5HMNA

Crystal structure of an aminoglycoside acetyltransferase hmb0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
SLDVHQLSPNEVALMETLLATFGEAFNDMETYTGNRPRGAYSRRLLESDYFIALAALEYGEIVGGLAAYELKKFEQERSEIYIYDLAVAKAHRRRGIATALIEKLKELGAARGAYVIFVQADTAIEDEPAIALYSKLGVREEVLHFDIPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAC3-I
publication title Crystal structure of an aminoglycoside acetyltransferase HMB0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol
rcsb
source organism Uncultured bacterium
molecule tags Transferase
total genus 33
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5hmnA00
1Q2YA 1QSMA 2QMLA 3GY9A 3TE4A 4FD6A 2FIWA 2I79A 1MJ9A 1KUYA 2VI7A 4CRZB 2VXKA 1Z9UA 1U6MA 3CXSA 4YRHA 3DSBA 2EUIA 1CM0A 3LD2A 4X5KA 3W91A 5DWMA 2HV2A 2JLMA 2R98A 2FSRA 2J8RA 4MBUA 2OZHA 4YGOA 4AVAA 5IB0A 2Q7BA 4KOWA 4QC6A 3UY5A 1LRZA 2Q44A 3FRMA 4LUAA 4UA3A 4MY0A 3SXOA 1S7LA 2B4DA 1MJAA 1YREA 4CRYB 3FYNA 1CJWA 1XE4A 2P6GA 5C82A 5KTDA 5EC4A 4MY3A 3TOAA 3R96A 3DDDA 5F47A 2OB0A 1RO5A 1S7KA 3N7ZA 4HNXB 4KOUA 3TO6A 2CNMA 3T9YA 2JDCA 1NE9A 2H5MA 3S6GA 3TO7A 3F0AA 1QSTA 4K30A 2HQYA 3FB3A 1VKCA 1N71A 2G3TA 3TCVA 2PQ8A 5DWNA 3W6XA 1IICA 3NE7A 4CAVA 3T90A 5IX3A 3R9GA 4KVOE 4CAWA 3GKRA 5F49A 1L0CA 1IYLA 3MGDA 4R3KA 4KUAA 2OZUA 4XPKA 1M1DA 4KOVA 3B8GA 4CS0B 2FXFA 3VWEA 4NF1A 4E8OA 4R3LA 4ORFA 3GYAA 5C88A 1UFHA 4AVBA 2P6EA 3PGPA 3TOBA 3RYOA 4B5PB 2HUZA 3G8WA 3JUWA 5J8CA 2R1IA 3DNSA 3SXNA 1KUVA 4B5PA 2VQYA 4L89A 4Y49C 2B58A 1K4JA 1P0HA 5KTAA 3FIXA 1YGHA 1YLEA 1J4JA 3G3SA 4FD5A 2ZW7A 4QBJA 4HNYB 4M3SA 3FNCA 3P2HA 1YX0A 2B3UA 4L8AA 1P4NA 3TT2A 4Y49B 2BEIA 2P0WA 4BMHA 4KVXA 2REEA 3EY5A 2Q0YA 3QB8A 4KZTA 5JPHA 4DNCA 1I21A 1XMTA 1NSLA 1M4DA 2NMTA 4JLYA 1BO4A 2IL4A 2DXQA 1S7FA 2ZW5A 2AJ6A 1IB1E 2PR8A 2J8MA 1Q2CA 4F0YA 2B4DB 4KVME 3KKWA 4NEXA 3BLNA 2A4NA 4QUSA 2X7BA 2Q4VA 1KZFA 2P6FA 4U5YA 5F48A 4KLWA 1M4GA 3D2MA 2CNTA 5CNPA 4KOYA 4LX9A 1TIQA 4R57A 3TTHA 2OH1A 2VBQA 3D3SA 3CXPA 3I3GA 2VZYA 4UWIA 5H84A 4UWJA 2REFA 3TO9A 1XIXA 4EVYA 1MK4A 3PZJA 3R9EA 4CAXA 5GCNA 1Y9WA 2B5GA 3D8PA 1IYKA 2F5IA 3DR6A 3K9UA 4R9MA 3S6HA 4PV6A 3R1KA 1Y7RA 1WK4A 2PSWA 5I0CA 4M85A 5EBVA 3SHPA 2PRBA 3BJ8A 1M44A 2GE3A 4IUSA 3EXNA 4RS2A 2EVNA 2ZW6A 3EFAA 3F5BA 4OADA 1I12A 2Z10A 4KOSA 1BOBA 2KCWA 2FT0A 4F6AA 1XF8A 4GS4A 4H6UA 1Z4EA 4FD4A 2CY2A 3I9SA 4U9ZA 2Q04A 3OWCA 4PSWA 3ZJ0A 1QSRA 2PC1A 3VWDA 3FXTA 1Q2DA 2GIVA 2ZW4A 4PK2A 2CNSA 5E96A 1I1DA 1Y9KA 2FL4A 1S60A 1WWZA 3EC4A 2R7HA 3EO4A 3PP9A 2JEVA 2Z11A 4NCZA 4NXYA 2VZZA 2D4PA 2JDDA 2Q4YA 4UBRA 2BSWA 2O28A 2QIRA 2OZGA 4HNWB 3LODA 3WR7A 1PU9A 4YFJA 5IV0A 4MHDA 4JD6A 1QSNA 4JXRA 4AB7A 2ZXVA 4E0AA 5JQ4A 5H86A 3C26A 1MJBA 2QECA 4PSXA 1XEBA 4J3GA 4JWPA 4XPDC 4E2AA 1B87A 4AG9A 1KUXA 4QB9A 1Z4RA 4NSQA 1R57A 3H4QA 4XPDB 1YK3A 1VHSA 4XNHC 2B5GB 2AE6A 2PDOA 2WPXA 4KORA 3S6KA 1S7NA 4JXQA 4ONUA 2RC4A 3S6FA 3R95A 5KTCA 3D2PA 1NMTA 1GHEA 4XNHB 2R8VA 3DR8A 3TFYA 1M4IA 1RXTA 4RI1A 1FY7A 1YVKA 2OU2A 3QAHA 5ISVA 3ZZIA 5J8FA 4OAEA 2J8NA 4FD7A 3IGRA 3FBUA 2Y0MA 1SQHA 1YVOA 2B3VA 1PUAA 2WPWA 2D4OA 4B5OA 5FVJA 2G0BA 2BUEA 1B6BA 4MI4A 3CXQA 4IF5A 5F46A 2PR1A 3JVNA 4ZBGA 1OZPA 2FE7A 2B4BA 2G3AA 4MJ8A 2C27A 4KLVA 1V0CA 3F8KA 4JJXA 4R87A 3BJ7A 4HKFA 4H89A 2I00A 4H6ZA 3P2FA 4OLLA 1S3ZA 2ATRA 1YR0A 4I49A 4QVTA 2FCKA 4PK3A 2FIAA 4XPLA 2ARHA 3IWGA 5HMNA 4KOXA 4AG7A 2ZPAA 5HH1A 4KUBA 1QSOA 2K5TA 3E0KA 4U9YA 4KOTA 1S5KA 4AVCA 1IIDA 2GANA 1ON0A 3W6SA 2Z0ZA 2VEZA 4II9A 3R9FA 2BL1A 3V8IA 2FS5A
chains in the Genus database with same CATH superfamily
