2K4BA 3CC2I 1AWCA 2M7BA 2Y30A 2X6YA 2VOPA 1S3JA 3U1DA 4V2FA 1Y8RB 3L1PA 4OMZA 3JAMZ 5LD2C 4NQWA 1OYWA 5FFXA 2K85A 1AKHA 1SD4A 4Q48A 2Z5UA 5M5XJ 2DTZA 1FMWA 2H6CA 5FKKA 1Z7LA 2DOAA 1P4WA 4M6VA 2EZIA 2GBYA 3PJRA 4G6TB 2KL4A 4U0VA 4I09A 2KRCA 1JKPC 2E1MB 2JPCA 3AFHA 2W85A 4IRIA 3QYEA 4ASNA 1FX7A 4BE1A 4A6EA 3R6SA 2HWVA 5DYMA 3FDYA 3C7JA 2H09A 3GVAA 1Y6IA 3R60A 3WU1B 1H9TA 2COMA 3HZJA 2P0WA 1POGA 2XAFA 3HDDA 1Z91A 3QPTA 1XGOA 2ZCWA 5EG0A 1LB2A 5J8FA 4UY8I 5IT9K 1SFUA 2E36A 2X6WA 3QPLA 4QPOA 1T8IA 2FF4A 1A31A 1WFXA 3M07A 4GFBA 2RNGA 1B9MA 1P2FA 4WF2A 2DA3A 4RB0A 1XMAA 1Z3XA 3QOPA 3GF2A 5GTIC 1WPKA 1JKRC 2K3PA 1HCRA 3WU0A 1YE9A 5D5UB 1QGPA 4NDLA 2XKOA 3GFJA 1NG7A 3V7SA 3CJQB 3OYHA 2I8DA 2PJPA 5EEAA 4BE2A 3GYHX 3DKXA 1YI2I 4HA8A 1R7JA 1FOYA 2TRTA 3GZNB 4CHUA 2UUZA 1TNTA 5F0HA 2W1OA 1NH3A 1UAAA 1QU3A 1MMSA 2A6EF 2RREA 2BW3A 3CF2A 1U5TA 4ZTJA 2VIXA 2DMUA 2F5EA 5DDGA 1Z3YA 1ULYA 1FMVA 2MH9A 4EM1A 2CSOA 1UZCA 5J8CA 2XROA 1B8IB 4IF4A 4MQVA 1VI0A 3LOCA 3OIPA 4M3DA 4B43A 2HDCA 2EV5A 5IP9J 5LGNA 3OYNA 3S2DJ 4PK4A 3W6VA 1T0FC 1MJ9A 1IRGA 3BG3A 4IVNA 1R4NB 2EH3A 3F0CA 4FE4A 2QSHX 2A69F 1ZN2A 3I55I 4Y33A 2MGQA 2H8RA 2HYFA 4BS9A 4KN7X 4ANJA 1MNMC 1LFPA 3BG5A 4XRSA 3TGNA 3EYIA 4GGGA 1SD6A 4HYEA 1HDPA 2RNJA 2MYSA 5J4VA 3M1EA 2ZJPF 1D8KA 2ELJA 4EVIA 1A36A 3BTJA 2M34A 3HJEA 4UXNA 2XPWA 3CTAA 3CF5F 2I10A 4NB5A 1X1CA 4C2MJ 3RQIA 5M5WJ 1DGWY 1MMDA 3IAM2 1U9NA 1LDKB 3LA3A 3TOAA 3U2RA 3HHHA 2DXIA 3HOXJ 3S17J 3MVPA 1A5JA 2QCOA 3E7LA 3E6CC 1WHUA 3QU6A 1PP8F 1SAXA 4IHXA 1RPWA 2J5OA 2CFXA 4XR6A 2LDUA 3VYUB 1DU0A 1TTYA 3Q0WA 1OCRH 3BR2A 2V1UA 2DT6A 1TW3A 4ZYHA 4M72A 4ETSA 5DCMA 1ZRDA 1SVLA 2DYSH 1Z21A 2M3AA 1ZELA 2YS9A 4AC0A 4KMUX 3MEXA 2B9SA 3DBHB 1J09A 1IXRC 1QVTA 3QPSA 3VDXA 1BC7C 2E34A 1P4XA 3DPUA 4DW6A 1R49A 4N4NB 2MFZA 1RETA 4MTDA 4S05A 2JT1A 5CQGA 4KIGA 2QENA 1CQTA 1BI0A 1TW2A 5E3LA 2VE8A 3MFKA 5KAIC 2L9NA 4Y4RA 5JR3A 1YQAA 2XGCA 1LPQA 2GOMA 1AU7A 1BIBA 2VKHA 1RKTA 2DMNA 2EV0A 3K2ZA 4OAYA 3O8HA 1RUNA 1ZRFA 5D8LB 1UFMA 4XBFA 2LR8A 1YHQI 2JQ7A 2R5YA 2IS2A 2ZB9A 2IVMA 1XMKA 3RPQA 2L7KA 4PJ0C 3FXQA 4XLAA 4EJVA 2FMLA 1ITYA 5DD8A 3BP8A 1MMGA 5GAEJ 2GQQA 2XAJA 5KAFC 4ZYDA 1SFKA 1QBJA 1B9NA 4B48A 1S29A 3BC8A 2R7OA 1FSEA 2X1DA 4G12A 4F91B 2VBXA 2W00A 3PSIA 3F6VA 3NEUA 1MMAA 5D6FA 5HODA 1KQ8A 4B4CA 1QZYA 4ZYAA 3PQJA 1D1CA 4HV6A 3VPRA 3RJPA 1Q1HA 4KIFA 5C4XJ 3DWLE 4YIIA 4CZZA 1HW5A 3OYMA 1K79A 1OJLA 2X48A 1YW7A 4YFNF 2CQKA 1KU7A 2WY7Q 2R7UA 3L2QA 3JREA 3OIOA 1VFCA 3KP7A 3QAHA 1OKRA 2VQCA 2ZJRF 4G7HF 3GXOA 1MNDA 1V5FA 3PUFA 2KIFA 3S1NJ 1N25A 4C2UA 2WAQN 4CYCB 3VODA 3V7CA 2DCEA 3NWSA 1XG1A 3KP2A 3LL7A 2P6TA 3GX4X 2PMZN 3H92A 4XLFA 3I4MJ 2CUFA 4M3GA 4AIKA 4RAYA 3WTXC 2KRFA 2ECBA 2K27A 2M4GA 3OOUA 1OR7C 4WXDA 1EF4A 4NNJA 2XAQA 2YU3A 1MBEA 3WU2C 3JRFA 5ILVA 3CJTB 2GZWA 4NQWB 2FBHA 1FYMA 3BR3A 1AKHB 3ZR8X 4BY1J 1HA8A 3NARA 2DN0A 4B3XA 3SZPA 5AIQA 1G3TA 1KYZA 1ACIA 1ZK8A 3IRRA 1O4XA 2COBA 1HW2A 1WI3A 2EZLA 5JLWA 3CCJI 3M3YJ 2FRHA 1UHMA 3G1MA 2GM4A 4JK1X 1YRNA 4G9YA 2YU9J 3ZQ7A 5B66C 2XF7A 2IGOA 3OY9A 2DA4A 3A02A 1EV7A 1HSJA 3S3NA 3FHZA 3J81K 4QTRA 2BY0A 3ABMH 3BLYA 2QSFX 3R4KA 2W7NA 3DBLB 1HLVA 2L7MP 1MD0A 1TT5B 3K4KA 4ON0A 1T08B 1S6LA 2K7LA 4XKVA 5J6XA 5DUIA 4A93J 1IDYA 5K7HA 4UV8A 4F92B 3F9KA 1G3SA 2FEZA 2H1KA 5EG0B 4M9SA 3DPLC 4GRIA 1W0UA 1WJFA 2BVMA 2X4HA 5A2QK 3E1SA 2H8WA 2WAEA 4V2GA 5DV5A 2V9PA 3DLLF 1BN5A 5K7ZA 3CCSI 5BMZA 2ETHA 3JRAA 1JGSA 3BR5A 4N9IA 3HXLA 3R0JA 3G2BA 1Y1VJ 3SDBA 2LD5A 4AYBN 2HKOA 2ISYA 2HKXA 4YG2F 2Y75A 4M73A 2CV0A 2HR3A 2FQ4A 3BTIA 3GTPJ 3WHCA 3FIWA 5FKOA 4A3DJ 5M3FJ 2BXYA 2QLZA 2VPRA 2BXZA 1R36A 2VJ5A 2L01A 2PLYA 1EH8A 2K9MA 1FIAA 2BW3B 4EEFG 4GYIA 1SFOJ 1U5TB 4V19K 4GO1A 1YO5C 2NVQJ 3ZGKA 1K7AA 1OLTA 2JRTA 2VKEA 5TGTA 2HQNA 2KFDA 1WWXA 2HOTA 2A05A 4H0EA 4J00A 4ENJA 2M9HA 2KKOA 3RTRA 1MMNA 3BROA 4E70A 1S7OA 3ZN0A 1G6NA 1XGMA 5FKLA 4MGRA 4U7BA 4I7HA 4F3QA 5D5WB 2OTLI 2Q2EA 2CUZA 4D7NA 2VC0A 2LOOA 3HOZJ 3JTGA 2VQLA 4AM3A 1ZRCA 5ERIA 3DU6A 3MZYA 1VQKI 1V4RA 2EA4A 3WGHA 4IJAA 1WQ2A 3ZMSA 3OS0A 5EJCA 2DMPA 1ONVA 2HTJA 3KEYA 5FO5A 3I4NJ 1HKTA 4RGSA 2Y0MA 4DQ2A 2EV6A 2LMDA 2CUEA 5IYCJ 4BJ5C 5CVIA 2R7FA 1YW9A 4BHPA 1I5ZA 3COAC 2GLOA 4HW0A 3B02A 2L9RA 1R1VA 1LVAA 2QF7A 2PFBA 3GMEA 2NVXJ 1R58A 1YX3A 2H1LA 2IS6A 1TP4A 1V3FA 4BUPA 2K9NA 1S7AA 3RIRA 3OS1A 3FBIB 4MQ9F 3PSFA 4J01A 3W2AA 5E3NA 2KZGA 1YJNI 5IY5H 2HGCA 1D1AA 2GIZA 2JRMA 1RI7A 5DCMB 4CO8A 4KYWA 2FJ1A 2NVYJ 4CZCA 1FOKA 4CCMA 1Q1VA 1V54H 2O6GE 2OQGA 2HNHA 1ERDA 3RKXA 2DA2A 4PDKA 3HSFA 4IL6C 1YX5A 1BOBA 2OAZA 3BY6A 1O3TA 4D7MA 1SD7A 3CDIA 4AD9A 1VQ5I 4A3BJ 3KP6A 1MIJA 2O8XA 1FP2A 1XPXA 2R7XA 4CSWA 1X2NA 3GZ5A 1LQ1A 5D8KB 2HYJA 3C2BA 4FTHA 4D5FA 2JTVA 3F23A 3CD6I 3F6OA 3E6DA 4DGWB 4Z2YA 3H5RA 3ZQGA 2LP0A 1W0TA 2K86A 2E71A 3BJ6A 3BQYA 1BR1A 3K4NA 1IW7F 3UR3C 2R5YB 3KETA 1OCTC 1ZLKA 3V42A 1TC3C 2FA5A 3AL0C 2NYXA 1R6RA 2XF5A 3PM1A 1BW6A 3BZKA 2R7RA 1GXPA 1K6OA 4BQOA 1TZLA 3TW7A 4KMFA 1FOWA 4PJNA 3A01A 1W36C 2BHYA 3WGGA 2BYVE 2BHZA 4G7OF 2EQRA 3L2RA 2P8TA 1JHHA 2DI3A 2DBBA 3WE3A 3BQZA 4F52A 3KEOA 2IW5A 1MZBA 3EUKL 1XSVA 4LIVA 4UHTA 2BOLA 3S14J 3QOEA 2XF6A 1XN7A 2FSWA 4E7KA 4IHYA 3RKWA 2JA2A 4Y15A 4M3FA 3HOWJ 2KISA 3H9JA 2EB7A 3CCQI 1HQCA 2QBYA 5D5VB 3HSRA 2P81A 2TCTA 3EUHC 2B63J 4CGZA 4CH7A 2VLAA 4OU0A 3SQNA 1K83J 5JLXA 5F04A 4ZZDA 1EH7A 4ZYEA 4U7DA 1RZ4A 4EJUA 3TEDA 3CMAI 4OIQF 1X1AA 5F0FA 3J7YJ 1ZGWA 3A0HC 3WG7H 1YS6A 2HVSA 1WJAA 2DPUA 5B5EC 4RB2C 1LDDA 2DAOA 3L2VA 1SANA 3MZHA 5HDNA 3BCBA 1G2HA 3HOVJ 3F8FA 5GP9A 2K3FA 4CYDA 3GTJJ 1F36A 3TKYA 4Y3OA 1YG2A 5JVTA 3RPUD 4LLNA 2RQQA 1YS7A 3CO6C 3K4JA 2CUJA 3HGYA 2LREA 3TW6A 3G3ZA 3I4PA 2WB1A 4MFDA 1IXCA 3CUQC 3WG9A 1ZTRA 3MKYB 4MIMA 3H35A 3OYAA 1R4MB 3GBGA 3KLNA 1W7PA 1YRNB 4L18B 2X1CA 2ME0A 4LB5A 3TOBA 4G8XA 3WTYC 1BBYA 1IJWC 3IL2A 3ZCOA 2UXXA 3HOUJ 2M8GX 1ENHA
chains in the Genus database with same CATH topology
1Z1DA 1FWZA 1R5HA 2ZXJA 2HFHA 1FZPB 3QP5A 5DCFA 4CICA 5D4SA 2VXZA 3HOSA 2DQRA 3C3WA 3CLOA 1YLFA 2IRFG 1TQMA 1HKSA 4GCVA 2EJRA 4O3MA 5EEHA 2ZNZA 3T1BA 3WTUC 1Z7UA 2D45A 2Q8KA 2FQ3A 4ZH4F 4A0YA 3B73A 4L9VA 1R1UA 2LSOA 2NRAC 2QM3A 3FZVA 5CVJA 4HX7A 4Y17A 3WODF 5CLSA 4OIOF 2P7CB 2CG4A 1KGSA 2QVOA 2GA1A 4BAYA 3NQOA 4B09A 1SMTA 3CDHA 5E18F 2KIMA 2XAGA 2CO5A 1E2XA 2A3SA 2ZMEA 5LRRA 2PQ8A 4Q4ZF 2UXNA 4UNOA 4YFXF 3TDZC 1W7PD 4BHCA 1HXDA 2ZFWA 1FNNA 3ABTA 3TO9A 4R1HA 2DLLA 4MHGA 4EM2A 2W25A 3FMQA 5BPDA 4R8HA 2RN7A 2ZBKA 5JI6A 4A0XA 2ADUA 1R23A 4L0ZB 2VBZA 3WTZA 1REPC 2ZJ2A 3HRSA 5E17F 1ZGAA 3BDDA 4HZFA 3ZMDA 2XKPA 2IA0A 4EJTA 1XD7A 3EYYA 1IRFA 4Q47A 5KVRA 3MQ0A 4KN4X 3PQKA 1O7FA 2D1HA 1G4DA 4ZYGA 4BYYA 3K1MA 1ODDA 3E5XA 5H6RA 2V1DA 3E5QA 4MEXF 5HS7A 2E1CA 1L0OC 4LK1F 1O7LA 4EMSA 1ZG1A 4ESJA 1ON1A 3T8TA 2M87A 5CVRA 4P5OA 4WK8F 4P9UA 2H27A 3QPHA 5E1ZB 2K4JA 2G7UA 1HKQA 5LEJA 1QNTA 2IA2A 2QBYB 3J7AO 2PI0A 3JTHA 1XDUA 2CYYA 2M1BA 2PBIA 2YSRA 5DUKA 2W57A 2WV0A 3T8RA 4O5VA 4HOBA 5LLQA 1L3LA 5CJ9A 2ESNA 3BPVA 3VEPA 3FX3A 4MEYF 3ECHA 1LNWA 1ZAOA 1STZA 2OD5A 2O61A 1IN5A 4CXFA 5H6QA 1LDJA 2M30A 2FMYA 2MLKA 4QWQA 1BM9A 1LJ9A 2TDXA 2D1VA 3I59A 1W7PB 1IAWA 4HBLA 3U9GA 1T98A 4M6XA 3C1DA 1IN8A 5HS8A 2FU4A 4M6YA 3C18A 3HRUA 1YFHA 3PFIA 3Q5FA 4EJOA 3ELKA 1FY7A 3IWFA 1DPRA 3L00A 1WKMA 2HEOA 4HDUA 1J5YA 3BWGA 3DPTA 1U3EM 2H94A 1G3WA 2D2WA 5ICFA 1IN7A 3DKWA 3DQVC 5KK1A 1OPCA 3E6MA 1QPMA 3W6JB 1F9NA 2A68F 1O3QA 4EJWA 2ESHA 4BHBA 4U0YA 3DV8A 2P5LC 2Z33A 2OBPA 3KP4A 3GWZA 1XSDA 3O6BB 1GHCA 2MA3A 2PMHA 3FXUA 2F5CA 3GFMA 2HOEA 1ZH5A 1Z05A 3WTWC 1X3UA 2YPRA 2ACJA 1XGNA 2Z9OA 4ZZLA 3NRVA 2ZMEB 2OQRA 4PCQA 5LHHA 2OZ6A 4IRHA 1WI9A 3LA7A 5JHUA 3MWMA 5HDGA 4WCGA 2A6HF 3IKVA 4A2UA 3J80K 2EFPA 2L3DA 3I53A 4P96A 2R3SA 3G73A 4LGWA 1ZARA 2Q0OA 2QQAA 4IPAA 4G6DA 1U5TC 1ZYRF 1MJBA 2L4AA 5BOXA 1WSUA 3L2CA 4KDPA 3LSTA 1CGPA 3GUDA 3K9TA 4AWXB 2P7VB 1PUEE 3LWFA 3SHFA 4I02A 4I98B 1KU9A 3GEZA 4PGHA 2K02A 4HF2A 3RI4A 1YIOA 2YX7A 2A61A 4U0WA 1B4AA 3I71A 3WTSC 1JXSA 1FBSA 4LLGF 5BS6A 3K69A 1ZGJA 4A6DA 4HX8A 3M9AA 3P9KA 1FSHA 2DK5A 1A04A 5DEQA 2F5DA 2XIGA 3FMRA 1F5TA 4MNUA 2BBYA 2O03A 1QO0D 4LMYA 5ILUA 3F22A 3ZN1A 1MKMA 1XGSA 2QYOA 3ABUA 4IXAA 5E1WA 1KU3A 3L9FA 1U8RA 2V79A 3ISPA 3ZMZA 2KJCA 4EGYA 3JAMK 3T5XA 5CVUA 5FD5A 5FB2A 2ELHA 2DTRA 3HOTA 1XDSA 3LAPA 2FBIA 4HQMA 1K78B 2HYGD 4BNCA 1JHFA 2BV6A 4MTEA 5EEGA 4HDVA 1IUYA 2XVCA 1J59A 1FLIA 3CO7C 3K1PA 4GXOA 3I59B 1DPUA 4PGGA 3BJAA 2DO7A 3HSEA 2MLGA 2DK8A 2QWWA 2E1NA 2EA2A 5TRDA 3TDUC 4LG0A 1P6RA 1T0FA 1SFEA 2DT5A 1BI1A 3MCZA 3JW4A 4KIBA 1I1GA 5LGTA 3V7RA 3ZPLA 1OYYA 3K1NA 4CDGA 4LB6B 3V8LA 3WE2A 2HS5A 3V8JA 2NNNA 3HRMA 3KFWX 4UUVA 4HQEA 1J0RA 3O3KA 4XLPF 1FYLA 2GXBA 1O3SA 4HAMA 5JFRA 3AAFA 4WWCA 4M9XA 1PP7U 3F21A 2DU9A 1R1TA 2P6SA 2F5FA 2FBKA 1IZ1A 5L3FA 3FM5A 3I5UA 4FT8A 1LEBA 