5HMAA

Crystal structure of mamo protease domain from magnetospirillum magneticum (ni bound form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
191
structure length
191
Chain Sequence
LYHTVPPAVVGVGGGGVNAGPVASGAIVGTNGYVITTLHSVSKLPEISVQVATTGGIRRFPAQVVKTIPGHDLALLKMQTTEKFLHFRMADVQTVVPGQQVFAFGRNMAGAPLVRQGLVQSADAPLAVGATQITHLLRSDAVYSWEQTGGPLVNAQGDLVGINIAATGPTGKVEGFTVPAQVIVSHLQDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin-like serine protease
publication title MamO Is a Repurposed Serine Protease that Promotes Magnetite Biomineralization through Direct Transition Metal Binding in Magnetotactic Bacteria.
pubmed doi rcsb
source organism Magnetospirillum magneticum (strain amb-1 / atcc 700264)
molecule tags Hydrolase
total genus 39
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hmaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hmaA01
2H6MA 4X2WA 5EQSA 2JETB 4Z6AH 1ANBA 1G2MA 1Q2WA 2QV1A 2XBYA 3GICB 3PV4A 5DP6A 4GPGA 5DKMA 1O3KA 3GCNA 4NSYA 1HAOH 2GMTC 1MBQA 1HDTH 2BLQA 5FCRA 6ESTA 3C27B 3P17H 3S7KB 3QO6A 3UREA 5GWZA 3S9CA 1ZPBA 4WXVA 2FI4E 5EODA 1EB2A 1TQ0B 3KQBA 3K2UA 3RXAA 4MVNA 4ZKNU 1HCGA 5EOKA 3L6PA 4FU8A 1HAXB 3M3VA 1V2VT 4YESB 3BTWE 1H9IE 3IG6B 1TB6H 3GDSA 4FU7A 3RXHA 3QLPH 3H7OA 1LKBA 1WAYB 3RXCA 1BDAA 3EGKH 1C5QA 1XM1A 3ZV8A 2CHAB 1O2ZA 2FO9A 3RLYH 2Y5HA 4BTIB 2F9OA 2XXLA 5HMAA 1V2TT 3ZV9A 1KXCA 2SNVA 1ARBA 1ELCA 3PTNA 1GBTA 1ELGA 1O3MA 1THRH 1V2RT 2FOEA 4B73A 1O5DH 2ZFQH 4CRDA 2C8YB 1SGDE 1O5BB 1P3EA 5EXMA 3TGIE 1DDJA 1SC8U 4NGAH 3SV7A 1GGDB 1SSXA 2P8OB 1DWEH 4KTSA 1TBRH 1UHBA 4MNWA 1ACBE 1IQMA 1O2PA 1SGFG 2W7UA 4INKA 1DXWA 1ABJH 5EPYA 1MQ5A 1TYNA 1ARCA 2ZCHP 4YT6H 1B0FA 2BZAA 1F2SE 1GI0A 2FOFA 2H5DA 1UTKA 1GI8B 5GXPA 4K1EA 2J95A 1MTUA 1C9TA 1GMHG 1MTNB 3OX7U 1C1RA 1H1BA 3KEEA 3T29A 1C1NA 3PLPA 2FS8A 1O2GH 2ZTZA 4E7RG 1EAWA 2GTBA 5SGAE 1TPPA 2FZZA 1AU8A 1GG6C 1GI7B 1LCYA 1HJAB 1AKSB 3S9BA 2J2UA 2FLBH 2BDAA 4OGYA 3A7XA 1GL0E 1HGTH 2P3FH 1QA7A 1MZAA 1HXEH 5FBIA 1YLCA 1FPHH 1KYNA 3RXEA 2Y6TA 3FP6E 4HFPB 1L2EA 2ZHWH 1FY8E 1TOCB 4BAKB 1QRWA 2YOLA 3D65E 3Q00A 2VWMA 1P03A 1AFEH 1BJUA 2GP9B 1QBNA 5DP8A 2ZGXH 4GVUA 3SU3A 1N8OB 3TVJB 5DJ7A 1GBHA 1J16A 1DM4B 2J38A 1ANEA 2VWOA 1C5LH 1CT2E 4ABHA 3SU4A 3GISB 4UFFH 1KY9A 2PTNA 2ZWLH 1GBKA 3E0PB 3URCA 1UTPA 3UFAA 5A0CA 4Q7XA 2XC5A 3V13A 4IGDA 1A1RA 1FAKH 3BG4B 2AGIX 3LGUA 3SGQE 4CRBA 2ZU2A 2XNIA 4FU9A 3OTJE 1BMAA 1TNKA 1DLEA 1EOLA 2WINI 4ABFA 3BTKE 5CHAC 1BITA 1SPJA 1UCYH 2BHGA 1T32A 2EEKA 5AF9H 5G4BA 2Z6BD 1JIRA 1CQQA 4BXWA 3ZZ8A 2F83A 1AI8H 3KF2A 3L33A 2QGRA 2ZFRH 3LU9B 3A84A 3AASA 3KN2A 3DFLA 1VITF 2WPJS 1EATA 4GLYA 5TJXA 4ISOA 1QY6A 4BTTB 1RIWC 2Q6FA 1FZZA 1SLVB 1S82A 1P2NA 4VGCC 4IN2A 1AN1E 1BTHH 3ZZ4A 1ZYOA 1XKAC 2BVSH 1ETRH 2CMYA 3NPSA 1QB9A 4KTUA 3PMJA 1HIAB 3KQCA 3SI4H 2GCTB 1NFWA 3QZQA 3URDA 1P01A 4AYVB 2PTCE 2W5EA 4ZMAH 3SHCH 4X1RU 4UFEH 1T8MA 1CHGA 1WQVH 3MO6A 5E2PA 1N6YA 2AMQA 1HNEE 3GY8A 4A1XA 1D6RA 5GCHF 1ETSH 3GCTG 2WV5A 1W13U 1OX1A 2GX4A 8LPRA 1EPTB 1UVOA 1PYTD 2OD3B 1SLWB 1O2HA 1FY1A 4LK4A 1SGEE 4U01A 2A2QH 4B75A 2AEIH 2TGPZ 3RM0H 3ZZCA 1BRAA 2PSXA 1DPOA 2ALPA 2WPHS 1SHHB 4ZXXH 3B9FH 1AQ7A 1KXFA 3GCOA 4DURA 3A7YA 1BTWA 2Z3EA 3F9HA 3W94A 3VXFH 4KTCA 1G32B 1KTSB 4GCHG 5HM2A 1BZXE 3ATLA 4JZDH 1AGJA 1HAGE 2C4FH 2VINA 1H8IH 3DA9B 2G51A 3GCHC 3M35A 4XSKU 1EOJA 4AG1A 2FOHA 1AB9B 2HLCA 1V2ST 2FYRA 1NROH 2FOAA 1XUHA 2BDCA 1V6DA 3ODDA 1OPHB 1JBUH 1TGCA 1O33A 2ANKH 5DP5A 4X2XA 3ESTA 2SGEE 3UWJH 1GI2A 1UTOA 1AKSA 2A2XH 2H9EH 4AFZA 3HGPA 3F9FA 1A7SA 1J15A 2BB4A 3U1IB 4NZLA 1P11E 2Y81A 3BTDE 1ID5H 3N7OA 1YPGH 2AMPA 4ZHMU 1XUKA 1TNHA 1BBRH 4JYTA 1NC6A 5F8TA 2FI3E 1TGNA 4CRCA 1NO9H 1GJ5H 7LPRA 4IC6A 5L6NH 1ZJDA 2BLOA 1LHDH 2A4GA 1O3JA 1EZQA 5C1YA 3JZ1B 5B6OA 2BYAX 1FPCH 4HZHA 2OUAA 1H9LB 4K1SA 3U69H 3M3TA 3ZYDA 2M5TA 1ESBA 1P2OA 1GBCA 4E05H 2H9HA 1SGRE 1H8DH 1QRXA 1TPOA 3NWUA 3EA9A 1HXFH 1RGQA 2V3HH 1BTPA 1K1NA 3RXVA 4Y0ZE 3ZVEA 4Q2KA 4QT8C 4GHTA 1GWAA 2W3KA 3QK1A 1MTSA 1LPGB 2WPKS 4WH6A 3ZVAA 2BY7X 1Y3UA 4I8KA 1UMAH 5EPNA 2TGDA 2PSYA 2XTTB 1SLUB 2RCEA 5A8YA 7GCHF 1HB0B 1QNJA 2PLXA 1MBMA 2OBOA 3F6UH 2P3UB 3LC3A 3BG8A 1V2UT 1PQ5A 1WTHD 2VH0A 1SGFA 1GI6A 1Z8RA 3FP7E 4MPWA 3FZZA 3Q77A 2FP7B 2Y7XA 3STJA 5L30H 1G37A 1C2MA 4FUCA 4Z0KA 2ZDVH 1C2EA 1ZTKA 4ZHAA 1G3EA 2G8TA 2A45B 3D23A 1V2PT 1C1VH 3KQDA 4YLQH 4D8NA 2IJOB 1LHEH 4SGAE 2ULLA 1OS8A 3H7TA 1A0JA 3ZVFA 1EX3A 5LGOA 3GDVA 2ZDNA 1K21H 4NG9H 1D3PB 1QL9A 3A88A 3GY7A 1QR3E 1MKXH 1P2MA 3RLWH 1ELAA 2BTCE 1AY6H 1O2RA 4YOIA 8ESTE 3TU7H 1DWCH 3LGYA 3ZZ9A 1C2GA 3BTHE 1N1LA 1G3DA 5HYOA 2QYIA 1O3NA 4DT7B 5F8XA 4Y76A 1ANDA 4ABJA 2VIPA 2BDYA 1K2I1 3LH1A 2A32A 1GVZA 5LPRA 3HGNA 5J4QA 1ZPZA 4KKDA 4CH2B 3A7TA 2OC8A 1EPTA 4K8YA 3SGAE 1C2HA 1C5XB 1RD3B 2J94A 3RXFA 5JPMH 1MAXA 1YCPK 4DCDA 1UJ1A 1NESE 5AVDA 1GHYH 1GHXH 2UUYA 5L2YH 3C1KA 2H5CA 1BHXB 2SGQE 1W0YH 1K28D 5JBBS 1ELDE 1SVPA 3BF6H 2NU0E 1GVKB 1TOMH 2BY5X 1SQTA 1PPHE 1QBVH 1XMNB 3BSQA 4WMFA 1V2JT 1G2LA 1LMWB 1C5PA 1EZSC 4BXSA 5C1UA 1O34A 3TJNA 3S7HB 9ESTA 1V2OT 1N6XA 3PO1B 4MLFB 4R8TB 3CENA 1JRTA 3PB1E 4FUGA 2K1QA 4ABIA 