5HMNA

Crystal structure of an aminoglycoside acetyltransferase hmb0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
SLDVHQLSPNEVALMETLLATFGEAFNDMETYTGNRPRGAYSRRLLESDYFIALAALEYGEIVGGLAAYELKKFEQERSEIYIYDLAVAKAHRRRGIATALIEKLKELGAARGAYVIFVQADTAIEDEPAIALYSKLGVREEVLHFDIPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAC3-I
publication title Crystal structure of an aminoglycoside acetyltransferase HMB0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol
rcsb
source organism Uncultured bacterium
molecule tags Transferase
total genus 33
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5hmnA00
2B4DA 1Q2CA 2R8VA 4AG7A 2DXQA 3JUWA 2JLMA 3FB3A 1XEBA 3I3GA 2R98A 1S7NA 4L8AA 4KLWA 3G3SA 4M3SA 1V0CA 5HH1A 2EUIA 4MI4A 3KKWA 2Q0YA 2OU2A 1YGHA 1NE9A 1M44A 1PU9A 1SQHA 2JEVA 3EFAA 5C82A 3FNCA 4OLLA 4XPDC 5EC4A 1Y7RA 2Q44A 3DDDA 3BLNA 4QBJA 3R96A 2OZUA 3R95A 1YREA 1M4GA 2OZHA 4AB7A 3S6GA 3R9GA 1PUAA 4KVXA 4QUSA 2EVNA 1FY7A 1CM0A 2QMLA 3D2MA 3K9UA 2A4NA 3T9YA 2JDDA 5KTCA 2D4PA 3DR6A 4F6AA 2ATRA 2GIVA 2BSWA 3FXTA 3QB8A 4R57A 4YGOA 4H6UA 1TIQA 2OB0A 3FIXA 2Y0MA 1VKCA 5DWNA 2P0WA 4ZBGA 3TT2A 1YR0A 1S5KA 3LODA 4B5PA 4MHDA 2F5IA 3H4QA 2FS5A 4R3KA 2JDCA 3MGDA 2VQYA 2BL1A 2VBQA 3GKRA 1NMTA 3T90A 4XPKA 4KZTA 3R9EA 1KZFA 4JXQA 2CNTA 3LD2A 3DR8A 1P4NA 1LRZA 2AE6A 4OADA 1CJWA 2QIRA 2HUZA 2BUEA 2J8RA 4YFJA 5J8FA 3TTHA 1R57A 2GANA 5KTDA 1GHEA 4AG9A 2AJ6A 1QSMA 5F47A 1MJAA 4IF5A 4LX9A 2OH1A 4UWJA 4KLVA 1NSLA 5JPHA 1IB1E 2ARHA 2G3TA 4PSWA 4PV6A 1BOBA 4XPDB 2HQYA 3CXPA 4B5OA 2REFA 3W91A 4MJ8A 4KORA 1K4JA 1WWZA 3PP9A 4MY3A 4UWIA 4XNHC 1RO5A 4NXYA 4H6ZA 2PDOA 1Q2DA 5JQ4A 4UBRA 3C26A 2H5MA 4CAWA 4MBUA 1KUXA 2Z11A 1Y9WA 4PSXA 4QB9A 2FXFA 2PC1A 4AVBA 3N7ZA 4JWPA 3TE4A 2R7HA 2ZW5A 1QSTA 3ZZIA 4E0AA 3V8IA 4R87A 3GYAA 4Y49C 4U9YA 4FD7A 1I1DA 1MK4A 1P0HA 5GCNA 1N71A 3R9FA 4U9ZA 2B3VA 4UA3A 2C27A 4R3LA 4JXRA 3TOBA 4HKFA 3R1KA 2ZW6A 4KVME 2Z10A 1U6MA 2NMTA 4L89A 1YX0A 2R1IA 2B58A 1IYLA 2FE7A 2IL4A 2X7BA 4M85A 4QC6A 2Q04A 4H89A 3VWEA 4X5KA 3EC4A 2O28A 3S6HA 4KUBA 4OAEA 1KUVA 2VZYA 1WK4A 5F46A 4CAXA 2PSWA 1ON0A 3FRMA 1Z4EA 3TO9A 3P2FA 2VXKA 2FIAA 1XMTA 1MJBA 3S6KA 4XNHB 3S6FA 3FYNA 3BJ7A 3IWGA 4KUAA 4JJXA 1RXTA 5HMNA 4KOXA 1S7KA 2G0BA 2Z0ZA 5H86A 2FIWA 1VHSA 5IB0A 1KUYA 2Q7BA 2I00A 2VEZA 3OWCA 3SXNA 2VI7A 4PK3A 1YLEA 2ZXVA 4AVCA 3DSBA 3EO4A 4AVAA 4NCZA 2PR1A 1QSOA 4LUAA 2D4OA 5F48A 4Y49B 5FVJA 1L0CA 4KOUA 3BJ8A 5EBVA 2QECA 3RYOA 2K5TA 3TFYA 4CS0B 1S60A 5I0CA 1XE4A 3W6SA 1J4JA 2P6EA 2FSRA 3PGPA 1Q2YA 2REEA 5IV0A 3E0KA 1I21A 4DNCA 3UY5A 1Y9KA 4NEXA 1M4IA 4MY0A 4XPLA 2B5GB 3D3SA 3F5BA 3I9SA 2P6GA 2B4DB 4K30A 4KOVA 1S7FA 1QSRA 3WR7A 4E8OA 4IUSA 3VWDA 5C88A 2Q4VA 2CNMA 4HNYB 1S7LA 2Q4YA 1QSNA 2FT0A 4KVOE 4KOYA 4RI1A 3GY9A 4FD5A 3QAHA 4J3GA 1UFHA 3CXQA 4F0YA 2RC4A 1OZPA 1BO4A 2WPWA 3G8WA 2J8NA 3TCVA 3NE7A 1YVKA 5E96A 5IX3A 1M4DA 4EVYA 1MJ9A 3F0AA 5H84A 4FD4A 2PQ8A 4U5YA 4NF1A 2B3UA 3D2PA 1XF8A 3B8GA 4FD6A 4QVTA 2VZZA 1Z4RA 2CNSA 2PRBA 1S3ZA 4KOTA 2FCKA 2BEIA 2P6FA 3TO7A 5CNPA 1I12A 4E2AA 1XIXA 3IGRA 4YRHA 4R9MA 4JD6A 3W6XA 3SXOA 1Z9UA 3FBUA 4JLYA 2G3AA 2J8MA 4II9A 1IIDA 2FL4A 4ONUA 4CAVA 1M1DA 5DWMA 3ZJ0A 4B5PB 4BMHA 2OZGA 4ORFA 4PK2A 4CRZB 3CXSA 1YK3A 1B6BA 4GS4A 3JVNA 2PR8A 3TO6A 1YVOA 2GE3A 2WPXA 2I79A 2HV2A 2ZPAA 5J8CA 4KOSA 3TOAA 2KCWA 3PZJA 3P2HA 2CY2A 2ZW7A 5F49A 4NSQA 3SHPA 4CRYB 2B4BA 4HNXB 3F8KA 5ISVA 4KOWA 3EY5A 4I49A 4HNWB 3DNSA 3EXNA 2B5GA 1IYKA 2ZW4A 1IICA 5KTAA 1B87A 3D8PA 4RS2A
chains in the Genus database with same CATH superfamily