4MHNA 1Z8WA 1HDQA 1Q2YA 1QSMA 2QMLA 4F9VA 2Z3KA 3GY9A 3TE4A 2Q51A 3VATA 4FD6A 1FT7A 6CPAA 2GLFA 5AG7A 2V8VA 2Q43A 3FF3A 3DGVA 3D4UA 2FIWA 3IWWA 2V8DA 2I79A 4RUHA 4JZ0A 1MJ9A 2PJ4A 1KUYA 2O53A 2VI7A 3B3VA 2VXKA 1BPNA 1Z9UA 3NFZA 4ZX9A 4C7IA 4CRZB 1H8LA 1F57A 1U6MA 5HVHA 1IOIA 1AUGA 3CXSA 2Z3OA 4YRHA 3SJFA 4A33A 3BHXA 3DSBA 2EUIA 1M4LA 4PQAA 1CM0A 1LOKA 5G1ZA 4MXUA 3LD2A 4X5KA 4YWYA 1CP6A 3W91A 5DWMA 5AGEA 2HV2A 1XBUA 3IEHA 4UIBA 2ODFA 2JLMA 3K2KA 1YLOA 2R98A 2FSRA 4FWUA 4K3NA 2IJZA 2J8RA 4EWTA 2PJ3A 3KR5A 4MBUA 2OZHA 4YGOA 3IU1A 4AVAA 5A28A 4BINA 2Q7BA 4KOWA 4QC6A 5IB0A 2ANPA 1LRZA 4TNUA 3UY5A 2Q44A 1Z8LA 4A95A 3FRMA 4B6ZA 7CPAA 4LUAA 5IX3A 4UA3A 4MCRA 4MY0A 3SXOA 1S7LA 1QQ9A 4NGRA 2B4DA 4CGPA 1MJAA 1YW6A 2PJCA 2QVPA 1XRYA 1YMEA 1YREA 3B2YA 4A30A 4MFLA 4CGNA 4CRYB 3FYNA 2AFWA 2IMOA 1CJWA 1XE4A 2P6GA 4MHZA 5C82A 5KTDA 1LCPA 4P6YA 5EC4A 4DJLA 4MY3A 3TOAA 5LRKA 1JQGA 2GFQA 4A2ZA 2FVGA 3R96A 2EK9A 1IY7A 1KWMA 2Q7SA 1IGBA 3DDDA 3PBBA 2CIJA 4MHYA 2OB0A 5F47A 4R7MA 4WJBA 2YGWA 1RO5A 4ZY2A 1S7KA 3N7ZA 4CYPA 1Y7EA 4P4EA 5BWAB 3V7ZA 3H5ZA 1VHEA 4HNXB 4KOUA 1TKJA 2QJ8A 2CNMA 2V8GA 4MFPA 4P4BA 3TO6A 3VH9A 2I3CA 2PJ1A 3NH5A 4Q38A 4UFXA 2JDCA 4IAVA 1NE9A 3T9YA 1GYTA 2AFMA 2H5MA 4NGTA 3S6GA 3TO7A 5LRGA 3F0AA 3QAYA 4JYWA 1QSTA 4K30A 2HQYA 3FB3A 2WZNA 3CT9A 1VKCA 3NA6A 1BLLE 4UCPA 4A38A 1N71A 2G3TA 4MRIA 2ZEGA 3TCVA 2PQ8A 1LANA 5DWNA 3W6XA 1IICA 3NE7A 4NJQA 4CAVA 3T90A 3S9MA 3R9GA 4KVOE 4NGPA 5G20A 2DPSA 4YU9A 4ZX8A 4P10A 4CAWA 3GKRA 5F49A 2YNEA 1YW4A 2ZEDA 1L0CA 1IYLA 3D7FA 3MGDA 1Y0YA 3SJXA 3FMCA 4A94A 4R3KA 4KUAA 2OZUA 3IFEA 4FUUA 4XPKA 1M1DA 1ARMA 4KOVA 3IC1A 1VHOA 2PE3A 2POKA 3B8GA 1R3NA 4Z65A 5HVFA 3CDXA 4C2ZA 2PJ6A 4CS0B 2FXFA 3VWEA 4NJRA 4NF1A 4E8OA 3WABA 3ISXA 4ORFA 4R3LA 1IOFA 4M6GA 5IB9A 3GYAA 5C88A 1UFHA 1Z2LA 2GU2A 4AVBA 2PRQA 3GB0A 3LMSA 2P6EA 3SI2A 3PGPA 3TOBA 3FH4A 3RYOA 3HUVA 4B5PB 1FNOA 4R76A 2HUZA 3G8WA 3IWEA 3JUWA 2JEWA 2YNDA 5J8CA 2PJ8A 2R1IA 5AG4A 1CG2A 2PVWA 3DNSA 3SXNA 4ONWA 1KUVA 4B5PA 1PYTB 2AFOA 2VQYA 4L89A 4Y49C 4NGQA 2B58A 1K4JA 1P0HA 1PCAA 4KSFA 3FIXA 4OC5A 5KTAA 1JWQA 1YGHA 1YLEA 1J4JA 3G3SA 4FD5A 1CX8A 2ZEHA 2ZW7A 5JGFA 4QBJA 3D67A 4ZYQA 3KHXA 3NH8A 4HNYB 2ZOGA 4M3SA 3FNCA 3P2HA 1YX0A 2BOAA 2B3UA 3CZXA 1P4NA 4L8AA 5THWA 4Y49B 3TT2A 1X12A 2BEIA 2P0WA 2RB7A 3FEEA 4BMHA 4KVXA 2REEA 4AXVA 3EY5A 1Z8TA 2Q0YA 3QB8A 2PJ2A 4KZTA 1ZG8A 3WT4A 5JPHA 4DNCA 1I21A 1XMTA 1NSLA 1ELMP 1M4DA 1Z5RA 4RN7A 2NMTA 5A27A 4JLYA 1BO4A 1AMPA 2IL4A 2DXQA 1S7FA 2ZW5A 2XEFA 2AJ6A 3BI1A 3WC7A 3I1UA 2PJBA 4G1PA 5F09A 1IB1E 2PR8A 3PBEA 1HEEA 2J8MA 5JH9A 8CPAA 1Q2CA 4F0YA 3PB7X 2PIYA 2PCUA 2B4DB 4KVME 3KKWA 4NEXA 2DPTA 3BLNA 2A4NA 1YSJA 2PJAA 4QUSA 3PFEA 4A31A 2X7BA 2Q4VA 1KZFA 4PXBA 1YQEA 5D8NA 1ARLA 4C2YA 2P6FA 3D7GA 2OOTA 4PXEA 4U5YA 5F48A 5K8MA 4KLWA 1M4GA 2C1CA 2CNTA 3D2MA 5CNPA 3K9TA 4KOYA 4X2TA 4LX9A 2HC9A 1TIQA 2NSMA 4R57A 4KS9A 4UIAA 4KSIA 3SI1A 3TTHA 4ZY1A 2V77A 1DTDA 2OH1A 3IU2A 2C6CA 2VBQA 4HPSA 4W9YA 1CPXA 3D3SA 3CXPA 1NSAA 3I3GA 3PFOA 2VZYA 1EE3P 2ZENA 4UWIA 5H84A 4UWJA 2REFA 4NGSA 4CYQA 4F0XA 3TO9A 3TC8A 4Q7AA 1XIXA 4EVYA 4GXHA 1MK4A 3PZJA 3IJ3A 3R9EA 4CAXA 5GCNA 1X10A 3H8FA 3RAMA 1Y9WA 2B5GA 2CF4A 5LYLA 3D8PA 4A39A 1IYKA 1ZLHA 1TKHA 2F5IA 1VIXA 3DR6A 4C2XA 3K9UA 4C7HA 4MMOA 3FECA 2JBJA 3RO0A 2Z3LA 4R9MA 3D66A 4OC0A 3S6HA 4PV6A 4P4JA 3RBUA 3R1KA 1Y7RA 1WK4A 2PSWA 4TWEA 3H8GA 3NH4A 5I0CA 1VGYA 3JTKA 4M85A 5EBVA 3SHPA 2PRBA 3BJ8A 3VARA 1M44A 2C6PA 2GREA 2GE3A 4IUSA 1F2PA 4MFJA 2DEAA 3KR4A 1HDUA 3EXNA 4IK2A 3GIUA 4RS2A 2EVNA 2ZW6A 4BBHA 3HLPA 3EFAA 2C6GA 4UF4A 3F5BA 4OADA 4NGNA 4FBEA 1I12A 2Z10A 3MRUA 3FJUA 4F9UA 2ZEMA 3KZWA 2WUUA 5DS0A 3S9NA 4CAEA 1CP7A 4KOSA 4ZY0A 1BOBA 2KCWA 2FT0A 4F6AA 1XF8A 4GS4A 4MFZA 4H6UA 3GUXA 3JRUA 1CBXA 1Z4EA 4FD4A 1RTQA 2CY2A 3I9SA 4A32A 4U9ZA 2PVVA 2Q04A 1ELLP 3OWCA 4PSWA 3ZJ0A 2EO8A 3CPXA 2Z3PA 1QSRA 4OP4A 5CPAA 3WC6A 4EMEA 2PC1A 3VWDA 1ZO0A 4GM5A 4P4FA 3IO1A 5ELYA 3FXTA 1Q2DA 4FAIA 3SJGA 2GIVA 2VL1A 3L2NA 3D7HA 4NGMA 2RFHA 3T8WA 2ZW4A 4PK2A 2CNSA 4MCSA 1Y0RA 5E96A 1I1DA 1Y9KA 2FL4A 3D68A 2AFSA 4UEEA 1S60A 4MFQA 1WWZA 3EC4A 2R7HA 3EO4A 1LFWA 2BCOA 3PP9A 2JEVA 2Z11A 3B35A 4NCZA 2WYRA 4NXYA 1ZG7A 4H2KA 2G9DA 4CYOA 4OMEA 2VZZA 4OC2A 2F7VA 3LWUA 2D4PA 2XEIA 3PB9X 2JDDA 5LYFA 3H8EA 4MHPA 2Q4YA 1Q7LA 2XEGA 4UBRA 3N5FA 1LAPA 2BSWA 2O28A 2QIRA 5HXDA 2OZGA 4HNWB 3RNZA 2PJ0A 4OC4A 1BPMA 1TXRA 2ZOFA 2ZEPA 3LODA 4OIWA 3WR7A 2XEJA 1PU9A 3LACA 4YFJA 4MHDA 5IV0A 4JD6A 1QSNA 2PJ7A 3PEIA 3IIBA 4CYNA 3S9LA 4F8ZA 4JXRA 4O23A 4AB7A 5G21A 2ZXVA 4UEFA 5LYDA 4E0AA 2ZELA 5I4MA 