5HNHA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
279
structure length
279
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 107
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnhA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnhA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hnhA02
2VLAA 5HLTA 5HNFA 5HNHA
chains in the Genus database with same CATH superfamily
5FKMA 1SD6A 2BVMA 3SZPA 4XOTA 4A3GJ 1J59A 3G1LA 2X1CA 1ODDA 1X2MA 3U2RA 3S8PA 3BG9A 5FD6A 1YYVA 1V54H 2Q2EA 1RUOA 3ABLH 4FT8A 1FSEA 4CCLA 5AIPA 2PN6A 4NNJA 3GWZA 3G1MA 3QPLA 2O03A 4PW4A 5CVIA 1E0EA 4BE1A 4ZZDA 4AIDA 2CQKA 5GPCA 2D2WA 3I58A 4LLNA 3OYKA 4C2UA 1RKWA 3UEQA 1Z0XA 3PM1A 2R3SA 2RREA 3CLOA 5H2FC 2G9WA 2XRNA 3SQNA 3ABMH 2XPWA 3ISPA 2D1VA 2JPCA 3FM3A 3VODA 3KEQA 3WQQA 1ENHA 2I5UA 5FROA 2W4SA 4XIDA 1ETXA 3D5RC 2CGPA 4ZN6A 3G3ZA 2UZKA 2LKXA 4RSYA 2ESNA 4R8HA 3F9KA 4GGGA 2FD5A 2WBMA 1IN7A 2FRHA 2R7SA 5FKOA 1S8NA 1SVOA 2A6EF 4IHWA 2EQRA 5FLXZ 2CW0F 2Y75A 3I54A 3VEPA 3NARA 3VB2A 1ZLKA 4BXUA 1EH7A 1ONPA 2OBPA 2V7FA 4QMEA 1OCRH 4IOAF 4Q4IA 3CCMI 3CJRB 2OCEA 2CWEA 4XLCA 1U8RA 3N05A 1WFXA 4OWRB 3JR9A 3K70D 1FC3A 2M30A 3HB9A 1GVDA 4D9JA 1IW7F 1G3WA 3H5RA 2JUCA 3DPTA 3ZMZA 3LSHA 3OY9A 3EUAA 4CCJA 3HZJA 3GZ6A 3CMMA 2OQRA 3W6JB 4ZW3A 3OYEA 1WJBA 5CVUA 3FUKA 4XQFA 4N4OB 4XLAA 2FEZA 4G7ZF 3ECOA 2VOPA 1MJ9A 3Q5FA 3S16J 4HX7A 2NYXA 2QYOA 3SEZA 1J7KA 1SFXA 2TRTA 4IRGA 4WXHA 1GVJA 1WKMA 1IUFA 4I99C 4DPRA 3R61A 3H3UA 3S3OA 1W4MA 2LR8A 5M5XJ 1T08B 1YX5A 1KU7A 2JQ7A 3SDBA 4EQQA 3RQIA 2XUBA 1SEUA 2LC2A 2XGXA 4XN9A 1Z9CA 2QZ8A 2JD0A 2ETHA 1Z6RA 4KIFA 4UUTA 3G4SI 4IHXA 2YX7A 4I6ZA 4BJTA 4ESFA 3ABUA 2DMNA 3OIPA 2QCOA 2NXNB 5F08A 5D5VB 1OYWA 3RKQA 2DOFA 2E1MC 3BG6A 1ONVA 1S29A 4XLNF 1IDYA 3KX2A 3CC2I 1R0LA 4J3BA 1HA8A 1KU3A 4ZYHA 3KZYA 1F43A 1D1BA 4C3JJ 3ZMUA 4L5JA 5C4XJ 2QGUA 2DYRH 5FLMJ 2NS0A 2NNYA 3BPXA 2XRLA 4RB1A 2CV1A 4A3BJ 4CYDA 4BHCA 3TBIA 2BGCA 4LIUA 4UVCA 3CHOA 2HYFA 3KFWX 2G7UA 5DUKA 