1TF9A 2B4DA 3I1UA 1Q2CA 2R8VA 4AG7A 3WC7A 4DJLA 1IOFA 2DXQA 3VARA 4W9YA 3JUWA 2JLMA 3FB3A 4B14A 1XEBA 3I3GA 4ZY1A 4F9VA 2RFHA 2R98A 3BXMA 4C7IA 4FAIA 4MFQA 1S7NA 4L8AA 4KLWA 4OIWA 4CYNA 3G3SA 4M3SA 2Q4ZA 4HPSA 1AYEA 1V0CA 2PJ2A 3NE8A 4OP4A 5LYFA 5HH1A 2EUIA 4CYQA 4MI4A 3KKWA 1DE4C 3B3VA 4ZGYB 2Q0YA 4CGMA 2OU2A 1YGHA 2V8VA 2DPSA 4UEEA 1NE9A 2C1CA 4LQGA 2DEAA 1M44A 1PU9A 1SQHA 2JEVA 3EFAA 2Z3NA 1Z8XA 5C82A 3DLJA 3FNCA 2RB7A 2PJ7A 4OLLA 3BI1A 3CZXA 1VHEA 4P4BA 1Y7RA 2Q44A 2NYQA 4NFRA 3DDDA 5EC4A 3BLNA 4QBJA 3R96A 2OZUA 2CIJA 2EBJA 4UEZA 1Y0RA 3R95A 1YREA 1M4GA 4ZI6A 2OZHA 4AB7A 2GU2A 3S6GA 3R9GA 2Z3KA 4H2KA 1PUAA 4Z65A 4A37A 4KVXA 5I4MA 4QUSA 2EVNA 1CBXA 2CXAA 1FY7A 5LRGA 1CM0A 2QMLA 1JWQA 3D2MA 3K9UA 5CPAA 1TKJA 2A4NA 3H8GA 4UF4A 2PIYA 1A2ZA 3S9LA 3T9YA 2JDDA 5KTCA 1XJOA 2GLFA 3NA6A 5EMIA 2D4PA 5K8PA 3DR6A 4CGLA 2ATRA 2V8DA 4F6AA 4NGSA 5K8OA 2QVPA 4TNUA 3LWUA 2Q51A 4UCPA 5AG4A 2GIVA 2BSWA 3FXTA 3QB8A 4R57A 4YGOA 3KQXA 2AFWA 4H6UA 4ZYQA 3RBUA 1TIQA 2OB0A 4MFKA 3IJ3A 2JBJA 3L2NA 3FIXA 5AG5A 4B13A 4NGMA 3FECA 2PJCA 2Y0MA 4P4JA 1F2PA 1R3NA 1VKCA 2BCOA 4Q36A 5DWNA 2P0WA 1X10A 4PXDA 2JBKA 4ZBGA 1X12A 1F2OA 3IEHA 3TT2A 4NGTA 1YR0A 4FWUA 1S5KA 3GIUA 4C7HA 1LOKA 5G21A 4ZY0A 3LODA 2QYVA 4OIDA 1HDQA 4LQ6A 4B5PA 3PB8X 4MHDA 4PQAA 1IU8A 1XRYA 2F5IA 3H4QA 3PBBA 2FS5A 3IFEA 4R3KA 2JDCA 5G1ZA 3MGDA 5HVGA 2VQYA 6CPAA 2BL1A 2VBQA 3GKRA 5CBMA 1NMTA 2PVWA 3T90A 4XPKA 2ZOFA 2XEIA 3HUVA 3B3WA 4KZTA 1KZFA 3R9EA 4B6ZA 4JXQA 2CNTA 3IIBA 3DR8A 3LD2A 3WABA 1P4NA 1Z8LA 1LRZA 2AE6A 4OADA 4C68A 4B11A 1CJWA 2QIRA 1CG2A 2HUZA 5THWA 2BUEA 2J8RA 4FUUA 7CPAA 4YFJA 5J8FA 3TTHA 4MRIA 1R57A 2GANA 4OC2A 1TKHA 2PJ1A 2ZEPA 5KTDA 1GHEA 4AG9A 2AJ6A 1QSMA 1VGYA 5F47A 1ZLIA 1MJAA 2ZEDA 4A95A 2F8HA 4IF5A 4LX9A 5K8MA 2CTBA 2OH1A 3NH4A 4UWJA 3PFEA 4CAEA 4KLVA 1NSLA 1Z8TA 4P6YA 5JPHA 1IB1E 2ARHA 4OC5A 2G3TA 2GLJA 4PSWA 4PV6A 2Z3MA 1BOBA 4XPDB 2HQYA 2HB6A 4GXHA 3CXPA 4B5OA 2REFA 3W91A 3B3SA 3S9MA 4AXVA 4MJ8A 1DTDA 4KORA 3PB7X 3D7FA 1K4JA 1IGBA 1WWZA 4X8IA 3PP9A 4MY3A 1QMUA 2PJ4A 4A30A 4UWIA 3MRUA 2XEFA 4DUKA 4XNHC 1RO5A 2VL1A 3PBEA 5D29A 4OC4A 4NXYA 5JM6A 4MFLA 4H6ZA 4MXUA 4P4EA 2PDOA 1Q2DA 1NSAA 2ANPA 2YNCC 2DF5A 2AFOA 5JQ4A 4UBRA 3C26A 3KASA 4ZX8A 2H5MA 3DGVA 4MMOA 4OMEA 4CAWA 4MBUA 2WZNA 1KUXA 5LYDA 2G9DA 4Q38A 2Z11A 4F0XA 4P4IA 1Y9WA 3FF3A 4PSXA 4QB9A 2FXFA 1TKFA 3HLPA 4R7MA 2PC1A 4AVBA 3N7ZA 4JWPA 4R6TA 1OBRA 3CPXA 3TE4A 2R7HA 3LMSA 2ZW5A 3VATA 1QSTA 4PXCA 3ZZIA 1UWYA 5AGEA 4E0AA 4P45A 2OR4A 3V8IA 4R87A 3GYAA 4Y49C 1Z5RA 4A32A 4U9YA 3QAYA 1IY7A 4FD7A 1I1DA 4MHNA 4UCMA 1MK4A 3V38A 4G1PA 1P0HA 1BLLE 5GCNA 4A38A 4EFDA 1N71A 2Z3LA 3PEIA 4OC3A 3R9FA 5LRKA 5G20A 4P4FA 4U9ZA 2WYRA 3CT9A 2B3VA 4UA3A 2C27A 4MCPA 1XMBA 4R3LA 4JXRA 3TOBA 4HKFA 1CP6A 4X3RA 5HVFA 3FX6A 3R1KA 1Y0YA 3BI0A 4C2ZA 1Q7LA 1Z2LA 4WJBA 1CPSA 2ZW6A 4KVME 2Z10A 4UEFA 3PB4X 1FNOA 2PJ9A 1U6MA 2NMTA 3KHXA 4R8FA 4L89A 3WT4A 3KQZA 4NGPA 1YX0A 4PPZA 2R1IA 2B58A 3KI9A 1IYLA 4MFPA 5G22A 4DYOA 4ONWA 2FE7A 2IL4A 3PFOA 3PB9X 2X7BA 3CPAA 4M85A 4QC6A 4TWEA 3SJXA 4C2YA 4CGOA 2Q04A 1HEEA 4H89A 3VWEA 4X5KA 4MHYA 4A94A 3EC4A 2O28A 3S6HA 4KUBA 1LFWA 4OAEA 1KUVA 2PJ6A 2PE3A 2VZYA 1WK4A 4XPDC 5D8NA 4CAXA 5F46A 3SJFA 2PSWA 1ON0A 4PXEA 2ZEOA 3FRMA 3IO1A 1Z4EA 2GREA 3TO9A 1JQGA 3P2FA 2VXKA 2FIAA 4F8ZA 1XMTA 2EWBA 4NGQA 1MJBA 3KR5A 3TX8A 3S6KA 2PCUA 4XNHB 3PB6X 3S6FA 1H8LA 2EK8A 3BJ7A 3FYNA 3IWGA 4UFXA 4A2ZA 3IWWA 2O53A 4KUAA 3KHZA 4JJXA 1RXTA 2C6GA 5HMNA 4RN7A 4KOXA 1S7KA 1ZG7A 2HC9A 3D7DA 2ZEMA 2G0BA 2Z0ZA 1AUGA 1YMEA 5H86A 5J1QA 3KGQA 1Y7EA 2FIWA 1VHSA 2ZEFA 1TXRA 4IHMA 4CYPA 1KUYA 3RAMA 5IB0A 2Q7BA 2I00A 2VEZA 3D7HA 2BO9A 3OWCA 1LAPA 1ZG8A 3NH5A 3SXNA 2ZEHA 4B12A 2VI7A 4NJRA 4PK3A 1YLEA 1VHOA 3K2KA 3RNZA 3LACA 8CPAA 2ZXVA 4AVCA 3DSBA 3H8EA 3EO4A 3GLJA 3ISXA 4NCZA 4AVAA 2PR1A 1QSOA 4LUAA 3D4UA 2D4OA 3D67A 3SJGA 3A9LA 3B7IA 2ABZA 2WUUA 4MHZA 4JZ0A 1KWMA 5F48A 1F57A 4Y49B 3FMCA 5FVJA 1YLOA 1L0CA 4EMEA 4KOUA 2Q7SA 3H5ZA 3B3CA 4MCQA 4BBHA 3BJ8A 5EBVA 2QECA 1ELMP 1FT7A 2K5TA 3RYOA 4A31A 4CS0B 3TFYA 4X2TA 2GFQA 5I0CA 4UFWA 3RZAA 4B10A 3IU1A 1XE4A 4P4DA 3W6SA 4R76A 1J4JA 2P6EA 2FSRA 3PGPA 4IK2A 4UIAA 1Q2YA 3H8FA 2NSMA 2AFZA 2REEA 2ODFA 4ZX9A 4FBEA 5IV0A 2IMOA 2QJ8A 3E0KA 1HDUA 1I21A 1LAMA 3KZWA 4KSAA 5LRJA 4DNCA 4JYWA 3UY5A 3D66A 4C2XA 2WSAA 5DS0A 2I3CA 2DPTA 4YWYA 1Y9KA 4NEXA 1M4IA 3D68A 4F9UA 4MY0A 4XPLA 4KSIA 2B5GB 5ELYA 3D3SA 3F5BA 4CGPA 2F7VA 3I9SA 4GM5A 2XEJA 4NGRA 5HVHA 2P6GA 4A33A 2B4DB 4P44A 3FEDA 1M4LA 4K3NA 3B35A 4K30A 1S7FA 1QSRA 4KOVA 3WR7A 4E8OA 4UIBA 4IUSA 3VWDA 5C88A 