5HNAA

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph-1251
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
361
structure length
352
Chain Sequence
LAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKDINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSREIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIDNLIYKKIEDISMLMGEYFQIHDDYLDIFDSTKTGKVSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic Structure and Inhibition of a Malaria Drug Target: Geranylgeranyl Diphosphate Synthase.
pubmed doi rcsb
molecule keywords Farnesyl pyrophosphate synthase, putative
molecule tags Transferase/transferase inhibitor
source organism Plasmodium vivax
total genus 145
structure length 352
sequence length 361
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5hnaA00
1N23A 3LJIA 3M00A 4LFEA 2FTZA 3OABB 5I1UA 5DJVF 4KPDA 3N3DA 3P5PA 4LZCA 5H9DA 5ILKA 2E4OA 2AZJA 2E93A 4LOBA 4KVYA 1YYUA 1YHKA 3AQBB 3Q2QA 4ZQ8A 4KVWA 2Q58A 3G4DA 3LVSA 1HX9A 3LLWA 3OACB 2AEKA 4JXYA 3ZMCA 4DI5A 3WE9A 4JYXA 5IVGA 2AELA 5DGSF 3KRAB 3LZ9A 4KKMA 4L2XF 4JXNA 4NKFA 1KIZA 2Z7HA 2F8CF 3CKEA 4NKEA 4WK5A 5CG6A 4KQ5A 4MC0A 5EROA 4LA5A 3N45F 5DIQF 2OPNA 4JZXA 3V1VA 2PS5A 4RXEA 5HNAA 3M9UA 3KRPB 3WEIA 2J5CA 2QISA 4P0WA 3N5HF 4OKZA 1PS1A 4KQSA 1N22A 5A0IA 5DZ2A 1HM4A 5IK9A 5B03A 3PH7A 3IPIA 5E8LA 1WL1A 3SDUA 2F94F 4OKMA 5AFXA 4MC3A 2F9KF 1FPSA 3ZCDA 4KUXA 3KRAA 1N1ZA 5EAUA 4OGUA 3S4JA 3WEKA 1WY0A 3LMDA 4LPHF 1VG2A 3WCJA 3ZL6A 1HM7A 2ZEVA 3PYAA 2E8VA 4RYPA 2ONGA 4E9ZA 4LA6A 3AE0A 4DXJA 4LZ0A 5JV0F 4FP4A 4E1EA 4QXSF 5JUZF 3TFVA 4H5EF 2Z4VA 3N1VF 5EATA 3NPRA 3Q1OA 3ADZA 4PVYF 4LIXA 4GP1A 3ZMBA 2ZCQA 2F8ZF 5DJPF 3WEGA 3VJ9A 1UBWA 2Q9YA 5IMIA 3PYBA 3LK5A 3TFNA 3VJCA 5KSXF 4KQUA 3SAEA 5CG5A 4KK2A 3WCGA 3QKCA 3S9VA 5ILYA 5EASA 4JVJF 3KRFB 3WCLA 4LFGA 2E92A 4FJQA 1KIYA 3ACXA 3N0FA 1YYSA 3G4FA 3WJKA 5B02A 4MC8A 4F6XA 5DGNF 5DGMF 4NFJF 4LTVA 3ICNA 3ASXA 3AQ0A 3LDWA 4LXWA 1WMWA 4OMGA 2ZY1A 1YHMA 5B01A 5IMPA 2E94A 2Z78A 5E8HA 3UCAA 3KROA 1N20A 4JZBA 3NPKA 3M0GA 4RNQA 5B0KA 1YQ7A 1JFAA 1RQJA 4P0VA 3WCDA 2F92F 3OABA 2PS6A 3VJEA 3TS7A 5ILIA 3LSNA 5IKHA 3RMGA 1YYQA 5IL8A 2E8UA 3EFQA 3EGTA 1VG6A 4LTZA 3WCFA 3KRFA 5E8KA 5IMNA 1UBXA 2Z50A 4LLTA 3Q2ZA 3ICZA 4Q23A 3WCHA 1YV5A 1V4JA 2Z4XA 3OACA 4N1ZF 4LPGF 4LUUA 4EA1A 5B0MA 4OMHA 2DH4A 5ILJA 1RQIA 1DGPA 5B0LA 1N1BA 2J1PA 3CC9A 3VJDA 3V1XA 3SDTA 5IK6A 4E9UA 3TC1A 4KFAA 3RBMA 3VJBA 5B00A 4F62A 2AZKA 3LEEA 1V4IA 4KVDA 5B0IA 3WCEA 5ERMA 1N21A 2F89F 4LFVF 2RAHA 3RYEA 2Z4ZA 4GP2A 2F7MF 3KRPA 2ZEUA 5DHKA 2Z4YA 5B0JA 2AZLA 2Z7IA 4LLSA 3WSBA 4RXAA 3WCIA 3LGKA 5DJRF 5DW7A 4XQRF 4DZWA 2J1OA 3PDEA 3KRCB 3N3LF 3WCAA 2Z52A 2EWGA 3LGZB 3ZOUA 5ERNA 4GA3A 5JA0F 3MZVA 4N9UA 1N24A 4KVIA 1UBVA 5IK0A 2PS4A 5HN9A 4F6VA 3AQCB 2OPMA 1WL0A 2E95A 4KWDA 3QQVA 3DYHA 5AELA 2O1OA 2Q80A 1HXGA 2H8OA 2ZCSA 4HD1A 3Q30A 1HXAA 