2AFXA 5JQ4A 1IU8A 5H86A 4B10A 3B3WA 4CGMA 4OC3A 1R43A 1MJBA 2QECA 3C26A 3MN8A 4C68A 4PSXA 2Z3NA 1XEBA 4CAFA 4CGOA 1TF8A 4J3GA 2EK8A 4JWPA 2ZEOA 3KQXA 3DLJA 4XPDC 4E2AA 1B87A 5JM6A 4AG9A 2YNCC 2BO9A 4P4IA 4Q36A 4PXDA 2Z3MA 1KUXA 4X8IA 1OBRA 2HB6A 3FX6A 4CPAA 4B12A 5J1QA 5EMIA 4ZI6A 4QB9A 1Z4RA 4UCNA 5LYIA 1AYEA 4NSQA 1R57A 5AG5A 3H4QA 4XPDB 1YK3A 1VHSA 2ABZA 2PJ9A 3A9LA 2O4HA 3SJEA 4XNHC 2B5GB 2AE6A 2PDOA 2WPXA 3ISZA 4KORA 3S6KA 4B11A 1S7NA 4UCMA 2GLJA 4PPZA 3B7IA 4B13A 4JXQA 4MCPA 4ONUA 2CTCA 2EWBA 3KHZA 4NFRA 4EFDA 2RC4A 3S6FA 3R95A 3PB8X 1ZG9A 5KTCA 2YNCA 3D2PA 4MCQA 5K8NA 1NMTA 1GHEA 4X3RA 4CGLA 3SI0A 4XNHB 2R8VA 2ZEFA 3DR8A 1DE4C 3TFYA 1M4IA 3NE8A 4UFWA 1RXTA 1XOVA 4RI1A 1FY7A 2F8HA 2AFUA 4R8FA 4UFVA 1YVKA 2OU2A 3PRTA 3QAHA 5G22A 4B14A 3FEDA 3B3CA 3ZZIA 5ISVA 5J8FA 4OAEA 3V38A 2J8NA 1ZLIA 2V8HA 1QMUA 4FD7A 3IGRA 3FBUA 2Y0MA 1SQHA 1YVOA 3PB6X 2B3VA 2PIZA 1PUAA 2WPWA 2D4OA 4B5OA 2JBKA 5FVJA 2G0BA 3BXMA 2BUEA 5AG6A 1B6BA 2Q4ZA 1A2ZA 4MI4A 4LQ6A 3KL9A 3CXQA 4IF5A 4WWVA 2ZEEA 3D7DA 4ZGYB 3CPAA 2CTBA 5F46A 2PJ5A 2PR1A 3JVNA 4ZBGA 3KGQA 1OZPA 2FE7A 2B4BA 3BI0A 2G3AA 4MJ8A 2IQ6A 2C27A 3B3SA 2DF5A 3QNVA 4KLVA 3KASA 1UWYA 1V0CA 3F8KA 4JJXA 4R87A 3BJ7A 4R6TA 2NYQA 4HKFA 4H89A 3WC5A 2I00A 1XFOA 1LAMA 3PB4X 4H6ZA 3GLJA 4KSAA 4LQGA 4P45A 2CXAA 3P2FA 2WSAA 4OLLA 1S3ZA 1TF9A 1F2OA 5CBMA 2ATRA 4M6HA 1YR0A 4I49A 4QVTA 4PXCA 4DYOA 2J9AA 2FCKA 4PK3A 3KI9A 3RZAA 3TX8A 2FIAA 4BD9A 4XPLA 2ARHA 4A37A 1BAVA 4P4DA 3IWGA 4OKOA 5D29A 5HMNA 1CPSA 5K8OA 4P44A 4KOXA 4AG7A 4M6IA 5LRJA 5HVGA 2ZPAA 1XMBA 3FVLA 5HH1A 4DUKA 4KUBA 1QSOA 2QYVA 2K5TA 3E0KA 4U9YA 4MFKA 1XJOA 4KOTA 3KQZA 1S5KA 4AVCA 1Z8XA 1IIDA 2GANA 4OC1A 2EBJA 1ON0A 3W6SA 2Z0ZA 1TKFA 2OR4A 3V8IA 4IHMA 2VEZA 3B3TA 5K8PA 4II9A 3R9FA 2AFZA 4UEZA 2BL1A 4OIDA 2FS5A
chains in the Genus database with same CATH topology
1Q2YA 1QSMA 2QMLA 2Z3KA 3GY9A 3TE4A 4FD6A 5AG7A 2FIWA 2I79A 1MJ9A 1KUYA 4C7IA 2VI7A 4CRZB 2VXKA 1Z9UA 1U6MA 3CXSA 2Z3OA 4YRHA 4A33A 3DSBA 2EUIA 5G1ZA 1CM0A 3LD2A 4X5KA 3W91A 5DWMA 5AGEA 2HV2A 2JLMA 2R98A 2FSRA 2J8RA 4MBUA 2OZHA 4YGOA 3IU1A 4AVAA 5A28A 5IB0A 2Q7BA 4KOWA 4QC6A 3UY5A 1LRZA 2Q44A 4A95A 3FRMA 4LUAA 4UA3A 4MY0A 3SXOA 1S7LA 2B4DA 4CGPA 1MJAA 1YREA 4CGNA 4A30A 4MFLA 4CRYB 3FYNA 1CJWA 1XE4A 2P6GA 5C82A 5KTDA 5EC4A 4MY3A 3TOAA 4A2ZA 3R96A 3DDDA 5F47A 2OB0A 2YGWA 1RO5A 1S7KA 3N7ZA 4CYPA 5BWAB 3H5ZA 4HNXB 4KOUA 4MFPA 3TO6A 2CNMA 4Q38A 3T9YA 4UFXA 2JDCA 1NE9A 2H5MA 3S6GA 3TO7A 3F0AA 1QSTA 4K30A 2HQYA 3FB3A 1VKCA 4UCPA 1N71A 2G3TA 3TCVA 2PQ8A 5DWNA 3W6XA 1IICA 3NE7A 4CAVA 3T90A 5IX3A 3R9GA 4KVOE 5G20A 2DPSA 4CAWA 3GKRA 5F49A 2YNEA 1L0CA 1IYLA 3MGDA 4R3KA 4KUAA 2OZUA 4XPKA 1M1DA 4KOVA 3B8GA 4C2ZA 4CS0B 2FXFA 3VWEA 4NF1A 4E8OA 4R3LA 4ORFA 3GYAA 5C88A 1UFHA 4AVBA 2P6EA 3PGPA 3TOBA 3RYOA 4B5PB 2HUZA 3G8WA 3IWEA 3JUWA 2YNDA 5J8CA 2R1IA 5AG4A 3DNSA 3SXNA 1KUVA 4B5PA 2VQYA 4L89A 4Y49C 2B58A 1K4JA 1P0HA 4KSFA 5KTAA 3FIXA 1YGHA 1YLEA 1J4JA 3G3SA 4FD5A 2ZW7A 4QBJA 4HNYB 4M3SA 3FNCA 3P2HA 1YX0A 2B3UA 4L8AA 1P4NA 3TT2A 4Y49B 2BEIA 2P0WA 4BMHA 4KVXA 2REEA 3EY5A 2Q0YA 3QB8A 4KZTA 5JPHA 4DNCA 1I21A 1XMTA 1NSLA 1M4DA 2NMTA 5A27A 4JLYA 1BO4A 2IL4A 2DXQA 1S7FA 2ZW5A 2AJ6A 1IB1E 2PR8A 2J8MA 1Q2CA 4F0YA 2B4DB 4KVME 3KKWA 4NEXA 2DPTA 3BLNA 2A4NA 4QUSA 4A31A 2X7BA 2Q4VA 1KZFA 4C2YA 2P6FA 4U5YA 5F48A 4KLWA 1M4GA 3D2MA 2CNTA 5CNPA 4KOYA 4LX9A 1TIQA 4R57A 4KS9A 3TTHA 2OH1A 3IU2A 2VBQA 3D3SA 3CXPA 3I3GA 2VZYA 4UWIA 5H84A 4UWJA 2REFA 4CYQA 4F0XA 3TO9A 1XIXA 4EVYA 1MK4A 3PZJA 3R9EA 4CAXA 5GCNA 1Y9WA 2B5GA 3D8PA 1IYKA 2F5IA 3DR6A 4C2XA 3K9UA 4C7HA 2Z3LA 4R9MA 3S6HA 4PV6A 3R1KA 1Y7RA 1WK4A 2PSWA 5I0CA 3JTKA 4M85A 5EBVA 3SHPA 2PRBA 3BJ8A 1M44A 2GE3A 4IUSA 4MFJA 3EXNA 4RS2A 2EVNA 2ZW6A 4BBHA 3EFAA 3F5BA 4OADA 1I12A 2Z10A 2WUUA 4CAEA 4KOSA 1BOBA 2KCWA 2FT0A 4F6AA 1XF8A 4GS4A 4MFZA 4H6UA 1Z4EA 4FD4A 2CY2A 3I9SA 4A32A 4U9ZA 2Q04A 3OWCA 4PSWA 3ZJ0A 2Z3PA 1QSRA 2PC1A 3VWDA 1ZO0A 3FXTA 1Q2DA 2GIVA 2ZW4A 4PK2A 2CNSA 5E96A 1I1DA 1Y9KA 2FL4A 1S60A 4MFQA 1WWZA 3EC4A 2R7HA 3EO4A 3PP9A 