4A5MA 3RYRA 3HUGA 4R79A 2C6YA 1D8JA 4F7ZA 5ICGA 2E7XA 2XV4S 1T38A 2ZO4A 1FBQA 4ENNA 2B0LA 3IC7A 3BZ6A 4HX4A 2GWRA 4RGRA 3HRTA 5HOOA 3F3XA 4L9JA 1YTYA 1I27A 2H6BA 2LNBA 3EETA 2LF7A 2XAHA 3KEQA 3IWZA 2VBWA 4ENKA 2XRNA 4KA4A 4YIFA 2G9WA 3FMSA 3OOPA 1BI3A 2VODA 3RYPA 2LF8A 2V6CA 4JQFA 3OV8A 3M8FA 3EQLF 1TBXA 4LK0F 4TV7A 4KUMA 3D5LA 2O3FA 3GFLA 3P7NA 3JSPA 2XUBA 4S04A 5H20A 4IHTA 4XRFA 1OR7A 2EFNA 3L7WA 4GYGA 2UZKA 3E97A 1RNLA 3WTVC 5FLXZ 3TO7A 1XB4A 5HS9A 5HLIA 2L02A 2VT3A 5CVVA 2WTEA 3SFZA 3I64A 1YW8A 2WC2A 4RGXA 3I58A 5ED4A 1C0WA 5LEKA 3IHUA 5IT3A 2IP2A 3V4GA 4UVBA 3ZMTA 2QUFA 2Z99A 3HYIA 3GZ6A 4I2OA 5ILSA 4K2EA 2J5PA 1RIOH 1XSXA 1WRJA 4HLXA 3N4MA 4FHTA 2XGXA 2VE9A 3ROUA 3H3ZA 2YR2A 1H9GA 1TLHB 3ZMUA 1SFXA 2RGVA 1Z6TA 2ISZA 3F72A 2AXLA 1GXQA 4U88A 2DPDA 2HQRA 3TO6A 4RS8A 2PN6A 2RVCA 3HHGA 2AS5F 1MJAA 1ZREA 2M8EA 3HTUA 4M71A 1J9IA 5F6FA 5HVQC 1KQ0A 5AIPA 3MAJA 5K5OA 3HTSB 1FBUA 2FOKA 2QQ9A 3ECOA 2Z3YA 1IN4A 3R0AA 2V9VA 3R61A 4LG0B 1O3RA 2EK5A 5HLHA 2WWYA 4ESBA 3DEUA 4OOIA 1MGTA 2P5KA 1SD5A 2VBYA 5L3CA 4FX0A 1Z9CA 4HF0A 4WXCA 4N0BA 3EDPA 1U78A 1I1SA 4XSZF 4ESFA 2JSCA 2P4WA 2GIVA 4WXHA 3RKYA 3I0TA 1P92A 4FX4A 4UVCA 4A5NA 5D4RA 1KU2A 4OMYA 2FNAA 4EQQA 1O57A 1K78A 1NHAA 4RGUA 1TNSA 5D6EA 4QLCU 2G7HA 4N9HA 2EFOA 4XSXF 2NNYA 5AONA 1G3YA 1GVJA 2VN2A 3LFKA 5E8IA 1U6GA 1USSA 5HLGA 3LA2A 4Y13A 1J2XA 3E5UA 3F8NA 3FF5A 1AOYA 1ZG3A 2EWNA 2P5VA 2NS0A 2DFIA 3KZYA 2W84A 1EH6A 2IPQX 2Y48A 3SZTA 4NHJA 1P4AA 5LHIA 2GXGA 3KZZA 2CWEA 3KLOA 5IT9Z 5FD6A 5K5RA 1DDNA 1BOAA 4KICA 4AIJA 1OMIA 4PZJA 1HSTA 2DQLA 1FT9A 3N97A 3RDIA 4L5IA 1IF1A 4YFKF 5E8GA 3F8BA 4IHSA 2UWMA 3E3VA 3IKTA 1BIAA 3BPXA 4AIHA 3BOQA 3P9CA 1CF7A 1TQIA 1MDMA 4P55A 3F8CA 1DUXC 3EUHA 3QP6A 3ML6A 3W6KB 3KP3A 3KCCA 4A0ZA 3Q9VA 2YX4A 5LRSA 1QZZA 2RV8A 3GW2A 1E17A 4BH9A 2PG4A 3S2WA 6PAXA 3ULQB 1KYWA 2V1XA 1FYKA 2VOOA 2OU2A 1F4KA 4BQAA 3M8EA 2HTSA 4OIRF 1B6AA 2LKPA 3CUQA 3GLXA 2STTA 3LQRA 2JZYA 3FXRA 2QQBA 1TQPA 2QZ8A 3I54A 4L0YB 4P9FA 2XHKA 2CGPA 1UB9A 2W24A 4OINF 3L09A 4D0PA 1OYIA 2PMUA 3VB2A 1FC3A 2X0LA 3WGIA 1HBXG 5LBQA 1YYVA 3CUOA 2VC1A 3DFGA 2MH2A 5FFZA 1T39A 4HF1A 5K5QA 1J75A 2FE3A 4LJZF 1Z6RA 4B8XA 1R5GA 2O0YA 1PDNC 2E7WA 3K0LA 1KA8A 4M9ZA 4UVAA 3QU3A 3GFIA 2EFWA 1D3YA 1B59A 1VTNC 3KP5A 2M45A 4KNYA 1D5VA 3E6BA 5BQTA 4OIPF 1W5SA 1ZG5A 2VONA 2OZUA 2F2EA 3QRFF 2FNPA 2KIUA 2BEOA 1FP1D 5F1RA 4L5JA 5HDKA 3BJOA 2L4MA 4AVPA 5L3BA 2EFQA 2DW4A 2GA2A 1U2WA 4I0AA 1I6XA 3REOA 4L9NA 2BE5F 3LAJA 4G6QA 2MD5A 2RDPA 2VT2A 4LLLA 4WX9A 3LQQA 2L54A 3HIFA 5L3EA 5E20A 1XCBA 4UV9A 5ICCA 3JSOA 3RPUA 1UCRA 2FXAA 5CYVA 5F64A 2HZTA 3ZMVA 2R7DA 4EV0A 4HLYA 5TJJA 1J7KA 4KT5C 1LEAA 4G7ZF 1XCVA 3D0SA 5LGUA 1T2KA 2RKHA 4XLNF 5BPIA 4L9TA 2IT0A 2IA1A 2BGCA 3VFZA 3T0YA 2A5YB 1IXSB 4RB1A 3J81Z 2JPBA 1BC8C 5FLXK 2GAUA 2MC3A 3M7GA 2MBFA 2RC4A 3DXJF 4BXUA 4I01A 5A2QZ 3ZP5A 3V8KA 1ON2A 3J80Z 1ZLJA 2IJLA 5DD4A 1ZHFA 1R00A 2NAZA 4RAZA 1BJAA 4KFCA 4G94A 5L3DA 5D5XB 1UHWA 4IRGA 3ERED 1S8NA 5ICEA 1FPQA 1SMYF 3F8MA 1QQIA 1Y0UA 4A12A 1DP7P 3FWEA 1KQ9A 4DNCA 1CF7B 1MDMB 1BI2A 4LFUA 3DP7A 4HV5A 4O6JA 4JBAA 5E1XA 2STWA 2A07F 1B1BA 4I0BA 3CJNA 4ENMA 2KJBA 3GO5A 4EM0B 4EGZA 1HW1A 1W4MA 2ZKZA 3KE2A 3TQNA 1T6SA 1IN6A 1F1ZA 3DF8A 3CUQB 3H3UA 2ZNYA 4RB3C 1R22A 3VOEA 5FGMA 1JE8A 3P9IA 4LD5A 1W5TA 2M5WA 2CW0F 2PEXA 3WTTC 4Q5SF 2XASA 5K1YA 5L3GA 3Q9SA 3SXYA 1RUOA 4M74A 3O2PE 1USTA 3FM3A 3IRQA 2RQPA 1H0MA 5LHGA 2OA4A 2K4BA 1AWCA 2VOPA 1S3JA 3U1DA 4OMZA 3JAMZ 4NQWA 1OYWA 5FFXA 1SD4A 4Q48A 2Z5UA 2H6CA 1P4WA 4U0VA 4I09A 2JPCA 2W85A 4IRIA 4ASNA 1FX7A 4A6EA 3R6SA 2HWVA 5DYMA 3C7JA 2H09A 3GVAA 3R60A 3WU1B 1H9TA 2COMA 2XAFA 1Z91A 3QPTA 1XGOA 2ZCWA 1LB2A 5J8FA 5IT9K 1SFUA 2FF4A 1B9MA 1P2FA 4WF2A 4RB0A 1XMAA 3QOPA 3GF2A 3WU0A 5D5UB 1QGPA 2XKOA 3GFJA 3V7SA 2PJPA 3GYHX 4HA8A 1R7JA 4CHUA 1TNTA 2A6EF 1U5TA 5DDGA 2F5EA 1ULYA 2MH9A 4EM1A 2CSOA 5J8CA 2XROA 4IF4A 4MQVA 2HDCA 2EV5A 5LGNA 1MJ9A 1IRGA 4IVNA 2A69F 1ZN2A 2HYFA 4KN7X 3TGNA 3EYIA 4GGGA 1SD6A 4HYEA 2RNJA 3M1EA 1D8KA 4EVIA 4UXNA 3CTAA 4NB5A 1LDKB 3LA3A 3TOAA 3U2RA 3HHHA 3E6CC 3QU6A 1PP8F 1SAXA 2J5OA 2CFXA 2LDUA 1TTYA 2V1UA 4ZYHA 1TW3A 4M72A 4ETSA 5DCMA 1ZRDA 4KMUX 3MEXA 1BC7C 1IXRC 1P4XA 4MTDA 4S05A 2JT1A 4KIGA 2QENA 1BI0A 1TW2A 3MFKA 2VE8A 5JR3A 1YQAA 1BIBA 2EV0A 3K2ZA 1RUNA 1ZRFA 5D8LB 1UFMA 4XBFA 2IVMA 1XMKA 3RPQA 3FXQA 4EJVA 2FMLA 5DD8A 3BP8A 4ZYDA 2GQQA 2XAJA 1QBJA 1B9NA 1S29A 1FSEA 2VBXA 3F6VA 3NEUA 1KQ8A 5D6FA 1QZYA 3PQJA 4HV6A 3RJPA 1Q1HA 4KIFA 4YIIA 4CZZA 1HW5A 1K79A 1YW7A 4YFNF 2CQKA 1KU7A 3KP7A 3QAHA 1OKRA 4G7HF 3GXOA 2KIFA 3VODA 3V7CA 3KP2A 2P6TA 3GX4X 3H92A 4AIKA 4RAYA 3WTXC 2KRFA 2K27A 4WXDA 2XAQA 2YU3A 5ILVA 2GZWA 2FBHA 1FYMA 3SZPA 5AIQA 1G3TA 1KYZA 3IRRA 1HW2A 2FRHA 1UHMA 4JK1X 4G9YA 3ZQ7A 1EV7A 1HSJA 3FHZA 3J81K 3R4KA 5J6XA 1MD0A 4ON0A 1S6LA 2K7LA 5DUIA 4UV8A 1G3SA 2FEZA 4M9SA 3DPLC 2X4HA 5A2QK 5DV5A 1BN5A 5BMZA 2ETHA 1JGSA 4N9IA 3R0JA 2HKOA 2ISYA 2HKXA 4YG2F 2Y75A 4M73A 2HR3A 2QLZA 1R36A 2L01A 2PLYA 1EH8A 4GYIA 1U5TB 4GO1A 1YO5C 1K7AA 2JRTA 2HQNA 1WWXA 4H0EA 4ENJA 2KKOA 3RTRA 3BROA 4E70A 1S7OA 3ZN0A 1G6NA 1XGMA 4MGRA 4U7BA 4I7HA 5D5WB 2Q2EA 2VC0A 3JTGA 1ZRCA 5ERIA 3MZYA 1V4RA 2EA4A 3WGHA 4IJAA 1WQ2A 3ZMSA 1ONVA 2HTJA 5FO5A 1HKTA 4RGSA 2Y0MA 4DQ2A 2EV6A 5CVIA 2R7FA 1YW9A 4BHPA 1I5ZA 3COAC 4HW0A 3B02A 1R1VA 1LVAA 2PFBA 1R58A 1V3FA 1S7AA 3RIRA 4MQ9F 2HGCA 4CO8A 4KYWA 1RI7A 5DCMB 1FOKA 2O6GE 2OQGA 3RKXA 4PDKA 3HSFA 2OAZA 3BY6A 1O3TA 1SD7A 4AD9A 3KP6A 2O8XA 1FP2A 3GZ5A 1LQ1A 5D8KB 2JTVA 3F23A 3F6OA 3E6DA 4Z2YA 2K86A 3BJ6A 1IW7F 3KETA 1ZLKA 2FA5A 2NYXA 1GXPA 1K6OA 4KMFA 3WGGA 2BYVE 4G7OF 2P8TA 1JHHA 2DI3A 2DBBA 3WE3A 3KEOA 2IW5A 1MZBA 1XSVA 4UHTA 1XN7A 2FSWA 3RKWA 4Y15A 2EB7A 1HQCA 2QBYA 5D5VB 3HSRA 4CGZA 4OU0A 3SQNA 4ZZDA 1EH7A 4ZYEA 4U7DA 1RZ4A 4EJUA 4OIQF 1YS6A 2DPUA 4RB2C 1LDDA 2DAOA 3MZHA 5HDNA 3F8FA 4CYDA 3TKYA 1YG2A 5JVTA 4LLNA 1YS7A 3CO6C 3G3ZA 3I4PA 1IXCA 3CUQC 3WG9A 3KLNA 1W7PA 4L18B 4LB5A 3TOBA 4G8XA 3WTYC 1BBYA 3IL2A 2UXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1D A;  1FWZ A;  1R5H A;  2ZXJ A;  2HFH A;  1FZP B;  3QP5 A;  5DCF A;  4CIC A;  5D4S A;  2VXZ A;  3HOS A;  2DQR A;  3C3W A;  3CLO A;  1YLF A;  2IRF G;  1TQM A;  1HKS A;  4GCV A;  2EJR A;  4O3M A;  5EEH A;  2ZNZ A;  3T1B A;  3WTU C;  1Z7U A;  2D45 A;  2Q8K A;  2FQ3 A;  4ZH4 F;  4A0Y A;  3B73 A;  4L9V A;  1R1U A;  2LSO A;  2NRA C;  2QM3 A;  3FZV A;  5CVJ A;  4HX7 A;  4Y17 A;  3WOD F;  5CLS A;  4OIO F;  2P7C B;  2CG4 A;  1KGS A;  2QVO A;  2GA1 A;  4BAY A;  3NQO A;  4B09 A;  1SMT A;  3CDH A;  5E18 F;  2KIM A;  2XAG A;  2CO5 A;  1E2X A;  2A3S A;  2ZME A;  5LRR A;  2PQ8 A;  4Q4Z F;  2UXN A;  4UNO A;  4YFX F;  3TDZ C;  1W7P D;  4BHC A;  1HXD A;  2ZFW A;  1FNN A;  3ABT A;  3TO9 A;  4R1H A;  2DLL A;  4MHG A;  4EM2 A;  2W25 A;  3FMQ A;  5BPD A;  4R8H A;  2RN7 A;  2ZBK A;  5JI6 A;  4A0X A;  2ADU A;  1R23 A;  4L0Z B;  2VBZ A;  3WTZ A;  1REP C;  2ZJ2 A;  3HRS A;  5E17 F;  1ZGA A;  3BDD A;  4HZF A;  3ZMD A;  2XKP A;  2IA0 A;  4EJT A;  1XD7 A;  3EYY A;  1IRF A;  4Q47 A;  5KVR A;  3MQ0 A;  4KN4 X;  3PQK A;  1O7F A;  2D1H A;  1G4D A;  4ZYG A;  4BYY A;  3K1M A;  1ODD A;  3E5X A;  5H6R A;  2V1D A;  3E5Q A;  4MEX F;  5HS7 A;  2E1C A;  1L0O C;  4LK1 F;  1O7L A;  4EMS A;  1ZG1 A;  4ESJ A;  1ON1 A;  3T8T A;  2M87 A;  5CVR A;  4P5O A;  4WK8 F;  4P9U A;  2H27 A;  3QPH A;  5E1Z B;  2K4J A;  2G7U A;  1HKQ A;  5LEJ A;  1QNT A;  2IA2 A;  2QBY B;  3J7A O;  2PI0 A;  3JTH A;  1XDU A;  2CYY A;  2M1B A;  2PBI A;  2YSR A;  5DUK A;  2W57 A;  2WV0 A;  3T8R A;  4O5V A;  4HOB A;  5LLQ A;  1L3L A;  5CJ9 A;  2ESN A;  3BPV A;  3VEP A;  3FX3 A;  4MEY F;  3ECH A;  1LNW A;  1ZAO A;  1STZ A;  2OD5 A;  2O61 A;  1IN5 A;  4CXF A;  5H6Q A;  1LDJ A;  2M30 A;  2FMY A;  2MLK A;  4QWQ A;  1BM9 A;  1LJ9 A;  2TDX A;  2D1V A;  3I59 A;  1W7P B;  1IAW A;  4HBL A;  3U9G A;  1T98 A;  4M6X A;  3C1D A;  1IN8 A;  5HS8 A;  2FU4 A;  4M6Y A;  3C18 A;  3HRU A;  1YFH A;  3PFI A;  3Q5F A;  4EJO A;  3ELK A;  1FY7 A;  3IWF A;  1DPR A;  3L00 A;  1WKM A;  2HEO A;  4HDU A;  1J5Y A;  3BWG A;  3DPT A;  1U3E M;  2H94 A;  1G3W A;  2D2W A;  5ICF A;  1IN7 A;  3DKW A;  3DQV C;  5KK1 A;  1OPC A;  3E6M A;  1QPM A;  3W6J B;  1F9N A;  2A68 F;  1O3Q A;  4EJW A;  2ESH A;  4BHB A;  4U0Y A;  3DV8 A;  2P5L C;  2Z33 A;  2OBP A;  3KP4 A;  3GWZ A;  1XSD A;  3O6B B;  1GHC A;  2MA3 A;  2PMH A;  3FXU A;  2F5C A;  3GFM A;  2HOE A;  1ZH5 A;  1Z05 A;  3WTW C;  1X3U A;  2YPR A;  2ACJ A;  1XGN A;  2Z9O A;  4ZZL A;  3NRV A;  2ZME B;  2OQR A;  4PCQ A;  5LHH A;  2OZ6 A;  4IRH A;  1WI9 A;  3LA7 A;  5JHU A;  3MWM A;  5HDG A;  4WCG A;  2A6H F;  3IKV A;  4A2U A;  3J80 K;  2EFP A;  2L3D A;  3I53 A;  4P96 A;  2R3S A;  3G73 A;  4LGW A;  1ZAR