2OA6A 4LZ3A 5AYPA 3PKOA 3VJ8A 3WC9A 2E91A 3APZA 3CP6A 3IBAA 4NFIF 5A0JA 1DI1A 4DHDA 2Z4WA 4UMJA 1VG4A 4PVXF 3WCCA 3P5RA 4QPFA 5JV2F 3ICKA 1YHLA 4RXDA 3N0GA 3N46F 3N49F 1WL3A 5IM1A 5AHUB 3ACWA 3N1WF 3ACYA 3LOMA 1V4KA 1EZFA 2VF6A 4GAXA 3KRCA 1WKZA 1YYRA 5ILZA 2E8TA 2Q9ZA 1V4EA 3SDQA 1ZW5A 3TFPA 2ZCRA 3P8RA 5IL3A 4RXCA 4NFKF 1VG3A 3NF2A 3W7FA 3WEHA 3M02A 3LG5A 2ZCOA 3RYWA 3ICMA 1JFGA 4XQTF 1UBYA 3SDRA 3B7LA 3M01A 3WCBA 4K10A 3ID0A 3P41A 5C05A 4NUAA 1RTRA 4KPJA 1VG7A 4DEMF 3BNYA 3NRIA 3WSAA 5HN7A 3SDVA 1YYTA 4DWBA 3KBKA 3P8LA 4XQSF 2P1CA 3VJAA 2FORA 3N5JF 5IN8A 5ILDA 2ONHA 5DHIA 5ER8A 2PS7A 3MAVA 5ILHA 2E90A 2OGDA 4EA0A 4DWGA 3WJOA 2E8XA 3BNXA 5A0KA 2PS8A 4P0XA 3EZ3A 2E8WA 3DYGA 4NG6A 5JV1F 3N6KF 3KB9A 3V66A 3WEFA 3WJNA 5IKAA 1HXCA 1V4HA 2I19A 3WCMA 3OYRA 5HN8A 4EA2A 4H5CF 1WL2A 3WEJA 2AETA 4H5DF 3KROB 1YJ4A 3DYFA
chains in the Genus database with same CATH superfamily
1N23A 3LJIA 3M00A 4LFEA 2FTZA 3OABB 5I1UA 5DJVF 4KPDA 3N3DA 3P5PA 4LZCA 5H9DA 5ILKA 2E4OA 2AZJA 2E93A 4LOBA 4KVYA 1YYUA 1YHKA 3AQBB 3Q2QA 4ZQ8A 4KVWA 2Q58A 3G4DA 3LVSA 1HX9A 3LLWA 3OACB 2AEKA 4JXYA 3ZMCA 4DI5A 3WE9A 4JYXA 5IVGA 2AELA 5DGSF 3KRAB 3LZ9A 4KKMA 4L2XF 4JXNA 4NKFA 1KIZA 2Z7HA 2F8CF 3CKEA 4NKEA 4WK5A 5CG6A 4KQ5A 4MC0A 5EROA 4LA5A 3N45F 5DIQF 2OPNA 4JZXA 3V1VA 2PS5A 4RXEA 5HNAA 3M9UA 3KRPB 3WEIA 2J5CA 2QISA 4P0WA 3N5HF 4OKZA 1PS1A 4KQSA 1N22A 5A0IA 5DZ2A 1HM4A 5IK9A 5B03A 3PH7A 3IPIA 5E8LA 1WL1A 3SDUA 2F94F 4OKMA 5AFXA 4MC3A 2F9KF 1FPSA 3ZCDA 4KUXA 3KRAA 1N1ZA 5EAUA 4OGUA 3S4JA 3WEKA 1WY0A 3LMDA 4LPHF 1VG2A 3WCJA 3ZL6A 1HM7A 2ZEVA 3PYAA 2E8VA 4RYPA 2ONGA 4E9ZA 4LA6A 3AE0A 4DXJA 4LZ0A 5JV0F 4FP4A 4E1EA 4QXSF 5JUZF 3TFVA 4H5EF 2Z4VA 3N1VF 5EATA 3NPRA 3Q1OA 3ADZA 4PVYF 4LIXA 4GP1A 3ZMBA 2ZCQA 2F8ZF 5DJPF 3WEGA 3VJ9A 1UBWA 2Q9YA 5IMIA 3PYBA 3LK5A 3TFNA 3VJCA 5KSXF 4KQUA 3SAEA 5CG5A 4KK2A 3WCGA 3QKCA 3S9VA 5ILYA 5EASA 4JVJF 3KRFB 3WCLA 4LFGA 2E92A 4FJQA 1KIYA 3ACXA 3N0FA 1YYSA 3G4FA 3WJKA 5B02A 4MC8A 4F6XA 5DGNF 5DGMF 4NFJF 4LTVA 3ICNA 3ASXA 3AQ0A 3LDWA 4LXWA 1WMWA 4OMGA 2ZY1A 1YHMA 5B01A 5IMPA 2E94A 2Z78A 5E8HA 3UCAA 3KROA 1N20A 4JZBA 3NPKA 3M0GA 4RNQA 5B0KA 1YQ7A 1JFAA 1RQJA 4P0VA 3WCDA 2F92F 3OABA 2PS6A 3VJEA 3TS7A 5ILIA 3LSNA 5IKHA 3RMGA 1YYQA 5IL8A 2E8UA 3EFQA 3EGTA 1VG6A 4LTZA 3WCFA 3KRFA 5E8KA 5IMNA 1UBXA 2Z50A 4LLTA 3Q2ZA 3ICZA 4Q23A 3WCHA 1YV5A 1V4JA 2Z4XA 3OACA 4N1ZF 4LPGF 4LUUA 4EA1A 5B0MA 4OMHA 2DH4A 5ILJA 1RQIA 1DGPA 5B0LA 1N1BA 2J1PA 3CC9A 3VJDA 3V1XA 3SDTA 5IK6A 4E9UA 3TC1A 4KFAA 3RBMA 3VJBA 5B00A 4F62A 2AZKA 3LEEA 1V4IA 4KVDA 5B0IA 3WCEA 5ERMA 1N21A 2F89F 4LFVF 2RAHA 3RYEA 2Z4ZA 4GP2A 2F7MF 3KRPA 2ZEUA 5DHKA 2Z4YA 5B0JA 2AZLA 2Z7IA 4LLSA 3WSBA 4RXAA 3WCIA 3LGKA 5DJRF 5DW7A 4XQRF 4DZWA 2J1OA 3PDEA 3KRCB 3N3LF 3WCAA 2Z52A 2EWGA 3LGZB 3ZOUA 5ERNA 4GA3A 5JA0F 3MZVA 4N9UA 1N24A 4KVIA 1UBVA 5IK0A 2PS4A 5HN9A 4F6VA 