2JKHA 4AOQA 1GPZA 5TCCA 3ZVBA 3MU8A 1ELFA 3ATMA 3MH5A 3A87A 3A83A 1O37A 2ZPQA 4H4FA 3RXLA 1GHZA 1NRQH 1OYQA 3A8CA 4BANB 1Y5UT 1IQNA 5A0AE 5K0HA 1VGCC 1WQSA 3OY5U 3SNBA 1RRKA 2WYGA 2XRCA 1O35A 1PPBH 2SFAA 1W0ZU 3VGCB 3MMGA 2TRMA 2D1JA 4WH8A 1SL3A 1SB1H 1ZRBA 4AFSA 1C1QA 4D7GA 3QTOH 2ZTYA 3RMNH 2ZHEH 3O8CA 1K1IA 5JB8S 3BEUA 2GD4B 2ANYA 1FY5A 3HKIB 4X6NA 4KELA 2UWPA 3U98H 1AZZA 2D26C 5EQQA 2R3UA 1AVWA 3SNAA 1O38A 2ZFTA 2BD5A 1AWHB 3EA8A 3UOUA 4DW2U 2AGEX 3PTBA 5EW1H 4A1TA 4BTUB 4GCHF 1BTUA 1C5VA 1YCPM 4GUXA 1P12E 2GDEH 1QL7A 1YPHC 3G01A 1U6QA 4CHAC 4UDWH 5K7RA 1L1GA 3MNSA 4Y79A 3EE0B 2DE8A 1O3LA 5A09A 2STBE 1QBOA 2D2DA 3EA7A 2GV6A 1GDUA 1O2WA 3P95A 2A4RA 4MPUA 1NTPA 5HM9A 1HFDA 2PKAB 3ATWA 4ESTE 4GAWA 2BDHA 2JH0D 2BXTH 4DGJA 1O3BA 1T8OA 4ISNA 2DE9A 1TONA 1YF4A 3PWCA 1SQAA 1JMOH 4FXGH 1GHAG 1CBWC 3CP7A 5E8EH 1EB1H 2A7JA 1THSH 1DOJA 3RU4T 1F7ZA 1CA0C 3SJOA 4JMYA 3OYPA 2OCVB 2J4IA 4ABGA 2ESTE 1EAUA 1O2UA 3SUEA 1HAHH 1S83A 4NA9H 4X2VA 1BRCE 1C1PA 1O3GA 1T7CA 5ETXA 3SNEA 3M3SA 4YM9A 5JYIA 3UQOA 2BY9X 3RUOA 1P05A 4Y0YE 1AFQC 2C8XB 2SGFE 2ZA5A 4LXBH 2ZECA 4M7GA 2TBSA 3SV2H 5ESTE 3TJOA 3UWIA 2SGAA 2Z7FE 3MO3A 1FV9A 4ABDA 3SJ9A 3KGPA 3OU0A 1D4PB 1BHXF 1VCQA 1DSUA 2F91A 1FJSA 3SJ8A 3A86A 1GJDB 2ANMH 3GDUA 3K65B 1AUTC 3QDZB 1MTVA 2QIQA 2BX4A 2AGGX 5DP9A 5C5NA 1GBIA 3MH6A 1TIOA 2BQ6B 1IQHA 1O2VA 3BTTE 4INHA 3HATH 3BN9A 1TGSZ 2GZ8A 1Q31A 1QGFA 1G3BA 4XBCA 4B74A 2GGVB 2CF9H 1FDPA 5GJ4B 1RXPA 5GPIB 1TMBH 2GZ9A 4UE7H 3H5CB 1P2KA 1BUIA 1GDQA 2BD4A 1IQFA 2IPHA 1K1MA 2JETC 4TPYA 3NKKA 1K1JA 3HK6B 1OOKB 2AS9A 4IS5A 2V3OH 5F6MA 1GBBA 2BVXH 5JB9S 1GL1A 1ZR0A 2ZHQH 1RTKA 1GJCB 1QHRB 1TNIA 1E34B 1IQEA 2OINA 3BIVH 1Z1IA 3GY2A 1RTFB 1PYTC 1UO6A 1GBAA 1ZSJA 1PPZA 1ZTJA 1IQJA 1EKBB 3Q76A 2FMJA 3SUGA 3ZYEA 1LPZB 1UTMA 2C8ZB 2H9TH 3NK8A 4LOYH 1DVAH 2R9PA 2ZDAH 1A3BH 1TRYA 2FM2A 2J9NA 1Y5BT 1MQ6A 1HRTH 1EZUC 3KL6A 3O8DA 5C3NA 4I32A 3PROA 1C1UH 1C1TA 2O8MA 1ORFA 3UNRA 2ZU3A 1UCYE 3RXQA 1TABE 4A7IB 1GJBB 3VB4A 1OP2A 3SU6A 3SNDA 1L4ZA 1NRNH 2XWAA 1L1NA 2CHAC 5CHAB 5L2ZH 5FHTA 1TFXA 3VB5A 1F92A 3FAOA 1NPMA 2P95A 1UVSH 3M5LA 1P3CA 2ZU4A 4AORA 4E7NA 1EQ9A 4CREA 2UUFB 1TRMA 1OP0A 5EG4A 1QIXB 1ZZZA 3Q3XA 1GGDC 2P8OC 2BZ6H 1Y5AT 3V0XA 3I77A 3LGWA 1PJPA 1OWDA 8GCHG 1ZGVA 1FXYA 3RXMA 2Q1JA 1NT1A 4JZEH 1F5LA 2H2ZA 4X1QU 4WXIA 1RS0A 3SV8A 1CGJE 2PKAA 5JBCS 2OC1A 4Q7YA 1MTNC 1DY8A 1Z6EA 4DIHH 3KQEA 3A7VA 4MPVA 3RXTA 3SI3H 2LPRA 2DUCA 6CHAB 1HAYB 1ELTA 1OWEA 1SMFE 3SJIA 3KIDU 1JIMA 5JDUB 1V2NT 1T4UH 3PM3A 4UD9H 1MD8A 1NU7B 1SBWA 4AB8A 2QN5T 1M9UA 1GBEA 4Y7AA 1O5FH 4CR9A 3B23B 2VGCB 3ZZ5A 1GHWH 3UOPA 1FQ3A 1IAUA 4DIIH 5HXFA 1GDNA 2NU3E 2A31A 1ELEE 1SQOA 4J2YB 1W10U 1IQLA 2HGTH 3FFGA 1W11U 3RU4D 2Q6GA 2AIQA 4IMQA 4MTBA 1YLDA 2OQ5A 5DGJA 3M5NA 4Y8YA 1WOFA 3GYMA 3RXDA 2HNTF 1HPGA 1TPAE 1V3XA 3NZIA 1N8OC 3V3MA 1Z1JA 1PQAA 1DLKB 1TMTH 1GBDA 1BMMH 4I7YH 1NN6A 3F9EA 1J14A 3SGBE 1NS3A 1C5UA 2G4TA 4ISHH 1K1PA 1ESAA 3P6ZB 4BAMB 4AN7A 3DFJA 1L1JA 2EI8A 1P9SA 3GY5A 1BBRE 1E38B 2Z9GA 2ZTXA 1FI8A 2QXGA 3U1JB 3MH4A 3ATIA 2BY6X 1DS2E 3BG4C 2C3SA 3UY9A 1XUGA 4CRGA 2EI6A 3QN7A 2OLGA 5A8XA 3TH4H 1XXFA 4NA8A 4INLA 4F49A 5BPEA 1W3CA 1GHVH 1YM0A 7ESTE 2PV9B 2VH6A 4IN1A 3BTME 1IHSH 3M37A 3PMAB 1O2OA 5JBTA 2G5VA 1Z8GA 2XWBI 3NXPA 4U32A 4XFQA 3E0NB 5AFZH 1PFXC 1TMUH 3M36A 1HAPH 4X6MA 1GCDA 4OS6A 2STAE 1FONA 2VB0A 2I6SA 1UVUH 2GCHG 4O97A 2PGQB 4FUEA 1C2FA 4K69A 3SV6A 1WTGH 2GCTC 1QTFA 2YNAA 3D62A 1F0SA 2SNWA 4ASHA 2BY8X 2QAAA 5CE1A 3O8RA 2ZQ1A 1LO6A 3E16B 1YPMH 1TBZH 3A8DA 4WMEA 4X1PU 2XCNA 4X2YA 2BOKA 1FLEE 3T62A 2G81E 1BMNH 2B7DH 3R0FA 2XBVA 1TNGA 1TX8A 3A89A 1C2IA 1EPTC 1C1SA 3RDZA 3T28A 1OWHA 1G30B 1WV7H 1WSSH 2W26A 3MU1A 1S5SA 5DG6A 1Z6JH 2ODYB 4AGKA 3U8TH 1CSOE 2Y5GA 1HAVB 1AVGH 1KLTA 1UK4A 3SBKA 4JYVH 5C67A 1ZJKA 1F5RA 2P3TB 5TCAA 1YGCH 4UFDH 4CR5A 4OS4A 4Y8ZA 1DITH 2ZC9H 1Y3WA 3A7WA 1AE8H 1GCTB 4U30A 4BAHB 1UCYK 2UUJB 5F8ZA 4YOGA 3UUZA 2HALA 1AHTH 1AB9C 1C5RA 1CA8B 4ZKOU 4I8JA 1GMHF 1MKWH 1XVMA 1ESTA 4AG2A 3FANA 3SU1A 4NZQA 2CJIA 1A61H 1MU8B 3O8BA 4JK5A 3UNQA 1O0DH 1PPCE 3SU2A 2F9NA 1KLJH 4O03A 1KTTB 1KIGH 3RXOA 1SI5H 4X6OA 2A0QB 2QC2A 4FUFA 1V2LT 1O2QA 1K22H 2AFQB 5E0HA 4I8LA 1SGQE 1WU1A 1XX9A 3STIA 2QF3A 2O8TA 2QF0A 1Z8IB 2BDIA 2RA0A 2RDLA 1SHYA 2FOCA 1A4WH 3LT3A 1LHFH 2D8WA 1O2TA 4OS7A 4H6SB 4BAOB 2NU1E 3AW1A 4B71A 1YKTA 1QB6A 4XDEA 3QWCH 1C4V2 1UVPA 3BTQE 4MDSA 4D76A 1C1OA 1MTWA 2W3IA 2EC9H 1OWKA 2ZFSA 3SJKA 1W7GH 1NRRH 3RMOH 1J17T 1SGCA 1O3PB 1K9OE 2YNBA 8GCHF 1Z71A 3TITA 4THNH 1AUJA 4IMZA 1C5TA 3MNXA 4WY3A 1UTQA 2R2WU 2XW9A 1A5HA 3HK3B 1JRSA 1TA6A 1SGPE 2CF8H 2XC4A 4YTAA 2FODA 4B76A 1QL8A 3BTGE 4K2YA 2TIOA 3T27A 1SFIA 1EP6A 4X8SH 2ZU1A 2G55A 1S0QA 1OP8A 2ZDLA 3CS0A 1WCZA 2AIPA 4JYUH 4XE4A 3T2NA 2ILNA 1TALA 2J92A 1B0EA 2F9PA 1KXAA 3GY6A 5FPTA 1QURH 1CU1A 4CBOA 1SGYE 3AAUA 5BRRE 2AERH 1CE5A 3T5FH 1EP5A 1OWIA 3TPIZ 1P06A 5LPFA 5C1XA 1YP9A 4NA7A 1T8LA 3SO3A 2BOHB 2QCYA 3A8BA 1BQYA 1GI4A 3EDXB 3M61U 1GJAB 2AH4X 1Q3XA 1IOEA 1V2WT 3IWMA 2BQWB 2F3CE 1LHCH 3MU4A 3SQEE 3VPKA 2A4QA 3ZZ3A 5IDKA 1D9IA 1O2XA 3LOXA 4TWWA 2Z9KA 5IYTA 2OP9A 3MNBA 5FCKA 