A;  2Q0O A;  2QQA A;  4IPA A;  4G6D A;  1U5T C;  1ZYR F;  1MJB A;  2L4A A;  5BOX A;  1WSU A;  3L2C A;  4KDP A;  3LST A;  1CGP A;  3GUD A;  3K9T A;  4AWX B;  2P7V B;  1PUE E;  3LWF A;  3SHF A;  4I02 A;  4I98 B;  1KU9 A;  3GEZ A;  4PGH A;  2K02 A;  4HF2 A;  3RI4 A;  1YIO A;  2YX7 A;  2A61 A;  4U0W A;  1B4A A;  3I71 A;  3WTS C;  1JXS A;  1FBS A;  4LLG F;  5BS6 A;  3K69 A;  1ZGJ A;  4A6D A;  4HX8 A;  3M9A A;  3P9K A;  1FSH A;  2DK5 A;  1A04 A;  5DEQ A;  2F5D A;  2XIG A;  3FMR A;  1F5T A;  4MNU A;  2BBY A;  2O03 A;  1QO0 D;  4LMY A;  5ILU A;  3F22 A;  3ZN1 A;  1MKM A;  1XGS A;  2QYO A;  3ABU A;  4IXA A;  5E1W A;  1KU3 A;  3L9F A;  1U8R A;  2V79 A;  3ISP A;  3ZMZ A;  2KJC A;  4EGY A;  3JAM K;  3T5X A;  5CVU A;  5FD5 A;  5FB2 A;  2ELH A;  2DTR A;  3HOT A;  1XDS A;  3LAP A;  2FBI A;  4HQM A;  1K78 B;  2HYG D;  4BNC A;  1JHF A;  2BV6 A;  4MTE A;  5EEG A;  4HDV A;  1IUY A;  2XVC A;  1J59 A;  1FLI A;  3CO7 C;  3K1P A;  4GXO A;  3I59 B;  1DPU A;  4PGG A;  3BJA A;  2DO7 A;  3HSE A;  2MLG A;  2DK8 A;  2QWW A;  2E1N A;  2EA2 A;  5TRD A;  3TDU C;  4LG0 A;  1P6R A;  1T0F A;  1SFE A;  2DT5 A;  1BI1 A;  3MCZ A;  3JW4 A;  4KIB A;  1I1G A;  5LGT A;  3V7R A;  3ZPL A;  1OYY A;  3K1N A;  4CDG A;  4LB6 B;  3V8L A;  3WE2 A;  2HS5 A;  3V8J A;  2NNN A;  3HRM A;  3KFW X;  4UUV A;  4HQE A;  1J0R A;  3O3K A;  4XLP F;  1FYL A;  2GXB A;  1O3S A;  4HAM A;  5JFR A;  3AAF A;  4WWC A;  4M9X A;  1PP7 U;  3F21 A;  2DU9 A;  1R1T A;  2P6S A;  2F5F A;  2FBK A;  1IZ1 A;  5L3F A;  3FM5 A;  3I5U A;  4FT8 A;  1LEB A;  4A5M A;  3RYR A;  3HUG A;  4R79 A;  2C6Y A;  1D8J A;  4F7Z A;  5ICG A;  2E7X A;  2XV4 S;  1T38 A;  2ZO4 A;  1FBQ A;  4ENN A;  2B0L A;  3IC7 A;  3BZ6 A;  4HX4 A;  2GWR A;  4RGR A;  3HRT A;  5HOO A;  3F3X A;  4L9J A;  1YTY A;  1I27 A;  2H6B A;  2LNB A;  3EET A;  2LF7 A;  2XAH A;  3KEQ A;  3IWZ A;  2VBW A;  4ENK A;  2XRN A;  4KA4 A;  4YIF A;  2G9W A;  3FMS A;  3OOP A;  1BI3 A;  2VOD A;  3RYP A;  2LF8 A;  2V6C A;  4JQF A;  3OV8 A;  3M8F A;  3EQL F;  1TBX A;  4LK0 F;  4TV7 A;  4KUM A;  3D5L A;  2O3F A;  3GFL A;  3P7N A;  3JSP A;  2XUB A;  4S04 A;  5H20 A;  4IHT A;  4XRF A;  1OR7 A;  2EFN A;  3L7W A;  4GYG A;  2UZK A;  3E97 A;  1RNL A;  3WTV C;  5FLX Z;  3TO7 A;  1XB4 A;  5HS9 A;  5HLI A;  2L02 A;  2VT3 A;  5CVV A;  2WTE A;  3SFZ A;  3I64 A;  1YW8 A;  2WC2 A;  4RGX A;  3I58 A;  5ED4 A;  1C0W A;  5LEK A;  3IHU A;  5IT3 A;  2IP2 A;  3V4G A;  4UVB A;  3ZMT A;  2QUF A;  2Z99 A;  3HYI A;  3GZ6 A;  4I2O A;  5ILS A;  4K2E A;  2J5P A;  1RIO H;  1XSX A;  1WRJ A;  4HLX A;  3N4M A;  4FHT A;  2XGX A;  2VE9 A;  3ROU A;  3H3Z A;  2YR2 A;  1H9G A;  1TLH B;  3ZMU A;  1SFX A;  2RGV A;  1Z6T A;  2ISZ A;  3F72 A;  2AXL A;  1GXQ A;  4U88 A;  2DPD A;  2HQR A;  3TO6 A;  4RS8 A;  2PN6 A;  2RVC A;  3HHG A;  2AS5 F;  1MJA A;  1ZRE A;  2M8E A;  3HTU A;  4M71 A;  1J9I A;  5F6F A;  5HVQ C;  1KQ0 A;  5AIP A;  3MAJ A;  5K5O A;  3HTS B;  1FBU A;  2FOK A;  2QQ9 A;  3ECO A;  2Z3Y A;  1IN4 A;  3R0A A;  2V9V A;  3R61 A;  4LG0 B;  1O3R A;  2EK5 A;  5HLH A;  2WWY A;  4ESB A;  3DEU A;  4OOI A;  1MGT A;  2P5K A;  1SD5 A;  2VBY A;  5L3C A;  4FX0 A;  1Z9C A;  4HF0 A;  4WXC A;  4N0B A;  3EDP A;  1U78 A;  1I1S A;  4XSZ F;  4ESF A;  2JSC A;  2P4W A;  2GIV A;  4WXH A;  3RKY A;  3I0T A;  1P92 A;  4FX4 A;  4UVC A;  4A5N A;  5D4R A;  1KU2 A;  4OMY A;  2FNA A;  4EQQ A;  1O57 A;  1K78 A;  1NHA A;  4RGU A;  1TNS A;  5D6E A;  4QLC U;  2G7H A;  4N9H A;  2EFO A;  4XSX F;  2NNY A;  5AON A;  1G3Y A;  1GVJ A;  2VN2 A;  3LFK A;  5E8I A;  1U6G A;  1USS A;  5HLG A;  3LA2 A;  4Y13 A;  1J2X A;  3E5U A;  3F8N A;  3FF5 A;  1AOY A;  1ZG3 A;  2EWN A;  2P5V A;  2NS0 A;  2DFI A;  3KZY A;  2W84 A;  1EH6 A;  2IPQ X;  2Y48 A;  3SZT A;  4NHJ A;  1P4A A;  5LHI A;  2GXG A;  3KZZ A;  2CWE A;  3KLO A;  5IT9 Z;  5FD6 A;  5K5R A;  1DDN A;  1BOA A;  4KIC A;  4AIJ A;  1OMI A;  4PZJ A;  1HST A;  2DQL A;  1FT9 A;  3N97 A;  3RDI A;  4L5I A;  1IF1 A;  4YFK F;  5E8G A;  3F8B A;  4IHS A;  2UWM A;  3E3V A;  3IKT A;  1BIA A;  3BPX A;  4AIH A;  3BOQ A;  3P9C A;  1CF7 A;  1TQI A;  1MDM A;  4P55 A;  3F8C A;  1DUX C;  3EUH A;  3QP6 A;  3ML6 A;  3W6K B;  3KP3 A;  3KCC A;  4A0Z A;  3Q9V A;  2YX4 A;  5LRS A;  1QZZ A;  2RV8 A;  3GW2 A;  1E17 A;  4BH9 A;  2PG4 A;  3S2W A;  6PAX A;  3ULQ B;  1KYW A;  2V1X A;  1FYK A;  2VOO A;  2OU2 A;  1F4K A;  4BQA A;  3M8E A;  2HTS A;  4OIR F;  1B6A A;  2LKP A;  3CUQ A;  3GLX A;  2STT A;  3LQR A;  2JZY A;  3FXR A;  2QQB A;  1TQP A;  2QZ8 A;  3I54 A;  4L0Y B;  4P9F A;  2XHK A;  2CGP A;  1UB9 A;  2W24 A;  4OIN F;  3L09 A;  4D0P A;  1OYI A;  2PMU A;  3VB2 A;  1FC3 A;  2X0L A;  3WGI A;  1HBX G;  5LBQ A;  1YYV A;  3CUO A;  2VC1 A;  3DFG A;  2MH2 A;  5FFZ A;  1T39 A;  4HF1 A;  5K5Q A;  1J75 A;  2FE3 A;  4LJZ F;  1Z6R A;  4B8X A;  1R5G A;  2O0Y A;  1PDN C;  2E7W A;  3K0L A;  1KA8 A;  4M9Z A;  4UVA A;  3QU3 A;  3GFI A;  2EFW A;  1D3Y A;  1B59 A;  1VTN C;  3KP5 A;  2M45 A;  4KNY A;  1D5V A;  3E6B A;  5BQT A;  4OIP F;  1W5S A;  1ZG5 A;  2VON A;  2OZU A;  2F2E A;  3QRF F;  2FNP A;  2KIU A;  2BEO A;  1FP1 D;  5F1R A;  4L5J A;  5HDK A;  3BJO A;  2L4M A;  4AVP A;  5L3B A;  2EFQ A;  2DW4 A;  2GA2 A;  1U2W A;  4I0A A;  1I6X A;  3REO A;  4L9N A;  2BE5 F;  3LAJ A;  4G6Q A;  2MD5 A;  2RDP A;  2VT2 A;  4LLL A;  4WX9 A;  3LQQ A;  2L54 A;  3HIF A;  5L3E A;  5E20 A;  1XCB A;  4UV9 A;  5ICC A;  3JSO A;  3RPU A;  1UCR A;  2FXA A;  5CYV A;  5F64 A;  2HZT A;  3ZMV A;  2R7D A;  4EV0 A;  4HLY A;  5TJJ A;  1J7K A;  4KT5 C;  1LEA A;  4G7Z F;  1XCV A;  3D0S A;  5LGU A;  1T2K A;  2RKH A;  4XLN F;  5BPI A;  4L9T A;  2IT0 A;  2IA1 A;  2BGC A;  3VFZ A;  3T0Y A;  2A5Y B;  1IXS B;  4RB1 A;  3J81 Z;  2JPB A;  1BC8 C;  5FLX K;  2GAU A;  2MC3 A;  3M7G A;  2MBF A;  2RC4 A;  3DXJ F;  4BXU A;  4I01 A;  5A2Q Z;  3ZP5 A;  3V8K A;  1ON2 A;  3J80 Z;  1ZLJ A;  2IJL A;  5DD4 A;  1ZHF A;  1R00 A;  2NAZ A;  4RAZ A;  1BJA A;  4KFC A;  4G94 A;  5L3D A;  5D5X B;  1UHW A;  4IRG A;  3ERE D;  1S8N A;  5ICE A;  1FPQ A;  1SMY F;  3F8M A;  1QQI A;  1Y0U A;  4A12 A;  1DP7 P;  3FWE A;  1KQ9 A;  4DNC A;  1CF7 B;  1MDM B;  1BI2 A;  4LFU A;  3DP7 A;  4HV5 A;  4O6J A;  4JBA A;  5E1X A;  2STW A;  2A07 F;  1B1B A;  4I0B A;  3CJN A;  4ENM A;  2KJB A;  3GO5 A;  4EM0 B;  4EGZ A;  1HW1 A;  1W4M A;  2ZKZ A;  3KE2 A;  3TQN A;  1T6S A;  1IN6 A;  1F1Z A;  3DF8 A;  3CUQ B;  3H3U A;  2ZNY A;  4RB3 C;  1R22 A;  3VOE A;  5FGM A;  1JE8 A;  3P9I A;  4LD5 A;  1W5T A;  2M5W A;  2CW0 F;  2PEX A;  3WTT C;  4Q5S F;  2XAS A;  5K1Y A;  5L3G A;  3Q9S A;  3SXY A;  1RUO A;  4M74 A;  3O2P E;  1UST A;  3FM3 A;  3IRQ A;  2RQP A;  1H0M A;  5LHG A;  2OA4 A;  2K4B A;  1AWC A;  2VOP A;  1S3J A;  3U1D A;  4OMZ A;  3JAM Z;  4NQW A;  1OYW A;  5FFX A;  1SD4 A;  4Q48 A;  2Z5U A;  2H6C A;  1P4W A;  4U0V A;  4I09 A;  2JPC A;  2W85 A;  4IRI A;  4ASN A;  1FX7 A;  4A6E A;  3R6S A;  2HWV A;  5DYM A;  3C7J A;  2H09 A;  3GVA A;  3R60 A;  3WU1 B;  1H9T A;  2COM A;  2XAF A;  1Z91 A;  3QPT A;  1XGO A;  2ZCW A;  1LB2 A;  5J8F A;  5IT9 K;  1SFU A;  2FF4 A;  1B9M A;  1P2F A;  4WF2 A;  4RB0 A;  1XMA A;  3QOP A;  3GF2 A;  3WU0 A;  5D5U B;  1QGP A;  2XKO A;  3GFJ A;  3V7S A;  2PJP A;  3GYH X;  4HA8 A;  1R7J A;  4CHU A;  1TNT A;  2A6E F;  1U5T A;  5DDG A;  2F5E A;  1ULY A;  2MH9 A;  4EM1 A;  2CSO A;  5J8C A;  2XRO A;  4IF4 A;  4MQV A;  2HDC A;  2EV5 A;  5LGN A;  1MJ9 A;  1IRG A;  4IVN A;  2A69 F;  1ZN2 A;  2HYF A;  4KN7 X;  3TGN A;  3EYI A;  4GGG A;  1SD6 A;  4HYE A;  2RNJ A;  3M1E A;  1D8K A;  4EVI A;  4UXN A;  3CTA A;  4NB5 A;  1LDK B;  3LA3 A;  3TOA A;  3U2R A;  3HHH A;  3E6C C;  3QU6 A;  1PP8 F;  1SAX A;  2J5O A;  2CFX A;  2LDU A;  1TTY A;  2V1U A;  4ZYH A;  1TW3 A;  4M72 A;  4ETS A;  5DCM A;  1ZRD A;  4KMU X;  3MEX A;  1BC7 C;  1IXR C;  1P4X A;  4MTD A;  4S05 A;  2JT1 A;  4KIG A;  2QEN A;  1BI0 A;  1TW2 A;  3MFK A;  2VE8 A;  5JR3 A;  1YQA A;  1BIB A;  2EV0 A;  3K2Z A;  1RUN A;  1ZRF A;  5D8L B;  1UFM A;  4XBF A;  2IVM A;  1XMK A;  3RPQ A;  3FXQ A;  4EJV A;  2FML A;  5DD8 A;  3BP8 A;  4ZYD A;  2GQQ A;  2XAJ A;  1QBJ A;  1B9N A;  1S29 A;  1FSE A;  2VBX A;  3F6V A;  3NEU A;  1KQ8 A;  5D6F A;  1QZY A;  3PQJ A;  4HV6 A;  3RJP A;  1Q1H A;  4KIF A;  4YII A;  4CZZ A;  1HW5 A;  1K79 A;  1YW7 A;  4YFN F;  2CQK A;  1KU7 A;  3KP7 A;  3QAH A;  1OKR A;  4G7H F;  3GXO A;  2KIF A;  3VOD A;  3V7C A;  3KP2 A;  2P6T A;  3GX4 X;  3H92 A;  4AIK A;  4RAY A;  3WTX C;  2KRF A;  2K27 A;  4WXD A;  2XAQ A;  2YU3 A;  5ILV A;  2GZW A;  2FBH A;  1FYM A;  3SZP A;  5AIQ A;  1G3T A;  1KYZ A;  3IRR A;  1HW2 A;  2FRH A;  1UHM A;  4JK1 X;  4G9Y A;  3ZQ7 A;  1EV7 A;  1HSJ A;  3FHZ A;  3J81 K;  3R4K