4UXNA 3TGNA 5M5YJ 1OR7C 1FTZA 4PGGA 4BDZA 2B9SA 3FK6A 5F0CA 1YOVB 3ROUA 4UUVA 3OYAA 3LAPA 3WGGA 5JFRA 3ANNA 3AU8A 1JUPA 2WWYA 4II3A 4JQFA 3DU6A 1HCRA 2CQXA 2EIKH 4IHYA 1U78A 1U5TC 4F93B 4IX7A 4LLGF 1B8IB 3CDIA 1TWAJ 4EVIA 1HOMA 3I0TA 3FXKA 3WU0A 2MBFA 4U0YA 2FBIA 4P9FA 2DJNA 3ASNH 4BGDA 1ULYA 2JD1A 3B2PA 4XN7A 1RETA 2K4BA 5LGTA 5J8CA 3R0JA 2FBKA 1Z21A 5LRSA 4A3CJ 1OYYA 3GYHX 3B7UX 5JNLA 2DA1A 1O3TA 2EIMH 1FBUA 5EYRA 1SAUA 1QO0D 4AR9A 2ZO4A 2GWRA 4IHVA 2R72A 3S1QJ 1Q0LA 3FF5A 3BR3A 3KZIC 1TZLA 4A5MA 2RV8A 2C5ZA 1B59A 5LD2C 2DN0A 4IZZA 3B73A 1YS7A 4XO4A 4N9HA 4DYCA 4XONA 4S0HB 3RIRA 3R0AA 4S05A 4WF2A 2O0YA 4BQOA 3NRVA 3BR1A 4QIRA 3H3ZA 5JHUA 3X2QH 3BG3A 3PL8A 4B4CA 4DNCA 1OYIA 1ON2A 5EDNA 1MSFC 2ZC2A 1A31A 1R58A 3HG9A 4LGWA 5IYCJ 2A61A 5J1RA 2V4JC 3EUHA 1T56A 2F6CA 1D1CA 5EGOB 3VFZA 2PG4A 1WJAA 3HM5A 3T0YA 3TMOA 2DT5A 3CF5F 2FNPA 1XGOA 4N0BA 1BI1A 3HUGB 3QJXA 3OR2C 3FWEA 1E3PA 1S7EA 1IUYA 2HPOA 3ZR8X 1YTYA 2VE8A 4PUSA 3HHGA 3MZYA 2RGVA 1R5GA 3F6VA 1XCBA 3TO7A 1B8IA 2HDDA 3CF2A 1OJLA 2MD5A 1IJWC 3H36A 1O7FA 1MBEA 4IRIA 1Z6TA 3M3YJ 2E19A 4ZDPA 5AENA 2XAHA 3HW2A 1LFBA 5EG0B 3TO9A 1ZRFA 3FUJA 5GP9A 4QWQA 3FUFA 1K83J 3TEDA 2Y1EA 3DKYA 3U9WA 4XK4A 4OIRF 3ELKA 2JD2A 5DM6F 4P5OA 4BXXJ 1HKTA 3R0IA 2EA4A 2F5DA 3CC4I 1XS9A 3SZTA 1YFHA 5LLQA 3IAM2 4L9TA 1X4PA 3OS1A 3ZCOA 5D6EA 3VPRA 1ZR4A 3OR1C 3FXJA 3GFMA 4DYQA 4JNDA 2XSDC 1TW2A 1P7IA 4H0EA 2JA7J 2W48A 1EF4A 2LG4A 3B7TA 1MKMA 1R5ID 3TW7A 2VBYA 5DTDA 1ETYA 5E3OA 1SMTA 1BBYA 2RAEA 4UVBA 2IS1A 1V4RA 1IXSB 1LFPA 2F5VA 2LBFB 4A0YA 3O3KA 3PUUA 4AVZA 2ACJA 1XGMA 3P9IA 5EGOA 1Z1DA 5FRNA 4IF4A 5HS9A 2DA4A 3OS0A 5ILUA 3TP0A 2ZXWH 2HDWA 3NAUA 1W0UA 2VT3A 2CS3A 4DQ2A 3S17J 3BT9A 3HUGA 2K9NA 3FTWA 4IKFA 3EQLF 3M1EA 3GZ5A 4E7SA 1UMQA 2ICWG 4MNUA 3KP5A 4E70A 4WX9A 3MCZA 2COMA 3GLXA 1ZH5A 2VXZA 2YUSA 4ZJZA 3FMRA 3ZQQA 1JJ6C 3MFKA 3OYCA 1Q0QA 5DULA 1L0OC 2MW8A 1E2XA 3L2RA 4BEHB 1YIOA 3O8HA 2CV2A 1X2NA 1U3EM 3C18A 2X0LA 1LDDA 4CSWA 2GA2A 