3AQCB 2OPMA 1WL0A 2E95A 4KWDA 3QQVA 3DYHA 5AELA 2O1OA 2Q80A 1HXGA 2H8OA 2ZCSA 4HD1A 3Q30A 1HXAA 2OA6A 4LZ3A 5AYPA 3PKOA 3VJ8A 3WC9A 2E91A 3APZA 3CP6A 3IBAA 4NFIF 5A0JA 1DI1A 4DHDA 2Z4WA 4UMJA 1VG4A 4PVXF 3WCCA 3P5RA 4QPFA 5JV2F 3ICKA 1YHLA 4RXDA 3N0GA 3N46F 3N49F 1WL3A 5IM1A 5AHUB 3ACWA 3N1WF 3ACYA 3LOMA 1V4KA 1EZFA 2VF6A 4GAXA 3KRCA 1WKZA 1YYRA 5ILZA 2E8TA 2Q9ZA 1V4EA 3SDQA 1ZW5A 3TFPA 2ZCRA 3P8RA 5IL3A 4RXCA 4NFKF 1VG3A 3NF2A 3W7FA 3WEHA 3M02A 3LG5A 2ZCOA 3RYWA 3ICMA 1JFGA 4XQTF 1UBYA 3SDRA 3B7LA 3M01A 3WCBA 4K10A 3ID0A 3P41A 5C05A 4NUAA 1RTRA 4KPJA 1VG7A 4DEMF 3BNYA 3NRIA 3WSAA 5HN7A 3SDVA 1YYTA 4DWBA 3KBKA 3P8LA 4XQSF 2P1CA 3VJAA 2FORA 3N5JF 5IN8A 5ILDA 2ONHA 5DHIA 5ER8A 2PS7A 3MAVA 5ILHA 2E90A 2OGDA 4EA0A 4DWGA 3WJOA 2E8XA 3BNXA 5A0KA 2PS8A 4P0XA 3EZ3A 2E8WA 3DYGA 4NG6A 5JV1F 3N6KF 3KB9A 3V66A 3WEFA 3WJNA 5IKAA 1HXCA 1V4HA 2I19A 3WCMA 3OYRA 5HN8A 4EA2A 4H5CF 1WL2A 3WEJA 2AETA 4H5DF 3KROB 1YJ4A 3DYFA
chains in the Genus database with same CATH topology
1N23A 3LJIA 3M00A 4LFEA 2FTZA 3OABB 5I1UA 5DJVF 4KPDA 3N3DA 3P5PA 4LZCA 5H9DA 5ILKA 2E4OA 2AZJA 2E93A 4LOBA 4KVYA 1YYUA 1YHKA 3AQBB 3Q2QA 4ZQ8A 4KVWA 2Q58A 3G4DA 3LVSA 1HX9A 3LLWA 3OACB 2AEKA 4JXYA 3ZMCA 4DI5A 3WE9A 4JYXA 5IVGA 2AELA 5DGSF 3KRAB 3LZ9A 4KKMA 4L2XF 4JXNA 4NKFA 1KIZA 2Z7HA 2F8CF 3CKEA 4NKEA 4WK5A 5CG6A 4KQ5A 4MC0A 5EROA 4LA5A 3N45F 5DIQF 2OPNA 4JZXA 3V1VA 2PS5A 4RXEA 5HNAA 3M9UA 3KRPB 3WEIA 2J5CA 2QISA 4P0WA 3N5HF 4OKZA 1PS1A 4KQSA 1N22A 5A0IA 5DZ2A 1HM4A 5IK9A 5B03A 3PH7A 3IPIA 5E8LA 1WL1A 3SDUA 2F94F 4OKMA 5AFXA 4MC3A 2F9KF 1FPSA 3ZCDA 4KUXA 3KRAA 1N1ZA 5EAUA 4OGUA 3S4JA 3WEKA 1WY0A 3LMDA 4LPHF 1VG2A 3WCJA 3ZL6A 1HM7A 2ZEVA 3PYAA 2E8VA 4RYPA 2ONGA 4E9ZA 4LA6A 3AE0A 4DXJA 4LZ0A 5JV0F 4FP4A 4E1EA 4QXSF 5JUZF 3TFVA 4H5EF 2Z4VA 3N1VF 5EATA 3NPRA 3Q1OA 3ADZA 4PVYF 4LIXA 4GP1A 3ZMBA 2ZCQA 2F8ZF 5DJPF 3WEGA 3VJ9A 1UBWA 2Q9YA 5IMIA 3PYBA 3LK5A 3TFNA 3VJCA 5KSXF 4KQUA 3SAEA 5CG5A 4KK2A 3WCGA 3QKCA 3S9VA 5ILYA 5EASA 4JVJF 3KRFB 3WCLA 4LFGA 2E92A 4FJQA 1KIYA 3ACXA 3N0FA 1YYSA 3G4FA 3WJKA 5B02A 4MC8A 4F6XA 5DGNF 5DGMF 4NFJF 4LTVA 3ICNA 3ASXA 3AQ0A 3LDWA 4LXWA 1WMWA 4OMGA 2ZY1A 1YHMA 5B01A 5IMPA 2E94A 2Z78A 5E8HA 3UCAA 3KROA 1N20A 4JZBA 3NPKA 3M0GA 4RNQA 5B0KA 1YQ7A 1JFAA 1RQJA 4P0VA 3WCDA 2F92F 3OABA 2PS6A 3VJEA 3TS7A 5ILIA 3LSNA 5IKHA 3RMGA 1YYQA 5IL8A 2E8UA 3EFQA 3EGTA 1VG6A 4LTZA 3WCFA 3KRFA 5E8KA 5IMNA 1UBXA 2Z50A 4LLTA 3Q2ZA 3ICZA 4Q23A 3WCHA 1YV5A 1V4JA 2Z4XA 3OACA 4N1ZF 4LPGF 4LUUA 4EA1A 5B0MA 4OMHA 2DH4A 5ILJA 1RQIA 1DGPA 5B0LA 1N1BA 2J1PA 3CC9A 3VJDA 3V1XA 3SDTA 5IK6A 4E9UA 3TC1A 4KFAA 3RBMA 3VJBA 5B00A 4F62A 2AZKA 3LEEA 1V4IA 4KVDA 5B0IA 3WCEA 5ERMA 1N21A 2F89F 4LFVF 2RAHA 3RYEA 2Z4ZA 4GP2A 2F7MF 3KRPA 2ZEUA 5DHKA 2Z4YA 5B0JA 2AZLA 2Z7IA 4LLSA 3WSBA 4RXAA 3WCIA 3LGKA 5DJRF 5DW7A 4XQRF 4DZWA 2J1OA 3PDEA 3KRCB 3N3LF 3WCAA 2Z52A 2EWGA 