A;  5J6X A;  1MD0 A;  4ON0 A;  1S6L A;  2K7L A;  5DUI A;  4UV8 A;  1G3S A;  2FEZ A;  4M9S A;  3DPL C;  2X4H A;  5A2Q K;  5DV5 A;  1BN5 A;  5BMZ A;  2ETH A;  1JGS A;  4N9I A;  3R0J A;  2HKO A;  2ISY A;  2HKX A;  4YG2 F;  2Y75 A;  4M73 A;  2HR3 A;  2QLZ A;  1R36 A;  2L01 A;  2PLY A;  1EH8 A;  4GYI A;  1U5T B;  4GO1 A;  1YO5 C;  1K7A A;  2JRT A;  2HQN A;  1WWX A;  4H0E A;  4ENJ A;  2KKO A;  3RTR A;  3BRO A;  4E70 A;  1S7O A;  3ZN0 A;  1G6N A;  1XGM A;  4MGR A;  4U7B A;  4I7H A;  5D5W B;  2Q2E A;  2VC0 A;  3JTG A;  1ZRC A;  5ERI A;  3MZY A;  1V4R A;  2EA4 A;  3WGH A;  4IJA A;  1WQ2 A;  3ZMS A;  1ONV A;  2HTJ A;  5FO5 A;  1HKT A;  4RGS A;  2Y0M A;  4DQ2 A;  2EV6 A;  5CVI A;  2R7F A;  1YW9 A;  4BHP A;  1I5Z A;  3COA C;  4HW0 A;  3B02 A;  1R1V A;  1LVA A;  2PFB A;  1R58 A;  1V3F A;  1S7A A;  3RIR A;  4MQ9 F;  2HGC A;  4CO8 A;  4KYW A;  1RI7 A;  5DCM B;  1FOK A;  2O6G E;  2OQG A;  3RKX A;  4PDK A;  3HSF A;  2OAZ A;  3BY6 A;  1O3T A;  1SD7 A;  4AD9 A;  3KP6 A;  2O8X A;  1FP2 A;  3GZ5 A;  1LQ1 A;  5D8K B;  2JTV A;  3F23 A;  3F6O A;  3E6D A;  4Z2Y A;  2K86 A;  3BJ6 A;  1IW7 F;  3KET A;  1ZLK A;  2FA5 A;  2NYX A;  1GXP A;  1K6O A;  4KMF A;  3WGG A;  2BYV E;  4G7O F;  2P8T A;  1JHH A;  2DI3 A;  2DBB A;  3WE3 A;  3KEO A;  2IW5 A;  1MZB A;  1XSV A;  4UHT A;  1XN7 A;  2FSW A;  3RKW A;  4Y15 A;  2EB7 A;  1HQC A;  2QBY A;  5D5V B;  3HSR A;  4CGZ A;  4OU0 A;  3SQN A;  4ZZD A;  1EH7 A;  4ZYE A;  4U7D A;  1RZ4 A;  4EJU A;  4OIQ F;  1YS6 A;  2DPU A;  4RB2 C;  1LDD A;  2DAO A;  3MZH A;  5HDN A;  3F8F A;  4CYD A;  3TKY A;  1YG2 A;  5JVT A;  4LLN A;  1YS7 A;  3CO6 C;  3G3Z A;  3I4P A;  1IXC A;  3CUQ C;  3WG9 A;  3KLN A;  1W7P A;  4L18 B;  4LB5 A;  3TOB A;  4G8X A;  3WTY C;  1BBY A;  3IL2 A;  2UXX A; 
#chains in the Genus database with same CATH topology
 2X6O A;  3GTO J;  2X85 A;  3ABK H;  4PFP A;  1Z1D A;  1H88 C;  1QHG A;  1ZR4 A;  3K4M A;  4AUX A;  1FWZ A;  3HPG A;  3ZQQ A;  1SAU A;  1R5H A;  4PJM A;  2ZXJ A;  2HFH A;  1FZP B;  3QP5 A;  5DCF A;  4CIC A;  3QYF A;  2VXZ A;  5D4S A;  4XN0 A;  2DQR A;  3HOS A;  1VQO I;  3C3W A;  1AA7 A;  3CLO A;  1YLF A;  1JTX A;  1A6Q A;  3I3L A;  2IRF G;  1TQM A;  4E4H A;  5FKN A;  4S0H B;  1WJC A;  5BNG A;  2HPI A;  3CCM I;  5EDN A;  1HKS A;  2E5N A;  4GCV A;  2EJR A;  4O3M A;  1OCZ H;  5EEH A;  1VQ9 I;  2HQ5 A;  2ZNZ A;  3T1B A;  3WTU C;  3BTL A;  1Z7U A;  2D45 A;  2IS4 A;  1YJW I;  2Q8K A;  2DA7 A;  2FQ3 A;  3JCU C;  3JRG A;  4ZH4 F;  3ESW B;  1W1W E;  4NBQ A;  4GDF A;  2M7A A;  4HNU A;  4A0Y A;  3NWT A;  3B73 A;  4L9V A;  2E2H J;  1KZH A;  3VSL A;  1R1U A;  4UUS A;  2LSO A;  2NRA C;  2QM3 A;  3FZV A;  5CVJ A;  1GDT A;  4HX7 A;  4Y17 A;  3WOD F;  1B72 A;  5CLS A;  4OIO F;  2P7C B;  1IV8 A;  2CG4 A;  2JVG A;  4C9Y A;  1VF9 A;  5M5Y J;  4IQ4 A;  1KGS A;  2QVO A;  1MBF A;  2GA1 A;  2DOD A;  2WAF A;  4BAY A;  4HST A;  2QKM B;  3NQO A;  4XM3 A;  4B09 A;  1SMT A;  3CDH A;  5E18 F;  2E35 A;  2KIM A;  3PUB A;  4XN3 A;  2MW8 A;  2XAG A;  2CO5 A;  1E2X A;  2XB0 X;  2A3S A;  1RKW A;  2Z2S B;  5DM7 F;  2ZME A;  5LRR A;  2Q2E B;  2PQ8 A;  2L7F P;  1LFB A;  1YOV B;  4Q4Z F;  3I9V 2;  1Y56 A;  2JMW A;  1WGX A;  2UXN A;  4YFX F;  4UNO A;  1MW7 A;  3TDZ C;  4BAC A;  2KMU A;  1Z77 A;  1W7P D;  4BHC A;  1HXD A;  2Y0S A;  1VQ8 I;  1WJB A;  3BZC A;  2ZFW A;  2DOE A;  1FNN A;  2KT0 A;  3ABT A;  3TO9 A;  2LFB A;  4IX7 A;  4R1H A;  2DLL A;  2R7Q A;  4MHG A;  4EM2 A;  3FK6 A;  1QA6 A;  2W25 A;  4C30 A;  3FMQ A;  5BPD A;  4R8H A;  2R92 J;  1IUF A;  1RR7 A;  4CCK A;  2RN7 A;  2ZBK A;  1RC9 A;  5JI6 A;  4A0X A;  2ADU A;  3OR2 C;  3DTE A;  1R23 A;  4YEL A;  4L0Z B;  2VBZ A;  2L9V A;  2QKL B;  3WTZ A;  4DBR A;  1REP C;  3PNY A;  2ZJ2 A;  3HRS A;  3SYT A;  5E17 F;  2OUM A;  1ZGA A;  3BDD A;  4HZF A;  3ZMD A;  1WH5 A;  2XKP A;  2IA0 A;  2I5U A;  2XSJ C;  4EJT A;  1GUU A;  1XD7 A;  4F55 A;  3EYY A;  2R7W A;  1IRF A;  2OV7 A;  4Q47 A;  5KVR A;  3MQ0 A;  3A1Y A;  4KN4 X;  1BJZ A;  5C3E J;  3PQK A;  4AU7 A;  3PNT A;  1Y39 A;  1O7F A;  2D1H A;  3VYS B;  3LSG A;  1G4D A;  1OCC H;  4DJA A;  1OCO H;  4ZYG A;  4BYY A;  3K1M A;  4E7H A;  3SFI A;  2KPM A;  3X2Q H;  1WJ5 A;  3FXL A;  2L0K A;  4HRI A;  4BKX A;  1ODD A;  4E7Z A;  1MBG A;  3E5X A;  5H6R A;  2V1D A;  4L5E A;  3E5Q A;  1X3W B;  4MEX F;  4XIC A;  5HS7 A;  4HSR A;  4XOR A;  2E1C A;  1L0O C;  4LK1 F;  1O7L A;  4EMS A;  1ZG1 A;  1QHH D;  4QSH A;  4ESJ A;  1QZE A;  1MBK A;  1ON1 A;  4BJ6 C;  3IUO A;  3A01 B;  1IDZ A;  4DOZ A;  2NS8 A;  3T8T A;  3HOY J;  2KHM A;  2M87 A;  2KRH A;  5CVR A;  1JUP A;  4P5O A;  4WK8 F;  1YJ9 I;  3QYB A;  1E3H A;  1IO2 A;  3DBR B;  4P9U A;  2H27 A;  2O5R A;  4OWR B;  5EGO A;  3QPH A;  5E1Z B;  1S9H A;  3PNV A;  1ETX A;  2OCE A;  1BA5 A;  1FEX A;  2K4J A;  4E7I A;  2G7U A;  1HKQ A;  5LEJ A;  5FRO A;  2D5V A;  1QNT A;  2IA2 A;  2QBY B;  2DDA A;  3J7A O;  2PI0 A;  4RLQ A;  3JTH A;  2QA4 I;  1XDU A;  2CYY A;  2M1B A;  2PBI A;  4ZC3 A;  2YSR A;  5DUK A;  2W57 A;  2CRG A;  2WV0 A;  3CMY A;  3T8R A;  4B44 A;  3U1K A;  4O5V A;  1Z67 A;  4HOB A;  3BG6 A;  5LLQ A;  1L3L A;  1QPI A;  1FTZ A;  2X51 A;  5CJ9 A;  2ESN A;  3BPV A;  3VEP A;  1R71 A;  2FUG 2;  4XOT A;  3FX3 A;  4MEY F;  4JX5 A;  3ECH A;  2HU9 A;  3CJR B;  1LNW A;  4N4O B;  2VPL A;  1ZAO A;  2DFF A;  1STZ A;  2OD5 A;  2O61 A;  1IN5 A;  4BDY A;  4CXF A;  5H6Q A;  5FLM J;  1LDJ A;  2M30 A;  2LY2 A;  3PIP F;  2FMY A;  3BR6 A;  2MLK A;  4QWQ A;  5HLT A;  1BM9 A;  1LJ9 A;  4CCN A;  2TDX A;  3C2G A;  2D1V A;  3I59 A;  1W7P B;  1IAW A;  3IH2 A;  3H1C A;  1DU6 A;  4HBL A;  3U9G A;  1T98 A;  4M6X A;  2OPT A;  3C1D A;  1IN8 A;  5HS8 A;  2IEK A;  3SEQ A;  2L2O A;  2CQX A;  2FU4 A;  2Q1Z B;  4M6Y A;  3C18 A;  3HRU A;  1YFH A;  3FXK A;  4BXF A;  3PFI A;  3Q5F A;  2AXT C;  1I6H J;  4EJO A;  3OYE A;  3RKQ A;  1X2M A;  1FY7 A;  3ELK A;  3GTL J;  1TL8 A;  2JJ7 A;  3IWF A;  4IO9 F;  4BE0 A;  4I6Z A;  1DPR A;  4ZDO A;  2HOA A;  3L00 A;  1WKM A;  2HEO A;  3FBN B;  4HDU A;  1J5Y A;  3BWG A;  3CCR I;  3O8G A;  3DPT A;  1U3E M;  2O9L A;  5E3O A;  2H94 A;  1G3W A;  4IQJ A;  3UNG C;  2D2W A;  1S5L C;  2WY8 Q;  5LFA A;  5FLV A;  1U9O A;  5ICF A;  1IN7 A;  1ORK A;  2EZH A;  3DKW A;  3DQV C;  5KK1 A;  2CJJ A;  1OPC A;  3E6M A;  1QPM A;  2ID6 A;  3B6C A;  1F9N A;  3W6J B;  4BL0 B;  1UHS A;  2A68 F;  1MSE C;  3RZD J;  1O3Q A;  4EJW A;  2ESH A;  4BHB A;  2G0E A;  4U0Y A;  3DV8 A;  2P5L C;  4BQQ A;  2KDO A;  2ZSI B;  1VQ4 I;  2W4S A;  4XQF A;  2Z33 A;  2CW8 A;  2OBP A;  2XGD A;  4HNT A;  3KP4 A;  2BVL A;  4BY7 J;  3GWZ A;  4UUS B;  1MH4 A;  1XSD A;  1X1P A;  3QOD A;  3HC7 A;  1B72 B;  3O6B B;  1D0X A;  1GHC A;  2MA3 A;  2PMH A;  3FXU A;  3M4O J;  1TWG J;  1IRZ A;  2F5C A;  1ZR2 A;  3GFM A;  2HOE A;  1ZH5 A;  1Z05 A;  3WTW C;  1X3U A;  2YPR A;  1NG6 A;  2ACJ A;  1U8B A;  1GVD A;  1XGN A;  2Z9O A;  3H5N A;  2V6E A;  4ZZL A;  3OIQ A;  1MNE A;  3NRV A;  2ZME B;  4JOM A;  1IC8 A;  2BY2 A;  2OQR A;  4YIR X;  4OAZ A;  3IV5 A;  4PCQ A;  5LHH A;  2OZ6 A;  2LRD A;  2IGK A;  4BDZ A;  4IRH A;  4A3M J;  3Q3S A;  1WI9 A;  3NAU A;  3LA7 A;  3CZ6 A;  5JHU A;  3MWM A;  5HDG A;  4XKC A;  4WCG A;  2A6H F;  3IKV A;  3ZOB A;  1QVU A;  4A2U A;  3J80 K;  1LFU P;  1OFC X;  2EFP A;  4ZDP A;  2L3D A;  9ANT A;  1OCP A;  3I53 A;  4P96 A;  2R3S A;  3G73 A;  5DM6 F;  4LGW A;  1ZAR A;  2ID3 A;  3AG4 H;  2Q0O A;  4RM3 A;  2QQA A;  4IPA A;  2QEX I;  4D1Q A;  4G6D A;  2E1O A;  1U5T C;  3IH3 A;  1ZYR F;  3AG1 H;  4KJZ A;  1DGR M;  1MJB A;  2L4A A;  5BOX A;  1WSU A;  4W1U A;  1X4O A;  4J19 A;  4A3K J;  1BR4 A;  5E3M A;  3L2C A;  4KDP A;  3LST A;  1X1B A;  1CGP A;  3CCV I;  3GUD A;  3LSJ A;  3K9T A;  4AWX B;  2P7V B;  1PUE E;  2X1E A;  4RA2 A;  3LWF A;  2VJJ A;  3SHF A;  2JUC A;  2MAB A;  4I02 A;  2QGU A;  3FIS A;  4I98 B;  1KU9 A;  3GTK J;  2M4K A;  3GEZ A;  4PGH A;  1YIT I;  2EIK H;  2K02 A;  1H89 C;  1FTT A;  4QPQ A;  1N77 A;  4HF2 A;  3RI4 A;  1UEL B;  1YIO A;  1MSF C;  2YX7 A;  4XNF A;  2A61 A;  4U0W A;  3ASO H;  1B4A A;  5J1Y A;  2EBI A;  2NOJ B;  3I71 A;  5F08 A;  3WTS C;  3A2K A;  1JXS A;  3H5A A;  1FBS A;  4KIT B;  2LKX A;  4LLG F;  1X19 A;  2FD5 A;  3ZQH A;  5BS6 A;  1VQP I;  2VJI A;  2HZD A;  3LSH A;  4CCJ A;  2V4J C;  4PUS A;  2JA6 J;  1ZKG A;  4LG3 A;  3K69 A;  1ZGJ A;  2VQG A;  5B1B H;  3JR9 A;  4A6D A;  3H3V K;  3AG3 H;  4H4K C;  4HX8 A;  3PIO F;  1ETQ A;  1MH3 A;  3M9A A;  3P9K A;  1FSH A;  2DK5 A;  1A04 A;  2K9Q A;  4HNV A;  2LC2 A;  2N8G A;  4FQG A;  2CS3 A;  4C3I J;  5DEQ A;  3CCL I;  2F5D A;  2XIG A;  3FMR A;  2AQE A;  3JRC A;  4RM2 A;  5EGO B;  1F5T A;  2CU7 A;  1V55 H;  4MNU A;  2JA8 J;  2BBY