1C2LA 2O8UA 1DWDH 1RFNA 1WYKA 1BJVA 1AVXA 3FVFB 1S0RA 3UR6A 4D9RA 1C4U2 2FX4A 1RJXB 1GBLA 2ALVA 2PKSB 3RXIA 2BD9A 9LPRA 1LVOA 1K1LA 3MO9A 3PYHA 1A46H 3RC4A 3RXGA 1C2KA 3ELAH 3PMBB 1ZMJA 5E2OA 1TX6A 2F9VA 1GJ6A 1DX5M 2HPQH 3GCTF 2BLWA 1O2MA 3SORA 3EQ0H 2HNTE 1SFQB 2RG3A 3E91A 4K60A 4NWLA 3RC5A 2QA9E 1XUFA 1OXGA 2UUKB 3LGTA 1AMHA 5H4IB 1BRBE 3QGNB 1TNLA 2ZIQH 4X6PA 1NFXA 1HAVA 2BMGB 1IQKA 1C5MD 1PQ8A 5ABWA 2NWNA 2VU8E 3P8FA 2GMTB 4JCNA 1HV7A 1LPKB 1E0FD 1O3IA 1BT7A 1EAIA 4AB9A 2C90B 1QA0A 1AFQB 2AYWA 4DOQA 4I31A 3GY3A 1KDQB 3HPTB 2ZFFH 2QXJA 4YT7H 1ZTLA 1O3OA 1VJAU 2HRVA 3Q3YA 1Y8TA 4WMDA 3MHWU 1GI5A 1GHBG 1UK2A 3U8OH 3PO1C 1CGIE 4GHQA 5LH8A 2GCHF 1KXBA 5HGGA 1FN6A 2A7CA 1OSSA 2IOTA 5JBAS 1GVLA 3ODFA 5GCHG 1EJMA 1MCTA 4FUIA 1VITH 2VVCA 1THPB 5DP4A 3K6ZA 1A5IA 3ATKA 3UTUH 2XBXA 1HUTH 3QUMP 3SN8A 1O5AB 2EA3A 2B9LA 1VCWA 1LQDB 3UR9A 1A3EH 3VGCC 4J1YA 5I46H 3MI4A 3TIUA 5FPYA 5DO4H 1DICA 1X7AC 2A5AA 3FP8E 2B0FA 4TY7A 4PROA 1P2JA 1FY3A 3S0NA 2HPPH 1WUNH 3TJVA 2TGAA 1P8VC 1GMCG 2VJ1A 1ZOMA 1XUJA 1K1OA 2BD2A 2FOMB 1TPSA 4OS1A 3W95A 3E3TA 4CRFA 4DY7B 1YPJH 1DANH 1O3DA 4U2WA 4D9QA 1FNIA 3F9GA 2PUXB 4H6TA 2FTMA 2ZCLP 1O36A 1VZQH 4ZUHA 4FVBA 2A7HA 2TGTA 4NCYA 1S81A 3SW2B 1EJNA 2P59A 3L3TA 1GG6B 1KXDA 4B2CA 1GI1A 2ZU5A 5E0JA 1CHOG 4Q7ZA 2ODQA 2V0BA 1P10A 3E90B 3TGKE 2ZGCA 3MH7A 4I8GA 1H4WA 1ZHMA 1P09A 1DE7H 2ZDMA 3T25A 2PFEA 2R0KA 3T26A 2Z3CA 1AIXH 1GI9B 2Y80A 3EAJA 2W7SA 1D3TB 2BLVA 4ZKRU 1J9CH 4ABAA 1DY9A 3DHKH 3TGJE 1B5GH 3KNXA 1TA2A 3TJUA 4K1TA 2ZCKP 1ELBA 4MNXA 4WJG2 4MQAA 4O3UA 2ZGJA 3F68H 1FIWA 1F0UA 1BTYA 1NZQH 5EXLA 2PHBA 2NU2E 3PLBA 5EXNA 1P04A 2QXHA 3VB3A 4A5TS 3TH2H 1AZ8A 3MTYA 4YOJA 4Q80A 3ENSB 3M7QA 2BQ7B 1P0SH 1O2IA 3SU5A 2HWLB 2V35A 3OSYA 3LKWA 1HAIH 2OTVA 4NWKA 4AYYB 4DJZB 4JZIA 1UTJA 5GIBA 2VIQA 1O3AA 1YPEH 1O5EH 1C1WH 7GCHG 3VB7A 2GDDA 1MD7A 2P94A 1KLIH 3A8AA 2Z9JA 2FYQA 4ISLA 2C8WB 3R3GB 1C5SA 1A2CH 2OQUA 1GBMA 2BDBA 1ETTH 1GMDG 1KSNA 2HNTC 2ZP0H 3RM2H 2VWNA 1O3CA 3QX5H 4A1VA 1TBQH 1S84A 4ZKSU 1NM6A 1TQ7B 3CS7A 3RXUA 1CVWH 3UPEA 2Y5FA 1SOTA 1TAWA 1BTXA 2A5IA 4K5ZA 1RIWB 4K3JA 4TYDA 1L4DA 4X8UH 4VGCB 4JZFH 1CGHA 1PQ7A 1T4VH 1KDQA 3ZZ6A 1FAXA 5EU8A 3P8OA 1VJ9U 3TK9A 1W7XH 3Q3KA 1XXDA 2ZNKH 1TX7A 1NRSH 1TLDA 3M7UA 2FX6A 5C2ZA 1O39A 3VFEA 2VVVA 3AAVA 2Z9IA 1YYY1 1UK3A 4Y71A 3RXJA 1F0TA 4MG3A 2VIDA 1HJAC 3P70B 1O3EA 4WF8A 3TK6A 4FVDA 3RXKA 3PWBA 1LVBA 4E06H 1E37B 4O9VA 2VIWA 1OWJA 4H42U 1DUAA 3SUDA 5A8ZA 3MWIU 3P8GA 4ZHLU 4RSPA 1A0HB 1MU6B 3LIWA 3DUXH 1O2NA 4XOJA 3GYLB 3M5OA 2PUQH 1MUEB 1DSTA 1TE0A 4YO9A 4AFUA 1G9IE 2VIVA 6GCHG 1NFUA 3A85A 3P92A 1DUEA 1MAYA 1C9PA 2KAIB 4RN6A 1EAXA 1C1MA 4BOHA 1DXPA 5FX6A 1NFYA 3V7TA 2XCFA 3GCHB 4TPIZ 1RTLA 3LDXH 5DP7A 4D7FA 4ZROA 2A1DB 4SGBE 1VCPA 2JH5D 1P2IA 4Y11E 2G00A 2EI7A 4IW4E 3UQVA 1F0RA 3V12A 2ZPRA 2ZI2H 2UWOA 1INCA 2ZEBA 5EW2H 1O2KA 2VNTA 3SNCA 3RMMH 1HYLA 2BDGA 1C5NH 2A4OA 4MNYA 5DK1A 4AGJA 2R2MB 2BD7A 1GHBF 4K8BA 1ZPCA 5F03A 2J34A 4YLUA 2PR3A 3UIRA 1J8AA 3LONA 1OYTH 1C2JA 4F4OC 3MU0A 1TRNA 2CV3A 5DP3A 2O8WA 5FPSA 6CHAC 3SV9A 2FTLE 2GZ7A 2A5KA 2FPZA 4ISIH 1GHAF 3A7ZA 1ZHRA 3SQHE 1SGTA 1O31A 1O3HA 4UFGH 3GY4A 4MNVA 5GDSH 4B2AA 3I29A 4Y7BA 3TH3H 1O2JA 1T8NA 2VGCC 1SOZA 4ZH8A 3NCLA 3ZZ7A 1SG8B 2TPIZ 2VVUA 3AW0A 2AMDA 2FLRH 1UVTH 2WUBA 1SGNE 1W14U 1EZXC 4Y10E 1PPEE 4X1SU 2FEQH 1O2YA 2HVXA 1W2KH 1P02A 1GMCF 1G36A 1QQ4A 4AX9H 1AO5A 3E8LA 4I33A 1YCPH 1MZDA 1YPLH 2R0LA 3M7TA 3A80A 1QJ1B 4OS2A 4X8VH 4FUJA 1P57B 1AE5A 3B8JA 1ANCA 4RKOB 1BOQA 1KXEA 5E0GA 5FX5A 4CBNA 1ELVA 2B8OH 3ZZAA 4WVPE 1GJ7B 2ZKSA 1CHOF 3RC6A 2G5NA 4X0WU 3LGVA 3BTEE 2GT8A 1C5WB 3S9AA 1DWBH 1WBGB 4ZXYH 1EJAA 3U9AH 4OGXA 4AZ2B 2FOGA 1E36B 1TWXB 1G3CA 2FDAA 1BMLA 4IBLH 3PLKA 3LGIA 1HAZB 1IQIA 2BVRH 2P93A 3LJJA 1QRZA 3AVZA 1ZSLA 2Q6DA 5C5OA 1YBWA 4ABEA 1F5KU 4KP0A 2ZHFH 1GJ9B 2ODPA 3RMLH 4BAQB 4BNRA 5EQRA 5A0BA 4RKJB 1FY4A 3SZNA 2RA3A 4DVAU 2ZZUH 1QCPA 2G52A 1YPHE 1S6FA 3E1XB 1JOUB 3E6PH 1FN8A 1W8BH 2CXVA 4UEHH 5EGMA 3ZZDA 2FOBA 2SGPE 1Z8JB 2GT7A 1Y3VA 4X1NU 3BEFB 2WUCA 1Y3XA 3TK5A 4HTCH 3VB6A 5AFYH 4AFQA 5ESBA 1O5GH 3MU5A 1ZLRA 3PMHB 1QQUA 2FESH 5FAHA 1QJ6B 2Z9LA 1LVMA 3FZDA 4YZUA 1C5OH 3LC5A 3BTFE 1BCUH 2FS9A 2VIOA 1O3FA 4OS5A 2OBQA 1GBFA 3TNSA 4ABBA 3ZZBA 1FMGA 1LDTT 3GOVB 3MNCA 1GMDF 4HI3A 5T6DA 3MYWA 2ZDKA 2KAIA 1NU9A 1ZHPA 2GV7A 2IN2A 4NFEA 1O2LA 1BA8B 2F9BH 3UNSA 4CH8B 4Y6DA 2HOBA 1SR5C 4CRAA 1Y59T 2JH6D 5LPEA 1XKBC 1LHGH 1FIZA 1HBTH 3A82A 1DT2A 1YC0A 2ZHDA 1HJ8A 1GCTC 3I78A 1TGBA 2QXIA 4WWYA 1GBJA 1HIAA 2WPIS 1CO7E 2O9QA 3K9XB 3KCGH 2FXRA 1AWFH 2SGDE 1E35B 3BIUH 2NU4E 2FWWA 4KGAA 4HGCA 1BIOA 4IC5A 1A5GH 1O5CB 1VGCB 1ZMLA 2BD3A 2CGAA 2OXSA 1V2MT 1DFPA 2FI5E 1D3QB 1C2DA 2Y82A 2I6QA 2BX3A 6LPRA 4TY6A 2BXUH 1P9UA 1LQEA 2O8LA 1YPKH 3QTVH 4NSVA 1JWTA 3RU4E 5J4SA 3A81A 4B1TA 3TNTA 4ZAEA 1OKXA 1H9HE 5C20A 3ZVDA 1ZMNA 1Y3YA 3NUMA 1S85A 1PPGE 4NFFA 3IITA 1BBRK 2WV4A 6GCHF 4B2BA 2ZG0H 1UHBB 3RXPA 2CN0H 2OC7A 1BB0B 2G4UA 4CHAB 3ITIA 4NIXA 3K6YA 2WPMS 3RXBA 3HKJB 4O3TA 3RXRA 2PWXA 2B5TB 4LZ1H 1PPFE 1LTOA 2ANWA 4NIWA 3P8NA 1Z7KA 2ZQ2A 1ZRKA 2C93B 5AHGH 1L0ZA 3SUFA 3EYDA 2ZGHA 