2JEVA 2Z11A 4NCZA 4NXYA 4CYOA 2VZZA 2D4PA 2JDDA 2Q4YA 4UBRA 2BSWA 2O28A 2QIRA 2OZGA 4HNWB 3LODA 3WR7A 1PU9A 4YFJA 5IV0A 4MHDA 4JD6A 1QSNA 4CYNA 4JXRA 4AB7A 5G21A 2ZXVA 4E0AA 5JQ4A 5H86A 4B10A 4CGMA 3C26A 1MJBA 2QECA 4C68A 4PSXA 2Z3NA 1XEBA 4CAFA 4CGOA 4J3GA 4JWPA 4XPDC 4E2AA 1B87A 4AG9A 2YNCC 4Q36A 2Z3MA 1KUXA 4B12A 4QB9A 1Z4RA 4UCNA 4NSQA 1R57A 5AG5A 3H4QA 4XPDB 1YK3A 1VHSA 3A9LA 4XNHC 2B5GB 2AE6A 2PDOA 2WPXA 4KORA 3S6KA 4B11A 1S7NA 4UCMA 4B13A 4JXQA 4ONUA 2RC4A 3S6FA 3R95A 5KTCA 2YNCA 3D2PA 1NMTA 1GHEA 4CGLA 4XNHB 2R8VA 3DR8A 3TFYA 1M4IA 4UFWA 1RXTA 4RI1A 1FY7A 4UFVA 1YVKA 2OU2A 3QAHA 5G22A 5ISVA 4B14A 3ZZIA 5J8FA 4OAEA 2J8NA 4FD7A 3IGRA 3FBUA 2Y0MA 1SQHA 1YVOA 2B3VA 1PUAA 2WPWA 2D4OA 4B5OA 5FVJA 2G0BA 2BUEA 5AG6A 1B6BA 4MI4A 3CXQA 4IF5A 4ZGYB 5F46A 2PR1A 3JVNA 4ZBGA 1OZPA 2FE7A 2B4BA 2G3AA 4MJ8A 2C27A 4KLVA 1V0CA 3F8KA 4JJXA 4R87A 3BJ7A 4HKFA 4H89A 2I00A 4KSAA 4H6ZA 2CXAA 3P2FA 2WSAA 4OLLA 1S3ZA 2ATRA 1YR0A 4I49A 4QVTA 2FCKA 4PK3A 2FIAA 4XPLA 2ARHA 3IWGA 5HMNA 4KOXA 4AG7A 2ZPAA 5HH1A 4KUBA 1QSOA 2K5TA 3E0KA 4U9YA 4MFKA 4KOTA 1S5KA 4AVCA 1IIDA 2GANA 1ON0A 3W6SA 2Z0ZA 2VEZA 4II9A 3R9FA 2BL1A 3V8IA 2FS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q2Y A;  1QSM A;  2QML A;  3GY9 A;  3TE4 A;  4FD6 A;  2FIW A;  2I79 A;  1MJ9 A;  1KUY A;  2VI7 A;  4CRZ B;  2VXK A;  1Z9U A;  1U6M A;  3CXS A;  4YRH A;  3DSB A;  2EUI A;  1CM0 A;  3LD2 A;  4X5K A;  3W91 A;  5DWM A;  2HV2 A;  2JLM A;  2R98 A;  2FSR A;  2J8R A;  4MBU A;  2OZH A;  4YGO A;  4AVA A;  5IB0 A;  2Q7B A;  4KOW A;  4QC6 A;  3UY5 A;  1LRZ A;  2Q44 A;  3FRM A;  4LUA A;  4UA3 A;  4MY0 A;  3SXO A;  1S7L A;  2B4D A;  1MJA A;  1YRE A;  4CRY B;  3FYN A;  1CJW A;  1XE4 A;  2P6G A;  5C82 A;  5KTD A;  5EC4 A;  4MY3 A;  3TOA A;  3R96 A;  3DDD A;  5F47 A;  2OB0 A;  1RO5 A;  1S7K A;  3N7Z A;  4HNX B;  4KOU A;  3TO6 A;  2CNM A;  3T9Y A;  2JDC A;  1NE9 A;  2H5M A;  3S6G A;  3TO7 A;  3F0A A;  1QST A;  4K30 A;  2HQY A;  3FB3 A;  1VKC A;  1N71 A;  2G3T A;  3TCV A;  2PQ8 A;  5DWN A;  3W6X A;  1IIC A;  3NE7 A;  4CAV A;  3T90 A;  5IX3 A;  3R9G A;  4KVO E;  4CAW A;  3GKR A;  5F49 A;  1L0C A;  1IYL A;  3MGD A;  4R3K A;  4KUA A;  2OZU A;  4XPK A;  1M1D A;  4KOV A;  3B8G A;  4CS0 B;  2FXF A;  3VWE A;  4NF1 A;  4E8O A;  4R3L A;  4ORF A;  3GYA A;  5C88 A;  1UFH A;  4AVB A;  2P6E A;  3PGP A;  3TOB A;  3RYO A;  4B5P B;  2HUZ A;  3G8W A;  3JUW A;  5J8C A;  2R1I A;  3DNS A;  3SXN A;  1KUV A;  4B5P A;  2VQY A;  4L89 A;  4Y49 C;  2B58 A;  1K4J A;  1P0H A;  5KTA A;  3FIX A;  1YGH A;  1YLE A;  1J4J A;  3G3S A;  4FD5 A;  2ZW7 A;  4QBJ A;  4HNY B;  4M3S A;  3FNC A;  3P2H A;  1YX0 A;  2B3U A;  4L8A A;  1P4N A;  3TT2 A;  4Y49 B;  2BEI A;  2P0W A;  4BMH A;  4KVX A;  2REE A;  3EY5 A;  2Q0Y A;  3QB8 A;  4KZT A;  5JPH A;  4DNC A;  1I21 A;  1XMT A;  1NSL A;  1M4D A;  2NMT A;  4JLY A;  1BO4 A;  2IL4 A;  2DXQ A;  1S7F A;  2ZW5 A;  2AJ6 A;  1IB1 E;  2PR8 A;  2J8M A;  1Q2C A;  4F0Y A;  2B4D B;  4KVM E;  3KKW A;  4NEX A;  3BLN A;  2A4N A;  4QUS A;  2X7B A;  2Q4V A;  1KZF A;  2P6F A;  4U5Y A;  5F48 A;  4KLW A;  1M4G A;  3D2M A;  2CNT A;  5CNP A;  4KOY A;  4LX9 A;  1TIQ A;  4R57 A;  3TTH A;  2OH1 A;  2VBQ A;  3D3S A;  3CXP A;  3I3G A;  2VZY A;  4UWI A;  5H84 A;  4UWJ A;  2REF A;  3TO9 A;  1XIX A;  4EVY A;  1MK4 A;  3PZJ A;  3R9E A;  4CAX A;  5GCN A;  1Y9W A;  2B5G A;  3D8P A;  1IYK A;  2F5I A;  3DR6 A;  3K9U A;  4R9M A;  3S6H A;  4PV6 A;  3R1K A;  1Y7R A;  1WK4 A;  2PSW A;  5I0C A;  4M85 A;  5EBV A;  3SHP A;  2PRB A;  3BJ8 A;  1M44 A;  2GE3 A;  4IUS A;  3EXN A;  4RS2 A;  2EVN A;  2ZW6 A;  3EFA A;  3F5B A;  4OAD A;  1I12 A;  2Z10 A;  4KOS A;  1BOB A;  2KCW A;  2FT0 A;  4F6A A;  1XF8 A;  4GS4 A;  4H6U A;  1Z4E A;  4FD4 A;  2CY2 A;  3I9S A;  4U9Z A;  2Q04 A;  3OWC A;  4PSW A;  3ZJ0 A;  1QSR A;  2PC1 A;  3VWD A;  3FXT A;  1Q2D A;  2GIV A;  2ZW4 A;  4PK2 A;  2CNS A;  5E96 A;  1I1D A;  1Y9K A;  2FL4 A;  1S60 A;  1WWZ A;  3EC4 A;  2R7H A;  3EO4 A;  3PP9 A;  2JEV A;  2Z11 A;  4NCZ A;  4NXY A;  