3LGZB 3ZOUA 5ERNA 4GA3A 5JA0F 3MZVA 4N9UA 1N24A 4KVIA 1UBVA 5IK0A 2PS4A 5HN9A 4F6VA 3AQCB 2OPMA 1WL0A 2E95A 4KWDA 3QQVA 3DYHA 5AELA 2O1OA 2Q80A 1HXGA 2H8OA 2ZCSA 4HD1A 3Q30A 1HXAA 2OA6A 4LZ3A 5AYPA 3PKOA 3VJ8A 3WC9A 2E91A 3APZA 3CP6A 3IBAA 4NFIF 5A0JA 1DI1A 4DHDA 2Z4WA 4UMJA 1VG4A 4PVXF 3WCCA 3P5RA 4QPFA 5JV2F 3ICKA 1YHLA 4RXDA 3N0GA 3N46F 3N49F 1WL3A 5IM1A 5AHUB 3ACWA 3N1WF 3ACYA 3LOMA 1V4KA 1EZFA 2VF6A 4GAXA 3KRCA 1WKZA 1YYRA 5ILZA 2E8TA 2Q9ZA 1V4EA 3SDQA 1ZW5A 3TFPA 2ZCRA 3P8RA 5IL3A 4RXCA 4NFKF 1VG3A 3NF2A 3W7FA 3WEHA 3M02A 3LG5A 2ZCOA 3RYWA 3ICMA 1JFGA 4XQTF 1UBYA 3SDRA 3B7LA 3M01A 3WCBA 4K10A 3ID0A 3P41A 5C05A 4NUAA 1RTRA 4KPJA 1VG7A 4DEMF 3BNYA 3NRIA 3WSAA 5HN7A 3SDVA 1YYTA 4DWBA 3KBKA 3P8LA 4XQSF 2P1CA 3VJAA 2FORA 3N5JF 5IN8A 5ILDA 2ONHA 5DHIA 5ER8A 2PS7A 3MAVA 5ILHA 2E90A 2OGDA 4EA0A 4DWGA 3WJOA 2E8XA 3BNXA 5A0KA 2PS8A 4P0XA 3EZ3A 2E8WA 3DYGA 4NG6A 5JV1F 3N6KF 3KB9A 3V66A 3WEFA 3WJNA 5IKAA 1HXCA 1V4HA 2I19A 3WCMA 3OYRA 5HN8A 4EA2A 4H5CF 1WL2A 3WEJA 2AETA 4H5DF 3KROB 1YJ4A 3DYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N23 A;  3LJI A;  3M00 A;  4LFE A;  2FTZ A;  3OAB B;  5I1U A;  5DJV F;  4KPD A;  3N3D A;  3P5P A;  4LZC A;  5H9D A;  5ILK A;  2E4O A;  2AZJ A;  2E93 A;  4LOB A;  4KVY A;  1YYU A;  1YHK A;  3AQB B;  3Q2Q A;  4ZQ8 A;  4KVW A;  2Q58 A;  3G4D A;  3LVS A;  1HX9 A;  3LLW A;  3OAC B;  2AEK A;  4JXY A;  3ZMC A;  4DI5 A;  3WE9 A;  4JYX A;  5IVG A;  2AEL A;  5DGS F;  3KRA B;  3LZ9 A;  4KKM A;  4L2X F;  4JXN A;  4NKF A;  1KIZ A;  2Z7H A;  2F8C F;  3CKE A;  4NKE A;  4WK5 A;  5CG6 A;  4KQ5 A;  4MC0 A;  5ERO A;  4LA5 A;  3N45 F;  5DIQ F;  2OPN A;  4JZX A;  3V1V A;  2PS5 A;  4RXE A;  5HNA A;  3M9U A;  3KRP B;  3WEI A;  2J5C A;  2QIS A;  4P0W A;  3N5H F;  4OKZ A;  1PS1 A;  4KQS A;  1N22 A;  5A0I A;  5DZ2 A;  1HM4 A;  5IK9 A;  5B03 A;  3PH7 A;  3IPI A;  5E8L A;  1WL1 A;  3SDU A;  2F94 F;  4OKM A;  5AFX A;  4MC3 A;  2F9K F;  1FPS A;  3ZCD A;  4KUX A;  3KRA A;  1N1Z A;  5EAU A;  4OGU A;  3S4J A;  3WEK A;  1WY0 A;  3LMD A;  4LPH F;  1VG2 A;  3WCJ A;  3ZL6 A;  1HM7 A;  2ZEV A;  3PYA A;  2E8V A;  4RYP A;  2ONG A;  4E9Z A;  4LA6 A;  3AE0 A;  4DXJ A;  4LZ0 A;  5JV0 F;  4FP4 A;  4E1E A;  4QXS F;  5JUZ F;  3TFV A;  4H5E F;  2Z4V A;  3N1V F;  5EAT A;  3NPR A;  3Q1O A;  3ADZ A;  4PVY F;  4LIX A;  4GP1 A;  3ZMB A;  2ZCQ A;  2F8Z F;  5DJP F;  3WEG A;  3VJ9 A;  1UBW A;  2Q9Y A;  5IMI A;  3PYB A;  3LK5 A;  3TFN A;  3VJC A;  5KSX F;  4KQU A;  3SAE A;  5CG5 A;  4KK2 A;  3WCG A;  3QKC A;  3S9V A;  5ILY A;  5EAS A;  4JVJ F;  3KRF B;  3WCL A;  4LFG A;  2E92 A;  4FJQ A;  1KIY A;  3ACX A;  3N0F A;  1YYS A;  3G4F A;  3WJK A;  5B02 A;  4MC8 A;  4F6X A;  5DGN F;  5DGM F;  4NFJ F;  4LTV A;  3ICN A;  3ASX A;  3AQ0 A;  3LDW A;  4LXW A;  1WMW A;  4OMG A;  2ZY1 A;  1YHM A;  5B01 A;  5IMP A;  2E94 A;  2Z78 