3FXUA 2OZUA 3RC8A 1P4WA 4YEJA 2OTJI 1XMXA 2HGCA 3A4CA 4E7ZA 2JMWA 3O8GA 2JJ7A 2CJJA 3C2GA 4U7DA 2A6HF 3AU9A 4PZJA 5B1BH 1TWFJ 3FXRA 1NG6A 2H27A 1JE8A 1I3AA 1JJ8C 4G6QA 1GDTA 2QF7A 3RKYA 3WG7H 4ENJA 3K4NA 3ZMTA 4ZTFA 2EGHA 1WJDA 1B6AA 3L09A 4XRSA 5EEGA 3DTEA 3WTSC 4BY7J 4GDFA 2BHYA 3IH4A 2M45A 4L5EA 4EATA 4EV0A 5FFXA 2OAZA 5JI6A 4HPQA 4EJVA 2L5QA 2LBFA 3ANMA 4NUBA 2A05A 3JRGA 2DPUA 3B2XA 4GRIA 3QQAA 3FU6A 1P7JA 1Z91A 1YO5C 1SC7A 3CCQI 2R70A 3CLQA 2UXXA 3E6BA 1FYLA 3A1YA 3EETA 4RLQA 1LDJA 3UNGC 2GIVA 1VFCA 3KP6A 1MNDA 2Z1DA 2EFQA 3LSPA 1BR2A 4PVBA 4RGUA 1G59A 2Y1DA 3ANLA 1HKQA 3UR3C 2EILH 4G6DA 4AC0A 1APLC 1XSDA 1A6QA 1YW7A 3FXMA 3LOCA 4HZFA 3AG4H 4U0VA 3LSRA 2GXAA 1J09A 2DFFA 3S14J 2MH2A 2DA5A 3IHUA 3WHCA 4D7NA 3JRIA 4M3BA 2M87A 2QQAA 4FTHA 1Y1VJ 4JX6A 4DZJA 3QP6A 5ERIA 5DV5A 1I1SA 2QVOA 3CMEI 2CW7A 1OCPA 1ZGAA 2KISA 2PEXA 4U0WA 4MTEA 3K7AJ 2MD0A 2L9RA 1KU2A 4YIRX 2K40A 3B6AA 3CHSA 3K4LA 2WAFA 1JUMA 3FKIJ 1T95A 5JLXA 3CCEI 5A2QZ 3KP2A 3AFHA 1OCZH 3JW4A 3CHRA 1S7OA 3H92A 4B1RA 1VF9A 4MEYF 1R71A 5EEAA 4JX5A 2IXSA 3F72A 2M1BA 1SAXA 2LNBA 2R5ZB 1JI8A 4E4HA 3DPUA 3PJRA 3C7JA 4NQWB 4XNDA 2XPYA 2AXLA 4JBAA 5HDGA 2CG4A 1I6HJ 3F6OA 2L9SA 4AD9A 4AYSA 3A01B 1XGSA 4KICA 1I50J 5F27A 1R5HA 2ZSIB 2PJRB 3RZOJ 4KIGA 4EMSA 2IAIA 4HDVA 1FYMA 2JA6J 1Z7LA 3U9GA 4C9YA 3HBLA 2HVSA 3FHNA 1KQ8A 5H6QA 3MAJA 4JOMA 2BHZA 4LD5A 5CPRB 1IRXA 2DDBA 3H1CA 3T8RA 1EA3A 3REOA 2HKOA 1SC5A 2F5FA 4F91B 2E2JJ 5LHHA 1WSUA 2MC3A 2R59A 1Z3XA 2DA6A 3O6BB 1T0FC 2IGMA 3OSGA 1ZRDA 5C4JJ 3ZHYA 1D8JA 2R7OA 3KP3A 2COBA 2FA5A 5E8GA 4K5NA 3ZHXA 4KISA 3JRDA 5B66C 2ID3A 2PMZA 2RJIA 4Z2YA 4FLRA 2R7FA 1FOKA 3IC7A 4XMTA 3W6KB 2VLAA 2JUGA 4RB3C 2VXDA 4BXFA 2JK3A 4YFNF 4M72A 4U88A 2R5YB 1BI0A 4UV9A 3L2UA 3V8LA 4MTDA 4R7LA 5C44J 5EZGA 1IN6A 4Y4RA 5FKLA 2R7WA 3QOPA 4Y67A 2R5ZA 4RM2A 5LHGA 1ZHFA 2W00A 4HA8A 3CZEA 3BROA 4PJNA 4A69C 3FTXA 3GW2A 5HLGA 3S93A 3HOXJ 2ZKZA 3OSFA 3OIQA 3A01A 5BNGA 3BTLA 4RMNA 1Z77A 2LH9A 4AWXB 