2VZZ A;  2D4P A;  2JDD A;  2Q4Y A;  4UBR A;  2BSW A;  2O28 A;  2QIR A;  2OZG A;  4HNW B;  3LOD A;  3WR7 A;  1PU9 A;  4YFJ A;  5IV0 A;  4MHD A;  4JD6 A;  1QSN A;  4JXR A;  4AB7 A;  2ZXV A;  4E0A A;  5JQ4 A;  5H86 A;  3C26 A;  1MJB A;  2QEC A;  4PSX A;  1XEB A;  4J3G A;  4JWP A;  4XPD C;  4E2A A;  1B87 A;  4AG9 A;  1KUX A;  4QB9 A;  1Z4R A;  4NSQ A;  1R57 A;  3H4Q A;  4XPD B;  1YK3 A;  1VHS A;  4XNH C;  2B5G B;  2AE6 A;  2PDO A;  2WPX A;  4KOR A;  3S6K A;  1S7N A;  4JXQ A;  4ONU A;  2RC4 A;  3S6F A;  3R95 A;  5KTC A;  3D2P A;  1NMT A;  1GHE A;  4XNH B;  2R8V A;  3DR8 A;  3TFY A;  1M4I A;  1RXT A;  4RI1 A;  1FY7 A;  1YVK A;  2OU2 A;  3QAH A;  5ISV A;  3ZZI A;  5J8F A;  4OAE A;  2J8N A;  4FD7 A;  3IGR A;  3FBU A;  2Y0M A;  1SQH A;  1YVO A;  2B3V A;  1PUA A;  2WPW A;  2D4O A;  4B5O A;  5FVJ A;  2G0B A;  2BUE A;  1B6B A;  4MI4 A;  3CXQ A;  4IF5 A;  5F46 A;  2PR1 A;  3JVN A;  4ZBG A;  1OZP A;  2FE7 A;  2B4B A;  2G3A A;  4MJ8 A;  2C27 A;  4KLV A;  1V0C A;  3F8K A;  4JJX A;  4R87 A;  3BJ7 A;  4HKF A;  4H89 A;  2I00 A;  4H6Z A;  3P2F A;  4OLL A;  1S3Z A;  2ATR A;  1YR0 A;  4I49 A;  4QVT A;  2FCK A;  4PK3 A;  2FIA A;  4XPL A;  2ARH A;  3IWG A;  5HMN A;  4KOX A;  4AG7 A;  2ZPA A;  5HH1 A;  4KUB A;  1QSO A;  2K5T A;  3E0K A;  4U9Y A;  4KOT A;  1S5K A;  4AVC A;  1IID A;  2GAN A;  1ON0 A;  3W6S A;  2Z0Z A;  2VEZ A;  4II9 A;  3R9F A;  2BL1 A;  3V8I A;  2FS5 A; 
#chains in the Genus database with same CATH topology
 4MHN A;  1Z8W A;  1HDQ A;  1Q2Y A;  1QSM A;  2QML A;  4F9V A;  2Z3K A;  3GY9 A;  3TE4 A;  2Q51 A;  3VAT A;  4FD6 A;  1FT7 A;  6CPA A;  2GLF A;  5AG7 A;  2V8V A;  2Q43 A;  3FF3 A;  3DGV A;  3D4U A;  2FIW A;  3IWW A;  2V8D A;  2I79 A;  4RUH A;  4JZ0 A;  1MJ9 A;  2PJ4 A;  1KUY A;  2O53 A;  2VI7 A;  3B3V A;  2VXK A;  1BPN A;  1Z9U A;  3NFZ A;  4ZX9 A;  4C7I A;  4CRZ B;  1H8L A;  1F57 A;  1U6M A;  5HVH A;  1IOI A;  1AUG A;  3CXS A;  2Z3O A;  4YRH A;  3SJF A;  4A33 A;  3BHX A;  3DSB A;  2EUI A;  1M4L A;  4PQA A;  1CM0 A;  1LOK A;  5G1Z A;  4MXU A;  3LD2 A;  4X5K A;  4YWY A;  1CP6 A;  3W91 A;  5DWM A;  5AGE A;  2HV2 A;  1XBU A;  3IEH A;  4UIB A;  2ODF A;  2JLM A;  3K2K A;  1YLO A;  2R98 A;  2FSR A;  4FWU A;  4K3N A;  2IJZ A;  2J8R A;  4EWT A;  2PJ3 A;  3KR5 A;  4MBU A;  2OZH A;  4YGO A;  3IU1 A;  4AVA A;  5A28 A;  4BIN A;  2Q7B A;  4KOW A;  4QC6 A;  5IB0 A;  2ANP A;  1LRZ A;  4TNU A;  3UY5 A;  2Q44 A;  1Z8L A;  4A95 A;  3FRM A;  4B6Z A;  7CPA A;  4LUA A;  5IX3 A;  4UA3 A;  4MCR A;  4MY0 A;  3SXO A;  1S7L A;  1QQ9 A;  4NGR A;  2B4D A;  4CGP A;  1MJA A;  1YW6 A;  2PJC A;  2QVP A;  1XRY A;  1YME A;  1YRE A;  3B2Y A;  4A30 A;  4MFL A;  4CGN A;  4CRY B;  3FYN A;  2AFW A;  2IMO A;  1CJW A;  1XE4 A;  2P6G A;  4MHZ A;  5C82 A;  5KTD A;  1LCP A;  4P6Y A;  5EC4 A;  4DJL A;  4MY3 A;  3TOA A;  5LRK A;  1JQG A;  2GFQ A;  4A2Z A;  2FVG A;  3R96 A;  2EK9 A;  1IY7 A;  1KWM A;  2Q7S A;  1IGB A;  3DDD A;  3PBB A;  2CIJ A;  4MHY A;  2OB0 A;  5F47 A;  4R7M A;  4WJB A;  2YGW A;  1RO5 A;  4ZY2 A;  1S7K A;  3N7Z A;  4CYP A;  1Y7E A;  4P4E A;  5BWA B;  3V7Z A;  3H5Z A;  1VHE A;  4HNX B;  4KOU A;  1TKJ A;  2QJ8 A;  2CNM A;  2V8G A;  4MFP A;  4P4B A;  3TO6 A;  3VH9 A;  2I3C A;  2PJ1 A;  3NH5 A;  4Q38 A;  4UFX A;  2JDC A;  4IAV A;  1NE9 A;  3T9Y A;  1GYT A;  2AFM A;  2H5M A;  4NGT A;  3S6G A;  3TO7 A;  5LRG A;  3F0A A;  3QAY A;  4JYW A;  1QST A;  4K30 A;  2HQY A;  3FB3 A;  2WZN A;  3CT9 A;  1VKC A;  3NA6 A;  1BLL E;  4UCP A;  4A38 A;  1N71 A;  2G3T A;  4MRI A;  2ZEG A;  3TCV A;  2PQ8 A;  1LAN A;  5DWN A;  3W6X A;  1IIC A;  3NE7 A;  4NJQ A;  4CAV A;  3T90 A;  3S9M A;  3R9G A;  4KVO E;  4NGP A;  5G20 A;  2DPS A;  4YU9 A;  4ZX8 A;  4P10 A;  4CAW A;  3GKR A;  5F49 A;  2YNE A;  1YW4 A;  2ZED A;  1L0C A;  1IYL A;  3D7F A;  3MGD A;  1Y0Y A;  3SJX A;  3FMC A;  4A94 A;  4R3K A;  4KUA A;  2OZU A;  3IFE A;  4FUU A;  4XPK A;  1M1D A;  1ARM A;  4KOV A;  3IC1 A;  1VHO A;  2PE3 A;  2POK A;  3B8G A;  1R3N A;  4Z65 A;  5HVF A;  3CDX A;  4C2Z A;  2PJ6 