A;  5E8H A;  3UCA A;  3KRO A;  1N20 A;  4JZB A;  3NPK A;  3M0G A;  4RNQ A;  5B0K A;  1YQ7 A;  1JFA A;  1RQJ A;  4P0V A;  3WCD A;  2F92 F;  3OAB A;  2PS6 A;  3VJE A;  3TS7 A;  5ILI A;  3LSN A;  5IKH A;  3RMG A;  1YYQ A;  5IL8 A;  2E8U A;  3EFQ A;  3EGT A;  1VG6 A;  4LTZ A;  3WCF A;  3KRF A;  5E8K A;  5IMN A;  1UBX A;  2Z50 A;  4LLT A;  3Q2Z A;  3ICZ A;  4Q23 A;  3WCH A;  1YV5 A;  1V4J A;  2Z4X A;  3OAC A;  4N1Z F;  4LPG F;  4LUU A;  4EA1 A;  5B0M A;  4OMH A;  2DH4 A;  5ILJ A;  1RQI A;  1DGP A;  5B0L A;  1N1B A;  2J1P A;  3CC9 A;  3VJD A;  3V1X A;  3SDT A;  5IK6 A;  4E9U A;  3TC1 A;  4KFA A;  3RBM A;  3VJB A;  5B00 A;  4F62 A;  2AZK A;  3LEE A;  1V4I A;  4KVD A;  5B0I A;  3WCE A;  5ERM A;  1N21 A;  2F89 F;  4LFV F;  2RAH A;  3RYE A;  2Z4Z A;  4GP2 A;  2F7M F;  3KRP A;  2ZEU A;  5DHK A;  2Z4Y A;  5B0J A;  2AZL A;  2Z7I A;  4LLS A;  3WSB A;  4RXA A;  3WCI A;  3LGK A;  5DJR F;  5DW7 A;  4XQR F;  4DZW A;  2J1O A;  3PDE A;  3KRC B;  3N3L F;  3WCA A;  2Z52 A;  2EWG A;  3LGZ B;  3ZOU A;  5ERN A;  4GA3 A;  5JA0 F;  3MZV A;  4N9U A;  1N24 A;  4KVI A;  1UBV A;  5IK0 A;  2PS4 A;  5HN9 A;  4F6V A;  3AQC B;  2OPM A;  1WL0 A;  2E95 A;  4KWD A;  3QQV A;  3DYH A;  5AEL A;  2O1O A;  2Q80 A;  1HXG A;  2H8O A;  2ZCS A;  4HD1 A;  3Q30 A;  1HXA A;  2OA6 A;  4LZ3 A;  5AYP A;  3PKO A;  3VJ8 A;  3WC9 A;  2E91 A;  3APZ A;  3CP6 A;  3IBA A;  4NFI F;  5A0J A;  1DI1 A;  4DHD A;  2Z4W A;  4UMJ A;  1VG4 A;  4PVX F;  3WCC A;  3P5R A;  4QPF A;  5JV2 F;  3ICK A;  1YHL A;  4RXD A;  3N0G A;  3N46 F;  3N49 F;  1WL3 A;  5IM1 A;  5AHU B;  3ACW A;  3N1W F;  3ACY A;  3LOM A;  1V4K A;  1EZF A;  2VF6 A;  4GAX A;  3KRC A;  1WKZ A;  1YYR A;  5ILZ A;  2E8T A;  2Q9Z A;  1V4E A;  3SDQ A;  1ZW5 A;  3TFP A;  2ZCR A;  3P8R A;  5IL3 A;  4RXC A;  4NFK F;  1VG3 A;  3NF2 A;  3W7F A;  3WEH A;  3M02 A;  3LG5 A;  2ZCO A;  3RYW A;  3ICM A;  1JFG A;  4XQT F;  1UBY A;  3SDR A;  3B7L A;  3M01 A;  3WCB A;  4K10 A;  3ID0 A;  3P41 A;  5C05 A;  4NUA A;  1RTR A;  4KPJ A;  1VG7 A;  4DEM F;  3BNY A;  3NRI A;  3WSA A;  5HN7 A;  3SDV A;  1YYT A;  4DWB A;  3KBK A;  3P8L A;  4XQS F;  2P1C A;  3VJA A;  2FOR A;  3N5J F;  5IN8 A;  5ILD A;  2ONH A;  5DHI A;  5ER8 A;  2PS7 A;  3MAV A;  5ILH A;  2E90 A;  2OGD A;  4EA0 A;  4DWG A;  3WJO A;  2E8X A;  3BNX A;  5A0K A;  2PS8 A;  4P0X A;  3EZ3 A;  2E8W A;  3DYG A;  4NG6 A;  5JV1 F;  3N6K F;  3KB9 A;  3V66 A;  3WEF A;  3WJN A;  5IKA A;  1HXC A;  1V4H A;  2I19 A;  3WCM A;  3OYR A;  5HN8 A;  4EA2 A;  4H5C F;  1WL2 A;  3WEJ A;  2AET A;  4H5D F;  3KRO B;  1YJ4 A;  3DYF A; 
#chains in the Genus database with same CATH topology