1S6HA 1ZGIA 4JZ1A 1SGIB 2QY0B 1AD8H 2ZPSA 1HJ9A 2V6NA 5FBEA 1MCVA 3DD2H 3ZVCA 2BD8A 4UONA 2UWLA 2Y7ZA 2OC0A 2GVFA 4MPXA 1CBWB 5DPAA 1UTLM 3M5MA 3OY6U 1GI3A 4R0IA 2XBWA 1TGTA 2F9UA 3QZRA 4XBBA 3TLOA 1GJ8B 1QB1A 1FUJA 1O30A 1CA0B 1A0LA 3JZ2B 1EASA 1MKWK 7KMEH 3MFJA 1QFKH 1VITG 4A6LA 2H1UA 4DG4A 1QJ7B 2WPLS 1EUFA 1MMJN 3D49H 1VR1H 4TWYA 5PTPA 1V2QT 4NIYA 3F1SB 1MH0A 1UTNA 2PW8H 4JK6A 5T6FA 1D6WA 5A2MH 1CT4E 3U8RH 2WYJA 3SOSA 2R3YA 3LH3A 3BV9B 1ZSKA 4FUHA 2ZFPH 5T3HA 1P2QA 2Z94A 1O2SA 1IQGA 1ABIH 1C4Y2 4GSOA 4FUDA 2THFB 3ZVGA 1BRUP 3WY8A 5I25A 2FIRH 1TNJA 3MOCA 1CT0E 5FXLA 4FUBA 1LVYA 3VXEH 1W12U 1V2KT 3RXSA 3SHAH 1B7XB 1NY22 2XYAA 3LJOA 3LPRA 4NIVA 3DT0H 3KHVA 2P16A 4X8TH 3VEQB 3BEIB 1GJ4H 1IHTH 2BM2A 1MKXK 2VWLA 2PKSC 1HLTH 1C5YB 2ZGBH 1C5ZB 1T31A 1O32A 8KME2 2GKVE 2PGBB 2ASUB 2Z3DA 4Y8XA 2LNCA 4LZ4B 2ZO3H 1NRPH 4A92A 1JXPA 1EXFA 2ZF0H 2XC0A 4XBDA 3SU0A 3QGJA 1D3DB 5T6GA 5CMXH 3S69A 1BTZA 1LKAA 1XUIA 3RP2A 1SLXB 1XVOA 4I8HA
chains in the Genus database with same CATH superfamily
2H6MA 4X2WA 5EQSA 2JETB 4Z6AH 1ANBA 1G2MA 1Q2WA 2QV1A 1FX0B 2XBYA 3GICB 3F3BA 3PV4A 5DP6A 4GPGA 5DKMA 1O3KA 3GCNA 4NSYA 1HAOH 2GMTC 1MBQA 1HDTH 2BLQA 5FCRA 6ESTA 3C27B 3P17H 3S7KB 3QO6A 3UREA 5GWZA 3S9CA 1ZPBA 4WXVA 2FI4E 4XD7D 5EODA 1EB2A 1TQ0B 2KCPA 3KQBA 3K2UA 3RXAA 2EQNA 4MVNA 5HIZA 4ZKNU 1HCGA 5EOKA 3L6PA 4FU8A 1HAXB 3M3VA 1V2VT 4YESB 3BTWE 1H9IE 3FO8D 3IG6B 1TB6H 3GDSA 4FU7A 3RXHA 3QLPH 3H7OA 1LKBA 1WAYB 3RXCA 1BDAA 3EGKH 1C5QA 2K8IA 1XM1A 3ZV8A 2CHAB 1O2ZA 2FO9A 2IPQX 3RLYH 2Y5HA 4BTIB 2F9OA 2XXLA 5HMAA 1V2TT 3ZV9A 1KXCA 2SNVA 1ARBA 1ELCA 3PTNA 1GBTA 1ELGA 1O3MA 1THRH 1V2RT 2FOEA 4B73A 1O5DH 2ZFQH 4CRDA 2C8YB 1SGDE 3WWBA 2GJGA 1O5BB 1P3EA 5EXMA 5KEDA 1DDJA 1SC8U 4NGAH 3SV7A 3TGIE 1GGDB 1SSXA 2P8OB 1DWEH 4KTSA 1TBRH 1UHBA 4MNWA 1ACBE 1IQMA 1O2PA 1SGFG 2W7UA 4INKA 1DXWA 1ABJH 5EPYA 1MQ5A 1TYNA 1ARCA 2ZCHP 4YT6H 1B0FA 2BZAA 1F2SE 1GI0A 2FOFA 2H5DA 1UTKA 1GI8B 5GXPA 4K1EA 5FL7D 2J95A 1MTUA 1C9TA 1GMHG 1MTNB 3OX7U 1C1RA 1H1BA 3KEEA 3T29A 1C1NA 3PLPA 2FS8A 1O2GH 5DSFA 2ZTZA 4E7RG 1EAWA 2GTBA 5SGAE 1TPPA 2FZZA 1AU8A 1GG6C 1GI7B 1LCYA 1HJAB 1AKSB 3S9BA 2J2UA 2FLBH 2BDAA 4OGYA 3A7XA 1GL0E 1HGTH 2P3FH 1QA7A 2WPDD 1MZAA 1HXEH 5FBIA 1YLCA 1FPHH 1KYNA 3RXEA 2Y6TA 3FP6E 4HFPB 1L2EA 2ZHWH 1FY8E 1TOCB 4BAKB 1QRWA 2YOLA 3D65E 3Q00A 5HIYA 2VWMA 1P03A 2KCAA 1AFEH 1BJUA 2GP9B 1QBNA 5DP8A 2ZGXH 4GVUA 3SU3A 1N8OB 3TVJB 5DJ7A 1GBHA 1J16A 1DM4B 2J38A 1ANEA 4FOUC 2VWOA 1C5LH 1CT2E 4ABHA 3SU4A 3GISB 4UFFH 1KY9A 4RI0A 2PTNA 2ZWLH 1GBKA 3E0PB 2HLDD 3URCA 1UTPA 3UFAA 5A0CA 4Q7XA 2XC5A 3V13A 4IGDA 1A1RA 1FAKH 3BG4B 2AGIX 3LGUA 3SGQE 4CRBA 2ZU2A 2XNIA 4FU9A 2EY4C 3OTJE 1BMAA 1TNKA 1DLEA 1EOLA 2WINI 2YMSB 4ABFA 3BTKE 5CHAC 1BITA 4Z1MD 1SPJA 1UCYH 2BHGA 1T32A 2EEKA 5AF9H 5G4BA 2KX4A 1JIRA 1CQQA 2Z6BD 4BXWA 3ZZ8A 2F83A 1AI8H 3KF2A 3L33A 2QGRA 2ZFRH 3LU9B 3A84A 3AASA 3KN2A 3DFLA 1VITF 4Q4LA 2WPJS 1EATA 4GLYA 5TJXA 1NBMD 4ISOA 1QY6A 2K0QA 4BTTB 1RIWC 2Q6FA 1FZZA 1SLVB 1S82A 2QE7D 1P2NA 4VGCC 4IN2A 1AN1E 1BTHH 3ZZ4A 1ZYOA 1XKAC 2BVSH 1ETRH 2CMYA 3NPSA 1QB9A 4KTUA 3PMJA 1HIAB 3KQCA 3SI4H 2GCTB 1NFWA 3QZQA 3URDA 1P01A 4AYVB 2PTCE 2W5EA 4ZMAH 3SHCH 4X1RU 4UFEH 1T8MA 1CHGA 1YLNA 1WQVH 3MO6A 5E2PA 1N6YA 2AMQA 1HNEE 3GY8A 4A1XA 1D6RA 5GCHF 1ETSH 3GCTG 2WV5A 1W13U 1OX1A 2GX4A 8LPRA 1EPTB 1UVOA 1PYTD 2V7QD 2OD3B 1EFRD 1SLWB 1O2HA 1FY1A 4LK4A 1SGEE 4U01A 2A2QH 4B75A 2AEIH 2TGPZ 3RM0H 3ZZCA 1BRAA 2PSXA 1DPOA 2ALPA 1YY3A 2WPHS 1SHHB 4ZXXH 3B9FH 1AQ7A 1KXFA 3GCOA 4DURA 3A7YA 1BTWA 2Z3EA 3F9HA 3W94A 3VXFH 4KTCA 1G32B 1KTSB 4GCHG 5HM2A 1BZXE 3ATLA 4JZDH 1AGJA 1HAGE 2C4FH 2VINA 1H8IH 3DA9B 2G51A 3GCHC 3M35A 4XSKU 1EOJA 4AG1A 2FOHA 1AB9B 2HLCA 1V2ST 2FYRA 1NROH 2FOAA 1XUHA 2AHME 2BDCA 1V6DA 3ODDA 1OPHB 1JBUH 1TGCA 3OTPA 1O33A 2ANKH 5DP5A 4X2XA 3ESTA 2SGEE 3UWJH 1GI2A 1UTOA 1AKSA 2A2XH 2H9EH 4AFZA 3HGPA 3F9FA 1A7SA 1J15A 2BB4A 3U1IB 4NZLA 1P11E 2Y81A 3BTDE 1ID5H 3DSOA 3N7OA 1YPGH 2AMPA 4ZHMU 1XUKA 1TNHA 1BBRH 4JYTA 1NC6A 5F8TA 2FI3E 1TGNA 4CRCA 1NO9H 1GJ5H 7LPRA 4IC6A 5L6NH 2IJD1 1ZJDA 2BLOA 1LHDH 2A4GA 1O3JA 1EZQA 5C1YA 3JZ1B 5B6OA 2BYAX 1FPCH 4HZHA 5EIYA 2OUAA 1H9LB 4K1SA 3U69H 3M3TA 3ZYDA 2M5TA 1ESBA 1P2OA 1GBCA 2JJ2D 4E05H 2H9HA 1SGRE 1H8DH 1QRXA 1TPOA 3NWUA 3EA9A 1HXFH 1RGQA 2V3HH 1BTPA 1K1NA 3RXVA 1YWUA 4Y0ZE 3ZVEA 4Q2KA 4QT8C 4GHTA 1GWAA 2W3KA 3QK1A 1MTSA 1LPGB 2WPKS 4WH6A 3ZVAA 2BY7X 1Y3UA 4I8KA 1UMAH 5EPNA 2TGDA 2PSYA 2XTTB 1SLUB 2RCEA 5A8YA 7GCHF 1HB0B 1QNJA 2PLXA 1MBMA 2OBOA 3F6UH 2P3UB 3LC3A 3BG8A 1V2UT 1PQ5A 1WTHD 2VH0A 1SGFA 1GI6A 1Z8RA 3FP7E 4MPWA 3FZZA 3Q77A 2FP7B 2Y7XA 3STJA 5L30H 1G37A 1C2MA 4FUCA 4Z0KA 2ZDVH 1C2EA 1ZTKA 4ZHAA 1G3EA 2G8TA 2A45B 3D23A 1V2PT 2L74A 1C1VH 3KQDA 4YLQH 4D8NA 2IJOB 1LHEH 4B6EA 4SGAE 2ULLA 1OS8A 3H7TA 1A0JA 3ZVFA 1EX3A 5LGOA 3GDVA 2YMSD 2ZDNA 1K21H 4NG9H 1D3PB 1QL9A 3A88A 3GY7A 5HKKD 1QR3E 1MKXH 1P2MA 3GS9A 3RLWH 1ELAA 2BTCE 1AY6H 1O2RA 2WSSD 4YOIA 8ESTE 3TU7H 1DWCH 3LGYA 3ZZ9A 1C2GA 3BTHE 1N1LA 3OEHD 1G3DA 2RFKC 5HYOA 2QYIA 1O3NA 4DT7B 5F8XA 4Y76A 1ANDA 4ABJA 2VIPA 2BDYA 1K2I1 3LH1A 2A32A 2W6ID 1GVZA 5LPRA 