A;  4CS0 B;  2FXF A;  3VWE A;  4NJR A;  4NF1 A;  4E8O A;  3WAB A;  3ISX A;  4ORF A;  4R3L A;  1IOF A;  4M6G A;  5IB9 A;  3GYA A;  5C88 A;  1UFH A;  1Z2L A;  2GU2 A;  4AVB A;  2PRQ A;  3GB0 A;  3LMS A;  2P6E A;  3SI2 A;  3PGP A;  3TOB A;  3FH4 A;  3RYO A;  3HUV A;  4B5P B;  1FNO A;  4R76 A;  2HUZ A;  3G8W A;  3IWE A;  3JUW A;  2JEW A;  2YND A;  5J8C A;  2PJ8 A;  2R1I A;  5AG4 A;  1CG2 A;  2PVW A;  3DNS A;  3SXN A;  4ONW A;  1KUV A;  4B5P A;  1PYT B;  2AFO A;  2VQY A;  4L89 A;  4Y49 C;  4NGQ A;  2B58 A;  1K4J A;  1P0H A;  1PCA A;  4KSF A;  3FIX A;  4OC5 A;  5KTA A;  1JWQ A;  1YGH A;  1YLE A;  1J4J A;  3G3S A;  4FD5 A;  1CX8 A;  2ZEH A;  2ZW7 A;  5JGF A;  4QBJ A;  3D67 A;  4ZYQ A;  3KHX A;  3NH8 A;  4HNY B;  2ZOG A;  4M3S A;  3FNC A;  3P2H A;  1YX0 A;  2BOA A;  2B3U A;  3CZX A;  1P4N A;  4L8A A;  5THW A;  4Y49 B;  3TT2 A;  1X12 A;  2BEI A;  2P0W A;  2RB7 A;  3FEE A;  4BMH A;  4KVX A;  2REE A;  4AXV A;  3EY5 A;  1Z8T A;  2Q0Y A;  3QB8 A;  2PJ2 A;  4KZT A;  1ZG8 A;  3WT4 A;  5JPH A;  4DNC A;  1I21 A;  1XMT A;  1NSL A;  1ELM P;  1M4D A;  1Z5R A;  4RN7 A;  2NMT A;  5A27 A;  4JLY A;  1BO4 A;  1AMP A;  2IL4 A;  2DXQ A;  1S7F A;  2ZW5 A;  2XEF A;  2AJ6 A;  3BI1 A;  3WC7 A;  3I1U A;  2PJB A;  4G1P A;  5F09 A;  1IB1 E;  2PR8 A;  3PBE A;  1HEE A;  2J8M A;  5JH9 A;  8CPA A;  1Q2C A;  4F0Y A;  3PB7 X;  2PIY A;  2PCU A;  2B4D B;  4KVM E;  3KKW A;  4NEX A;  2DPT A;  3BLN A;  2A4N A;  1YSJ A;  2PJA A;  4QUS A;  3PFE A;  4A31 A;  2X7B A;  2Q4V A;  1KZF A;  4PXB A;  1YQE A;  5D8N A;  1ARL A;  4C2Y A;  2P6F A;  3D7G A;  2OOT A;  4PXE A;  4U5Y A;  5F48 A;  5K8M A;  4KLW A;  1M4G A;  2C1C A;  2CNT A;  3D2M A;  5CNP A;  3K9T A;  4KOY A;  4X2T A;  4LX9 A;  2HC9 A;  1TIQ A;  2NSM A;  4R57 A;  4KS9 A;  4UIA A;  4KSI A;  3SI1 A;  3TTH A;  4ZY1 A;  2V77 A;  1DTD A;  2OH1 A;  3IU2 A;  2C6C A;  2VBQ A;  4HPS A;  4W9Y A;  1CPX A;  3D3S A;  3CXP A;  1NSA A;  3I3G A;  3PFO A;  2VZY A;  1EE3 P;  2ZEN A;  4UWI A;  5H84 A;  4UWJ A;  2REF A;  4NGS A;  4CYQ A;  4F0X A;  3TO9 A;  3TC8 A;  4Q7A A;  1XIX A;  4EVY A;  4GXH A;  1MK4 A;  3PZJ A;  3IJ3 A;  3R9E A;  4CAX A;  5GCN A;  1X10 A;  3H8F A;  3RAM A;  1Y9W A;  2B5G A;  2CF4 A;  5LYL A;  3D8P A;  4A39 A;  1IYK A;  1ZLH A;  1TKH A;  2F5I A;  1VIX A;  3DR6 A;  4C2X A;  3K9U A;  4C7H A;  4MMO A;  3FEC A;  2JBJ A;  3RO0 A;  2Z3L A;  4R9M A;  3D66 A;  4OC0 A;  3S6H A;  4PV6 A;  4P4J A;  3RBU A;  3R1K A;  1Y7R A;  1WK4 A;  2PSW A;  4TWE A;  3H8G A;  3NH4 A;  5I0C A;  1VGY A;  3JTK A;  4M85 A;  5EBV A;  3SHP A;  2PRB A;  3BJ8 A;  3VAR A;  1M44 A;  2C6P A;  2GRE A;  2GE3 A;  4IUS A;  1F2P A;  4MFJ A;  2DEA A;  3KR4 A;  1HDU A;  3EXN A;  4IK2 A;  3GIU A;  4RS2 A;  2EVN A;  2ZW6 A;  4BBH A;  3HLP A;  3EFA A;  2C6G A;  4UF4 A;  3F5B A;  4OAD A;  4NGN A;  4FBE A;  1I12 A;  2Z10 A;  3MRU A;  3FJU A;  4F9U A;  2ZEM A;  3KZW A;  2WUU A;  5DS0 A;  3S9N A;  4CAE A;  1CP7 A;  4KOS A;  4ZY0 A;  1BOB A;  2KCW A;  2FT0 A;  4F6A A;  1XF8 A;  4GS4 A;  4MFZ A;  4H6U A;  3GUX A;  3JRU A;  1CBX A;  1Z4E A;  4FD4 A;  1RTQ A;  2CY2 A;  3I9S A;  4A32 A;  4U9Z A;  2PVV A;  2Q04 A;  1ELL P;  3OWC A;  4PSW A;  3ZJ0 A;  2EO8 A;  3CPX A;  2Z3P A;  1QSR A;  4OP4 A;  5CPA A;  3WC6 A;  4EME A;  2PC1 A;  3VWD A;  1ZO0 A;  4GM5 A;  4P4F A;  3IO1 A;  5ELY A;  3FXT A;  1Q2D A;  4FAI A;  3SJG A;  2GIV A;  2VL1 A;  3L2N A;  3D7H A;  4NGM A;  2RFH A;  3T8W A;  2ZW4 A;  4PK2 A;  2CNS A;  4MCS A;  1Y0R A;  5E96 A;  1I1D A;  1Y9K A;  2FL4 A;  3D68 A;  2AFS A;  4UEE A;  1S60 A;  4MFQ A;  1WWZ A;  3EC4 A;  2R7H A;  3EO4 A;  1LFW A;  2BCO A;  3PP9 A;  2JEV A;  2Z11 A;  3B35 A;  4NCZ A;  2WYR A;  4NXY A;  1ZG7 A;  4H2K A;  2G9D A;  4CYO A;  4OME A;  2VZZ A;  4OC2 A;  2F7V A;  3LWU A;  2D4P A;  2XEI A;  3PB9 X;  2JDD A;  5LYF A;  3H8E A;  4MHP A;  2Q4Y A;  1Q7L A;  2XEG A;  4UBR A;  3N5F A;  1LAP A;  2BSW A;  2O28 A;  2QIR A;  5HXD A;  2OZG A;  4HNW B;  3RNZ A;  2PJ0 A;  4OC4 A;  1BPM A;  1TXR A;  2ZOF A;  2ZEP A;  3LOD A;  4OIW