4RUHA 1LCPA 3FH4A 1PCAA 4BD9A 2Q4VA 3N5FA 4UFVA 1XOVA 3QNVA 2CNMA 4HNYB 1BAVA 1S7LA 2Q4YA 2Z3PA 5AG6A 1QSNA 3SI1A 2FT0A 2CTCA 4KVOE 5A27A 4BINA 2AFUA 3FJUA 3GUXA 2Z3OA 3BHXA 4KOYA 4RI1A 3GY9A 4FD5A 3QAHA 4J3GA 1UFHA 5IX3A 2JEWA 2PJ0A 3CXQA 4F0YA 1ARLA 1XFOA 2RC4A 3NH8A 4MFJA 1OZPA 3IWEA 4KSFA 1BO4A 2WPWA 3G8WA 2J8NA 3TCVA 3NE7A 1YVKA 2OOTA 4A39A 1R43A 2ZEGA 5E96A 2ZOGA 4ZY2A 1M4DA 1CPXA 3B2YA 3WC5A 1MJ9A 4EVYA 3F0AA 5H84A 4FD4A 2PRQA 2PQ8A 1IOIA 5IB9A 4U5YA 4NF1A 4CAFA 3T8WA 5F09A 2B3UA 3D2PA 1XF8A 2IQ6A 1QQ9A 2V8HA 3B8GA 2VZZA 2C6CA 4FD6A 1Z4RA 4QVTA 5HXDA 2CNSA 2PRBA 3PRTA 2PJ8A 1BPMA 4CGNA 1S3ZA 1ZO0A 4KS9A 1ZLHA 4KOTA 4M6GA 3B3TA 2FCKA 1EE3P 3FVLA 4MFZA 1PYTB 2BEIA 2V77A 2O4HA 2P6FA 3TO7A 4PXBA 4CPAA 5CNPA 1I12A 3JRUA 2PIZA 4E2AA 4WWVA 4MCRA 2YNCA 1XIXA 2BOAA 3IGRA 1ELLP 3WC6A 5JH9A 4YRHA 4R9MA 4JD6A 3W6XA 2PJBA 1YQEA 1Z9UA 3FBUA 3IC1A 4JLYA 3SXOA 2G3AA 2J8MA 2POKA 4II9A 2IJZA 1Z8WA 1IIDA 4EWTA 2EK9A 2YNDA 2AFSA 2YGWA 1YW6A 2FL4A 4ONUA 1GYTA 4UCNA 4CAVA 1RTQA 4YU9A 4P10A 1M1DA 2XEGA 1LANA 4M6HA 5DWMA 5LYIA 3D8PA 3ZJ0A 4B5PB 5A28A 4BMHA 2OZGA 4ORFA 4PK2A 4CRZB 4CYOA 2Q43A 3KR4A 3CXSA 1AMPA 1YK3A 1B6BA 4M6IA 4OKOA 4GS4A 3JVNA 1YW4A 2PR8A 3FEEA 3TO6A 1ARMA 1YVOA 5BWAB 2ZENA 2GE3A 2PVVA 5K8NA 2WPXA 3V7ZA 2I79A 2HV2A 3NFZA 3SI0A 2AFMA 1CX8A 3KL9A 2EO8A 1ZG9A 3CDXA 3K9TA 4MHPA 4OC0A 3SJEA 2C6PA 3ISZA 1VIXA 4IAVA 2ZPAA 3JTKA 3MN8A 3D7GA 2YNEA 5J8CA 1TF8A 4KOSA 1YSJA 3TOAA 2KCWA 3PZJA 4NJQA 4OC1A 4Q7AA 4MCSA 3P2HA 3IU2A 2CY2A 1XBUA 3VH9A 2ZW7A 5F49A 4NSQA 2V8GA 3RO0A 3SHPA 2ZELA 4CRYB 2AFXA 2B4BA 3S9NA 4HNXB 1CP7A 2J9AA 4NGNA 3F8KA 2CF4A 3GB0A 5ISVA 4O23A 4KOWA 3EY5A 5JGFA 3SI2A 2PJ5A 2PJAA 2FVGA 4I49A 1BPNA 3DNSA 3EXNA 2B5GA 4HNWB 1IYKA 2ZW4A 1IICA 5AG7A 5KTAA 3TC8A 5LYLA 2PJ3A 1B87A 1S60A 4RS2A 2ZEEA
chains in the Genus database with same CATH topology
2B4DA 1Q2CA 2R8VA 4AG7A 2DXQA 3JUWA 2JLMA 3FB3A 4B14A 1XEBA 3I3GA 2R98A 4C7IA 4MFQA 1S7NA 4L8AA 4KLWA 4CYNA 3G3SA 4M3SA 1V0CA 5HH1A 2EUIA 4CYQA 4MI4A 3KKWA 4ZGYB 2Q0YA 4CGMA 2OU2A 1YGHA 2DPSA 1NE9A 1M44A 1PU9A 1SQHA 2JEVA 3EFAA 2Z3NA 5C82A 3FNCA 4OLLA 4XPDC 5EC4A 1Y7RA 2Q44A 3DDDA 3BLNA 4QBJA 3R96A 2OZUA 3R95A 1YREA 1M4GA 2OZHA 4AB7A 3S6GA 3R9GA 2Z3KA 1PUAA 4KVXA 4QUSA 2EVNA 2CXAA 1FY7A 1CM0A 2QMLA 3D2MA 3K9UA 2A4NA 3T9YA 2JDDA 5KTCA 2D4PA 3DR6A 4CGLA 2ATRA 4F6AA 4UCPA 5AG4A 2GIVA 2BSWA 3FXTA 3QB8A 4R57A 4YGOA 4H6UA 1TIQA 2OB0A 4MFKA 5AG5A 3FIXA 4B13A 2Y0MA 1VKCA 4Q36A 5DWNA 2P0WA 4ZBGA 3TT2A 1YR0A 1S5KA 4C7HA 5G21A 3LODA 4B5PA 4MHDA 2F5IA 3H4QA 2FS5A 5G1ZA 4R3KA 2JDCA 3MGDA 2VQYA 2BL1A 2VBQA 3GKRA 1NMTA 3T90A 4XPKA 4KZTA 3R9EA 1KZFA 4JXQA 2CNTA 3LD2A 3DR8A 1P4NA 1LRZA 2AE6A 4OADA 4C68A 4B11A 1CJWA 2QIRA 2HUZA 2BUEA 2J8RA 4YFJA 5J8FA 3TTHA 1R57A 2GANA 5KTDA 1GHEA 4AG9A 2AJ6A 1QSMA 5F47A 1MJAA 4A95A 4IF5A 4LX9A 2OH1A 4CAEA 4UWJA 4KLVA 1NSLA 5JPHA 1IB1E 2ARHA 2G3TA 4PSWA 4PV6A 2Z3MA 1BOBA 4XPDB 2HQYA 3CXPA 4B5OA 2REFA 3W91A 4MJ8A 4KORA 1K4JA 1WWZA 3PP9A 4MY3A 4A30A 4UWIA 4XNHC 1RO5A 4NXYA 4MFLA 4H6ZA 2PDOA 1Q2DA 2YNCC 5JQ4A 4UBRA 3C26A 2H5MA 4CAWA 4MBUA 1KUXA 4F0XA 4Q38A 2Z11A 1Y9WA 4PSXA 4QB9A 2FXFA 2PC1A 4AVBA 3N7ZA 4JWPA 3TE4A 2R7HA 2ZW5A 1QSTA 3ZZIA 5AGEA 4E0AA 3V8IA 4R87A 3GYAA 4Y49C 4A32A 4U9YA 4FD7A 1I1DA 4UCMA 1MK4A 1P0HA 5GCNA 1N71A 2Z3LA 3R9FA 5G20A 4U9ZA 2B3VA 4UA3A 2C27A 4R3LA 4JXRA 3TOBA 4HKFA 3R1KA 4C2ZA 2ZW6A 4KVME 2Z10A 1U6MA 2NMTA 4L89A 1YX0A 2R1IA 2B58A 1IYLA 4MFPA 5G22A 2FE7A 2IL4A 2X7BA 4M85A 4QC6A 4CGOA 4C2YA 2Q04A 4H89A 3VWEA 4X5KA 3EC4A 2O28A 3S6HA 4KUBA 4OAEA 1KUVA 2VZYA 1WK4A 5F46A 4CAXA 2PSWA 1ON0A 3FRMA 1Z4EA 3TO9A 3P2FA 2VXKA 2FIAA 1XMTA 1MJBA 3S6KA 4XNHB 3S6FA 3FYNA 3BJ7A 4UFXA 4A2ZA 3IWGA 4KUAA 4JJXA 1RXTA 5HMNA 4KOXA 1S7KA 2G0BA 2Z0ZA 5H86A 2FIWA 1VHSA 4CYPA 5IB0A 1KUYA 2Q7BA 2I00A 2VEZA 3OWCA 3SXNA 4B12A 2VI7A 4PK3A 1YLEA 2ZXVA 4AVCA 3DSBA 3EO4A 4AVAA 4NCZA 2PR1A 1QSOA 4LUAA 2D4OA 3A9LA 2WUUA 5F48A 4Y49B 5FVJA 1L0CA 4KOUA 3H5ZA 4BBHA 3BJ8A 5EBVA 2QECA 3RYOA 4A31A 2K5TA 3TFYA 4CS0B 1S60A 5I0CA 4UFWA 4B10A 3IU1A 1XE4A 