A;  1EA3 A;  2QQ8 A;  2Z16 A;  4A3J J;  2O03 A;  2OJE D;  1JGG A;  1QO0 D;  4LMY A;  5DS9 A;  3IP4 B;  5ILU A;  1I39 A;  3BR1 A;  3ZN1 A;  1MKM A;  3F22 A;  3CQZ J;  4FET A;  3B6A A;  2NOG A;  1XGS A;  2QYO A;  3ABU A;  4IXA A;  5E1W A;  1KU3 A;  2GXA A;  3L9F A;  1U8R A;  1SVM A;  1WVR A;  2V79 A;  3ISP A;  3ZMZ A;  3G6E I;  4IOC F;  3GTG J;  3S1M J;  3S15 J;  3OYK A;  2HOS A;  2KJC A;  4XLC A;  5GAG J;  4ZJZ A;  4EGY A;  3Q0U A;  3JAM K;  3T5X A;  5J47 A;  3OYL A;  5CVU A;  5IPA A;  5IP7 J;  1LE8 A;  5FD5 A;  1BW5 A;  1HOM A;  5FB2 A;  3KYL A;  2ELH A;  2DOF A;  2DTR A;  5C4J J;  3HOT A;  1XDS A;  2WB1 N;  3D5S C;  3LAP A;  2FBI A;  4HQM A;  1K78 B;  2JVH A;  5F0C A;  2HYG D;  4BNC A;  1JHF A;  2BV6 A;  4MTE A;  3ZQI A;  5EEG A;  4B47 A;  4HDV A;  1IUY A;  2DJI A;  3RCO A;  2VUM J;  2XVC A;  1J59 A;  1FLI A;  3P5J A;  3CO7 C;  3K1P A;  4II2 A;  4GXO A;  3HEF A;  3I59 B;  3G71 I;  1HC8 A;  1DPU A;  1VZ0 A;  4PGG A;  3BJA A;  2DO7 A;  3HSE A;  2MLG A;  4XMY A;  5CQE A;  3SDG A;  2DK8 A;  2QWW A;  3HKZ A;  3U21 A;  4DIQ A;  1P9Q C;  1IG7 A;  2E1N A;  2EA2 A;  1D5Y A;  5TRD A;  3OYI A;  5J40 A;  3M1C A;  2CQ7 A;  2CH0 A;  2OCC H;  4B3A A;  1S7E A;  3TDU C;  4LG0 A;  1A6I A;  1P6R A;  1T0F A;  3OL4 A;  1UJ8 A;  1SFE A;  2DT5 A;  1BI1 A;  3MCZ A;  1D0Y A;  1TWF J;  4MFE A;  2HDD A;  4A3E J;  3ERM A;  3JW4 A;  4KIB A;  1I1G A;  3H36 A;  5LGT A;  3PO3 J;  3V7R A;  3ZPL A;  1X3Z B;  5IOZ A;  1OYY A;  2KZV A;  3K1N A;  3RSN A;  4CDG A;  4LB6 B;  2ELK A;  2NVT J;  1ETY A;  3V8L A;  3WE2 A;  4DZP A;  2WA0 A;  3KPH A;  2HS5 A;  3V8J A;  3LSP A;  2NNN A;  3HRM A;  3KFW X;  3DKY A;  4UUV A;  3AL0 B;  2HPM A;  4HQE A;  1JUS A;  1J0R A;  3O3K A;  4XLP F;  1RRJ A;  1PYV A;  1FYL A;  2GXB A;  5FKM A;  4M3E A;  1O3S A;  4HAM A;  5JFR A;  3AAF A;  1T56 A;  4WWC A;  2E2J J;  1PJR A;  1PVE A;  4M9X A;  4MO7 A;  1PP7 U;  1FOX A;  1U0J A;  4IKF A;  4KT6 A;  2XB5 A;  3OMY A;  3PL8 A;  4RAF A;  3F21 A;  4A3I J;  2DU9 A;  3VWB A;  3QWL A;  3EPZ A;  1WJD A;  1K4S A;  1R1T A;  3KIO A;  1HDD C;  2P6S A;  1OIS A;  2F5F A;  2FBK A;  1IZ1 A;  5L3F A;  3FM5 A;  3I5U A;  4RMN A;  3W2W A;  2IBD A;  1S72 I;  2M0C A;  1X58 A;  2EZK A;  1MBJ A;  4ZTF A;  4FT8 A;  1LEB A;  4A5M A;  3RYR A;  3HUG A;  4R79 A;  3K70 D;  1EKE A;  2Y0S N;  1SEU A;  4C3J J;  2C6Y A;  1JKO C;  1D8J A;  4F7Z A;  1P7I A;  3H0G J;  2CV2 A;  2R0Q C;  4PJJ A;  5ICG A;  2E7X A;  2XV4 S;  4BGD A;  1T38 A;  2CV1 A;  2VJ4 A;  5GPC A;  2ZO4 A;  1I50 J;  3K4L A;  1FBQ A;  1FJL A;  2MC4 A;  3ZQF A;  3MKW B;  4ENN A;  4AID A;  2AHQ A;  2B0L A;  3IC7 A;  2OC6 A;  4CCL A;  3BZ6 A;  4HX4 A;  4QIW N;  2GWR A;  4RGR A;  3FXJ A;  3HRT A;  5HOO A;  3F3X A;  4L9J A;  1YTY A;  1ETK A;  2JUG A;  1I27 A;  3CC4 I;  2H6B A;  4E7L A;  2LNB A;  3EET A;  3D1N I;  2LF7 A;  1X1D A;  2NXN B;  2XRL A;  2XAH A;  3SJM A;  3KEQ A;  3IWZ A;  1XC5 A;  2VBW A;  3LSK A;  4ENK A;  5CPR B;  2HVR A;  5IP6 A;  2XRN A;  2JWT A;  2EPF A;  3JRH A;  2E1M C;  2MG4 A;  1HF0 A;  3OWT A;  4KA4 A;  4IEJ A;  4YIF A;  1IV6 A;  4IZZ A;  2G9W A;  1FIP A;  3FMS A;  1MBH A;  3OOP A;  1BI3 A;  3OYF A;  2VOD A;  2R93 J;  3RYP A;  3K4B A;  4NUB A;  2LF8 A;  3A4C A;  2V6C A;  4JQF A;  3SEZ A;  3OV8 A;  2YUS A;  5EZG A;  3HGG A;  1WH7 A;  5EF6 A;  3M8F A;  3EQL F;  1TBX A;  1UG2 A;  4LK0 F;  4TV7 A;  4KUM A;  3A03 A;  3L2U A;  3D5L A;  3GLL A;  2R7V A;  2O3F A;  2BY1 A;  5GTH C;  2ZJQ F;  3BR0 A;  3GFL A;  3P7N A;  2A6T A;  5E79 C;  3CCU I;  3JSP A;  2XUB A;  4S04 A;  5H20 A;  3LSI A;  4XRF A;  5JVG F;  4IHT A;  4FCY A;  1R9T J;  1OR7 A;  1BR2 A;  2LYC A;  2EFN A;  1TT0 A;  3L7W A;  4GYG A;  2UZK A;  3E97 A;  2VXD A;  1RNL A;  2Y69 H;  3WTV C;  5FLX Z;  3TBI A;  3TO7 A;  3K10 A;  1JUM A;  1AHD P;  4DYR A;  2ZXH A;  3DTK A;  1XB4 A;  5GPA A;  4NC6 A;  5HS9 A;  2L02 A;  2F4M B;  2VT3 A;  5CVV A;  2WTE A;  5HLI A;  3SFZ A;  3MKL A;  3I64 A;  1YW8 A;  2WC2 A;  4RGX A;  4LOC A;  2V1N A;  3I58 A;  5ED4 A;  1C0W A;  5LEK A;  3IHU A;  2AQF A;  2CQQ A;  1Y1W J;  4U87 A;  2W48 A;  1JJ8 C;  1H8A C;  5IT3 A;  2L9S A;  2IP2 A;  5EYR A;  3V4G A;  3OYC A;  4UVB A;  1TWH J;  3ZMT A;  2QUF A;  2Z99 A;  3HYI A;  3GZ6 A;  4I2O A;  3TMO A;  1UMQ A;  1X4P A;  3K70 C;  5ILS A;  3H0D A;  4DZJ A;  4MLO A;  2V26 A;  2CQN A;  2HI3 A;  2AO9 A;  1LE8 B;  3J7Z I;  3DEW A;  4K2E A;  2J5P A;  4XRM A;  4DBQ A;  1RIO H;  1XSX A;  2FOW A;  5HNH A;  1WRJ A;  4HLX A;  4JX4 A;  2DFE A;  3N4M A;  1NTC A;  2V9K A;  4FHT A;  2XGX A;  2VE9 A;  3ROU A;  2DA6 A;  3H3Z A;  2BZT A;  2YR2 A;  1H9G A;  2DA1 A;  2LLK A;  1TLH B;  3ZMU A;  1GV5 A;  1SFX A;  2RGV A;  1Z6T A;  3AG2 H;  2ISZ A;  3F72 A;  2AXL A;  1GXQ A;  4U88 A;  2DPD A;  1PUF B;  2HQR A;  3TO6 A;  2VQH A;  1I3Q J;  5GAD J;  3MZ8 A;  4RS8 A;  2PN6 A;  2RVC A;  3HHG A;  2AS5 F;  1MJA A;  2EIJ H;  1ZRE A;  3FK7 A;  2M8E A;  3HTU A;  4M71 A;  2ZXW H;  1J9I A;  2MSY A;  4XL9 A;  5F6F A;  3DU5 A;  5HVQ C;  1KQ0 A;  5AIP A;  4BQN A;  3MAJ A;  3JRD A;  4IOA F;  5K5O A;  3HTS B;  1FBU A;  2FOK A;  4XKB A;  1Y0N A;  2QQ9 A;  4Y7N J;  3BT9 A;  1ETO A;  2WBM A;  2EIM H;  3ECO A;  2Z3Y A;  1IN4 A;  3R0A A;  2V9V A;  3R61 A;  4LG0 B;  1O3R A;  3TP3 A;  2EK5 A;  2DFH A;  5IYB J;  5HLH A;  2WWY A;  4ESB A;  3DEU A;  4OOI A;  1MGT A;  2P5K A;  3ABL H;  1SD5 A;  2VBY A;  3W2V A;  5L3C A;  4FX0 A;  1Z9C A;  2K9L A;  4HF0 A;  3FKJ A;  4WXC A;  4N0B A;  3C2H A;  2HXI A;  3EDP A;  1WCM J;  3E0J B;  4RAG A;  1U78 A;  1I1S A;  3KYD B;  3S16 J;  1A35 A;  3OS2 A;  3S1Q J;  4XSZ F;  4ESF A;  3CME I;  3GTQ J;  2JSC A;  2P4W A;  2GIV A;  4WXH A;  3RKY A;  3H9G A;  1JJ6 C;  3I0T A;  1P92 A;  4FX4 A;  1VQM I;  4UVC A;  4NC8 A;  4KIS A;  4LIT A;  4D5C A;  3EUA A;  4HG2 A;  4A5N A;  2R4G A;  5D4R A;  1KU2 A;  4OMY A;  2FNA A;  4EQQ A;  1O57 A;  1K78 A;  1NHA A;  1VND A;  1TNS A;  2DA5 A;  4RGU A;  5D6E A;  4QLC U;  2G7H A;  4A69 C;  2W82 A;  2LH9 A;  4N9H A;  4IHW A;  2EFO A;  1Y8Q B;  4XSX F;  2NNY A;  5AON A;  1G3Y A;  4IHV A;  4A3C J;  1GVJ A;  1JT6 A;  1VQL I;  2VN2 A;  3LFK A;  5E8I A;  1U6G A;  1USS A;  5HLG A;  3LA2 A;  4PSX A;  4Y13 A;  3KYC B;  1J2X A;  3HUG B;  3ONQ A;  3S32 A;  3E5U A;  2Y9Z A;  3F8N A;  3FF5 A;  3LFU A;  2E19 A;  1AOY A;  1TWA J;  1ZG3 A;  1T95 A;  2EWN A;  2P5V A;  4HEA 2;  3RQ4 A;  2NS0 A;  2DFI A;  3KZY A;  2W84 A;  1EH6 A;  1IRX A;  4XID A;  2IPQ X;  4BEH A;  5HNF A;  2Y48 A;  3SZT A;  1GV2 A;  4NHJ A;  1P4A A;  5LHI A;  5J4Y A;  2GXG A;  3KZZ A;  3ZXS A;  1G59 A;  2CWE A;  3DTI A;  3OR1 C;  2LG4 A;  2ICW G;  3KLO A;  1T33 A;  1YIJ I;  5IT9 Z;  3S2H J;  5FD6 A;  5KHD A;  4E7S A;  2QSG X;  5K5R A;  2R5Z A;  1DDN A;  4YRV A;  1BOA A;  4KIC A;  3ZQC A;  4AIJ A;  4ABZ A;  2O8K A;  2LVS A;  1OMI A;  3BTC A;  4PZJ A;  5K7F A;  1HST A;  1R5I D;  2LKS A;  5J1U A;  2ZXI A;  3H9Q A;  4JYK A;  2DQL A;  2JA5 J;  1FT9 A;  4II3 A;  2K9S A;  4M3B A;  3WHB A;  3N97 A;  2IAI A;  3RDI A;  4PSW A;  3CMM A;  4XOP A;  4XKW A;  2NVU B;  3LSR A;  4L5I A;  1IF1 A;  4YFK F;  2WV1 A;  4FE7 A;  5E8G A;  3F8B A;  2FX0 A;  2PJR A;  4IHS A;  2UWM A;  3E3V A;  3IKT A;  2ZME C;  2LY1 A;  1BIA A;  3BPX A;  4AIH A;  1DP3 A;  2XAU A;  3BOQ A;  3P9C A;  4AVZ A;  1CF7 A;  1TQI A;  4W97 A;  1MDM A;  4P55 A;  2JK3 A;  2LK2 A;  3OSG A;  3KZI C;  3F8C A;  2Y9Y A;  2R7S A;  1DUX C;  1LKX A;  3EUH A;  3TP0 A;  3QP6 A;  4BU2 A;  3ML6 A;  4X1E A;  4RBO A;  3W6K B;  3KP3 A;  3VYR B;  2F6C A;  3CC7 I;  3KCC A;  2HDW A;  3QQA A;  4A0Z A;  1XS9 A;  3Q9V A;  2YX4 A;  5LRS A;  1QZZ A;  1K61 A;  2RV8 A;  3GW2 A;  4NC7 A;  2VL8 A;  2EIN H;  2VAS A;  1E17 A;  2CFO A;  4Z6Y A;  4BH9 A;  2PG4 A;  4I99 C;  3S2W A;  2VKV A;  3DLA A;  3AKZ A;  6PAX A;  3ULQ B;  1KYW A;  2EIL H;  2V1X A;  1FYK A;  2VOO A;  2IGM A;  3SZG A;  2OU2 A;  4XON A;  3OSF A;  1F4K A;  3JRB A;  4RDU A;  4BQA A;  3M8E A;  2CMP A;  2HTS A;  1E0E A;  4OIR F;  1B6A A;  2DT7 B;  2V7F A;  2LKP A;  2X9D A;  3L2W A;  3CUQ A;  1GLN A;  3GLX A;  2CW7 A;  3LQR A;  2STT A;  1F43 A;  1E3O C;  3HPH A;  2JZY A;  2VI6 A;  4CA0 A;  2X6X A;  3OYG A;  3FXR A;  2IGN A;  3D5R C;  4XK4 A;  2QQB A;  1TQP A;  2QZ8 A;  3HL2 A;  5FRM A;  3I54 A;  4L0Y B;  4P9F A;  2VB6 A;  2GOX B;  2ZFU A;  4UB6 C;  2XHK A;  2CGP A;  1VQ6 I;  3VSK A;  3S8P A;  3MKZ A;  1JKQ C;  1D0Z A;  1UB9 A;  2W24 A;  3Q0V A;  2OF7 A;  4OIN F;  2PX9 A;  3L09 A;  4HPQ A;  4D0P A;  2LBF A;  1OYI A;  2PMU A;  1APL C;  1E3P A;  1V5G A;  4XRS G;  3VB2 A;  1FC3 A;  2X0L A;  4YEJ A;  1SVO A;  2JSP A;  4P1W A;  3WGI A;  1W36 D;  1HBX G;  2XPU A;  3G1L A;  3BG9 A;  5LBQ A;  2HVQ A;  2ZC2 A;  1YYV A;  3CUO