1O3SA 4OIOF 3DBLB 4EM0B 2PJRA 1R00A 4XLEA 1L3LA 3HHHA 1R4NB 5KHDA 2DAOA 2AHQA 1Q1HA 2STWA 1BN5A 2V9KA 4D7MA 5F0FA 2P81A 2VI6A 4G7OF 3HXLA 3RDIA 4BBSJ 3S2HJ 1OCCH 4A93J 2CFOA 3V8KA 3GTGJ 3FULA 2L3DA 2ZJ2A 1P4AA 4CDGA 1DGWY 4OMZA 1LDKB 5DYFA 1X4OA 4M3GA 1LE8B 3VVLA 3BR2A 3CCLI 2GM4A 4M6XA 4PJ0C 2NAZA 3A03A 3FU5A 3BQYA 2X6XA 1SFOJ 1X3ZB 3KIOA 2XVCA 2DMUA 5BQTA 1K78B 2WAQA 5BPDA 5BPPA 3V42A 2IVMA 2L54A 1DU0A 4UUSB 3JRCA 3RYRA 3S3NA 3WG9A 1D8KA 2Y31A 4QPEA 1EH8A 4DYRA 5TGTA 3OIOA 4LK0F 2LDUA 3B34A 3FTYA 3VOEA 3GTQJ 4PJMA 2R5YA 2Z9OA 1YW8A 2P0WA 4ZW7A 5D4SA 3I4MJ 4X1EA 5LRRA 1G8XA 3EBHA 4X2UA 4K5MA 3F22A 4PSWA 4M6VA 2E1CA 2HOAA 3GX4X 3AL0C 2Z5UA 2AO9A 2EV0A 2JSPA 4HQMA 1K6OA 2DYSH 4XO3A 3IWZA 2PMUA 1JKOC 4A0XA 3ECHA 1T2KA 3B6CA 1V5GA 2NVYJ 5JBIA 4ZW6A 1LVAA 2CUFA 2ZMEB 4XNBA 2FOKA 3FHEA 1IF1A 2L2OA 1TNSA 3I64A 1QVTA 2K4JA 4L5IA 2R4GA 3RPQA 2Z99A 2ZFUA 4P1WA 2PLYA 1JVSA 1JHHA 5HLTA 2Y0MA 2OA4A 2E7WA 1W7PB 4G8XA 4A3DJ 1BC7C 2CQNA 3DBHB 1LE8A 1GXQA 4LLLA 3FH7A 3LAJA 2MC4A 2M4GA 1N78A 2K9LA 2E60A 4A3EJ 1X3ZA 1K78A 1O4XA 1MBFA 3PNTA 2E2HJ 2HYGD 2I8DA 2OD5A 4ZQTA 3LL7A 1JGSA 1X1CA 3IUOA 5DD4A 3K4KA 1ZGJA 4OAZA 2DFHA 4RAGA 4JP0A 3V4GA 2XHKA 3JSOA 3ZXSA 1GHCA 3CD6I 3WE2A 3J7AY 1Y0NA 5JVTA 3FUIA 1D3YA 2JV7A 2STTA 3BJAA 5DYMA 4A3KJ 5FJ8J 2OQGA 1RNLA 4HEA2 4M9XA 4Q47A 1KYWA 3CDLA 3K70C 2W7NA 1X3WB 2VASA 3GEZA 3OYGA 1MBJA 6PAXA 2VPLA 1FEXA 3N4MA 3E5XA 1FWZA 4IQJA 3HKZA 3V7SA 2BOLA 3J81K 3HL2A 1OQYA 4KITB 2E2IJ 3J80Z 2ZMEA 3MKWB 1S9HA 3CCUI 4LB5A 3F8CA 2KJBA 2L01A 3J7ZI 4ZW8A 1R4MB 1R23A 1AU7A 1X19A 2MG4A 4HX8A 2H1LA 3K4CA 4PJLA 1W7PA 5M3MJ 5DM7F 4UNOA 2M8GX 2UXNA 3FX3A 3HJEA 4N9IA 4UB8C 1KZHA 2L7FP 4EGZA 4IHTA 2ECCA 3LA7A 2XKPA 3BQZA 3ZQLA 1K6YA 3U1DA 2ZJQF 1BA5A 2JVGA 5CKTA 5F0HA 2EIJH 2VBWA 2KQRA 2CFXA 4J00A 3CTAA 4DZPA 2W1OA 5E8IA 4V2FA 3RCOA 5JO0A 5L3BA 2B0LA 4X0GA 2XV4S 5F64A 2O8XA 4FHTA 4DOZA 2IS4A 5E1WA 3EBIA 1RRJA 3KEDA 2M9HA 4L0YB 3CUQB 4LOCA 3SFZA 1E3OC 2PL5A 4BE0A 