A;  3WR7 A;  2XEJ A;  1PU9 A;  3LAC A;  4YFJ A;  4MHD A;  5IV0 A;  4JD6 A;  1QSN A;  2PJ7 A;  3PEI A;  3IIB A;  4CYN A;  3S9L A;  4F8Z A;  4JXR A;  4O23 A;  4AB7 A;  5G21 A;  2ZXV A;  4UEF A;  5LYD A;  4E0A A;  2ZEL A;  5I4M A;  2AFX A;  5JQ4 A;  1IU8 A;  5H86 A;  4B10 A;  3B3W A;  4CGM A;  4OC3 A;  1R43 A;  1MJB A;  2QEC A;  3C26 A;  3MN8 A;  4C68 A;  4PSX A;  2Z3N A;  1XEB A;  4CAF A;  4CGO A;  1TF8 A;  4J3G A;  2EK8 A;  4JWP A;  2ZEO A;  3KQX A;  3DLJ A;  4XPD C;  4E2A A;  1B87 A;  5JM6 A;  4AG9 A;  2YNC C;  2BO9 A;  4P4I A;  4Q36 A;  4PXD A;  2Z3M A;  1KUX A;  4X8I A;  1OBR A;  2HB6 A;  3FX6 A;  4CPA A;  4B12 A;  5J1Q A;  5EMI A;  4ZI6 A;  4QB9 A;  1Z4R A;  4UCN A;  5LYI A;  1AYE A;  4NSQ A;  1R57 A;  5AG5 A;  3H4Q A;  4XPD B;  1YK3 A;  1VHS A;  2ABZ A;  2PJ9 A;  3A9L A;  2O4H A;  3SJE A;  4XNH C;  2B5G B;  2AE6 A;  2PDO A;  2WPX A;  3ISZ A;  4KOR A;  3S6K A;  4B11 A;  1S7N A;  4UCM A;  2GLJ A;  4PPZ A;  3B7I A;  4B13 A;  4JXQ A;  4MCP A;  4ONU A;  2CTC A;  2EWB A;  3KHZ A;  4NFR A;  4EFD A;  2RC4 A;  3S6F A;  3R95 A;  3PB8 X;  1ZG9 A;  5KTC A;  2YNC A;  3D2P A;  4MCQ A;  5K8N A;  1NMT A;  1GHE A;  4X3R A;  4CGL A;  3SI0 A;  4XNH B;  2R8V A;  2ZEF A;  3DR8 A;  1DE4 C;  3TFY A;  1M4I A;  3NE8 A;  4UFW A;  1RXT A;  1XOV A;  4RI1 A;  1FY7 A;  2F8H A;  2AFU A;  4R8F A;  4UFV A;  1YVK A;  2OU2 A;  3PRT A;  3QAH A;  5G22 A;  4B14 A;  3FED A;  3B3C A;  3ZZI A;  5ISV A;  5J8F A;  4OAE A;  3V38 A;  2J8N A;  1ZLI A;  2V8H A;  1QMU A;  4FD7 A;  3IGR A;  3FBU A;  2Y0M A;  1SQH A;  1YVO A;  3PB6 X;  2B3V A;  2PIZ A;  1PUA A;  2WPW A;  2D4O A;  4B5O A;  2JBK A;  5FVJ A;  2G0B A;  3BXM A;  2BUE A;  5AG6 A;  1B6B A;  2Q4Z A;  1A2Z A;  4MI4 A;  4LQ6 A;  3KL9 A;  3CXQ A;  4IF5 A;  4WWV A;  2ZEE A;  3D7D A;  4ZGY B;  3CPA A;  2CTB A;  5F46 A;  2PJ5 A;  2PR1 A;  3JVN A;  4ZBG A;  3KGQ A;  1OZP A;  2FE7 A;  2B4B A;  3BI0 A;  2G3A A;  4MJ8 A;  2IQ6 A;  2C27 A;  3B3S A;  2DF5 A;  3QNV A;  4KLV A;  3KAS A;  1UWY A;  1V0C A;  3F8K A;  4JJX A;  4R87 A;  3BJ7 A;  4R6T A;  2NYQ A;  4HKF A;  4H89 A;  3WC5 A;  2I00 A;  1XFO A;  1LAM A;  3PB4 X;  4H6Z A;  3GLJ A;  4KSA A;  4LQG A;  4P45 A;  2CXA A;  3P2F A;  2WSA A;  4OLL A;  1S3Z A;  1TF9 A;  1F2O A;  5CBM A;  2ATR A;  4M6H A;  1YR0 A;  4I49 A;  4QVT A;  4PXC A;  4DYO A;  2J9A A;  2FCK A;  4PK3 A;  3KI9 A;  3RZA A;  3TX8 A;  2FIA A;  4BD9 A;  4XPL A;  2ARH A;  4A37 A;  1BAV A;  4P4D A;  3IWG A;  4OKO A;  5D29 A;  5HMN A;  1CPS A;  5K8O A;  4P44 A;  4KOX A;  4AG7 A;  4M6I A;  5LRJ A;  5HVG A;  2ZPA A;  1XMB A;  3FVL A;  5HH1 A;  4DUK A;  4KUB A;  1QSO A;  2QYV A;  2K5T A;  3E0K A;  4U9Y A;  4MFK A;  1XJO A;  4KOT A;  3KQZ A;  1S5K A;  4AVC A;  1Z8X A;  1IID A;  2GAN A;  4OC1 A;  2EBJ A;  1ON0 A;  3W6S A;  2Z0Z A;  1TKF A;  2OR4 A;  3V8I A;  4IHM A;  2VEZ A;  3B3T A;  5K8P A;  4II9 A;  3R9F A;  2AFZ A;  4UEZ A;  2BL1 A;  4OID A;  2FS5 A; 
#chains in the Genus database with same CATH homology
 1Q2Y A;  1QSM A;  2QML A;  2Z3K A;  3GY9 A;  3TE4 A;  4FD6 A;  5AG7 A;  2FIW A;  2I79 A;  1MJ9 A;  1KUY A;  4C7I A;  2VI7 A;  4CRZ B;  2VXK A;  1Z9U A;  1U6M A;  3CXS A;  2Z3O A;  4YRH A;  4A33 A;  3DSB A;  2EUI A;  5G1Z A;  1CM0 A;  3LD2 A;  4X5K A;  3W91 A;  5DWM A;  5AGE A;  2HV2 A;  2JLM A;  2R98 A;  2FSR A;  2J8R A;  4MBU A;  2OZH A;  4YGO A;  3IU1 A;  4AVA A;  5A28 A;  5IB0 A;  2Q7B A;  4KOW A;  4QC6 A;  3UY5 A;  1LRZ A;  2Q44 A;  4A95 A;  3FRM A;  4LUA A;  4UA3 A;  4MY0 A;  3SXO A;  1S7L A;  2B4D A;  4CGP A;  1MJA A;  1YRE A;  4CGN A;  4A30 A;  4MFL A;  4CRY B;  3FYN A;  1CJW A;  1XE4 A;  2P6G A;  5C82 A;  5KTD A;  5EC4 A;  4MY3 A;  3TOA A;  4A2Z A;  3R96 A;  3DDD A;  5F47 A;  2OB0 A;  2YGW A;  1RO5 A;  1S7K A;  3N7Z A;  4CYP A;  5BWA B;  3H5Z A;  4HNX B;  4KOU A;  4MFP A;  3TO6 A;  2CNM A;  4Q38 A;  3T9Y A;  4UFX A;  2JDC A;  1NE9 A;  2H5M A;  3S6G A;  3TO7 A;  3F0A A;  1QST A;  4K30 A;  2HQY A;  3FB3 A;  1VKC A;  4UCP A;  1N71 A;  2G3T A;  3TCV A;  2PQ8 A;  5DWN A;  3W6X