 1N23 A;  3LJI A;  3M00 A;  4LFE A;  2FTZ A;  3OAB B;  5I1U A;  5DJV F;  4KPD A;  3N3D A;  3P5P A;  4LZC A;  5H9D A;  5ILK A;  2E4O A;  2AZJ A;  2E93 A;  4LOB A;  4KVY A;  1YYU A;  1YHK A;  3AQB B;  3Q2Q A;  4ZQ8 A;  4KVW A;  2Q58 A;  3G4D A;  3LVS A;  1HX9 A;  3LLW A;  3OAC B;  2AEK A;  4JXY A;  3ZMC A;  4DI5 A;  3WE9 A;  4JYX A;  5IVG A;  2AEL A;  5DGS F;  3KRA B;  3LZ9 A;  4KKM A;  4L2X F;  4JXN A;  4NKF A;  1KIZ A;  2Z7H A;  2F8C F;  3CKE A;  4NKE A;  4WK5 A;  5CG6 A;  4KQ5 A;  4MC0 A;  5ERO A;  4LA5 A;  3N45 F;  5DIQ F;  2OPN A;  4JZX A;  3V1V A;  2PS5 A;  4RXE A;  5HNA A;  3M9U A;  3KRP B;  3WEI A;  2J5C A;  2QIS A;  4P0W A;  3N5H F;  4OKZ A;  1PS1 A;  4KQS A;  1N22 A;  5A0I A;  5DZ2 A;  1HM4 A;  5IK9 A;  5B03 A;  3PH7 A;  3IPI A;  5E8L A;  1WL1 A;  3SDU A;  2F94 F;  4OKM A;  5AFX A;  4MC3 A;  2F9K F;  1FPS A;  3ZCD A;  4KUX A;  3KRA A;  1N1Z A;  5EAU A;  4OGU A;  3S4J A;  3WEK A;  1WY0 A;  3LMD A;  4LPH F;  1VG2 A;  3WCJ A;  3ZL6 A;  1HM7 A;  2ZEV A;  3PYA A;  2E8V A;  4RYP A;  2ONG A;  4E9Z A;  4LA6 A;  3AE0 A;  4DXJ A;  4LZ0 A;  5JV0 F;  4FP4 A;  4E1E A;  4QXS F;  5JUZ F;  3TFV A;  4H5E F;  2Z4V A;  3N1V F;  5EAT A;  3NPR A;  3Q1O A;  3ADZ A;  4PVY F;  4LIX A;  4GP1 A;  3ZMB A;  2ZCQ A;  2F8Z F;  5DJP F;  3WEG A;  3VJ9 A;  1UBW A;  2Q9Y A;  5IMI A;  3PYB A;  3LK5 A;  3TFN A;  3VJC A;  5KSX F;  4KQU A;  3SAE A;  5CG5 A;  4KK2 A;  3WCG A;  3QKC A;  3S9V A;  5ILY A;  5EAS A;  4JVJ F;  3KRF B;  3WCL A;  4LFG A;  2E92 A;  4FJQ A;  1KIY A;  3ACX A;  3N0F A;  1YYS A;  3G4F A;  3WJK A;  5B02 A;  4MC8 A;  4F6X A;  5DGN F;  5DGM F;  4NFJ F;  4LTV A;  3ICN A;  3ASX A;  3AQ0 A;  3LDW A;  4LXW A;  1WMW A;  4OMG A;  2ZY1 A;  1YHM A;  5B01 A;  5IMP A;  2E94 A;  2Z78 A;  5E8H A;  3UCA A;  3KRO A;  1N20 A;  4JZB A;  3NPK A;  3M0G A;  4RNQ A;  5B0K A;  1YQ7 A;  1JFA A;  1RQJ A;  4P0V A;  3WCD A;  2F92 F;  3OAB A;  2PS6 A;  3VJE A;  3TS7 A;  5ILI A;  3LSN A;  5IKH A;  3RMG A;  1YYQ A;  5IL8 A;  2E8U A;  3EFQ A;  3EGT A;  1VG6 A;  4LTZ A;  3WCF A;  3KRF A;  5E8K A;  5IMN A;  1UBX A;  2Z50 A;  4LLT A;  3Q2Z A;  3ICZ A;  4Q23 A;  3WCH A;  1YV5 A;  1V4J A;  2Z4X A;  3OAC A;  4N1Z F;  4LPG F;  4LUU A;  4EA1 A;  5B0M A;  4OMH A;  2DH4 A;  5ILJ A;  1RQI A;  1DGP A;  5B0L A;  1N1B A;  2J1P A;  3CC9 A;  3VJD A;  3V1X A;  3SDT A;  5IK6 A;  4E9U A;  3TC1 A;  4KFA A;  3RBM A;  3VJB A;  5B00 A;  4F62 A;  2AZK A;  3LEE A;  1V4I A;  4KVD A;  5B0I A;  3WCE A;  5ERM A;  1N21 A;  2F89 F;  4LFV F;  2RAH A;  3RYE A;  2Z4Z A;  4GP2 A;  2F7M F;  3KRP A;  2ZEU A;  5DHK A;  2Z4Y A;  5B0J A;  2AZL A;  2Z7I A;  4LLS A;  3WSB A;  4RXA A;  3WCI A;  3LGK A;  5DJR F;  5DW7 A;  4XQR F;  4DZW A;  2J1O A;  3PDE A;  3KRC B;  3N3L F;  3WCA A;  2Z52 A;  2EWG A;  3LGZ B;  3ZOU A;  5ERN A;  4GA3 A;  5JA0 F;  3MZV A;  4N9U A;  1N24 A;  4KVI A;  1UBV A;  5IK0 A;  2PS4 A;  5HN9 A;  4F6V A;  3AQC B;  2OPM A;  1WL0 A;  2E95 A;  4KWD A;  3QQV A;  3DYH A;  5AEL A;  2O1O A;  2Q80 A;  1HXG A;  2H8O A;  2ZCS A;  4HD1 A;  3Q30 A;  1HXA A;  2OA6 A;  4LZ3 A;  