3HGNA 5J4QA 1ZPZA 4KKDA 4CH2B 3A7TA 2OC8A 1EPTA 4K8YA 3SGAE 1C2HA 1C5XB 1RD3B 2J94A 3RXFA 5JPMH 1MAXA 3DCLA 1YCPK 4DCDA 1UJ1A 1NESE 5AVDA 1GHYH 1GHXH 2UUYA 5L2YH 2VBCA 3C1KA 2H5CA 1BHXB 2SGQE 1W0YH 1K28D 5JBBS 1ELDE 1SVPA 3BF6H 2NU0E 1GVKB 1TOMH 2BY5X 1SQTA 1PPHE 1QBVH 1XMNB 3BSQA 4WMFA 1V2JT 1G2LA 1LMWB 1C5PA 1EZSC 4BXSA 5C1UA 1O34A 3TJNA 3S7HB 9ESTA 1V2OT 1N6XA 3PO1B 4MLFB 4R8TB 3CENA 1JRTA 3PB1E 4FUGA 2K1QA 4ABIA 2JKHA 4AOQA 1GPZA 4AC9A 5TCCA 3ZVBA 3MU8A 1ELFA 3ATMA 3MH5A 3A87A 3A83A 1O37A 2ZPQA 4H4FA 3RXLA 1GHZA 1NRQH 1OYQA 3A8CA 4BANB 1Y5UT 1IQNA 5A0AE 3CNRA 5K0HA 1VGCC 1WQSA 3OY5U 3SNBA 1RRKA 2WYGA 2XRCA 1O35A 1PPBH 2SFAA 1W0ZU 3VGCB 3MMGA 2TRMA 2D1JA 4WH8A 1SL3A 1SB1H 1ZRBA 4AFSA 1C1QA 4D7GA 2CK3D 3QTOH 2ZTYA 3RMNH 2ZHEH 3O8CA 1K1IA 5JB8S 3BEUA 2GD4B 2ANYA 1FY5A 3HKIB 4X6NA 4KELA 2UWPA 3U98H 1AZZA 2D26C 5EQQA 3SZEA 4XRNA 2R3UA 1AVWA 3SNAA 1O38A 2ZFTA 2BD5A 1AWHB 3EA8A 3SYJA 3UOUA 2AGEX 4DW2U 2J98A 3PTBA 5EW1H 4A1TA 4BTUB 4GCHF 1BTUA 1C5VA 1YCPM 5T1VA 4GUXA 1P12E 3F2HA 2GDEH 1QL7A 1YPHC 3G01A 1U6QA 4CHAC 4UDWH 5K7RA 1L1GA 3MNSA 4Y79A 3EE0B 2DE8A 1O3LA 5A09A 2STBE 1QBOA 2D2DA 3EA7A 2GV6A 1GDUA 1O2WA 3P95A 2A4RA 4MPUA 1NTPA 5HM9A 1HFDA 2PKAB 3ATWA 4ESTE 4GAWA 2BDHA 2JH0D 2BXTH 4DGJA 1O3BA 1T8OA 4ISNA 2DE9A 1TONA 1YF4A 3PWCA 1SQAA 1JMOH 4FXGH 1GHAG 1CBWC 3CP7A 3N99A 5E8EH 1EB1H 2A7JA 1THSH 1DOJA 3RU4T 1F7ZA 1CA0C 3SJOA 4JMYA 3OYPA 2OCVB 2J4IA 4ABGA 2ESTE 1EAUA 1O2UA 3SUEA 1HAHH 1S83A 4NA9H 4X2VA 1BRCE 1C1PA 1O3GA 1T7CA 5ETXA 3SNEA 3M3SA 4YM9A 5JYIA 3UQOA 2BY9X 3RUOA 1P05A 4Y0YE 1AFQC 2C8XB 2SGFE 2KM0A 3FKSD 2ZA5A 4LXBH 2ZECA 4M7GA 2TBSA 3SV2H 5ESTE 3TJOA 3UWIA 2SGAA 2Z7FE 3MO3A 1FV9A 4ABDA 3SJ9A 3KGPA 3OU0A 1D4PB 1BHXF 1VCQA 5KGOA 1DSUA 2J97A 2F91A 1FJSA 3SJ8A 3A86A 1GJDB 2ANMH 3GDUA 3K65B 1AUTC 3QDZB 1MTVA 2QIQA 2BX4A 2AGGX 5DP9A 5C5NA 5EJZA 1GBIA 3MH6A 1TIOA 2BQ6B 1IQHA 1O2VA 3BTTE 4INHA 3HATH 4ZCNA 3BN9A 1TGSZ 2GZ8A 1Q31A 1QGFA 1G3BA 4XBCA 4B74A 2GGVB 2CF9H 1FDPA 5GJ4B 1RXPA 5GPIB 1TMBH 2GZ9A 4UE7H 3WWFA 3H5CB 1P2KA 1BUIA 1GDQA 2BD4A 1IQFA 2IPHA 1K1MA 2JETC 4TPYA 3NKKA 1K1JA 2V3MA 1OOKB 2AS9A 3HK6B 4IS5A 3UAIC 3MQKC 2V3OH 5F6MA 1GBBA 2BVXH 5JB9S 1GL1A 1ZR0A 2ZHQH 1RTKA 1GJCB 1QHRB 1TNIA 1E34B 1IQEA 1H8ED 2OINA 3BIVH 1Z1IA 3GY2A 1RTFB 1PYTC 1UO6A 1GBAA 1ZSJA 1PPZA 1ZTJA 1IQJA 1EKBB 3Q76A 2FMJA 3SUGA 3ZYEA 1LPZB 1UTMA 2C8ZB 2H9TH 3NK8A 4LOYH 1DVAH 2R9PA 2ZDAH 1A3BH 1TRYA 2FM2A 2J9NA 1Y5BT 1MQ6A 1HRTH 1EZUC 3KL6A 3O8DA 5C3NA 4I32A 3PROA 1C1UH 1C1TA 2O8MA 1ORFA 3UNRA 2ZU3A 1UCYE 3RXQA 1TABE 4A7IB 1GJBB 3VB4A 1OP2A 3SU6A 3SNDA 1L4ZA 1NRNH 2XWAA 1L1NA 2CHAC 5CHAB 5L2ZH 5FHTA 1TFXA 3VB5A 1F92A 3FAOA 1NPMA 2P95A 1UVSH 3M5LA 1P3CA 2ZU4A 3NRLA 4AORA 4E7NA 1EQ9A 4CREA 1SKYE 3PRBA 2UUFB 1TRMA 1OP0A 4Q63A 1QIXB 5EG4A 1ZZZA 3Q3XA 1GGDC 2P8OC 2BZ6H 1Y5AT 3V0XA 3I77A 3LGWA 4RT1A 1PJPA 1OWDA 8GCHG 1ZGVA 1FXYA 3RXMA 2Q1JA 1NT1A 4JZEH 1F5LA 2H2ZA 4X1QU 4WXIA 1RS0A 3SV8A 1CGJE 2PKAA 5JBCS 2OC1A 4Q7YA 1MTNC 1DY8A 1Z6EA 4DIHH 2LELA 1SQRA 3KQEA 3A7VA 4MPVA 3RXTA 3SI3H 2LPRA 2DUCA 6CHAB 1HAYB 1ELTA 1OWEA 1SMFE 3SJIA 3KIDU 1JIMA 5JDUB 1V2NT 1T4UH 3PM3A 4UD9H 1MD8A 1NU7B 1SBWA 4AB8A 2QN5T 1M9UA 1GBEA 4TT3D 4Y7AA 1O5FH 4CR9A 3B23B 2VGCB 3ZZ5A 1GHWH 3UOPA 1FQ3A 1IAUA 4DIIH 5HXFA 1GDNA 2NU3E 2A31A 1ELEE 1SQOA 4F48B 1E1QD 4J2YB 3H09A 1W10U 1IQLA 2HGTH 3FFGA 1W11U 3RU4D 2Q6GA 2AIQA 4IMQA 1OHHD 1YLDA 4MTBA 2OQ5A 5DGJA 3M5NA 4Y8YA 1WOFA 3GYMA 3RXDA 2HNTF 1HPGA 1TPAE 1V3XA 3NZIA 1N8OC 3V3MA 1Z1JA 1PQAA 1DLKB 1TMTH 1GBDA 1BMMH 4I7YH 1NN6A 3F9EA 1J14A 3SGBE 1NS3A 1C5UA 2G4TA 4ISHH 1K1PA 1ESAA 3P6ZB 1W0JD 4BAMB 4AN7A 3DFJA 1L1JA 2EI8A 1P9SA 3GY5A 1BBRE 1E38B 2Z9GA 2ZTXA 1FI8A 2QXGA 3U1JB 3MH4A 3ATIA 2BY6X 1DS2E 3BG4C 2C3SA 3UY9A 1XUGA 2YMSC 4CRGA 2EI6A 3QN7A 2OLGA 5A8XA 3TH4H 1XXFA 4NA8A 4INLA 4F49A 5BPEA 1W3CA 1GHVH 1YM0A 7ESTE 2PV9B 2VH6A 4IN1A 3BTME 1IHSH 3M37A 3PMAB 1O2OA 5JBTA 2G5VA 1Z8GA 2XWBI 3NXPA 4U32A 4XFQA 3E0NB 5AFZH 1PFXC 1TMUH 3M36A 1HAPH 4X6MA 1GCDA 4OS6A 3PV2A 1UW7A 2STAE 1FONA 2VB0A 2I6SA 3U28C 1UVUH 2GCHG 4O97A 2PGQB 2WHXA 4FUEA 1C2FA 4K69A 3SV6A 1WTGH 2GCTC 3FOAA 1QTFA 2YNAA 3D62A 1F0SA 2SNWA 4ASHA 2BY8X 2QAAA 5CE1A 3O8RA 2ZQ1A 1LO6A 3E16B 1YPMH 1TBZH 3A8DA 4WMEA 4X1PU 2XCNA 4X2YA 2BOKA 5CHBA 1FLEE 3T62A 2G81E 1BMNH 2B7DH 3R0FA 2XBVA 1TNGA 1TX8A 3A89A 1C2IA 4ACBA 1EPTC 1C1SA 3RDZA 3T28A 1OWHA 1G30B 1WV7H 5F53A 1WSSH 2W26A 3MU1A 1S5SA 5DG6A 1Z6JH 2ODYB 4AGKA 3U8TH 1CSOE 2Y5GA 1HAVB 1AVGH 1KLTA 1UK4A 3SBKA 4JYVH 5C67A 1ZJKA 1F5RA 2P3TB 5TCAA 1YGCH 4UFDH 4CR5A 2J98B 4OS4A 4Y8ZA 1DITH 2ZC9H 1Y3WA 3A7WA 1AE8H 1GCTB 4U30A 4BAHB 2WV9A 1UCYK 2UUJB 5F8ZA 4YOGA 3UUZA 2HALA 1AHTH 1AB9C 1C5RA 1CA8B 4ZKOU 4I8JA 1GMHF 1MKWH 1XVMA 1ESTA 1MABB 4AG2A 3FANA 3SU1A 4NZQA 2CJIA 1A61H 1MU8B 3O8BA 4JK5A 3UNQA 1O0DH 1PPCE 3SU2A 2F9NA 1KLJH 4O03A 1KTTB 1KIGH 3RXOA 1SI5H 4X6OA 2A0QB 2QC2A 4FUFA 1V2LT 1O2QA 1K22H 2AFQB 5E0HA 4I8LA 1SGQE 1WU1A 1XX9A 3STIA 2QF3A 2O8TA 2QF0A 1Z8IB 2BDIA 2RA0A 2RDLA 1SHYA 2FOCA 1A4WH 3LT3A 1LHFH 2D8WA 1O2TA 4OS7A 4H6SB 4BAOB 2NU1E 3AW1A 4B71A 1YKTA 1QB6A 4XDEA 3QWCH 1C4V2 1UVPA 