A;  1IIC A;  3NE7 A;  4CAV A;  3T90 A;  5IX3 A;  3R9G A;  4KVO E;  5G20 A;  2DPS A;  4CAW A;  3GKR A;  5F49 A;  2YNE A;  1L0C A;  1IYL A;  3MGD A;  4R3K A;  4KUA A;  2OZU A;  4XPK A;  1M1D A;  4KOV A;  3B8G A;  4C2Z A;  4CS0 B;  2FXF A;  3VWE A;  4NF1 A;  4E8O A;  4R3L A;  4ORF A;  3GYA A;  5C88 A;  1UFH A;  4AVB A;  2P6E A;  3PGP A;  3TOB A;  3RYO A;  4B5P B;  2HUZ A;  3G8W A;  3IWE A;  3JUW A;  2YND A;  5J8C A;  2R1I A;  5AG4 A;  3DNS A;  3SXN A;  1KUV A;  4B5P A;  2VQY A;  4L89 A;  4Y49 C;  2B58 A;  1K4J A;  1P0H A;  4KSF A;  5KTA A;  3FIX A;  1YGH A;  1YLE A;  1J4J A;  3G3S A;  4FD5 A;  2ZW7 A;  4QBJ A;  4HNY B;  4M3S A;  3FNC A;  3P2H A;  1YX0 A;  2B3U A;  4L8A A;  1P4N A;  3TT2 A;  4Y49 B;  2BEI A;  2P0W A;  4BMH A;  4KVX A;  2REE A;  3EY5 A;  2Q0Y A;  3QB8 A;  4KZT A;  5JPH A;  4DNC A;  1I21 A;  1XMT A;  1NSL A;  1M4D A;  2NMT A;  5A27 A;  4JLY A;  1BO4 A;  2IL4 A;  2DXQ A;  1S7F A;  2ZW5 A;  2AJ6 A;  1IB1 E;  2PR8 A;  2J8M A;  1Q2C A;  4F0Y A;  2B4D B;  4KVM E;  3KKW A;  4NEX A;  2DPT A;  3BLN A;  2A4N A;  4QUS A;  4A31 A;  2X7B A;  2Q4V A;  1KZF A;  4C2Y A;  2P6F A;  4U5Y A;  5F48 A;  4KLW A;  1M4G A;  3D2M A;  2CNT A;  5CNP A;  4KOY A;  4LX9 A;  1TIQ A;  4R57 A;  4KS9 A;  3TTH A;  2OH1 A;  3IU2 A;  2VBQ A;  3D3S A;  3CXP A;  3I3G A;  2VZY A;  4UWI A;  5H84 A;  4UWJ A;  2REF A;  4CYQ A;  4F0X A;  3TO9 A;  1XIX A;  4EVY A;  1MK4 A;  3PZJ A;  3R9E A;  4CAX A;  5GCN A;  1Y9W A;  2B5G A;  3D8P A;  1IYK A;  2F5I A;  3DR6 A;  4C2X A;  3K9U A;  4C7H A;  2Z3L A;  4R9M A;  3S6H A;  4PV6 A;  3R1K A;  1Y7R A;  1WK4 A;  2PSW A;  5I0C A;  3JTK A;  4M85 A;  5EBV A;  3SHP A;  2PRB A;  3BJ8 A;  1M44 A;  2GE3 A;  4IUS A;  4MFJ A;  3EXN A;  4RS2 A;  2EVN A;  2ZW6 A;  4BBH A;  3EFA A;  3F5B A;  4OAD A;  1I12 A;  2Z10 A;  2WUU A;  4CAE A;  4KOS A;  1BOB A;  2KCW A;  2FT0 A;  4F6A A;  1XF8 A;  4GS4 A;  4MFZ A;  4H6U A;  1Z4E A;  4FD4 A;  2CY2 A;  3I9S A;  4A32 A;  4U9Z A;  2Q04 A;  3OWC A;  4PSW A;  3ZJ0 A;  2Z3P A;  1QSR A;  2PC1 A;  3VWD A;  1ZO0 A;  3FXT A;  1Q2D A;  2GIV A;  2ZW4 A;  4PK2 A;  2CNS A;  5E96 A;  1I1D A;  1Y9K A;  2FL4 A;  1S60 A;  4MFQ A;  1WWZ A;  3EC4 A;  2R7H A;  3EO4 A;  3PP9 A;  2JEV A;  2Z11 A;  4NCZ A;  4NXY A;  4CYO A;  2VZZ A;  2D4P A;  2JDD A;  2Q4Y A;  4UBR A;  2BSW A;  2O28 A;  2QIR A;  2OZG A;  4HNW B;  3LOD A;  3WR7 A;  1PU9 A;  4YFJ A;  5IV0 A;  4MHD A;  4JD6 A;  1QSN A;  4CYN A;  4JXR A;  4AB7 A;  5G21 A;  2ZXV A;  4E0A A;  5JQ4 A;  5H86 A;  4B10 A;  4CGM A;  3C26 A;  1MJB A;  2QEC A;  4C68 A;  4PSX A;  2Z3N A;  1XEB A;  4CAF A;  4CGO A;  4J3G A;  4JWP A;  4XPD C;  4E2A A;  1B87 A;  4AG9 A;  2YNC C;  4Q36 A;  2Z3M A;  1KUX A;  4B12 A;  4QB9 A;  1Z4R A;  4UCN A;  4NSQ A;  1R57 A;  5AG5 A;  3H4Q A;  4XPD B;  1YK3 A;  1VHS A;  3A9L A;  4XNH C;  2B5G B;  2AE6 A;  2PDO A;  2WPX A;  4KOR A;  3S6K A;  4B11 A;  1S7N A;  4UCM A;  4B13 A;  4JXQ A;  4ONU A;  2RC4 A;  3S6F A;  3R95 A;  5KTC A;  2YNC A;  3D2P A;  1NMT A;  1GHE A;  4CGL A;  4XNH B;  2R8V A;  3DR8 A;  3TFY A;  1M4I A;  4UFW A;  1RXT A;  4RI1 A;  1FY7 A;  4UFV A;  1YVK A;  2OU2 A;  3QAH A;  5G22 A;  5ISV A;  4B14 A;  3ZZI A;  5J8F A;  4OAE A;  2J8N A;  4FD7 A;  3IGR A;  3FBU A;  2Y0M A;  1SQH A;  1YVO A;  2B3V A;  1PUA A;  2WPW A;  2D4O A;  4B5O A;  5FVJ A;  2G0B A;  2BUE A;  5AG6 A;  1B6B A;  4MI4 A;  3CXQ A;  4IF5 A;  4ZGY B;  5F46 A;  2PR1 A;  3JVN A;  4ZBG A;  1OZP A;  2FE7 A;  2B4B A;  2G3A A;  4MJ8 A;  2C27 A;  4KLV A;  1V0C A;  3F8K A;  4JJX A;  4R87 A;  3BJ7 A;  4HKF A;  4H89 A;  2I00 A;  4KSA A;  4H6Z A;  2CXA A;  3P2F A;  2WSA A;  4OLL A;  1S3Z A;  2ATR A;  1YR0 A;  4I49 A;  4QVT A;  2FCK A;  4PK3 A;  2FIA A;  4XPL A;  2ARH A;  3IWG A;  5HMN A;  4KOX A;  4AG7 A;  2ZPA A;  5HH1 A;  4KUB A;  1QSO A;  2K5T A;  3E0K A;  4U9Y A;  4MFK A;  4KOT A;  1S5K A;  4AVC A;  1IID A;  2GAN A;  1ON0 A;  3W6S A;  2Z0Z A;  2VEZ A;  4II9 A;  3R9F A;  2BL1 A;  3V8I A;  2FS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...