3W6SA 1J4JA 2P6EA 2FSRA 3PGPA 1Q2YA 2REEA 5IV0A 3E0KA 1I21A 4DNCA 4KSAA 3UY5A 4C2XA 2WSAA 2DPTA 1Y9KA 4NEXA 1M4IA 4MY0A 4XPLA 2B5GB 3D3SA 3F5BA 4CGPA 3I9SA 2P6GA 4A33A 2B4DB 4K30A 4KOVA 1S7FA 1QSRA 3WR7A 4E8OA 4IUSA 3VWDA 5C88A 2Q4VA 4UFVA 2CNMA 4HNYB 1S7LA 2Q4YA 2Z3PA 5AG6A 1QSNA 2FT0A 4KVOE 5A27A 2Z3OA 4KOYA 4RI1A 3GY9A 4FD5A 3QAHA 4J3GA 1UFHA 3CXQA 4F0YA 2RC4A 4MFJA 1OZPA 3IWEA 4KSFA 1BO4A 2WPWA 3G8WA 2J8NA 3TCVA 3NE7A 1YVKA 5E96A 5IX3A 1M4DA 4EVYA 1MJ9A 3F0AA 5H84A 4FD4A 2PQ8A 4U5YA 4NF1A 4CAFA 2B3UA 3D2PA 1XF8A 3B8GA 4FD6A 4QVTA 2VZZA 1Z4RA 2CNSA 2PRBA 4CGNA 1S3ZA 1ZO0A 4KS9A 4KOTA 2FCKA 4MFZA 2BEIA 2P6FA 3TO7A 5CNPA 1I12A 4E2AA 2YNCA 1XIXA 3IGRA 4YRHA 4R9MA 4JD6A 3W6XA 3SXOA 1Z9UA 3FBUA 4JLYA 2G3AA 2J8MA 4II9A 1IIDA 2YNDA 2YGWA 4UCNA 2FL4A 4ONUA 4CAVA 1M1DA 5A28A 5DWMA 3ZJ0A 4B5PB 4BMHA 2OZGA 4ORFA 4PK2A 4CRZB 4CYOA 3CXSA 1YK3A 1B6BA 4GS4A 3JVNA 2PR8A 3TO6A 1YVOA 5BWAB 2GE3A 2WPXA 2I79A 2HV2A 2ZPAA 3JTKA 2YNEA 5J8CA 4KOSA 3TOAA 2KCWA 3PZJA 3P2HA 3IU2A 2CY2A 2ZW7A 5F49A 4NSQA 3SHPA 4CRYB 2B4BA 4HNXB 3F8KA 5ISVA 4KOWA 3EY5A 4I49A 4HNWB 3DNSA 3EXNA 2B5GA 1IYKA 2ZW4A 1IICA 5AG7A 5KTAA 1B87A 3D8PA 4RS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4D A;  1Q2C A;  2R8V A;  4AG7 A;  2DXQ A;  3JUW A;  2JLM A;  3FB3 A;  1XEB A;  3I3G A;  2R98 A;  1S7N A;  4L8A A;  4KLW A;  3G3S A;  4M3S A;  1V0C A;  5HH1 A;  2EUI A;  4MI4 A;  3KKW A;  2Q0Y A;  2OU2 A;  1YGH A;  1NE9 A;  1M44 A;  1PU9 A;  1SQH A;  2JEV A;  3EFA A;  5C82 A;  3FNC A;  4OLL A;  4XPD C;  5EC4 A;  1Y7R A;  2Q44 A;  3DDD A;  3BLN A;  4QBJ A;  3R96 A;  2OZU A;  3R95 A;  1YRE A;  1M4G A;  2OZH A;  4AB7 A;  3S6G A;  3R9G A;  1PUA A;  4KVX A;  4QUS A;  2EVN A;  1FY7 A;  1CM0 A;  2QML A;  3D2M A;  3K9U A;  2A4N A;  3T9Y A;  2JDD A;  5KTC A;  2D4P A;  3DR6 A;  4F6A A;  2ATR A;  2GIV A;  2BSW A;  3FXT A;  3QB8 A;  4R57 A;  4YGO A;  4H6U A;  1TIQ A;  2OB0 A;  3FIX A;  2Y0M A;  1VKC A;  5DWN A;  2P0W A;  4ZBG A;  3TT2 A;  1YR0 A;  1S5K A;  3LOD A;  4B5P A;  4MHD A;  2F5I A;  3H4Q A;  2FS5 A;  4R3K A;  2JDC A;  3MGD A;  2VQY A;  2BL1 A;  2VBQ A;  3GKR A;  1NMT A;  3T90 A;  4XPK A;  4KZT A;  3R9E A;  1KZF A;  4JXQ A;  2CNT A;  3LD2 A;  3DR8 A;  1P4N A;  1LRZ A;  2AE6 A;  4OAD A;  1CJW A;  2QIR A;  2HUZ A;  2BUE A;  2J8R A;  4YFJ A;  5J8F A;  3TTH A;  1R57 A;  2GAN A;  5KTD A;  1GHE A;  4AG9 A;  2AJ6 A;  1QSM A;  5F47 A;  1MJA A;  4IF5 A;  4LX9 A;  2OH1 A;  4UWJ A;  4KLV A;  1NSL A;  5JPH A;  1IB1 E;  2ARH A;  2G3T A;  4PSW A;  4PV6 A;  1BOB A;  4XPD B;  2HQY A;  3CXP A;  4B5O A;  2REF A;  3W91 A;  4MJ8 A;  4KOR A;  1K4J A;  1WWZ A;  3PP9 A;  4MY3 A;  4UWI A;  4XNH C;  1RO5 A;  4NXY A;  4H6Z A;  2PDO A;  1Q2D A;  5JQ4 A;  4UBR A;  3C26 A;  2H5M A;  4CAW A;  4MBU A;  1KUX A;  2Z11 A;  1Y9W A;  4PSX A;  4QB9 A;  2FXF A;  2PC1 A;  4AVB A;  3N7Z A;  4JWP A;  3TE4 A;  2R7H A;  2ZW5 A;  1QST A;  3ZZI A;  4E0A A;  3V8I A;  4R87 A;  3GYA A;  4Y49 C;  4U9Y A;  4FD7 A;  1I1D A;  1MK4 A;  1P0H A;  5GCN A;  1N71 A;  3R9F A;  4U9Z A;  2B3V A;  4UA3 A;  2C27 A;  4R3L A;  4JXR A;  3TOB A;  4HKF A;  3R1K A;  2ZW6 A;  4KVM E;  2Z10 A;  1U6M A;  2NMT A;  4L89 A;  1YX0 A;  2R1I A;  2B58 A;  1IYL A;  2FE7 A;  2IL4 A;  2X7B A;  4M85 A;  4QC6 A;  2Q04 A;  4H89 A;  3VWE A;  4X5K A;  3EC4 A;  2O28 A;  3S6H A;  4KUB A;  4OAE A;  1KUV A;  2VZY A;  1WK4 A;  5F46 A;  4CAX A;  2PSW A;  1ON0 A;  3FRM A;  1Z4E A;  3TO9 A;  3P2F A;  2VXK A;  2FIA A;  1XMT A;  1MJB A;  3S6K A;  4XNH B;  3S6F A;  3FYN A;  3BJ7 A;  3IWG A;  4KUA A;  4JJX A;  1RXT A;  5HMN A;  4KOX A;  1S7K A;  2G0B A;  2Z0Z A;  5H86 A;  2FIW A;  1VHS A;  5IB0 A;  1KUY A;  2Q7B A;  2I00 A;  2VEZ A;  3OWC A;  3SXN A;  2VI7 A;  4PK3 A;  1YLE A;  2ZXV A;  4AVC A;  3DSB A;  3EO4 A;  4AVA A;  4NCZ A;  2PR1 A;  1QSO A;  4LUA A;  2D4O A;  5F48 A;  4Y49 B;  5FVJ A;  1L0C A;  4KOU A;  3BJ8 A;  5EBV A;  2QEC A;  3RYO A;  2K5T A;  3TFY A;  4CS0 B;  1S60 A;  5I0C A;  1XE4 A;  3W6S A;  1J4J A;  2P6E A;  2FSR A;  3PGP A;  1Q2Y