A;  3HM5 A;  1P7J A;  2WAQ A;  1V5E A;  2VC1 A;  4PFO A;  4X6A J;  3DFG A;  2MH2 A;  1EJ9 A;  3DCF A;  5FFZ A;  2PMZ A;  1T39 A;  4CCO A;  4HF1 A;  3HG9 A;  4BJT A;  5K5Q A;  1J75 A;  2FE3 A;  4LJZ F;  1G8X A;  4D9J A;  1Z6R A;  4B8X A;  1R5G A;  2O0Y A;  2LY9 A;  1PDN C;  1M1E B;  3HKZ N;  2E7W A;  4A3F J;  3CP2 A;  3K0L A;  4ITV A;  1SC7 A;  1KA8 A;  4M9Z A;  4UVA A;  5TIS C;  1IGN A;  3QU3 A;  1D1B A;  3GFI A;  2EFW A;  1D3Y A;  1B59 A;  3OYB A;  1VTN C;  5C44 J;  3KP5 A;  5J1R A;  1XTA A;  2M45 A;  5EZH A;  2A5W A;  4KNY A;  1D5V A;  3E6B A;  5BQT A;  4OIP F;  4FAS D;  1W5S A;  1ZG5 A;  2VON A;  1DQU A;  2F2E A;  2OZU A;  4CUG A;  3QRF F;  5KCM A;  2FNP A;  2KIU A;  1NK3 P;  2VKD A;  2BEO A;  1BL0 A;  1KON A;  2DDB A;  5JHF A;  3S3O A;  1FP1 D;  5F1R A;  2IXS A;  3HBL A;  4L5J A;  5HDK A;  3BJO A;  1JT0 A;  3G1O A;  3CES A;  3KX2 A;  2L4M A;  4AVP A;  5L3B A;  3J7A Y;  4UB8 C;  3MD2 A;  4EAT A;  1XX5 A;  4C2T A;  3OYJ A;  2EFQ A;  2DW4 A;  2GA2 A;  3I56 I;  1U2W A;  4I0A A;  3PFY A;  4X0G A;  3CLQ A;  3G4S I;  1I3A A;  1I6X A;  2KP6 A;  1TWC J;  3REO A;  2O7O A;  4A3G J;  4L9N A;  5IYD J;  2BE5 F;  2HQA A;  3LAJ A;  4G6Q A;  2MD5 A;  2RDP A;  4XLH A;  2F4O B;  2VT2 A;  4BBS J;  1JTY A;  1JI8 A;  5KNL A;  4LLL A;  4WX9 A;  2BY3 A;  3LQQ A;  3IH4 A;  4AYB A;  1N78 A;  2L54 A;  3HIF A;  5L3E A;  5E20 A;  2KQR A;  1XCB A;  4UV9 A;  5ICC A;  3JSO A;  3RPU A;  1ETW A;  5M3M J;  1UCR A;  2FXA A;  1VQN I;  2DMQ A;  5CYV A;  5F64 A;  1B8I A;  3ZQL A;  1OQY A;  2HZT A;  3ZMV A;  2R7D A;  4EV0 A;  4HLY A;  1PUF A;  5TJJ A;  4PJL A;  1J7K A;  2ME6 A;  3HB9 A;  4KT5 C;  3GCM A;  1LEA A;  5FRN A;  2K40 A;  4G7Z F;  3DEE A;  1XCV A;  3D0S A;  5LGU A;  3VYT B;  3FKI J;  3FHN A;  1K4T A;  1T2K A;  2RKH A;  4XLN F;  5BPI A;  4L9T A;  5B3S H;  2IT0 A;  2IA1 A;  2BGC A;  2Z1D A;  3VFZ A;  4B1R A;  3FXO A;  3T0Y A;  2A5Y B;  3S93 A;  1IXS B;  4RB1 A;  3J81 Z;  2F4I A;  2JPB A;  2MD0 A;  4RLF A;  1BC8 C;  4XLE A;  4BBR J;  5FLX K;  2RAE A;  2GAU A;  4Y52 J;  3TL4 X;  2MC3 A;  4BEH B;  3S3M A;  3M7G A;  2MBF A;  2L5Q A;  4FIS A;  2RC4 A;  2NS7 A;  3DXJ F;  2XSD C;  4UUT A;  4BXU A;  2KIQ A;  2M0M A;  2XPV A;  4I01 A;  3W3C A;  5A2Q Z;  2R5Z B;  3ZP5 A;  3V8K A;  1ON2 A;  2R7T A;  2HXO A;  3ZRG A;  3OL3 A;  1ZLJ A;  3J80 Z;  2IJL A;  5DD4 A;  1ZHF A;  2IS1 A;  1R00 A;  3BG7 A;  2NAZ A;  4RAZ A;  1K6Y A;  1BJA A;  3CCE I;  4KFC A;  4G94 A;  5L3D A;  5D5X B;  3M8J A;  3K7A J;  1UHW A;  4IRG A;  1VQ7 I;  3OYD A;  1Z0X A;  1N75 A;  3ERE D;  1S8N A;  2Y31 A;  2JA7 J;  2PJR B;  5ICE A;  5FJ8 J;  1FPQ A;  5B1A H;  1SMY F;  2B7E A;  3F8M A;  2KDZ A;  1QQI A;  1Y0U A;  2K5C A;  4A12 A;  3IAS 2;  2ZSH B;  2E2I J;  1DP7 P;  1WZ2 A;  2Y2Z A;  3FWE A;  1KQ9 A;  3ASN H;  4DNC A;  3LMM A;  4ZDL A;  1CF7 B;  1MDM B;  1BI2 A;  2OTJ I;  1XMX A;  4LFU A;  2XDV A;  3DP7 A;  5IOY A;  5H2F C;  5CKT A;  1ETV A;  2XC7 A;  2DMT A;  4HV5 A;  3CP8 A;  3MN2 A;  4O6J A;  2L7Z A;  4JBA A;  5E1X A;  2STW A;  2A07 F;  1B1B A;  1QRY A;  4I76 A;  2M2E A;  4JX6 A;  3A0B C;  4I0B A;  3CJN A;  1LUJ B;  5J3L A;  2E60 A;  2KLO A;  3N05 A;  4E7J A;  3RZO J;  5F27 A;  4A3L J;  3FXM A;  4ENM A;  3CCY A;  2KJB A;  3GO5 A;  4EM0 B;  5DTD A;  4EGZ A;  1HW1 A;  2F5V A;  1RES A;  1W4M A;  2ZKZ A;  3KE2 A;  3TQN A;  1T6S A;  3PO2 J;  1IN6 A;  3BCA A;  1F1Z A;  3K6G A;  3MMY B;  4F93 B;  2DJN A;  3DF8 A;  3CUQ B;  3H3U A;  2ZNY A;  3K4C A;  4RB3 C;  1NK2 P;  4DYQ A;  2UV1 A;  1R22 A;  3VOE A;  2JN6 A;  5FGM A;  1JE8 A;  3S1R J;  3P9I A;  3CDL A;  4LD5 A;  4E6K G;  1RR8 C;  2R7Z J;  5GAH J;  4JP0 A;  2WAD A;  5F1J A;  3JRI A;  1W5T A;  2F48 A;  3UKG A;  3GTM J;  2M5W A;  2CW0 F;  2LTP A;  2PEX A;  3WTT C;  1W5C C;  3LNQ A;  2XAS A;  5K1Y A;  4Q5S F;  2DYR H;  5L3G A;  3Q9S A;  3SXY A;  1RUO A;  4M74 A;  2E5Z A;  4C3H J;  3O2P E;  1LVK A;  1GT0 C;  2XGE A;  4BXX J;  1ZQ3 P;  1UST A;  3FM3 A;  4LIU A;  4CYC A;  3IRQ A;  3LSM A;  3K2A A;  2RQP A;  2LBF B;  1H0M A;  2ECC A;  5LHG A;  1WJE A;  2OA4 A;  4DYC A;  1UG0 A;  2K4B A;  3CC2 I;  1AWC A;  2M7B A;  2Y30 A;  2X6Y A;  2VOP A;  1S3J A;  3U1D A;  4V2F A;  1Y8R B;  3L1P A;  4OMZ A;  3JAM Z;  5LD2 C;  4NQW A;  1OYW A;  5FFX A;  2K85 A;  1AKH A;  1SD4 A;  4Q48 A;  2Z5U A;  5M5X J;  2DTZ A;  1FMW A;  2H6C A;  5FKK A;  1Z7L A;  2DOA A;  1P4W A;  4M6V A;  2EZI A;  2GBY A;  3PJR A;  4G6T B;  2KL4 A;  4U0V A;  4I09 A;  2KRC A;  1JKP C;  2E1M B;  2JPC A;  3AFH A;  2W85 A;  4IRI A;  3QYE A;  4ASN A;  1FX7 A;  4BE1 A;  4A6E A;  3R6S A;  2HWV A;  5DYM A;  3FDY A;  3C7J A;  2H09 A;  3GVA A;  1Y6I A;  3R60 A;  3WU1 B;  1H9T A;  2COM A;  3HZJ A;  2P0W A;  1POG A;  2XAF A;  3HDD A;  1Z91 A;  3QPT A;  1XGO A;  2ZCW A;  5EG0 A;  1LB2 A;  5J8F A;  4UY8 I;  5IT9 K;  1SFU A;  2E36 A;  2X6W A;  3QPL A;  4QPO A;  1T8I A;  2FF4 A;  1A31 A;  1WFX A;  3M07 A;  4GFB A;  2RNG A;  1B9M A;  1P2F A;  4WF2 A;  2DA3 A;  4RB0 A;  1XMA A;  1Z3X A;  3QOP A;  3GF2 A;  5GTI C;  1WPK A;  1JKR C;  2K3P A;  1HCR A;  3WU0 A;  1YE9 A;  5D5U B;  1QGP A;  4NDL A;  2XKO A;  3GFJ A;  1NG7 A;  3V7S A;  3CJQ B;  3OYH A;  2I8D A;  2PJP A;  5EEA A;  4BE2 A;  3GYH X;  3DKX A;  1YI2 I;  4HA8 A;  1R7J A;  1FOY A;  2TRT A;  3GZN B;  4CHU A;  2UUZ A;  1TNT A;  5F0H A;  2W1O A;  1NH3 A;  1UAA A;  1QU3 A;  1MMS A;  2A6E F;  2RRE A;  2BW3 A;  3CF2 A;  1U5T A;  4ZTJ A;  2VIX A;  2DMU A;  2F5E A;  5DDG A;  1Z3Y A;  1ULY A;  1FMV A;  2MH9 A;  4EM1 A;  2CSO A;  1UZC A;  5J8C A;  2XRO A;  1B8I B;  4IF4 A;  4MQV A;  1VI0 A;  3LOC A;  3OIP A;  4M3D A;  4B43 A;  2HDC A;  2EV5 A;  5IP9 J;  5LGN A;  3OYN A;  3S2D J;  4PK4 A;  3W6V A;  1T0F C;  1MJ9 A;  1IRG A;  3BG3 A;  4IVN A;  1R4N B;  2EH3 A;  3F0C A;  4FE4 A;  2QSH X;  2A69 F;  1ZN2 A;  3I55 I;  4Y33 A;  2MGQ A;  2H8R A;  2HYF A;  4BS9 A;  4KN7 X;  4ANJ A;  1MNM C;  1LFP A;  3BG5 A;  4XRS A;  3TGN A;  3EYI A;  4GGG A;  1SD6 A;  4HYE A;  1HDP A;  2RNJ A;  2MYS A;  5J4V A;  3M1E A;  2ZJP F;  1D8K A;  2ELJ A;  4EVI A;  1A36 A;  3BTJ A;  2M34 A;  3HJE A;  4UXN A;  2XPW A;  3CTA A;  3CF5 F;  2I10 A;  4NB5 A;  1X1C A;  4C2M J;  3RQI A;  5M5W J;  1DGW Y;  1MMD A;  3IAM 2;  1U9N A;  1LDK B;  3LA3 A;  3TOA A;  3U2R A;  3HHH A;  2DXI A;  3HOX J;  3S17 J;  3MVP A;  1A5J A;  2QCO A;  3E7L A;  3E6C C;  1WHU A;  3QU6 A;  1PP8 F;  1SAX A;  4IHX A;  1RPW A;  2J5O A;  2CFX A;  4XR6 A;  2LDU A;  3VYU B;  1DU0 A;  1TTY A;  3Q0W A;  1OCR H;  3BR2 A;  2V1U A;  2DT6 A;  1TW3 A;  4ZYH A;  4M72 A;  4ETS A;  5DCM A;  1ZRD A;  1SVL A;  2DYS H;  1Z21 A;  2M3A A;  1ZEL A;  2YS9 A;  4AC0 A;  4KMU X;  3MEX A;  2B9S A;  3DBH B;  1J09 A;  1IXR C;  1QVT A;  3QPS A;  3VDX A;  1BC7 C;  2E34 A;  1P4X A;  3DPU A;  4DW6 A;  1R49 A;  4N4N B;  2MFZ A;  1RET A;  4MTD A;  4S05 A;  2JT1 A;  5CQG A;  4KIG A;  2QEN A;  1CQT A;  1BI0 A;  1TW2 A;  5E3L A;  2VE8 A;  3MFK A;  5KAI C;  2L9N A;  4Y4R A;  5JR3 A;  1YQA A;  2XGC A;  1LPQ A;  2GOM A;  1AU7 A;  1BIB A;  2VKH A;  1RKT A;  2DMN A;  2EV0 A;  3K2Z A;  4OAY A;  3O8H A;  1RUN A;  1ZRF A;  5D8L B;  1UFM A;  4XBF A;  2LR8 A;  1YHQ I;  2JQ7 A;  2R5Y A;  2IS2 A;  2ZB9 A;  2IVM A;  1XMK A;  3RPQ A;  2L7K A;  4PJ0 C;  3FXQ A;  4XLA A;  4EJV A;  2FML A;  1ITY A;  5DD8 A;  3BP8 A;  1MMG A;  5GAE J;  2GQQ A;  2XAJ A;  5KAF C;  4ZYD A;  1SFK A;  1QBJ A;  1B9N A;  4B48 A;  1S29 A;  3BC8 A;  2R7O A;  1FSE A;  2X1D A;  4G12 A;  4F91 B;  2VBX A;  2W00 A;  3PSI A;  3F6V A;  3NEU A;  1MMA A;  5D6F A;  5HOD A;  1KQ8 A;  4B4C A;  1QZY A;  4ZYA A;  3PQJ A;  1D1C A;  4HV6 A;  3VPR A;  3RJP A;  1Q1H A;  4KIF A;  5C4X J;  3DWL E;  4YII A;  4CZZ A;  1HW5 A;  3OYM A;  1K79 A;  1OJL A;  2X48 A;  1YW7 A;  4YFN F;  2CQK A;  1KU7 A;  2WY7 Q;  2R7U A;  3L2Q A;  3JRE A;  3OIO A;  1VFC A;  3KP7 A;  3QAH A;  1OKR A;  2VQC A;  2ZJR F;  4G7H F;  3GXO A;  1MND A;  1V5F A;  3PUF A;  2KIF A;  3S1N J;  1N25 A;  4C2U A;  2WAQ N;  4CYC B;  3VOD A;  3V7C A;  2DCE A;  3NWS A;  1XG1 A;  3KP2 A;  3LL7 A;  2P6T A;  3GX4 X;  2PMZ N;  3H92 A;  4XLF A;  3I4M J;  2CUF A;  4M3G A;  4AIK A;  4RAY A;  3WTX C;  2KRF A;  2ECB A;  2K27 A;  2M4G A;  3OOU A;  1OR7 C;  4WXD A;  1EF4 A;  4NNJ A;  2XAQ A;  2YU3 A;  1MBE A;  3WU2 C;  3JRF A;  5ILV A;  3CJT B;  2GZW A;  4NQW B;  2FBH A;  1FYM A;  3BR3 A;  1AKH B;  3ZR8 X;  4BY1 J;  1HA8 A;  3NAR A;  2DN0 A;  4B3X A;  3SZP A;  5AIQ A;  1G3T A;  1KYZ A;  1ACI A;  1ZK8 A;  3IRR A;  1O4X A;  2COB A;  1HW2 A;  1WI3 A;  2EZL A;  5JLW A;  3CCJ I;  3M3Y J;  2FRH A;  1UHM A;  3G1M A;  2GM4 A;  4JK1 X;  1YRN A;  4G9Y A;  2YU9 J;  3ZQ7 A;  5B66 C;  2XF7 A;  2IGO A;  3OY9 A;  2DA4 A;  3A02 A;  1EV7 