3BTQE 2RDEA 4MDSA 4D76A 1C1OA 1MTWA 2W3IA 2EC9H 1OWKA 2ZFSA 3KYFA 3SJKA 1W7GH 1NRRH 3RMOH 1J17T 1SGCA 1O3PB 1K9OE 2YNBA 8GCHF 1Z71A 3TITA 4THNH 1AUJA 4IMZA 1C5TA 3MNXA 4WY3A 2JIZD 1UTQA 2R2WU 2XW9A 1A5HA 3HK3B 1JRSA 1TA6A 1SGPE 2CF8H 2XC4A 4YTAA 2FODA 4B76A 1QL8A 3BTGE 4K2YA 2TIOA 3T27A 1SFIA 1EP6A 4X8SH 2ZU1A 2G55A 1S0QA 1OP8A 2ZDLA 3CS0A 1WCZA 2AIPA 4JYUH 4XE4A 3T2NA 2ILNA 1TALA 2J92A 1B0EA 2F9PA 1KXAA 3GY6A 5FPTA 1QURH 1CU1A 4CBOA 1SGYE 3AAUA 5BRRE 2KR7A 2AERH 1CE5A 3T5FH 1EP5A 1OWIA 3TPIZ 1P06A 5LPFA 5C1XA 1YP9A 4NA7A 1T8LA 3SO3A 2BOHB 2QCYA 3A8BA 1BQYA 1GI4A 1WXRA 3EDXB 3M61U 1GJAB 2AH4X 1Q3XA 1IOEA 1V2WT 3IWMA 2BQWB 2F3CE 1LHCH 3MU4A 3SQEE 3OE7D 4I86A 3VPKA 2A4QA 3ZZ3A 2XNDD 5IDKA 1D9IA 1O2XA 3LOXA 4TWWA 2Z9KA 5IYTA 2OP9A 3MNBA 5FCKA 1K0HA 1C2LA 2O8UA 1DWDH 1RFNA 1WYKA 1BJVA 1AVXA 3FVFB 1H8HD 1S0RA 3UR6A 4D9RA 1C4U2 2FX4A 1RJXB 1GBLA 2ALVA 2PKSB 3RXIA 2BD9A 9LPRA 1LVOA 1K1LA 3MO9A 3PYHA 1A46H 2F4LA 3RC4A 3RXGA 1C2KA 3ELAH 3PMBB 1ZMJA 5E2OA 1TX6A 2F9VA 1GJ6A 1DX5M 2HPQH 3GCTF 2BLWA 1O2MA 3SORA 3EQ0H 2HNTE 1SFQB 2RG3A 3E91A 4K60A 4NWLA 3RC5A 2QA9E 1XUFA 1OXGA 2UUKB 3LGTA 1AMHA 5H4IB 1BRBE 3QGNB 1TNLA 2ZIQH 4HG6A 4X6PA 1NFXA 1HAVA 4YXWD 2BMGB 1IQKA 1C5MD 1PQ8A 5ABWA 2NWNA 2VU8E 3P8FA 2GMTB 4JCNA 1HV7A 1LPKB 1E0FD 1O3IA 1BT7A 1EAIA 4AB9A 2C90B 1QA0A 1AFQB 2AYWA 4DOQA 4I31A 3GY3A 1KDQB 3HPTB 2ZFFH 2QXJA 4YT7H 1ZTLA 1VKYA 1O3OA 1VJAU 2HRVA 3Q3YA 1Y8TA 4WMDA 3MHWU 1GI5A 1GHBG 1UK2A 3U8OH 3PO1C 1CGIE 4GHQA 5LH8A 5CDFE 2GCHF 1KXBA 5HGGA 1FN6A 3ZIAD 2A7CA 1OSSA 2IOTA 5JBAS 1GVLA 3ODFA 5GCHG 1EJMA 1MCTA 4M9FA 4FUIA 1VITH 2VVCA 1THPB 5DP4A 3K6ZA 1A5IA 3ATKA 3UTUH 2XBXA 1HUTH 3QUMP 3SN8A 1O5AB 2EA3A 2B9LA 1VCWA 1LQDB 3UR9A 1A3EH 3VGCC 4J1YA 2M2AA 5I46H 3MI4A 3TIUA 5FPYA 5DO4H 1DICA 1X7AC 2A5AA 3FP8E 2B0FA 4TY7A 4PROA 1P2JA 1FY3A 3S0NA 4FETA 2JJ1D 2HPPH 1WUNH 3TJVA 4P00A 2TGAA 1P8VC 3N7DA 1GMCG 2VJ1A 1ZOMA 1XUJA 1K1OA 2BD2A 2FOMB 1TPSA 4OS1A 3W95A 3E3TA 4CRFA 4DY7B 1YPJH 1DANH 1O3DA 4U2WA 4D9QA 1FNIA 3F9GA 2PUXB 4H6TA 2FTMA 2ZCLP 5GNDA 1O36A 1VZQH 4ZUHA 4FVBA 2A7HA 2TGTA 4NCYA 1S81A 3SW2B 5IK2D 1EJNA 2P59A 3L3TA 1GG6B 1KXDA 4B2CA 1GI1A 4RT0A 2ZU5A 5E0JA 1CHOG 4Q7ZA 2ODQA 2V0BA 1P10A 3E90B 3TGKE 2ZGCA 3MH7A 4I8GA 1H4WA 1ZHMA 1P09A 1DE7H 2ZDMA 3T25A 2PFEA 2R0KA 3T26A 2Z3CA 1AIXH 1GI9B 2Y80A 3EAJA 2W7SA 1D3TB 2BLVA 4ZKRU 1J9CH 4ABAA 1DY9A 3DHKH 3TGJE 1B5GH 3KNXA 1TA2A 3PV5A 3TJUA 5C0TA 4K1TA 2ZCKP 3F2FA 1ELBA 4MNXA 3F2GA 4MQAA 4O3UA 4WJG2 2ZGJA 3F68H 5C94A 1FIWA 1F0UA 1BTYA 1NZQH 5EXLA 2PHBA 2NU2E 3PLBA 5EXNA 1P04A 2QXHA 3VB3A 2L6OA 4A5TS 3TH2H 1AZ8A 3MTYA 4YOJA 4Q80A 3ENSB 3M7QA 2BQ7B 3DSGA 1P0SH 1O2IA 3SU5A 2HWLB 2V35A 3OSYA 3LKWA 1HAIH 2OTVA 4NWKA 3FN8A 4AYYB 4DJZB 5DN6D 4JZIA 1UTJA 5GIBA 2VIQA 1O3AA 1YPEH 1O5EH 1C1WH 7GCHG 3VB7A 2GDDA 1MD7A 2P94A 1KLIH 3A8AA 2Z9JA 2FYQA 4ISLA 2C8WB 3R3GB 1C5SA 1A2CH 2OQUA 1GBMA 2BDBA 1ETTH 1GMDG 1KSNA 2HNTC 2ZP0H 3RM2H 2F43B 2VWNA 1O3CA 3QX5H 4A1VA 1TBQH 1S84A 4ZKSU 1NM6A 1TQ7B 3CS7A 3RXUA 1CVWH 3UPEA 2Y5FA 2J5UA 1SOTA 1TAWA 1BTXA 2A5IA 4K5ZA 1RIWB 4K3JA 4TYDA 1L4DA 3WW7A 4X8UH 4VGCB 4JZFH 1CGHA 1PQ7A 1T4VH 1KDQA 2W6JD 3ZZ6A 4F55A 1FAXA 5EU8A 3P8OA 1VJ9U 3KQ5A 3TK9A 1W7XH 3Q3KA 1XXDA 2ZNKH 1TX7A 1NRSH 1TLDA 3M7UA 2KCYA 2FX6A 5C2ZA 1O39A 3VFEA 2VVVA 3AAVA 2Z9IA 1YYY1 1UK3A 4Y71A 3RXJA 1F0TA 4MG3A 2VIDA 1HJAC 3P70B 1O3EA 4WF8A 3TK6A 4FVDA 3RXKA 3PWBA 1LVBA 4E06H 1E37B 4O9VA 2VIWA 1OWJA 4H42U 1DUAA 3SUDA 5A8ZA 3MWIU 3P8GA 4ZHLU 4RSPA 1A0HB 1MU6B 3LIWA 3F0OA 3DUXH 1O2NA 4XOJA 3GYLB 3M5OA 2PUQH 1MUEB 1DSTA 1TE0A 4YO9A 4AFUA 1G9IE 2VIVA 6GCHG 1NFUA 3A85A 3P92A 3UB0A 1DUEA 1MAYA 1C9PA 2KAIB 4RN6A 1EAXA 1C1MA 4BOHA 1DXPA 5FX6A 1NFYA 3V7TA 2XCFA 3GCHB 4TPIZ 1RTLA 3LDXH 5DP7A 4D7FA 4ZROA 2A1DB 4SGBE 1VCPA 2JH5D 1P2IA 4Y11E 2G00A 2EI7A 4IW4E 3UQVA 1F0RA 3V12A 2ZPRA 2ZI2H 3N7EA 2UWOA 1INCA 2ZEBA 5EW2H 1O2KA 2VNTA 3SNCA 3RMMH 1HYLA 2BDGA 1C5NH 2A4OA 4MNYA 5DK1A 4AGJA 2R2MB 2BD7A 1GHBF 4K8BA 1ZPCA 4P02A 2J34A 5F03A 4YLUA 2PR3A 3UIRA 1J8AA 3LONA 1OYTH 1C2JA 4F4OC 3MU0A 1TRNA 2CV3A 5DP3A 2O8WA 5FPSA 6CHAC 3SV9A 2FTLE 2GZ7A 2A5KA 4ACAA 2FPZA 4ISIH 1GHAF 3A7ZA 1ZHRA 3SQHE 1SGTA 1O31A 1O3HA 4UFGH 3GY4A 4MNVA 5GDSH 4B2AA 3I29A 4Y7BA 3TH3H 1O2JA 1T8NA 2VGCC 1SOZA 2XOKD 4ZH8A 3NCLA 3ZZ7A 1SG8B 2TPIZ 1QZ8A 2VVUA 3AW0A 2AMDA 2FLRH 1UVTH 2WUBA 4OM9A 1SGNE 1W14U 1EZXC 4Y10E 1PPEE 3W1EA 4X1SU 2FEQH 1O2YA 5KECA 2HVXA 2PP6A 1W2KH 1P02A 1GMCF 1G36A 1QQ4A 4AX9H 1AO5A 3E8LA 4I33A 1YCPH 1MZDA 1YPLH 2R0LA 3M7TA 3A80A 1QJ1B 4OS2A 4X8VH 4FUJA 1P57B 1AE5A 3DSPA 3B8JA 1ANCA 4RKOB 1BOQA 1KXEA 5E0GA 5FX5A 4CBNA 1ELVA 2B8OH 3ZZAA 2LP6A 4WVPE 1KMHB 1GJ7B 2ZKSA 2HVYB 1CHOF 3RC6A 4ASUD 2G5NA 4X0WU 3LGVA 3BTEE 2GT8A 1C5WB 3S9AA 1DWBH 1WBGB 1S6LA 4ZXYH 1EJAA 3U9AH 4OGXA 4AZ2B 2FOGA 3EE7A 1E36B 1TWXB 1WDIA 1G3CA 2FDAA 1BMLA 4IBLH 3PLKA 3LGIA 1HAZB 2WZQA 1IQIA 2BVRH 2P93A 3LJJA 1QRZA 3AVZA 1ZSLA 2Q6DA 5C5OA 1YBWA 4ABEA 1F5KU 4KP0A 2ZHFH 1GJ9B 2ODPA 3RMLH 4BAQB 4BNRA 5EQRA 5A0BA 4RKJB 1FY4A 3SZNA 2RA3A 4DVAU 2ZZUH 1QCPA 2G52A 1YPHE 1S6FA 3E1XB 1JOUB 3E6PH 1FN8A 1W8BH 2CXVA 4UEHH 5EGMA 3ZZDA 2FOBA 