A;  2REE A;  5IV0 A;  3E0K A;  1I21 A;  4DNC A;  3UY5 A;  1Y9K A;  4NEX A;  1M4I A;  4MY0 A;  4XPL A;  2B5G B;  3D3S A;  3F5B A;  3I9S A;  2P6G A;  2B4D B;  4K30 A;  4KOV A;  1S7F A;  1QSR A;  3WR7 A;  4E8O A;  4IUS A;  3VWD A;  5C88 A;  2Q4V A;  2CNM A;  4HNY B;  1S7L A;  2Q4Y A;  1QSN A;  2FT0 A;  4KVO E;  4KOY A;  4RI1 A;  3GY9 A;  4FD5 A;  3QAH A;  4J3G A;  1UFH A;  3CXQ A;  4F0Y A;  2RC4 A;  1OZP A;  1BO4 A;  2WPW A;  3G8W A;  2J8N A;  3TCV A;  3NE7 A;  1YVK A;  5E96 A;  5IX3 A;  1M4D A;  4EVY A;  1MJ9 A;  3F0A A;  5H84 A;  4FD4 A;  2PQ8 A;  4U5Y A;  4NF1 A;  2B3U A;  3D2P A;  1XF8 A;  3B8G A;  4FD6 A;  4QVT A;  2VZZ A;  1Z4R A;  2CNS A;  2PRB A;  1S3Z A;  4KOT A;  2FCK A;  2BEI A;  2P6F A;  3TO7 A;  5CNP A;  1I12 A;  4E2A A;  1XIX A;  3IGR A;  4YRH A;  4R9M A;  4JD6 A;  3W6X A;  3SXO A;  1Z9U A;  3FBU A;  4JLY A;  2G3A A;  2J8M A;  4II9 A;  1IID A;  2FL4 A;  4ONU A;  4CAV A;  1M1D A;  5DWM A;  3ZJ0 A;  4B5P B;  4BMH A;  2OZG A;  4ORF A;  4PK2 A;  4CRZ B;  3CXS A;  1YK3 A;  1B6B A;  4GS4 A;  3JVN A;  2PR8 A;  3TO6 A;  1YVO A;  2GE3 A;  2WPX A;  2I79 A;  2HV2 A;  2ZPA A;  5J8C A;  4KOS A;  3TOA A;  2KCW A;  3PZJ A;  3P2H A;  2CY2 A;  2ZW7 A;  5F49 A;  4NSQ A;  3SHP A;  4CRY B;  2B4B A;  4HNX B;  3F8K A;  5ISV A;  4KOW A;  3EY5 A;  4I49 A;  4HNW B;  3DNS A;  3EXN A;  2B5G A;  1IYK A;  2ZW4 A;  1IIC A;  5KTA A;  1B87 A;  3D8P A;  4RS2 A; 
#chains in the Genus database with same CATH topology
 1TF9 A;  2B4D A;  3I1U A;  1Q2C A;  2R8V A;  4AG7 A;  3WC7 A;  4DJL A;  1IOF A;  2DXQ A;  3VAR A;  4W9Y A;  3JUW A;  2JLM A;  3FB3 A;  4B14 A;  1XEB A;  3I3G A;  4ZY1 A;  4F9V A;  2RFH A;  2R98 A;  3BXM A;  4C7I A;  4FAI A;  4MFQ A;  1S7N A;  4L8A A;  4KLW A;  4OIW A;  4CYN A;  3G3S A;  4M3S A;  2Q4Z A;  4HPS A;  1AYE A;  1V0C A;  2PJ2 A;  3NE8 A;  4OP4 A;  5LYF A;  5HH1 A;  2EUI A;  4CYQ A;  4MI4 A;  3KKW A;  1DE4 C;  3B3V A;  4ZGY B;  2Q0Y A;  4CGM A;  2OU2 A;  1YGH A;  2V8V A;  2DPS A;  4UEE A;  1NE9 A;  2C1C A;  4LQG A;  2DEA A;  1M44 A;  1PU9 A;  1SQH A;  2JEV A;  3EFA A;  2Z3N A;  1Z8X A;  5C82 A;  3DLJ A;  3FNC A;  2RB7 A;  2PJ7 A;  4OLL A;  3BI1 A;  3CZX A;  1VHE A;  4P4B A;  1Y7R A;  2Q44 A;  2NYQ A;  4NFR A;  3DDD A;  5EC4 A;  3BLN A;  4QBJ A;  3R96 A;  2OZU A;  2CIJ A;  2EBJ A;  4UEZ A;  1Y0R A;  3R95 A;  1YRE A;  1M4G A;  4ZI6 A;  2OZH A;  4AB7 A;  2GU2 A;  3S6G A;  3R9G A;  2Z3K A;  4H2K A;  1PUA A;  4Z65 A;  4A37 A;  4KVX A;  5I4M A;  4QUS A;  2EVN A;  1CBX A;  2CXA A;  1FY7 A;  5LRG A;  1CM0 A;  2QML A;  1JWQ A;  3D2M A;  3K9U A;  5CPA A;  1TKJ A;  2A4N A;  3H8G A;  4UF4 A;  2PIY A;  1A2Z A;  3S9L A;  3T9Y A;  2JDD A;  5KTC A;  1XJO A;  2GLF A;  3NA6 A;  5EMI A;  2D4P A;  5K8P A;  3DR6 A;  4CGL A;  2ATR A;  2V8D A;  4F6A A;  4NGS A;  5K8O A;  2QVP A;  4TNU A;  3LWU A;  2Q51 A;  4UCP A;  5AG4 A;  2GIV A;  2BSW A;  3FXT A;  3QB8 A;  4R57 A;  4YGO A;  3KQX A;  2AFW A;  4H6U A;  4ZYQ A;  3RBU A;  1TIQ A;  2OB0 A;  4MFK A;  3IJ3 A;  2JBJ A;  3L2N A;  3FIX A;  5AG5 A;  4B13 A;  4NGM A;  3FEC A;  2PJC A;  2Y0M A;  4P4J A;  1F2P A;  1R3N A;  1VKC A;  2BCO A;  4Q36 A;  5DWN A;  2P0W A;  1X10 A;  4PXD A;  2JBK A;  4ZBG A;  1X12 A;  1F2O A;  3IEH A;  3TT2 A;  4NGT A;  1YR0 A;  4FWU A;  1S5K A;  3GIU A;  4C7H A;  1LOK A;  5G21 A;  4ZY0 A;  3LOD A;  2QYV A;  4OID A;  1HDQ A;  4LQ6 A;  4B5P A;  3PB8 X;  4MHD A;  4PQA A;  1IU8 A;  1XRY A;  2F5I A;  3H4Q A;  3PBB A;  2FS5 A;  3IFE A;  4R3K A;  2JDC A;  5G1Z A;  3MGD A;  5HVG A;  2VQY A;  6CPA A;  2BL1 A;  2VBQ A;  3GKR A;  5CBM A;  1NMT A;  2PVW A;  3T90 A;  4XPK A;  2ZOF A;  2XEI A;  3HUV A;  3B3W A;  4KZT A;  1KZF A;  3R9E A;  4B6Z A;  4JXQ A;  2CNT A;  3IIB A;  3DR8 A;  3LD2 A;  3WAB A;  1P4N A;  1Z8L A;  1LRZ A;  2AE6 A;  4OAD A;  4C68 A;  4B11 A;  1CJW A;  2QIR A;  1CG2 A;  2HUZ A;  5THW A;  2BUE A;  2J8R A;  4FUU A;  7CPA A;  4YFJ A;  5J8F A;  3TTH A;  4MRI A;  1R57 A;  2GAN A;  4OC2 A;  1TKH A;  2PJ1 A;  2ZEP A;  5KTD A;  1GHE A;  4AG9 A;  2AJ6 