A;  1HSJ A;  3S3N A;  3FHZ A;  3J81 K;  4QTR A;  2BY0 A;  3ABM H;  3BLY A;  2QSF X;  3R4K A;  2W7N A;  3DBL B;  1HLV A;  2L7M P;  1MD0 A;  1TT5 B;  3K4K A;  4ON0 A;  1T08 B;  1S6L A;  2K7L A;  4XKV A;  5J6X A;  5DUI A;  4A93 J;  1IDY A;  5K7H A;  4UV8 A;  4F92 B;  3F9K A;  1G3S A;  2FEZ A;  2H1K A;  5EG0 B;  4M9S A;  3DPL C;  4GRI A;  1W0U A;  1WJF A;  2BVM A;  2X4H A;  5A2Q K;  3E1S A;  2H8W A;  2WAE A;  4V2G A;  5DV5 A;  2V9P A;  3DLL F;  1BN5 A;  5K7Z A;  3CCS I;  5BMZ A;  2ETH A;  3JRA A;  1JGS A;  3BR5 A;  4N9I A;  3HXL A;  3R0J A;  3G2B A;  1Y1V J;  3SDB A;  2LD5 A;  4AYB N;  2HKO A;  2ISY A;  2HKX A;  4YG2 F;  2Y75 A;  4M73 A;  2CV0 A;  2HR3 A;  2FQ4 A;  3BTI A;  3GTP J;  3WHC A;  3FIW A;  5FKO A;  4A3D J;  5M3F J;  2BXY A;  2QLZ A;  2VPR A;  2BXZ A;  1R36 A;  2VJ5 A;  2L01 A;  2PLY A;  1EH8 A;  2K9M A;  1FIA A;  2BW3 B;  4EEF G;  4GYI A;  1SFO J;  1U5T B;  4V19 K;  4GO1 A;  1YO5 C;  2NVQ J;  3ZGK A;  1K7A A;  1OLT A;  2JRT A;  2VKE A;  5TGT A;  2HQN A;  2KFD A;  1WWX A;  2HOT A;  2A05 A;  4H0E A;  4J00 A;  4ENJ A;  2M9H A;  2KKO A;  3RTR A;  1MMN A;  3BRO A;  4E70 A;  1S7O A;  3ZN0 A;  1G6N A;  1XGM A;  5FKL A;  4MGR A;  4U7B A;  4I7H A;  4F3Q A;  5D5W B;  2OTL I;  2Q2E A;  2CUZ A;  4D7N A;  2VC0 A;  2LOO A;  3HOZ J;  3JTG A;  2VQL A;  4AM3 A;  1ZRC A;  5ERI A;  3DU6 A;  3MZY A;  1VQK I;  1V4R A;  2EA4 A;  3WGH A;  4IJA A;  1WQ2 A;  3ZMS A;  3OS0 A;  5EJC A;  2DMP A;  1ONV A;  2HTJ A;  3KEY A;  5FO5 A;  3I4N J;  1HKT A;  4RGS A;  2Y0M A;  4DQ2 A;  2EV6 A;  2LMD A;  2CUE A;  5IYC J;  4BJ5 C;  5CVI A;  2R7F A;  1YW9 A;  4BHP A;  1I5Z A;  3COA C;  2GLO A;  4HW0 A;  3B02 A;  2L9R A;  1R1V A;  1LVA A;  2QF7 A;  2PFB A;  3GME A;  2NVX J;  1R58 A;  1YX3 A;  2H1L A;  2IS6 A;  1TP4 A;  1V3F A;  4BUP A;  2K9N A;  1S7A A;  3RIR A;  3OS1 A;  3FBI B;  4MQ9 F;  3PSF A;  4J01 A;  3W2A A;  5E3N A;  2KZG A;  1YJN I;  5IY5 H;  2HGC A;  1D1A A;  2GIZ A;  2JRM A;  1RI7 A;  5DCM B;  4CO8 A;  4KYW A;  2FJ1 A;  2NVY J;  4CZC A;  1FOK A;  4CCM A;  1Q1V A;  1V54 H;  2O6G E;  2OQG A;  2HNH A;  1ERD A;  3RKX A;  2DA2 A;  4PDK A;  3HSF A;  4IL6 C;  1YX5 A;  1BOB A;  2OAZ A;  3BY6 A;  1O3T A;  4D7M A;  1SD7 A;  3CDI A;  4AD9 A;  1VQ5 I;  4A3B J;  3KP6 A;  1MIJ A;  2O8X A;  1FP2 A;  1XPX A;  2R7X A;  4CSW A;  1X2N A;  3GZ5 A;  1LQ1 A;  5D8K B;  2HYJ A;  3C2B A;  4FTH A;  4D5F A;  2JTV A;  3F23 A;  3CD6 I;  3F6O A;  3E6D A;  4DGW B;  4Z2Y A;  3H5R A;  3ZQG A;  2LP0 A;  1W0T A;  2K86 A;  2E71 A;  3BJ6 A;  3BQY A;  1BR1 A;  3K4N A;  1IW7 F;  3UR3 C;  2R5Y B;  3KET A;  1OCT C;  1ZLK A;  3V42 A;  1TC3 C;  2FA5 A;  3AL0 C;  2NYX A;  1R6R A;  2XF5 A;  3PM1 A;  1BW6 A;  3BZK A;  2R7R A;  1GXP A;  1K6O A;  4BQO A;  1TZL A;  3TW7 A;  4KMF A;  1FOW A;  4PJN A;  3A01 A;  1W36 C;  2BHY A;  3WGG A;  2BYV E;  2BHZ A;  4G7O F;  2EQR A;  3L2R A;  2P8T A;  1JHH A;  2DI3 A;  2DBB A;  3WE3 A;  3BQZ A;  4F52 A;  3KEO A;  2IW5 A;  1MZB A;  3EUK L;  1XSV A;  4LIV A;  4UHT A;  2BOL A;  3S14 J;  3QOE A;  2XF6 A;  1XN7 A;  2FSW A;  4E7K A;  4IHY A;  3RKW A;  2JA2 A;  4Y15 A;  4M3F A;  3HOW J;  2KIS A;  3H9J A;  2EB7 A;  3CCQ I;  1HQC A;  2QBY A;  5D5V B;  3HSR A;  2P81 A;  2TCT A;  3EUH C;  2B63 J;  4CGZ A;  4CH7 A;  2VLA A;  4OU0 A;  3SQN A;  1K83 J;  5JLX A;  5F04 A;  4ZZD A;  1EH7 A;  4ZYE A;  4U7D A;  1RZ4 A;  4EJU A;  3TED A;  3CMA I;  4OIQ F;  1X1A A;  5F0F A;  3J7Y J;  1ZGW A;  3A0H C;  3WG7 H;  1YS6 A;  2HVS A;  1WJA A;  2DPU A;  5B5E C;  4RB2 C;  1LDD A;  2DAO A;  3L2V A;  1SAN A;  3MZH A;  5HDN A;  3BCB A;  1G2H A;  3HOV J;  3F8F A;  5GP9 A;  2K3F A;  4CYD A;  3GTJ J;  1F36 A;  3TKY A;  4Y3O A;  1YG2 A;  5JVT A;  3RPU D;  4LLN A;  2RQQ A;  1YS7 A;  3CO6 C;  3K4J A;  2CUJ A;  3HGY A;  2LRE A;  3TW6 A;  3G3Z A;  3I4P A;  2WB1 A;  4MFD A;  1IXC A;  3CUQ C;  3WG9 A;  1ZTR A;  3MKY B;  4MIM A;  3H35 A;  3OYA A;  1R4M B;  3GBG A;  3KLN A;  1W7P A;  1YRN B;  4L18 B;  2X1C A;  2ME0 A;  4LB5 A;  3TOB A;  4G8X A;  3WTY C;  1BBY A;  1IJW C;  3IL2 A;  3ZCO A;  2UXX A;  3HOU J;  2M8G X;  1ENH A; 
#chains in the Genus database with same CATH homology
 1Z1D A;  1FWZ A;  1R5H A;  2ZXJ A;  2HFH A;  1FZP B;  3QP5 A;  5DCF A;  4CIC A;  5D4S A;  2VXZ A;  3HOS A;  2DQR A;  3C3W A;  3CLO A;  1YLF A;  2IRF G;  1TQM A;  1HKS A;  4GCV A;  2EJR A;  4O3M A;  5EEH A;  2ZNZ A;  3T1B A;  3WTU C;  1Z7U A;  2D45 A;  2Q8K A;  2FQ3 A;  4ZH4 F;  4A0Y A;  3B73 A;  4L9V A;  1R1U A;  2LSO A;  2NRA C;  2QM3 A;  3FZV A;  5CVJ A;  4HX7 A;  4Y17 A;  3WOD F;  5CLS A;  4OIO F;  2P7C B;  2CG4 A;  1KGS A;  2QVO A;  2GA1 A;  4BAY A;  3NQO A;  4B09 A;  1SMT A;  3CDH A;  5E18 F;  2KIM A;  2XAG A;  2CO5 A;  1E2X A;  2A3S A;  2ZME A;  5LRR A;  2PQ8 A;  4Q4Z F;  2UXN A;  4UNO A;  4YFX F;  3TDZ C;  1W7P D;  4BHC A;  1HXD A;  2ZFW A;  1FNN A;  3ABT A;  3TO9 A;  4R1H A;  2DLL A;  4MHG A;  4EM2 A;  2W25 A;  3FMQ A;  5BPD A;  4R8H A;  2RN7 A;  2ZBK A;  5JI6 A;  4A0X A;  2ADU A;  1R23 A;  4L0Z B;  2VBZ A;  3WTZ A;  1REP C;  2ZJ2 A;  3HRS A;  5E17 F;  1ZGA A;  3BDD A;  4HZF A;  3ZMD A;  2XKP A;  2IA0 A;  4EJT A;  1XD7 A;  3EYY A;  1IRF A;  4Q47 A;  5KVR A;  3MQ0 A;  4KN4 X;  3PQK A;  1O7F A;  2D1H A;  1G4D A;  4ZYG A;  4BYY A;  3K1M A;  1ODD A;  3E5X A;  5H6R A;  2V1D A;  3E5Q A;  4MEX F;  5HS7 A;  2E1C A;  1L0O C;  4LK1 F;  1O7L A;  4EMS A;  1ZG1 A;  4ESJ A;  1ON1 A;  3T8T A;  2M87 A;  5CVR A;  4P5O A;  4WK8 F;  4P9U A;  2H27 A;  3QPH A;  5E1Z B;  2K4J A;  2G7U A;  1HKQ A;  5LEJ A;  1QNT A;  2IA2 A;  2QBY B;  3J7A O;  2PI0 A;  3JTH A;  1XDU A;  2CYY A;  2M1B A;  2PBI A;  2YSR A;  5DUK A;  2W57 A;  2WV0 A;  3T8R A;  4O5V A;  4HOB A;  5LLQ A;  1L3L A;  5CJ9 A;  2ESN A;  3BPV A;  3VEP A;  3FX3 A;  4MEY F;  3ECH A;  1LNW A;  1ZAO A;  1STZ A;  2OD5 A;  2O61 A;  1IN5 A;  4CXF A;  5H6Q A;  1LDJ A;  2M30 A;  2FMY A;  2MLK A;  4QWQ A;  1BM9 A;  1LJ9 A;  2TDX A;  2D1V A;  3I59 A;  1W7P B;  1IAW A;  4HBL A;  3U9G A;  1T98 A;  4M6X A;  3C1D A;  1IN8 A;  5HS8 A;  2FU4 A;  4M6Y A;  3C18 A;  3HRU A;  1YFH A;  3PFI A;  3Q5F A;  4EJO A;  3ELK A;  1FY7 A;  3IWF A;  1DPR A;  3L00 A;  1WKM A;  2HEO A;  4HDU A;  1J5Y A;  3BWG A;  3DPT A;  1U3E M;  2H94 A;  1G3W A;  2D2W A;  5ICF A;  1IN7 A;  3DKW A;  3DQV C;  5KK1 A;  1OPC A;  3E6M A;  1QPM A;  3W6J B;  1F9N A;  2A68 F;  1O3Q A;  4EJW A;  2ESH A;  4BHB A;  4U0Y A;  3DV8 A;  2P5L C;  2Z33 A;  2OBP A;  3KP4 A;  3GWZ A;  1XSD A;  3O6B B;  1GHC A;  2MA3 A;  2PMH A;  3FXU A;  2F5C A;  3GFM A;  2HOE A;  1ZH5 A;  1Z05 A;  3WTW C;  1X3U A;  2YPR A;  2ACJ A;  1XGN A;  2Z9O A;  4ZZL A;  3NRV A;  2ZME B;  2OQR A;  4PCQ A;  5LHH A;  2OZ6 A;  4IRH A;  1WI9 A;  3LA7 A;  5JHU A;  3MWM A;  5HDG A;  4WCG A;  2A6H F;  3IKV A;  4A2U A;  3J80 K;  2EFP A;  2L3D A;  3I53 A;  4P96 A;  2R3S A;  3G73 A;  4LGW A;  1ZAR A;  2Q0O A;  2QQA A;  4IPA A;  4G6D A;  1U5T C;  1ZYR F;  1MJB A;  2L4A A;  5BOX A;  1WSU A;  3L2C A;  4KDP A;  3LST A;  1CGP A;  3GUD A;  3K9T A;  4AWX B;  2P7V B;  1PUE E;  3LWF A;  3SHF A;  4I02 A;  4I98 B;  1KU9 A;  3GEZ A;  4PGH A;  2K02 A;  4HF2 A;  3RI4 A;  1YIO A;  2YX7 A;  2A61 A;  4U0W A;  1B4A A;  3I71 A;  3WTS C;  1JXS A;  1FBS A;  4LLG F;  5BS6 A;  3K69 A;  1ZGJ A;  4A6D A;  4HX8 A;  3M9A A;  3P9K A;  1FSH A;  2DK5 A;  1A04 A;  5DEQ A;  2F5D A;  2XIG A;  3FMR A;  1F5T A;  4MNU A;  2BBY A;  2O03 A;  1QO0 D;  4LMY A;  5ILU A;  3F22 A;  3ZN1 A;  1MKM A;  1XGS A;  2QYO A;  3ABU A;  4IXA A;  5E1W A;  1KU3 A;  3L9F A;  1U8R A;  2V79 A;  3ISP A;  3ZMZ A;  2KJC A;  4EGY A;  3JAM K;  3T5X A;  5CVU A;  5FD5 A;  5FB2 A;  2ELH A;  2DTR A;  3HOT A;  1XDS A;  3LAP A;  2FBI A;  4HQM A;  1K78 B;  2HYG D;  4BNC A;  1JHF A;  2BV6 A;  4MTE A;  5EEG A;  4HDV A;  1IUY A;  2XVC A;  1J59 A;  1FLI A;  3CO7 C;  3K1P A;  4GXO A;  3I59 B;  1DPU A;  4PGG A;  3BJA A;  2DO7 A;  3HSE A;  2MLG A;  2DK8 A;  2QWW A;  2E1N A;  2EA2 A;  5TRD A;  3TDU C;  4LG0 A;  1P6R A;  1T0F A;  1SFE A;  2DT5 A;  1BI1 A;  3MCZ A;  3JW4 A;  4KIB A;  1I1G A;  5LGT A;  3V7R A;  3ZPL A;  1OYY A;  3K1N A;  4CDG A;  4LB6 B;  3V8L A;  3WE2 A;  2HS5 A;  3V8J A;  2NNN A;  3HRM A;  3KFW X;  4UUV A;  4HQE A;  1J0R A;  3O3K A;  4XLP F;  1FYL A;  2GXB A;  1O3S A;  4HAM A;  5JFR A;  3AAF A;  4WWC A;  4M9X A;  1PP7 U;  3F21 A;  2DU9 A;  1R1T A;  2P6S A;  2F5F A;  2FBK A;  1IZ1 A;  5L3F A;  3FM5 A;  3I5U A;  4FT8 A;  1LEB A;  4A5M A;  3RYR A;  3HUG A;  4R79 A;  2C6Y A;  1D8J A;  4F7Z A;  5ICG A;  2E7X A;  2XV4 S;  1T38 A;  2ZO4 A;  1FBQ A;  4ENN A;  2B0L A;  3IC7 A;  3BZ6 A;  4HX4 A;  2GWR A;  4RGR A;  3HRT A;  5HOO A;  3F3X A;  4L9J A;  1YTY A;  1I27 A;  2H6B A;  2LNB A;  3EET