5AYP A;  3PKO A;  3VJ8 A;  3WC9 A;  2E91 A;  3APZ A;  3CP6 A;  3IBA A;  4NFI F;  5A0J A;  1DI1 A;  4DHD A;  2Z4W A;  4UMJ A;  1VG4 A;  4PVX F;  3WCC A;  3P5R A;  4QPF A;  5JV2 F;  3ICK A;  1YHL A;  4RXD A;  3N0G A;  3N46 F;  3N49 F;  1WL3 A;  5IM1 A;  5AHU B;  3ACW A;  3N1W F;  3ACY A;  3LOM A;  1V4K A;  1EZF A;  2VF6 A;  4GAX A;  3KRC A;  1WKZ A;  1YYR A;  5ILZ A;  2E8T A;  2Q9Z A;  1V4E A;  3SDQ A;  1ZW5 A;  3TFP A;  2ZCR A;  3P8R A;  5IL3 A;  4RXC A;  4NFK F;  1VG3 A;  3NF2 A;  3W7F A;  3WEH A;  3M02 A;  3LG5 A;  2ZCO A;  3RYW A;  3ICM A;  1JFG A;  4XQT F;  1UBY A;  3SDR A;  3B7L A;  3M01 A;  3WCB A;  4K10 A;  3ID0 A;  3P41 A;  5C05 A;  4NUA A;  1RTR A;  4KPJ A;  1VG7 A;  4DEM F;  3BNY A;  3NRI A;  3WSA A;  5HN7 A;  3SDV A;  1YYT A;  4DWB A;  3KBK A;  3P8L A;  4XQS F;  2P1C A;  3VJA A;  2FOR A;  3N5J F;  5IN8 A;  5ILD A;  2ONH A;  5DHI A;  5ER8 A;  2PS7 A;  3MAV A;  5ILH A;  2E90 A;  2OGD A;  4EA0 A;  4DWG A;  3WJO A;  2E8X A;  3BNX A;  5A0K A;  2PS8 A;  4P0X A;  3EZ3 A;  2E8W A;  3DYG A;  4NG6 A;  5JV1 F;  3N6K F;  3KB9 A;  3V66 A;  3WEF A;  3WJN A;  5IKA A;  1HXC A;  1V4H A;  2I19 A;  3WCM A;  3OYR A;  5HN8 A;  4EA2 A;  4H5C F;  1WL2 A;  3WEJ A;  2AET A;  4H5D F;  3KRO B;  1YJ4 A;  3DYF A; 
#chains in the Genus database with same CATH homology
 1N23 A;  3LJI A;  3M00 A;  4LFE A;  2FTZ A;  3OAB B;  5I1U A;  5DJV F;  4KPD A;  3N3D A;  3P5P A;  4LZC A;  5H9D A;  5ILK A;  2E4O A;  2AZJ A;  2E93 A;  4LOB A;  4KVY A;  1YYU A;  1YHK A;  3AQB B;  3Q2Q A;  4ZQ8 A;  4KVW A;  2Q58 A;  3G4D A;  3LVS A;  1HX9 A;  3LLW A;  3OAC B;  2AEK A;  4JXY A;  3ZMC A;  4DI5 A;  3WE9 A;  4JYX A;  5IVG A;  2AEL A;  5DGS F;  3KRA B;  3LZ9 A;  4KKM A;  4L2X F;  4JXN A;  4NKF A;  1KIZ A;  2Z7H A;  2F8C F;  3CKE A;  4NKE A;  4WK5 A;  5CG6 A;  4KQ5 A;  4MC0 A;  5ERO A;  4LA5 A;  3N45 F;  5DIQ F;  2OPN A;  4JZX A;  3V1V A;  2PS5 A;  4RXE A;  5HNA A;  3M9U A;  3KRP B;  3WEI A;  2J5C A;  2QIS A;  4P0W A;  3N5H F;  4OKZ A;  1PS1 A;  4KQS A;  1N22 A;  5A0I A;  5DZ2 A;  1HM4 A;  5IK9 A;  5B03 A;  3PH7 A;  3IPI A;  5E8L A;  1WL1 A;  3SDU A;  2F94 F;  4OKM A;  5AFX A;  4MC3 A;  2F9K F;  1FPS A;  3ZCD A;  4KUX A;  3KRA A;  1N1Z A;  5EAU A;  4OGU A;  3S4J A;  3WEK A;  1WY0 A;  3LMD A;  4LPH F;  1VG2 A;  3WCJ A;  3ZL6 A;  1HM7 A;  2ZEV A;  3PYA A;  2E8V A;  4RYP A;  2ONG A;  4E9Z A;  4LA6 A;  3AE0 A;  4DXJ A;  4LZ0 A;  5JV0 F;  4FP4 A;  4E1E A;  4QXS F;  5JUZ F;  3TFV A;  4H5E F;  2Z4V A;  3N1V F;  5EAT A;  3NPR A;  3Q1O A;  3ADZ A;  4PVY F;  4LIX A;  4GP1 A;  3ZMB A;  2ZCQ A;  2F8Z F;  5DJP F;  3WEG A;  3VJ9 A;  1UBW A;  2Q9Y A;  5IMI A;  3PYB A;  3LK5 A;  3TFN A;  3VJC A;  5KSX F;  4KQU A;  3SAE A;  5CG5 A;  4KK2 A;  3WCG A;  3QKC A;  3S9V A;  5ILY A;  5EAS A;  4JVJ F;  3KRF B;  3WCL A;  4LFG A;  2E92 A;  4FJQ A;  1KIY A;  3ACX A;  