A;  1QSM A;  1VGY A;  5F47 A;  1ZLI A;  1MJA A;  2ZED A;  4A95 A;  2F8H A;  4IF5 A;  4LX9 A;  5K8M A;  2CTB A;  2OH1 A;  3NH4 A;  4UWJ A;  3PFE A;  4CAE A;  4KLV A;  1NSL A;  1Z8T A;  4P6Y A;  5JPH A;  1IB1 E;  2ARH A;  4OC5 A;  2G3T A;  2GLJ A;  4PSW A;  4PV6 A;  2Z3M A;  1BOB A;  4XPD B;  2HQY A;  2HB6 A;  4GXH A;  3CXP A;  4B5O A;  2REF A;  3W91 A;  3B3S A;  3S9M A;  4AXV A;  4MJ8 A;  1DTD A;  4KOR A;  3PB7 X;  3D7F A;  1K4J A;  1IGB A;  1WWZ A;  4X8I A;  3PP9 A;  4MY3 A;  1QMU A;  2PJ4 A;  4A30 A;  4UWI A;  3MRU A;  2XEF A;  4DUK A;  4XNH C;  1RO5 A;  2VL1 A;  3PBE A;  5D29 A;  4OC4 A;  4NXY A;  5JM6 A;  4MFL A;  4H6Z A;  4MXU A;  4P4E A;  2PDO A;  1Q2D A;  1NSA A;  2ANP A;  2YNC C;  2DF5 A;  2AFO A;  5JQ4 A;  4UBR A;  3C26 A;  3KAS A;  4ZX8 A;  2H5M A;  3DGV A;  4MMO A;  4OME A;  4CAW A;  4MBU A;  2WZN A;  1KUX A;  5LYD A;  2G9D A;  4Q38 A;  2Z11 A;  4F0X A;  4P4I A;  1Y9W A;  3FF3 A;  4PSX A;  4QB9 A;  2FXF A;  1TKF A;  3HLP A;  4R7M A;  2PC1 A;  4AVB A;  3N7Z A;  4JWP A;  4R6T A;  1OBR A;  3CPX A;  3TE4 A;  2R7H A;  3LMS A;  2ZW5 A;  3VAT A;  1QST A;  4PXC A;  3ZZI A;  1UWY A;  5AGE A;  4E0A A;  4P45 A;  2OR4 A;  3V8I A;  4R87 A;  3GYA A;  4Y49 C;  1Z5R A;  4A32 A;  4U9Y A;  3QAY A;  1IY7 A;  4FD7 A;  1I1D A;  4MHN A;  4UCM A;  1MK4 A;  3V38 A;  4G1P A;  1P0H A;  1BLL E;  5GCN A;  4A38 A;  4EFD A;  1N71 A;  2Z3L A;  3PEI A;  4OC3 A;  3R9F A;  5LRK A;  5G20 A;  4P4F A;  4U9Z A;  2WYR A;  3CT9 A;  2B3V A;  4UA3 A;  2C27 A;  4MCP A;  1XMB A;  4R3L A;  4JXR A;  3TOB A;  4HKF A;  1CP6 A;  4X3R A;  5HVF A;  3FX6 A;  3R1K A;  1Y0Y A;  3BI0 A;  4C2Z A;  1Q7L A;  1Z2L A;  4WJB A;  1CPS A;  2ZW6 A;  4KVM E;  2Z10 A;  4UEF A;  3PB4 X;  1FNO A;  2PJ9 A;  1U6M A;  2NMT A;  3KHX A;  4R8F A;  4L89 A;  3WT4 A;  3KQZ A;  4NGP A;  1YX0 A;  4PPZ A;  2R1I A;  2B58 A;  3KI9 A;  1IYL A;  4MFP A;  5G22 A;  4DYO A;  4ONW A;  2FE7 A;  2IL4 A;  3PFO A;  3PB9 X;  2X7B A;  3CPA A;  4M85 A;  4QC6 A;  4TWE A;  3SJX A;  4C2Y A;  4CGO A;  2Q04 A;  1HEE A;  4H89 A;  3VWE A;  4X5K A;  4MHY A;  4A94 A;  3EC4 A;  2O28 A;  3S6H A;  4KUB A;  1LFW A;  4OAE A;  1KUV A;  2PJ6 A;  2PE3 A;  2VZY A;  1WK4 A;  4XPD C;  5D8N A;  4CAX A;  5F46 A;  3SJF A;  2PSW A;  1ON0 A;  4PXE A;  2ZEO A;  3FRM A;  3IO1 A;  1Z4E A;  2GRE A;  3TO9 A;  1JQG A;  3P2F A;  2VXK A;  2FIA A;  4F8Z A;  1XMT A;  2EWB A;  4NGQ A;  1MJB A;  3KR5 A;  3TX8 A;  3S6K A;  2PCU A;  4XNH B;  3PB6 X;  3S6F A;  1H8L A;  2EK8 A;  3BJ7 A;  3FYN A;  3IWG A;  4UFX A;  4A2Z A;  3IWW A;  2O53 A;  4KUA A;  3KHZ A;  4JJX A;  1RXT A;  2C6G A;  5HMN A;  4RN7 A;  4KOX A;  1S7K A;  1ZG7 A;  2HC9 A;  3D7D A;  2ZEM A;  2G0B A;  2Z0Z A;  1AUG A;  1YME A;  5H86 A;  5J1Q A;  3KGQ A;  1Y7E A;  2FIW A;  1VHS A;  2ZEF A;  1TXR A;  4IHM A;  4CYP A;  1KUY A;  3RAM A;  5IB0 A;  2Q7B A;  2I00 A;  2VEZ A;  3D7H A;  2BO9 A;  3OWC A;  1LAP A;  1ZG8 A;  3NH5 A;  3SXN A;  2ZEH A;  4B12 A;  2VI7 A;  4NJR A;  4PK3 A;  1YLE A;  1VHO A;  3K2K A;  3RNZ A;  3LAC A;  8CPA A;  2ZXV A;  4AVC A;  3DSB A;  3H8E A;  3EO4 A;  3GLJ A;  3ISX A;  4NCZ A;  4AVA A;  2PR1 A;  1QSO A;  4LUA A;  3D4U A;  2D4O A;  3D67 A;  3SJG A;  3A9L A;  3B7I A;  2ABZ A;  2WUU A;  4MHZ A;  4JZ0 A;  1KWM A;  5F48 A;  1F57 A;  4Y49 B;  3FMC A;  5FVJ A;  1YLO A;  1L0C A;  4EME A;  4KOU A;  2Q7S A;  3H5Z A;  3B3C A;  4MCQ A;  4BBH A;  3BJ8 A;  5EBV A;  2QEC A;  1ELM P;  1FT7 A;  2K5T A;  3RYO A;  4A31 A;  4CS0 B;  3TFY A;  4X2T A;  2GFQ A;  5I0C A;  4UFW A;  3RZA A;  4B10 A;  3IU1 A;  1XE4 A;  4P4D A;  3W6S A;  4R76 A;  1J4J A;  2P6E A;  2FSR A;  3PGP A;  4IK2 A;  4UIA A;  1Q2Y A;  3H8F A;  2NSM A;  2AFZ A;  2REE A;  2ODF A;  4ZX9 A;  4FBE A;  5IV0 A;  2IMO A;  2QJ8 A;  3E0K A;  1HDU A;  1I21 A;  1LAM A;  3KZW A;  4KSA A;  5LRJ A;  4DNC A;  4JYW A;  3UY5 A;  3D66 A;  4C2X A;  2WSA A;  5DS0 A;  2I3C A;  2DPT A;  4YWY A;  1Y9K A;  4NEX A;  1M4I A;  3D68 A;  4F9U A;  4MY0 A;  4XPL A;  4KSI A;  2B5G B;  5ELY A;  3D3S A;  3F5B A;  4CGP