2SGPE 1Z8JB 2GT7A 1Y3VA 4X1NU 3BEFB 2WUCA 1Y3XA 3TK5A 4HTCH 5B6LA 3VB6A 5AFYH 4AFQA 5ESBA 2JDID 1O5GH 3MU5A 1ZLRA 3PMHB 1QQUA 2FESH 5FAHA 1QJ6B 2Z9LA 1LVMA 3FZDA 4YZUA 1C5OH 3LC5A 2KCOA 3BTFE 1BCUH 2FS9A 2VIOA 1O3FA 4OS5A 2OBQA 1GBFA 3TNSA 4ABBA 3KYGA 3ZZBA 2KFWA 1BMFD 1COWD 1FMGA 1LDTT 3GOVB 3MNCA 1GMDF 4HI3A 5T6DA 3MYWA 2ZDKA 2KAIA 1NU9A 1ZHPA 2GV7A 2IN2A 4NFEA 1O2LA 1BA8B 2F9BH 3UNSA 4CH8B 4Y6DA 2HOBA 1SR5C 1E79D 4CRAA 1Y59T 2JH6D 5LPEA 5C0UA 1XKBC 1LHGH 1FIZA 2KZ4A 1HBTH 3A82A 1DT2A 1YC0A 3OEED 2ZHDA 1HJ8A 1GCTC 3F0PA 3I78A 1TGBA 2QXIA 4WWYA 1GBJA 1HIAA 2WPIS 1CO7E 2O9QA 3K9XB 3KCGH 2FXRA 1AWFH 2SGDE 1E35B 1W0KD 3BIUH 2NU4E 2FWWA 4KGAA 4HGCA 1BIOA 4IC5A 1A5GH 1O5CB 1VGCB 1ZMLA 2BD3A 2CGAA 2OXSA 1NBME 1V2MT 1DFPA 2FI5E 1D3QB 1C2DA 2Y82A 2I6QA 2BX3A 5EJLA 6LPRA 4TY6A 2BXUH 1P9UA 1LQEA 2O8LA 1YPKH 3QTVH 4NSVA 1JWTA 3RU4E 5EJ1A 5J4SA 3A81A 4B1TA 3TNTA 4ZAEA 1OKXA 1H9HE 5C20A 3ZVDA 1ZMNA 1Y3YA 3NUMA 1S85A 1PPGE 4NFFA 3IITA 1BBRK 2WV4A 6GCHF 4B2BA 2ZG0H 1UHBB 3RXPA 2CN0H 2OC7A 1BB0B 2G4UA 4CHAB 3ITIA 4NIXA 3K6YA 2WPMS 3RXBA 3HKJB 4O3TA 3RXRA 2PWXA 2B5TB 4LZ1H 1PPFE 1LTOA 2ANWA 4NIWA 3P8NA 1Z7KA 2ZQ2A 1ZRKA 2C93B 5AHGH 3OFND 1L0ZA 3SUFA 3EYDA 3VG8A 2ZGHA 1S6HA 1ZGIA 4JZ1A 1SGIB 2QY0B 1AD8H 1E1RD 2ZPSA 1HJ9A 2V6NA 5FBEA 1MCVA 3OAAD 3DD2H 3ZVCA 2BD8A 4UONA 2UWLA 2Y7ZA 2OC0A 2GVFA 4MPXA 1CBWB 4DT4A 5DPAA 1UTLM 3M5MA 3OY6U 1GI3A 4R0IA 2XBWA 1TGTA 2F9UA 3QZRA 4XBBA 3TLOA 1GJ8B 1QB1A 1FUJA 1O30A 1CA0B 1A0LA 3JZ2B 1EASA 1MKWK 7KMEH 3MFJA 1QFKH 1VITG 4TSFD 2H1UA 4A6LA 1QJ7B 2WPLS 4DG4A 3PRDA 1EUFA 1MMJN 3D49H 1VR1H 4TWYA 5PTPA 1V2QT 4NIYA 3F1SB 1MH0A 1UTNA 2PW8H 4JK6A 5T6FA 1D6WA 5A2MH 1CT4E 3U8RH 3AK5A 2WYJA 3SOSA 2R3YA 3LH3A 3BV9B 1ZSKA 4FUHA 2ZFPH 2QF4A 5T3HA 1P2QA 2Z94A 1O2SA 1IQGA 1ABIH 1C4Y2 4GSOA 4FUDA 2THFB 3ZVGA 1BRUP 3WY8A 4B6FA 5I25A 2FIRH 1TNJA 3MOCA 1CT0E 5FXLA 4FUBA 1LVYA 3VXEH 1W12U 1V2KT 3RXSA 3SHAH 1B7XB 1NY22 2XYAA 3LJOA 3LPRA 4NIVA 3DT0H 3KHVA 2P16A 4X8TH 2OK5A 3VEQB 3BEIB 1GJ4H 1IHTH 2BM2A 1MKXK 2VWLA 2PKSC 1HLTH 1C5YB 2ZGBH 1C5ZB 1T31A 1O32A 8KME2 2GKVE 2PGBB 2ASUB 2Z3DA 4Y8XA 2LNCA 5C17A 4LZ4B 2ZO3H 1NRPH 4A92A 1JXPA 1EXFA 2ZF0H 2XC0A 4XBDA 3SU0A 3QGJA 1D3DB 5T6GA 5CMXH 3S69A 1BTZA 1LKAA 1XUIA 3RP2A 1SLXB 1XVOA 4I8HA 2QF5A
chains in the Genus database with same CATH topology
2H6MA 4X2WA 5EQSA 2JETB 4Z6AH 1ANBA 1G2MA 1Q2WA 2QV1A 2XBYA 3GICB 3PV4A 5DP6A 4GPGA 5DKMA 1O3KA 3GCNA 4NSYA 1HAOH 2GMTC 1MBQA 1HDTH 2BLQA 5FCRA 6ESTA 3C27B 3P17H 3S7KB 3QO6A 3UREA 5GWZA 3S9CA 1ZPBA 4WXVA 2FI4E 5EODA 1EB2A 1TQ0B 3KQBA 3K2UA 3RXAA 4MVNA 4ZKNU 1HCGA 5EOKA 3L6PA 4FU8A 1HAXB 3M3VA 1V2VT 4YESB 3BTWE 1H9IE 3IG6B 1TB6H 3GDSA 4FU7A 3RXHA 3QLPH 3H7OA 1LKBA 1WAYB 3RXCA 1BDAA 3EGKH 1C5QA 1XM1A 3ZV8A 2CHAB 1O2ZA 2FO9A 3RLYH 2Y5HA 4BTIB 2F9OA 2XXLA 5HMAA 1V2TT 3ZV9A 1KXCA 2SNVA 1ARBA 1ELCA 3PTNA 1GBTA 1ELGA 1O3MA 1THRH 1V2RT 2FOEA 4B73A 1O5DH 2ZFQH 4CRDA 2C8YB 1SGDE 1O5BB 1P3EA 5EXMA 3TGIE 1DDJA 1SC8U 4NGAH 3SV7A 1GGDB 1SSXA 2P8OB 1DWEH 4KTSA 1TBRH 1UHBA 4MNWA 1ACBE 1IQMA 1O2PA 1SGFG 2W7UA 4INKA 1DXWA 1ABJH 5EPYA 1MQ5A 1TYNA 1ARCA 2ZCHP 4YT6H 1B0FA 2BZAA 1F2SE 1GI0A 2FOFA 2H5DA 1UTKA 1GI8B 5GXPA 4K1EA 2J95A 1MTUA 1C9TA 1GMHG 1MTNB 3OX7U 1C1RA 1H1BA 3KEEA 3T29A 1C1NA 3PLPA 2FS8A 1O2GH 2ZTZA 4E7RG 1EAWA 2GTBA 5SGAE 1TPPA 2FZZA 1AU8A 1GG6C 1GI7B 1LCYA 1HJAB 1AKSB 3S9BA 2J2UA 2FLBH 2BDAA 4OGYA 3A7XA 1GL0E 1HGTH 2P3FH 1QA7A 1MZAA 1HXEH 5FBIA 1YLCA 1FPHH 1KYNA 3RXEA 2Y6TA 3FP6E 4HFPB 1L2EA 2ZHWH 1FY8E 1TOCB 4BAKB 1QRWA 2YOLA 3D65E 3Q00A 2VWMA 1P03A 1AFEH 1BJUA 2GP9B 1QBNA 5DP8A 2ZGXH 4GVUA 3SU3A 1N8OB 3TVJB 5DJ7A 1GBHA 1J16A 1DM4B 2J38A 1ANEA 2VWOA 1C5LH 1CT2E 4ABHA 3SU4A 3GISB 4UFFH 1KY9A 2PTNA 2ZWLH 1GBKA 3E0PB 3URCA 1UTPA 3UFAA 5A0CA 4Q7XA 2XC5A 3V13A 4IGDA 1A1RA 1FAKH 3BG4B 2AGIX 3LGUA 3SGQE 4CRBA 2ZU2A 2XNIA 4FU9A 3OTJE 1BMAA 1TNKA 1DLEA 1EOLA 2WINI 4ABFA 3BTKE 5CHAC 1BITA 1SPJA 1UCYH 2BHGA 1T32A 2EEKA 5AF9H 5G4BA 2Z6BD 1JIRA 1CQQA 4BXWA 3ZZ8A 2F83A 1AI8H 3KF2A 3L33A 2QGRA 2ZFRH 3LU9B 3A84A 3AASA 3KN2A 3DFLA 1VITF 2WPJS 1EATA 4GLYA 5TJXA 4ISOA 1QY6A 4BTTB 1RIWC 2Q6FA 1FZZA 1SLVB 1S82A 1P2NA 4VGCC 4IN2A 1AN1E 1BTHH 3ZZ4A 1ZYOA 1XKAC 2BVSH 1ETRH 2CMYA 3NPSA 1QB9A 4KTUA 3PMJA 1HIAB 3KQCA 3SI4H 2GCTB 1NFWA 3QZQA 3URDA 1P01A 4AYVB 2PTCE 2W5EA 4ZMAH 3SHCH 4X1RU 4UFEH 1T8MA 1CHGA 1WQVH 3MO6A 5E2PA 1N6YA 2AMQA 1HNEE 3GY8A 4A1XA 1D6RA 5GCHF 1ETSH 3GCTG 2WV5A 1W13U 1OX1A 2GX4A 8LPRA 1EPTB 1UVOA 1PYTD 2OD3B 1SLWB 1O2HA 1FY1A 4LK4A 1SGEE 4U01A 2A2QH 4B75A 2AEIH 2TGPZ 3RM0H 3ZZCA 1BRAA 2PSXA 1DPOA 2ALPA 2WPHS 1SHHB 4ZXXH 3B9FH 1AQ7A 1KXFA 3GCOA 4DURA 3A7YA 1BTWA 2Z3EA 3F9HA 3W94A 3VXFH 4KTCA 1G32B 1KTSB 4GCHG 5HM2A 1BZXE 3ATLA 4JZDH 1AGJA 1HAGE 2C4FH 2VINA 1H8IH 3DA9B 2G51A 3GCHC 3M35A 4XSKU 1EOJA 4AG1A 2FOHA 1AB9B 2HLCA 1V2ST 2FYRA 1NROH 2FOAA 1XUHA 2BDCA 1V6DA 3ODDA 1OPHB 1JBUH 1TGCA 1O33A 2ANKH 5DP5A 4X2XA 3ESTA 2SGEE 3UWJH 1GI2A 1UTOA 1AKSA 2A2XH 2H9EH 4AFZA 3HGPA 3F9FA 1A7SA 1J15A 2BB4A 3U1IB 4NZLA 1P11E 2Y81A 3BTDE 1ID5H 3N7OA 1YPGH 2AMPA 4ZHMU 1XUKA 1TNHA 1BBRH 4JYTA 1NC6A 5F8TA 2FI3E 1TGNA 