3N0F A;  1YYS A;  3G4F A;  3WJK A;  5B02 A;  4MC8 A;  4F6X A;  5DGN F;  5DGM F;  4NFJ F;  4LTV A;  3ICN A;  3ASX A;  3AQ0 A;  3LDW A;  4LXW A;  1WMW A;  4OMG A;  2ZY1 A;  1YHM A;  5B01 A;  5IMP A;  2E94 A;  2Z78 A;  5E8H A;  3UCA A;  3KRO A;  1N20 A;  4JZB A;  3NPK A;  3M0G A;  4RNQ A;  5B0K A;  1YQ7 A;  1JFA A;  1RQJ A;  4P0V A;  3WCD A;  2F92 F;  3OAB A;  2PS6 A;  3VJE A;  3TS7 A;  5ILI A;  3LSN A;  5IKH A;  3RMG A;  1YYQ A;  5IL8 A;  2E8U A;  3EFQ A;  3EGT A;  1VG6 A;  4LTZ A;  3WCF A;  3KRF A;  5E8K A;  5IMN A;  1UBX A;  2Z50 A;  4LLT A;  3Q2Z A;  3ICZ A;  4Q23 A;  3WCH A;  1YV5 A;  1V4J A;  2Z4X A;  3OAC A;  4N1Z F;  4LPG F;  4LUU A;  4EA1 A;  5B0M A;  4OMH A;  2DH4 A;  5ILJ A;  1RQI A;  1DGP A;  5B0L A;  1N1B A;  2J1P A;  3CC9 A;  3VJD A;  3V1X A;  3SDT A;  5IK6 A;  4E9U A;  3TC1 A;  4KFA A;  3RBM A;  3VJB A;  5B00 A;  4F62 A;  2AZK A;  3LEE A;  1V4I A;  4KVD A;  5B0I A;  3WCE A;  5ERM A;  1N21 A;  2F89 F;  4LFV F;  2RAH A;  3RYE A;  2Z4Z A;  4GP2 A;  2F7M F;  3KRP A;  2ZEU A;  5DHK A;  2Z4Y A;  5B0J A;  2AZL A;  2Z7I A;  4LLS A;  3WSB A;  4RXA A;  3WCI A;  3LGK A;  5DJR F;  5DW7 A;  4XQR F;  4DZW A;  2J1O A;  3PDE A;  3KRC B;  3N3L F;  3WCA A;  2Z52 A;  2EWG A;  3LGZ B;  3ZOU A;  5ERN A;  4GA3 A;  5JA0 F;  3MZV A;  4N9U A;  1N24 A;  4KVI A;  1UBV A;  5IK0 A;  2PS4 A;  5HN9 A;  4F6V A;  3AQC B;  2OPM A;  1WL0 A;  2E95 A;  4KWD A;  3QQV A;  3DYH A;  5AEL A;  2O1O A;  2Q80 A;  1HXG A;  2H8O A;  2ZCS A;  4HD1 A;  3Q30 A;  1HXA A;  2OA6 A;  4LZ3 A;  5AYP A;  3PKO A;  3VJ8 A;  3WC9 A;  2E91 A;  3APZ A;  3CP6 A;  3IBA A;  4NFI F;  5A0J A;  1DI1 A;  4DHD A;  2Z4W A;  4UMJ A;  1VG4 A;  4PVX F;  3WCC A;  3P5R A;  4QPF A;  5JV2 F;  3ICK A;  1YHL A;  4RXD A;  3N0G A;  3N46 F;  3N49 F;  1WL3 A;  5IM1 A;  5AHU B;  3ACW A;  3N1W F;  3ACY A;  3LOM A;  1V4K A;  1EZF A;  2VF6 A;  4GAX A;  3KRC A;  1WKZ A;  1YYR A;  5ILZ A;  2E8T A;  2Q9Z A;  1V4E A;  3SDQ A;  1ZW5 A;  3TFP A;  2ZCR A;  3P8R A;  5IL3 A;  4RXC A;  4NFK F;  1VG3 A;  3NF2 A;  3W7F A;  3WEH A;  3M02 A;  3LG5 A;  2ZCO A;  3RYW A;  3ICM A;  1JFG A;  4XQT F;  1UBY A;  3SDR A;  3B7L A;  3M01 A;  3WCB A;  4K10 A;  3ID0 A;  3P41 A;  5C05 A;  4NUA A;  1RTR A;  4KPJ A;  1VG7 A;  4DEM F;  3BNY A;  3NRI A;  3WSA A;  5HN7 A;  3SDV A;  1YYT A;  4DWB A;  3KBK A;  3P8L A;  4XQS F;  2P1C A;  3VJA A;  2FOR A;  3N5J F;  5IN8 A;  5ILD A;  2ONH A;  5DHI A;  5ER8 A;  2PS7 A;  3MAV A;  5ILH A;  2E90 A;  2OGD A;  4EA0 A;  4DWG A;  3WJO A;  2E8X A;  3BNX A;  5A0K A;  2PS8 A;  4P0X A;  3EZ3 A;  2E8W A;  3DYG A;  4NG6 A;  5JV1 F;  3N6K F;  3KB9 A;  3V66 A;  3WEF A;  3WJN A;  5IKA A;  1HXC A;  1V4H A;  2I19 A;  3WCM A;  3OYR A;  5HN8 A;  4EA2 A;  4H5C F;  1WL2 A;  3WEJ A;  2AET A;  4H5D F;  3KRO B;  1YJ4 A;  3DYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...