A;  2F7V A;  3I9S A;  4GM5 A;  2XEJ A;  4NGR A;  5HVH A;  2P6G A;  4A33 A;  2B4D B;  4P44 A;  3FED A;  1M4L A;  4K3N A;  3B35 A;  4K30 A;  1S7F A;  1QSR A;  4KOV A;  3WR7 A;  4E8O A;  4UIB A;  4IUS A;  3VWD A;  5C88 A;  4RUH A;  1LCP A;  3FH4 A;  1PCA A;  4BD9 A;  2Q4V A;  3N5F A;  4UFV A;  1XOV A;  3QNV A;  2CNM A;  4HNY B;  1BAV A;  1S7L A;  2Q4Y A;  2Z3P A;  5AG6 A;  1QSN A;  3SI1 A;  2FT0 A;  2CTC A;  4KVO E;  5A27 A;  4BIN A;  2AFU A;  3FJU A;  3GUX A;  2Z3O A;  3BHX A;  4KOY A;  4RI1 A;  3GY9 A;  4FD5 A;  3QAH A;  4J3G A;  1UFH A;  5IX3 A;  2JEW A;  2PJ0 A;  3CXQ A;  4F0Y A;  1ARL A;  1XFO A;  2RC4 A;  3NH8 A;  4MFJ A;  1OZP A;  3IWE A;  4KSF A;  1BO4 A;  2WPW A;  3G8W A;  2J8N A;  3TCV A;  3NE7 A;  1YVK A;  2OOT A;  4A39 A;  1R43 A;  2ZEG A;  5E96 A;  2ZOG A;  4ZY2 A;  1M4D A;  1CPX A;  3B2Y A;  3WC5 A;  1MJ9 A;  4EVY A;  3F0A A;  5H84 A;  4FD4 A;  2PRQ A;  2PQ8 A;  1IOI A;  5IB9 A;  4U5Y A;  4NF1 A;  4CAF A;  3T8W A;  5F09 A;  2B3U A;  3D2P A;  1XF8 A;  2IQ6 A;  1QQ9 A;  2V8H A;  3B8G A;  2VZZ A;  2C6C A;  4FD6 A;  1Z4R A;  4QVT A;  5HXD A;  2CNS A;  2PRB A;  3PRT A;  2PJ8 A;  1BPM A;  4CGN A;  1S3Z A;  1ZO0 A;  4KS9 A;  1ZLH A;  4KOT A;  4M6G A;  3B3T A;  2FCK A;  1EE3 P;  3FVL A;  4MFZ A;  1PYT B;  2BEI A;  2V77 A;  2O4H A;  2P6F A;  3TO7 A;  4PXB A;  4CPA A;  5CNP A;  1I12 A;  3JRU A;  2PIZ A;  4E2A A;  4WWV A;  4MCR A;  2YNC A;  1XIX A;  2BOA A;  3IGR A;  1ELL P;  3WC6 A;  5JH9 A;  4YRH A;  4R9M A;  4JD6 A;  3W6X A;  2PJB A;  1YQE A;  1Z9U A;  3FBU A;  3IC1 A;  4JLY A;  3SXO A;  2G3A A;  2J8M A;  2POK A;  4II9 A;  2IJZ A;  1Z8W A;  1IID A;  4EWT A;  2EK9 A;  2YND A;  2AFS A;  2YGW A;  1YW6 A;  2FL4 A;  4ONU A;  1GYT A;  4UCN A;  4CAV A;  1RTQ A;  4YU9 A;  4P10 A;  1M1D A;  2XEG A;  1LAN A;  4M6H A;  5DWM A;  5LYI A;  3D8P A;  3ZJ0 A;  4B5P B;  5A28 A;  4BMH A;  2OZG A;  4ORF A;  4PK2 A;  4CRZ B;  4CYO A;  2Q43 A;  3KR4 A;  3CXS A;  1AMP A;  1YK3 A;  1B6B A;  4M6I A;  4OKO A;  4GS4 A;  3JVN A;  1YW4 A;  2PR8 A;  3FEE A;  3TO6 A;  1ARM A;  1YVO A;  5BWA B;  2ZEN A;  2GE3 A;  2PVV A;  5K8N A;  2WPX A;  3V7Z A;  2I79 A;  2HV2 A;  3NFZ A;  3SI0 A;  2AFM A;  1CX8 A;  3KL9 A;  2EO8 A;  1ZG9 A;  3CDX A;  3K9T A;  4MHP A;  4OC0 A;  3SJE A;  2C6P A;  3ISZ A;  1VIX A;  4IAV A;  2ZPA A;  3JTK A;  3MN8 A;  3D7G A;  2YNE A;  5J8C A;  1TF8 A;  4KOS A;  1YSJ A;  3TOA A;  2KCW A;  3PZJ A;  4NJQ A;  4OC1 A;  4Q7A A;  4MCS A;  3P2H A;  3IU2 A;  2CY2 A;  1XBU A;  3VH9 A;  2ZW7 A;  5F49 A;  4NSQ A;  2V8G A;  3RO0 A;  3SHP A;  2ZEL A;  4CRY B;  2AFX A;  2B4B A;  3S9N A;  4HNX B;  1CP7 A;  2J9A A;  4NGN A;  3F8K A;  2CF4 A;  3GB0 A;  5ISV A;  4O23 A;  4KOW A;  3EY5 A;  5JGF A;  3SI2 A;  2PJ5 A;  2PJA A;  2FVG A;  4I49 A;  1BPN A;  3DNS A;  3EXN A;  2B5G A;  4HNW B;  1IYK A;  2ZW4 A;  1IIC A;  5AG7 A;  5KTA A;  3TC8 A;  5LYL A;  2PJ3 A;  1B87 A;  1S60 A;  4RS2 A;  2ZEE A; 
#chains in the Genus database with same CATH homology
 2B4D A;  1Q2C A;  2R8V A;  4AG7 A;  2DXQ A;  3JUW A;  2JLM A;  3FB3 A;  4B14 A;  1XEB A;  3I3G A;  2R98 A;  4C7I A;  4MFQ A;  1S7N A;  4L8A A;  4KLW A;  4CYN A;  3G3S A;  4M3S A;  1V0C A;  5HH1 A;  2EUI A;  4CYQ A;  4MI4 A;  3KKW A;  4ZGY B;  2Q0Y A;  4CGM A;  2OU2 A;  1YGH A;  2DPS A;  1NE9 A;  1M44 A;  1PU9 A;  1SQH A;  2JEV A;  3EFA A;  2Z3N A;  5C82 A;  3FNC A;  4OLL A;  4XPD C;  5EC4 A;  1Y7R A;  2Q44 A;  3DDD A;  3BLN A;  4QBJ A;  3R96 A;  2OZU A;  3R95 A;  1YRE A;  1M4G A;  2OZH A;  4AB7 A;  3S6G A;  3R9G A;  2Z3K A;  1PUA A;  4KVX A;  4QUS A;  2EVN A;  2CXA A;  1FY7 A;  1CM0 A;  2QML A;  3D2M A;  3K9U A;  2A4N A;  3T9Y A;  2JDD A;  5KTC A;  2D4P A;  3DR6 A;  4CGL A;  2ATR A;  4F6A A;  4UCP A;  5AG4 A;  2GIV A;  2BSW A;  3FXT A;  3QB8 A;  4R57 A;  4YGO A;  4H6U A;  1TIQ A;  2OB0 A;  4MFK A;  5AG5 A;  3FIX A;  4B13 A;  2Y0M A;  1VKC A;  4Q36 A;  5DWN A;  2P0W A;  4ZBG A;  3TT2 A;  1YR0 A;  1S5K A;  4C7H A;  5G21 A;  3LOD A;  4B5P A;  4MHD A;  2F5I A;  3H4Q A;  2FS5 A;  5G1Z