A;  2LF7 A;  2XAH A;  3KEQ A;  3IWZ A;  2VBW A;  4ENK A;  2XRN A;  4KA4 A;  4YIF A;  2G9W A;  3FMS A;  3OOP A;  1BI3 A;  2VOD A;  3RYP A;  2LF8 A;  2V6C A;  4JQF A;  3OV8 A;  3M8F A;  3EQL F;  1TBX A;  4LK0 F;  4TV7 A;  4KUM A;  3D5L A;  2O3F A;  3GFL A;  3P7N A;  3JSP A;  2XUB A;  4S04 A;  5H20 A;  4IHT A;  4XRF A;  1OR7 A;  2EFN A;  3L7W A;  4GYG A;  2UZK A;  3E97 A;  1RNL A;  3WTV C;  5FLX Z;  3TO7 A;  1XB4 A;  5HS9 A;  5HLI A;  2L02 A;  2VT3 A;  5CVV A;  2WTE A;  3SFZ A;  3I64 A;  1YW8 A;  2WC2 A;  4RGX A;  3I58 A;  5ED4 A;  1C0W A;  5LEK A;  3IHU A;  5IT3 A;  2IP2 A;  3V4G A;  4UVB A;  3ZMT A;  2QUF A;  2Z99 A;  3HYI A;  3GZ6 A;  4I2O A;  5ILS A;  4K2E A;  2J5P A;  1RIO H;  1XSX A;  1WRJ A;  4HLX A;  3N4M A;  4FHT A;  2XGX A;  2VE9 A;  3ROU A;  3H3Z A;  2YR2 A;  1H9G A;  1TLH B;  3ZMU A;  1SFX A;  2RGV A;  1Z6T A;  2ISZ A;  3F72 A;  2AXL A;  1GXQ A;  4U88 A;  2DPD A;  2HQR A;  3TO6 A;  4RS8 A;  2PN6 A;  2RVC A;  3HHG A;  2AS5 F;  1MJA A;  1ZRE A;  2M8E A;  3HTU A;  4M71 A;  1J9I A;  5F6F A;  5HVQ C;  1KQ0 A;  5AIP A;  3MAJ A;  5K5O A;  3HTS B;  1FBU A;  2FOK A;  2QQ9 A;  3ECO A;  2Z3Y A;  1IN4 A;  3R0A A;  2V9V A;  3R61 A;  4LG0 B;  1O3R A;  2EK5 A;  5HLH A;  2WWY A;  4ESB A;  3DEU A;  4OOI A;  1MGT A;  2P5K A;  1SD5 A;  2VBY A;  5L3C A;  4FX0 A;  1Z9C A;  4HF0 A;  4WXC A;  4N0B A;  3EDP A;  1U78 A;  1I1S A;  4XSZ F;  4ESF A;  2JSC A;  2P4W A;  2GIV A;  4WXH A;  3RKY A;  3I0T A;  1P92 A;  4FX4 A;  4UVC A;  4A5N A;  5D4R A;  1KU2 A;  4OMY A;  2FNA A;  4EQQ A;  1O57 A;  1K78 A;  1NHA A;  4RGU A;  1TNS A;  5D6E A;  4QLC U;  2G7H A;  4N9H A;  2EFO A;  4XSX F;  2NNY A;  5AON A;  1G3Y A;  1GVJ A;  2VN2 A;  3LFK A;  5E8I A;  1U6G A;  1USS A;  5HLG A;  3LA2 A;  4Y13 A;  1J2X A;  3E5U A;  3F8N A;  3FF5 A;  1AOY A;  1ZG3 A;  2EWN A;  2P5V A;  2NS0 A;  2DFI A;  3KZY A;  2W84 A;  1EH6 A;  2IPQ X;  2Y48 A;  3SZT A;  4NHJ A;  1P4A A;  5LHI A;  2GXG A;  3KZZ A;  2CWE A;  3KLO A;  5IT9 Z;  5FD6 A;  5K5R A;  1DDN A;  1BOA A;  4KIC A;  4AIJ A;  1OMI A;  4PZJ A;  1HST A;  2DQL A;  1FT9 A;  3N97 A;  3RDI A;  4L5I A;  1IF1 A;  4YFK F;  5E8G A;  3F8B A;  4IHS A;  2UWM A;  3E3V A;  3IKT A;  1BIA A;  3BPX A;  4AIH A;  3BOQ A;  3P9C A;  1CF7 A;  1TQI A;  1MDM A;  4P55 A;  3F8C A;  1DUX C;  3EUH A;  3QP6 A;  3ML6 A;  3W6K B;  3KP3 A;  3KCC A;  4A0Z A;  3Q9V A;  2YX4 A;  5LRS A;  1QZZ A;  2RV8 A;  3GW2 A;  1E17 A;  4BH9 A;  2PG4 A;  3S2W A;  6PAX A;  3ULQ B;  1KYW A;  2V1X A;  1FYK A;  2VOO A;  2OU2 A;  1F4K A;  4BQA A;  3M8E A;  2HTS A;  4OIR F;  1B6A A;  2LKP A;  3CUQ A;  3GLX A;  2STT A;  3LQR A;  2JZY A;  3FXR A;  2QQB A;  1TQP A;  2QZ8 A;  3I54 A;  4L0Y B;  4P9F A;  2XHK A;  2CGP A;  1UB9 A;  2W24 A;  4OIN F;  3L09 A;  4D0P A;  1OYI A;  2PMU A;  3VB2 A;  1FC3 A;  2X0L A;  3WGI A;  1HBX G;  5LBQ A;  1YYV A;  3CUO A;  2VC1 A;  3DFG A;  2MH2 A;  5FFZ A;  1T39 A;  4HF1 A;  5K5Q A;  1J75 A;  2FE3 A;  4LJZ F;  1Z6R A;  4B8X A;  1R5G A;  2O0Y A;  1PDN C;  2E7W A;  3K0L A;  1KA8 A;  4M9Z A;  4UVA A;  3QU3 A;  3GFI A;  2EFW A;  1D3Y A;  1B59 A;  1VTN C;  3KP5 A;  2M45 A;  4KNY A;  1D5V A;  3E6B A;  5BQT A;  4OIP F;  1W5S A;  1ZG5 A;  2VON A;  2OZU A;  2F2E A;  3QRF F;  2FNP A;  2KIU A;  2BEO A;  1FP1 D;  5F1R A;  4L5J A;  5HDK A;  3BJO A;  2L4M A;  4AVP A;  5L3B A;  2EFQ A;  2DW4 A;  2GA2 A;  1U2W A;  4I0A A;  1I6X A;  3REO A;  4L9N A;  2BE5 F;  3LAJ A;  4G6Q A;  2MD5 A;  2RDP A;  2VT2 A;  4LLL A;  4WX9 A;  3LQQ A;  2L54 A;  3HIF A;  5L3E A;  5E20 A;  1XCB A;  4UV9 A;  5ICC A;  3JSO A;  3RPU A;  1UCR A;  2FXA A;  5CYV A;  5F64 A;  2HZT A;  3ZMV A;  2R7D A;  4EV0 A;  4HLY A;  5TJJ A;  1J7K A;  4KT5 C;  1LEA A;  4G7Z F;  1XCV A;  3D0S A;  5LGU A;  1T2K A;  2RKH A;  4XLN F;  5BPI A;  4L9T A;  2IT0 A;  2IA1 A;  2BGC A;  3VFZ A;  3T0Y A;  2A5Y B;  1IXS B;  4RB1 A;  3J81 Z;  2JPB A;  1BC8 C;  5FLX K;  2GAU A;  2MC3 A;  3M7G A;  2MBF A;  2RC4 A;  3DXJ F;  4BXU A;  4I01 A;  5A2Q Z;  3ZP5 A;  3V8K A;  1ON2 A;  3J80 Z;  1ZLJ A;  2IJL A;  5DD4 A;  1ZHF A;  1R00 A;  2NAZ A;  4RAZ A;  1BJA A;  4KFC A;  4G94 A;  5L3D A;  5D5X B;  1UHW A;  4IRG A;  3ERE D;  1S8N A;  5ICE A;  1FPQ A;  1SMY F;  3F8M A;  1QQI A;  1Y0U A;  4A12 A;  1DP7 P;  3FWE A;  1KQ9 A;  4DNC A;  1CF7 B;  1MDM B;  1BI2 A;  4LFU A;  3DP7 A;  4HV5 A;  4O6J A;  4JBA A;  5E1X A;  2STW A;  2A07 F;  1B1B A;  4I0B A;  3CJN A;  4ENM A;  2KJB A;  3GO5 A;  4EM0 B;  4EGZ A;  1HW1 A;  1W4M A;  2ZKZ A;  3KE2 A;  3TQN A;  1T6S A;  1IN6 A;  1F1Z A;  3DF8 A;  3CUQ B;  3H3U A;  2ZNY A;  4RB3 C;  1R22 A;  3VOE A;  5FGM A;  1JE8 A;  3P9I A;  4LD5 A;  1W5T A;  2M5W A;  2CW0 F;  2PEX A;  3WTT C;  4Q5S F;  2XAS A;  5K1Y A;  5L3G A;  3Q9S A;  3SXY A;  1RUO A;  4M74 A;  3O2P E;  1UST A;  3FM3 A;  3IRQ A;  2RQP A;  1H0M A;  5LHG A;  2OA4 A;  2K4B A;  1AWC A;  2VOP A;  1S3J A;  3U1D A;  4OMZ A;  3JAM Z;  4NQW A;  1OYW A;  5FFX A;  1SD4 A;  4Q48 A;  2Z5U A;  2H6C A;  1P4W A;  4U0V A;  4I09 A;  2JPC A;  2W85 A;  4IRI A;  4ASN A;  1FX7 A;  4A6E A;  3R6S A;  2HWV A;  5DYM A;  3C7J A;  2H09 A;  3GVA A;  3R60 A;  3WU1 B;  1H9T A;  2COM A;  2XAF A;  1Z91 A;  3QPT A;  1XGO A;  2ZCW A;  1LB2 A;  5J8F A;  5IT9 K;  1SFU A;  2FF4 A;  1B9M A;  1P2F A;  4WF2 A;  4RB0 A;  1XMA A;  3QOP A;  3GF2 A;  3WU0 A;  5D5U B;  1QGP A;  2XKO A;  3GFJ A;  3V7S A;  2PJP A;  3GYH X;  4HA8 A;  1R7J A;  4CHU A;  1TNT A;  2A6E F;  1U5T A;  5DDG A;  2F5E A;  1ULY A;  2MH9 A;  4EM1 A;  2CSO A;  5J8C A;  2XRO A;  4IF4 A;  4MQV A;  2HDC A;  2EV5 A;  5LGN A;  1MJ9 A;  1IRG A;  4IVN A;  2A69 F;  1ZN2 A;  2HYF A;  4KN7 X;  3TGN A;  3EYI A;  4GGG A;  1SD6 A;  4HYE A;  2RNJ A;  3M1E A;  1D8K A;  4EVI A;  4UXN A;  3CTA A;  4NB5 A;  1LDK B;  3LA3 A;  3TOA A;  3U2R A;  3HHH A;  3E6C C;  3QU6 A;  1PP8 F;  1SAX A;  2J5O A;  2CFX A;  2LDU A;  1TTY A;  2V1U A;  4ZYH A;  1TW3 A;  4M72 A;  4ETS A;  5DCM A;  1ZRD A;  4KMU X;  3MEX A;  1BC7 C;  1IXR C;  1P4X A;  4MTD A;  4S05 A;  2JT1 A;  4KIG A;  2QEN A;  1BI0 A;  1TW2 A;  3MFK A;  2VE8 A;  5JR3 A;  1YQA A;  1BIB A;  2EV0 A;  3K2Z A;  1RUN A;  1ZRF A;  5D8L B;  1UFM A;  4XBF A;  2IVM A;  1XMK A;  3RPQ A;  3FXQ A;  4EJV A;  2FML A;  5DD8 A;  3BP8 A;  4ZYD A;  2GQQ A;  2XAJ A;  1QBJ A;  1B9N A;  1S29 A;  1FSE A;  2VBX A;  3F6V A;  3NEU A;  1KQ8 A;  5D6F A;  1QZY A;  3PQJ A;  4HV6 A;  3RJP A;  1Q1H A;  4KIF A;  4YII A;  4CZZ A;  1HW5 A;  1K79 A;  1YW7 A;  4YFN F;  2CQK A;  1KU7 A;  3KP7 A;  3QAH A;  1OKR A;  4G7H F;  3GXO A;  2KIF A;  3VOD A;  3V7C A;  3KP2 A;  2P6T A;  3GX4 X;  3H92 A;  4AIK A;  4RAY A;  3WTX C;  2KRF A;  2K27 A;  4WXD A;  2XAQ A;  2YU3 A;  5ILV A;  2GZW A;  2FBH A;  1FYM A;  3SZP A;  5AIQ A;  1G3T A;  1KYZ A;  3IRR A;  1HW2 A;  2FRH A;  1UHM A;  4JK1 X;  4G9Y A;  3ZQ7 A;  1EV7 A;  1HSJ A;  3FHZ A;  3J81 K;  3R4K A;  5J6X A;  1MD0 A;  4ON0 A;  1S6L A;  2K7L A;  5DUI A;  4UV8 A;  1G3S A;  2FEZ A;  4M9S A;  3DPL C;  2X4H A;  5A2Q K;  5DV5 A;  1BN5 A;  5BMZ A;  2ETH A;  1JGS A;  4N9I A;  3R0J A;  2HKO A;  2ISY A;  2HKX A;  4YG2 F;  2Y75 A;  4M73 A;  2HR3 A;  2QLZ A;  1R36 A;  2L01 A;  2PLY A;  1EH8 A;  4GYI A;  1U5T B;  4GO1 A;  1YO5 C;  1K7A A;  2JRT A;  2HQN A;  1WWX A;  4H0E A;  4ENJ A;  2KKO A;  3RTR A;  3BRO A;  4E70 A;  1S7O A;  3ZN0 A;  1G6N A;  1XGM A;  4MGR A;  4U7B A;  4I7H A;  5D5W B;  2Q2E A;  2VC0 A;  3JTG A;  1ZRC A;  5ERI A;  3MZY A;  1V4R A;  2EA4 A;  3WGH A;  4IJA A;  1WQ2 A;  3ZMS A;  1ONV A;  2HTJ A;  5FO5 A;  1HKT A;  4RGS A;  2Y0M A;  4DQ2 A;  2EV6 A;  5CVI A;  2R7F A;  1YW9 A;  4BHP A;  1I5Z A;  3COA C;  4HW0 A;  3B02 A;  1R1V A;  1LVA A;  2PFB A;  1R58 A;  1V3F A;  1S7A A;  3RIR A;  4MQ9 F;  2HGC A;  4CO8 A;  4KYW A;  1RI7 A;  5DCM B;  1FOK A;  2O6G E;  2OQG A;  3RKX A;  4PDK A;  3HSF A;  2OAZ A;  3BY6 A;  1O3T A;  1SD7 A;  4AD9 A;  3KP6 A;  2O8X A;  1FP2 A;  3GZ5 A;  1LQ1 A;  5D8K B;  2JTV A;  3F23 A;  3F6O A;  3E6D A;  4Z2Y A;  2K86 A;  3BJ6 A;  1IW7 F;  3KET A;  1ZLK A;  2FA5 A;  2NYX A;  1GXP A;  1K6O A;  4KMF A;  3WGG A;  2BYV E;  4G7O F;  2P8T A;  1JHH A;  2DI3 A;  2DBB A;  3WE3 A;  3KEO A;  2IW5 A;  1MZB A;  1XSV A;  4UHT A;  1XN7 A;  2FSW A;  3RKW A;  4Y15 A;  2EB7 A;  1HQC A;  2QBY A;  5D5V B;  3HSR A;  4CGZ A;  4OU0 A;  3SQN A;  4ZZD A;  1EH7 A;  4ZYE A;  4U7D A;  1RZ4 A;  4EJU A;  4OIQ F;  1YS6 A;  2DPU A;  4RB2 C;  1LDD A;  2DAO A;  3MZH A;  5HDN A;  3F8F A;  4CYD A;  3TKY A;  1YG2 A;  5JVT A;  4LLN A;  1YS7 A;  3CO6 C;  3G3Z A;  3I4P A;  1IXC A;  3CUQ C;  3WG9 A;  3KLN A;  1W7P A;  4L18 B;  4LB5 A;  3TOB A;  4G8X A;  3WTY C;  1BBY A;  3IL2 A;  2UXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...