4CRCA 1NO9H 1GJ5H 7LPRA 4IC6A 5L6NH 1ZJDA 2BLOA 1LHDH 2A4GA 1O3JA 1EZQA 5C1YA 3JZ1B 5B6OA 2BYAX 1FPCH 4HZHA 2OUAA 1H9LB 4K1SA 3U69H 3M3TA 3ZYDA 2M5TA 1ESBA 1P2OA 1GBCA 4E05H 2H9HA 1SGRE 1H8DH 1QRXA 1TPOA 3NWUA 3EA9A 1HXFH 1RGQA 2V3HH 1BTPA 1K1NA 3RXVA 4Y0ZE 3ZVEA 4Q2KA 4QT8C 4GHTA 1GWAA 2W3KA 3QK1A 1MTSA 1LPGB 2WPKS 4WH6A 3ZVAA 2BY7X 1Y3UA 4I8KA 1UMAH 5EPNA 2TGDA 2PSYA 2XTTB 1SLUB 2RCEA 5A8YA 7GCHF 1HB0B 1QNJA 2PLXA 1MBMA 2OBOA 3F6UH 2P3UB 3LC3A 3BG8A 1V2UT 1PQ5A 1WTHD 2VH0A 1SGFA 1GI6A 1Z8RA 3FP7E 4MPWA 3FZZA 3Q77A 2FP7B 2Y7XA 3STJA 5L30H 1G37A 1C2MA 4FUCA 4Z0KA 2ZDVH 1C2EA 1ZTKA 4ZHAA 1G3EA 2G8TA 2A45B 3D23A 1V2PT 1C1VH 3KQDA 4YLQH 4D8NA 2IJOB 1LHEH 4SGAE 2ULLA 1OS8A 3H7TA 1A0JA 3ZVFA 1EX3A 5LGOA 3GDVA 2ZDNA 1K21H 4NG9H 1D3PB 1QL9A 3A88A 3GY7A 1QR3E 1MKXH 1P2MA 3RLWH 1ELAA 2BTCE 1AY6H 1O2RA 4YOIA 8ESTE 3TU7H 1DWCH 3LGYA 3ZZ9A 1C2GA 3BTHE 1N1LA 1G3DA 5HYOA 2QYIA 1O3NA 4DT7B 5F8XA 4Y76A 1ANDA 4ABJA 2VIPA 2BDYA 1K2I1 3LH1A 2A32A 1GVZA 5LPRA 3HGNA 5J4QA 1ZPZA 4KKDA 4CH2B 3A7TA 2OC8A 1EPTA 4K8YA 3SGAE 1C2HA 1C5XB 1RD3B 2J94A 3RXFA 5JPMH 1MAXA 1YCPK 4DCDA 1UJ1A 1NESE 5AVDA 1GHYH 1GHXH 2UUYA 5L2YH 3C1KA 2H5CA 1BHXB 2SGQE 1W0YH 1K28D 5JBBS 1ELDE 1SVPA 3BF6H 2NU0E 1GVKB 1TOMH 2BY5X 1SQTA 1PPHE 1QBVH 1XMNB 3BSQA 4WMFA 1V2JT 1G2LA 1LMWB 1C5PA 1EZSC 4BXSA 5C1UA 1O34A 3TJNA 3S7HB 9ESTA 1V2OT 1N6XA 3PO1B 4MLFB 4R8TB 3CENA 1JRTA 3PB1E 4FUGA 2K1QA 4ABIA 2JKHA 4AOQA 1GPZA 5TCCA 3ZVBA 3MU8A 1ELFA 3ATMA 3MH5A 3A87A 3A83A 1O37A 2ZPQA 4H4FA 3RXLA 1GHZA 1NRQH 1OYQA 3A8CA 4BANB 1Y5UT 1IQNA 5A0AE 5K0HA 1VGCC 1WQSA 3OY5U 3SNBA 1RRKA 2WYGA 2XRCA 1O35A 1PPBH 2SFAA 1W0ZU 3VGCB 3MMGA 2TRMA 2D1JA 4WH8A 1SL3A 1SB1H 1ZRBA 4AFSA 1C1QA 4D7GA 3QTOH 2ZTYA 3RMNH 2ZHEH 3O8CA 1K1IA 5JB8S 3BEUA 2GD4B 2ANYA 1FY5A 3HKIB 4X6NA 4KELA 2UWPA 3U98H 1AZZA 2D26C 5EQQA 2R3UA 1AVWA 3SNAA 1O38A 2ZFTA 2BD5A 1AWHB 3EA8A 3UOUA 4DW2U 2AGEX 3PTBA 5EW1H 4A1TA 4BTUB 4GCHF 1BTUA 1C5VA 1YCPM 4GUXA 1P12E 2GDEH 1QL7A 1YPHC 3G01A 1U6QA 4CHAC 4UDWH 5K7RA 1L1GA 3MNSA 4Y79A 3EE0B 2DE8A 1O3LA 5A09A 2STBE 1QBOA 2D2DA 3EA7A 2GV6A 1GDUA 1O2WA 3P95A 2A4RA 4MPUA 1NTPA 5HM9A 1HFDA 2PKAB 3ATWA 4ESTE 4GAWA 2BDHA 2JH0D 2BXTH 4DGJA 1O3BA 1T8OA 4ISNA 2DE9A 1TONA 1YF4A 3PWCA 1SQAA 1JMOH 4FXGH 1GHAG 1CBWC 3CP7A 5E8EH 1EB1H 2A7JA 1THSH 1DOJA 3RU4T 1F7ZA 1CA0C 3SJOA 4JMYA 3OYPA 2OCVB 2J4IA 4ABGA 2ESTE 1EAUA 1O2UA 3SUEA 1HAHH 1S83A 4NA9H 4X2VA 1BRCE 1C1PA 1O3GA 1T7CA 5ETXA 3SNEA 3M3SA 4YM9A 5JYIA 3UQOA 2BY9X 3RUOA 1P05A 4Y0YE 1AFQC 2C8XB 2SGFE 2ZA5A 4LXBH 2ZECA 4M7GA 2TBSA 3SV2H 5ESTE 3TJOA 3UWIA 2SGAA 2Z7FE 3MO3A 1FV9A 4ABDA 3SJ9A 3KGPA 3OU0A 1D4PB 1BHXF 1VCQA 1DSUA 2F91A 1FJSA 3SJ8A 3A86A 1GJDB 2ANMH 3GDUA 3K65B 1AUTC 3QDZB 1MTVA 2QIQA 2BX4A 2AGGX 5DP9A 5C5NA 1GBIA 3MH6A 1TIOA 2BQ6B 1IQHA 1O2VA 3BTTE 4INHA 3HATH 3BN9A 1TGSZ 2GZ8A 1Q31A 1QGFA 1G3BA 4XBCA 4B74A 2GGVB 2CF9H 1FDPA 5GJ4B 1RXPA 5GPIB 1TMBH 2GZ9A 4UE7H 3H5CB 1P2KA 1BUIA 1GDQA 2BD4A 1IQFA 2IPHA 1K1MA 2JETC 4TPYA 3NKKA 1K1JA 3HK6B 1OOKB 2AS9A 4IS5A 2V3OH 5F6MA 1GBBA 2BVXH 5JB9S 1GL1A 1ZR0A 2ZHQH 1RTKA 1GJCB 1QHRB 1TNIA 1E34B 1IQEA 2OINA 3BIVH 1Z1IA 3GY2A 1RTFB 1PYTC 1UO6A 1GBAA 1ZSJA 1PPZA 1ZTJA 1IQJA 1EKBB 3Q76A 2FMJA 3SUGA 3ZYEA 1LPZB 1UTMA 2C8ZB 2H9TH 3NK8A 4LOYH 1DVAH 2R9PA 2ZDAH 1A3BH 1TRYA 2FM2A 2J9NA 1Y5BT 1MQ6A 1HRTH 1EZUC 3KL6A 3O8DA 5C3NA 4I32A 3PROA 1C1UH 1C1TA 2O8MA 1ORFA 3UNRA 2ZU3A 1UCYE 3RXQA 1TABE 4A7IB 1GJBB 3VB4A 1OP2A 3SU6A 3SNDA 1L4ZA 1NRNH 2XWAA 1L1NA 2CHAC 5CHAB 5L2ZH 5FHTA 1TFXA 3VB5A 1F92A 3FAOA 1NPMA 2P95A 1UVSH 3M5LA 1P3CA 2ZU4A 4AORA 4E7NA 1EQ9A 4CREA 2UUFB 1TRMA 1OP0A 5EG4A 1QIXB 1ZZZA 3Q3XA 1GGDC 2P8OC 2BZ6H 1Y5AT 3V0XA 3I77A 3LGWA 1PJPA 1OWDA 8GCHG 1ZGVA 1FXYA 3RXMA 2Q1JA 1NT1A 4JZEH 1F5LA 2H2ZA 4X1QU 4WXIA 1RS0A 3SV8A 1CGJE 2PKAA 5JBCS 2OC1A 4Q7YA 1MTNC 1DY8A 1Z6EA 4DIHH 3KQEA 3A7VA 4MPVA 3RXTA 3SI3H 2LPRA 2DUCA 6CHAB 1HAYB 1ELTA 1OWEA 1SMFE 3SJIA 3KIDU 1JIMA 5JDUB 1V2NT 1T4UH 3PM3A 4UD9H 1MD8A 1NU7B 1SBWA 4AB8A 2QN5T 1M9UA 1GBEA 4Y7AA 1O5FH 4CR9A 3B23B 2VGCB 3ZZ5A 1GHWH 3UOPA 1FQ3A 1IAUA 4DIIH 5HXFA 1GDNA 2NU3E 2A31A 1ELEE 1SQOA 4J2YB 1W10U 1IQLA 2HGTH 3FFGA 1W11U 3RU4D 2Q6GA 2AIQA 4IMQA 4MTBA 1YLDA 2OQ5A 5DGJA 3M5NA 4Y8YA 1WOFA 3GYMA 3RXDA 2HNTF 1HPGA 1TPAE 1V3XA 3NZIA 1N8OC 3V3MA 1Z1JA 1PQAA 1DLKB 1TMTH 1GBDA 1BMMH 4I7YH 1NN6A 3F9EA 1J14A 3SGBE 1NS3A 1C5UA 2G4TA 4ISHH 1K1PA 1ESAA 3P6ZB 4BAMB 4AN7A 3DFJA 1L1JA 2EI8A 1P9SA 3GY5A 1BBRE 1E38B 2Z9GA 2ZTXA 1FI8A 2QXGA 3U1JB 3MH4A 3ATIA 2BY6X 1DS2E 3BG4C 2C3SA 3UY9A 1XUGA 4CRGA 2EI6A 3QN7A 2OLGA 5A8XA 3TH4H 1XXFA 4NA8A 4INLA 4F49A 5BPEA 1W3CA 1GHVH 1YM0A 7ESTE 2PV9B 2VH6A 4IN1A 3BTME 1IHSH 3M37A 3PMAB 1O2OA 5JBTA 2G5VA 1Z8GA 2XWBI 3NXPA 4U32A 4XFQA 3E0NB 5AFZH 1PFXC 1TMUH 3M36A 1HAPH 4X6MA 1GCDA 4OS6A 2STAE 1FONA 2VB0A 2I6SA 1UVUH 2GCHG 4O97A 2PGQB 4FUEA 1C2FA 4K69A 3SV6A 1WTGH 2GCTC 1QTFA 2YNAA 3D62A 1F0SA 2SNWA 4ASHA 2BY8X 2QAAA 5CE1A 3O8RA 2ZQ1A 1LO6A 3E16B 1YPMH 1TBZH 3A8DA 4WMEA 4X1PU 2XCNA 4X2YA 2BOKA 1FLEE 3T62A 2G81E 1BMNH 2B7DH 3R0FA 2XBVA 1TNGA 1TX8A 3A89A 1C2IA 1EPTC 1C1SA 3RDZA 3T28A 1OWHA 1G30B 1WV7H 1WSSH