A;  4R3K A;  2JDC A;  3MGD A;  2VQY A;  2BL1 A;  2VBQ A;  3GKR A;  1NMT A;  3T90 A;  4XPK A;  4KZT A;  3R9E A;  1KZF A;  4JXQ A;  2CNT A;  3LD2 A;  3DR8 A;  1P4N A;  1LRZ A;  2AE6 A;  4OAD A;  4C68 A;  4B11 A;  1CJW A;  2QIR A;  2HUZ A;  2BUE A;  2J8R A;  4YFJ A;  5J8F A;  3TTH A;  1R57 A;  2GAN A;  5KTD A;  1GHE A;  4AG9 A;  2AJ6 A;  1QSM A;  5F47 A;  1MJA A;  4A95 A;  4IF5 A;  4LX9 A;  2OH1 A;  4CAE A;  4UWJ A;  4KLV A;  1NSL A;  5JPH A;  1IB1 E;  2ARH A;  2G3T A;  4PSW A;  4PV6 A;  2Z3M A;  1BOB A;  4XPD B;  2HQY A;  3CXP A;  4B5O A;  2REF A;  3W91 A;  4MJ8 A;  4KOR A;  1K4J A;  1WWZ A;  3PP9 A;  4MY3 A;  4A30 A;  4UWI A;  4XNH C;  1RO5 A;  4NXY A;  4MFL A;  4H6Z A;  2PDO A;  1Q2D A;  2YNC C;  5JQ4 A;  4UBR A;  3C26 A;  2H5M A;  4CAW A;  4MBU A;  1KUX A;  4F0X A;  4Q38 A;  2Z11 A;  1Y9W A;  4PSX A;  4QB9 A;  2FXF A;  2PC1 A;  4AVB A;  3N7Z A;  4JWP A;  3TE4 A;  2R7H A;  2ZW5 A;  1QST A;  3ZZI A;  5AGE A;  4E0A A;  3V8I A;  4R87 A;  3GYA A;  4Y49 C;  4A32 A;  4U9Y A;  4FD7 A;  1I1D A;  4UCM A;  1MK4 A;  1P0H A;  5GCN A;  1N71 A;  2Z3L A;  3R9F A;  5G20 A;  4U9Z A;  2B3V A;  4UA3 A;  2C27 A;  4R3L A;  4JXR A;  3TOB A;  4HKF A;  3R1K A;  4C2Z A;  2ZW6 A;  4KVM E;  2Z10 A;  1U6M A;  2NMT A;  4L89 A;  1YX0 A;  2R1I A;  2B58 A;  1IYL A;  4MFP A;  5G22 A;  2FE7 A;  2IL4 A;  2X7B A;  4M85 A;  4QC6 A;  4CGO A;  4C2Y A;  2Q04 A;  4H89 A;  3VWE A;  4X5K A;  3EC4 A;  2O28 A;  3S6H A;  4KUB A;  4OAE A;  1KUV A;  2VZY A;  1WK4 A;  5F46 A;  4CAX A;  2PSW A;  1ON0 A;  3FRM A;  1Z4E A;  3TO9 A;  3P2F A;  2VXK A;  2FIA A;  1XMT A;  1MJB A;  3S6K A;  4XNH B;  3S6F A;  3FYN A;  3BJ7 A;  4UFX A;  4A2Z A;  3IWG A;  4KUA A;  4JJX A;  1RXT A;  5HMN A;  4KOX A;  1S7K A;  2G0B A;  2Z0Z A;  5H86 A;  2FIW A;  1VHS A;  4CYP A;  5IB0 A;  1KUY A;  2Q7B A;  2I00 A;  2VEZ A;  3OWC A;  3SXN A;  4B12 A;  2VI7 A;  4PK3 A;  1YLE A;  2ZXV A;  4AVC A;  3DSB A;  3EO4 A;  4AVA A;  4NCZ A;  2PR1 A;  1QSO A;  4LUA A;  2D4O A;  3A9L A;  2WUU A;  5F48 A;  4Y49 B;  5FVJ A;  1L0C A;  4KOU A;  3H5Z A;  4BBH A;  3BJ8 A;  5EBV A;  2QEC A;  3RYO A;  4A31 A;  2K5T A;  3TFY A;  4CS0 B;  1S60 A;  5I0C A;  4UFW A;  4B10 A;  3IU1 A;  1XE4 A;  3W6S A;  1J4J A;  2P6E A;  2FSR A;  3PGP A;  1Q2Y A;  2REE A;  5IV0 A;  3E0K A;  1I21 A;  4DNC A;  4KSA A;  3UY5 A;  4C2X A;  2WSA A;  2DPT A;  1Y9K A;  4NEX A;  1M4I A;  4MY0 A;  4XPL A;  2B5G B;  3D3S A;  3F5B A;  4CGP A;  3I9S A;  2P6G A;  4A33 A;  2B4D B;  4K30 A;  4KOV A;  1S7F A;  1QSR A;  3WR7 A;  4E8O A;  4IUS A;  3VWD A;  5C88 A;  2Q4V A;  4UFV A;  2CNM A;  4HNY B;  1S7L A;  2Q4Y A;  2Z3P A;  5AG6 A;  1QSN A;  2FT0 A;  4KVO E;  5A27 A;  2Z3O A;  4KOY A;  4RI1 A;  3GY9 A;  4FD5 A;  3QAH A;  4J3G A;  1UFH A;  3CXQ A;  4F0Y A;  2RC4 A;  4MFJ A;  1OZP A;  3IWE A;  4KSF A;  1BO4 A;  2WPW A;  3G8W A;  2J8N A;  3TCV A;  3NE7 A;  1YVK A;  5E96 A;  5IX3 A;  1M4D A;  4EVY A;  1MJ9 A;  3F0A A;  5H84 A;  4FD4 A;  2PQ8 A;  4U5Y A;  4NF1 A;  4CAF A;  2B3U A;  3D2P A;  1XF8 A;  3B8G A;  4FD6 A;  4QVT A;  2VZZ A;  1Z4R A;  2CNS A;  2PRB A;  4CGN A;  1S3Z A;  1ZO0 A;  4KS9 A;  4KOT A;  2FCK A;  4MFZ A;  2BEI A;  2P6F A;  3TO7 A;  5CNP A;  1I12 A;  4E2A A;  2YNC A;  1XIX A;  3IGR A;  4YRH A;  4R9M A;  4JD6 A;  3W6X A;  3SXO A;  1Z9U A;  3FBU A;  4JLY A;  2G3A A;  2J8M A;  4II9 A;  1IID A;  2YND A;  2YGW A;  4UCN A;  2FL4 A;  4ONU A;  4CAV A;  1M1D A;  5A28 A;  5DWM A;  3ZJ0 A;  4B5P B;  4BMH A;  2OZG A;  4ORF A;  4PK2 A;  4CRZ B;  4CYO A;  3CXS A;  1YK3 A;  1B6B A;  4GS4 A;  3JVN A;  2PR8 A;  3TO6 A;  1YVO A;  5BWA B;  2GE3 A;  2WPX A;  2I79 A;  2HV2 A;  2ZPA A;  3JTK A;  2YNE A;  5J8C A;  4KOS A;  3TOA A;  2KCW A;  3PZJ A;  3P2H A;  3IU2 A;  2CY2 A;  2ZW7 A;  5F49 A;  4NSQ A;  3SHP A;  4CRY B;  2B4B A;  4HNX B;  3F8K A;  5ISV A;  4KOW A;  3EY5 A;  4I49 A;  4HNW B;  3DNS A;  3EXN A;  2B5G A;  1IYK A;  2ZW4 A;  1IIC A;  5AG7 A;  5KTA A;  1B87 A;  3D8P A;  4RS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...