1SD5A 4OU0A 5GTHC 1VQ6I 2PMZN 1MGTA 2Z3YA 3OWTA 1N77A 1EH6A 3ML6A 1FBSA 3DLAA 2VQLA 3WTVC 1GV5A 4M6YA 3A14A 1HSJA 1LUJB 1X3WA 2QQ9A 1WRJA 5FGMA 4ZYAA 2EFWA 4XLHA 1YS6A 3WU1B 2LREA 4KA4A 4HV6A 2HQ5A 2M8EA 1IN5A 3HTUA 3QP5A 2HTJA 3IKTA 3F0CA 4KP7A 1MDMB 4AIHA 3ASOH 4G7HF 4IOCF 1ETKA 3R4KA 4KNYA 2L7KA 1FX7A 2OUMA 3ZQFA 3H3VK 2EINH 2MAPA 3LSGA 1MSEC 2Y2ZA 5J1YA 3ZGKA 1J5YA 4Y3OA 5HODA 2O6GE 1V5EA 3FXOA 4RS8A 3A02A 1CQTA 2F5CA 5IP9J 3OL3A 2NRAC 5DUIA 3KYCB 4ZX4A 2XAUA 4Y52J 3H5AA 3C2HA 4XR6A 2V1DA 1SVMA 1H9GA 1WH5A 2LY1A 5E1XA 4AR1A 2XASA 1R1VA 1T33A 2LOOA 3FTSA 1K4SA 2RKHA 3M8FA 1XDSA 3DWLE 2DDAA 2WADA 1E3HA 4HF0A 2W57A 1OCOH 4CA0A 1GLNA 3E5UA 2VKHA 3K2ZA 4I76A 3QPHA 1XDUA 2WAQN 1FLIA 1QPMA 1QZZA 3GMEA 2HXOA 2V1XA 4F92B 3OYMA 3QYBA 4OOFA 1MZBA 1X58A 2EZIA 5CYVA 2PMHA 4XNAA 2GA1A 3DP7A 2VJIA 1ZTRA 1BI2A 4XORA 5CLSA 3CUOA 3DQVC 2KKOA 2IT0A 2LMDA 4UVAA 2XGEA 3FKJA 1RC9A 1FBQA 2QENA 3HC7A 2Y1FA 1LVKA 2PQ8A 3FU0A 4XN2A 5FB2A 2NVUB 3A0BC 1XCVA 2K27A 2IJLA 1MDMA 2FMLA 4CXFA 3RI4A 4G94A 2K9QA 2VBXA 1BC8C 3AKZA 1QGPA 2IA2A 5ICFA 2C6YA 4FASD 4BYYA 2A68F 2KRCA 4QUOA 4EJOA 3LQQA 3HSFA 4XN0A 3J80K 5J40A 4HSTA 3JRAA 1PUEE 1RKTA 2ZJPF 3KPHA 4AM3A 5FKKA 1F5TA 3CQZJ 2VKDA 5D5WB 1R49A 3Q3SA 1VQ8I 1MBGA 3F8BA 2V9PA 1SD4A 2BVLA 2JT1A 2RQPA 4LUPA 1K79A 3OYJA 2DQRA 2Z2SB 2MLGA 2P4WA 2BV6A 3ZMDA 4QIWN 3C1DA 4NC7A 3ULQB 3SDGA 3LNQA 4L9VA 2ZXJA 4R1HA 4W1UA 2LRDA 3KEOA 1BL0A 1W7PD 4B3XA 1KGSA 5K5OA 4XRFA 2HU9A 3ABTA 4BS9A 1AHDP 1VTNC 3VSKA 3COAC 5E17F 1ZAOA 3HSRA 2VT2A 4XMYA 1NK3P 3BR0A 4GXOA 1JHFA 1MIJA 1W36D 4GYIA 2CSOA 2HOSA 2AQFA 1W1WE 2Y9ZA 3W2VA 1BW5A 1FOWA 2BEOA 3ZRGA 2IP2A 2XC7A 3DLLF 5KK1A 1ERDA 4JK1X 3WTXC 1MH4A 1WH7A 2R7ZJ 3C2BA 5BS6A 1YJWI 3S1RJ 2ZBKA 3HKZN 4TV7A 1UHWA 3FISA 3FBIB 3I9V2 5D5UB 2FX0A 2PUSA 2LF8A 5HNHA 1I1GA 1H8AC 3H9GA 4CZCA 1IG7A 1SG7A 2K9MA 3M1CA 3KLOA 2JVHA 1H0MA 3CO6C 4M3FA 1C0WA 1XN7A 4B09A 4HQEA 2VKVA 3LMMA 2DXIA 5GTIC 5B3SH 3BR5A 2F5EA 3FUEA 4CYCB 3GZNB 2R7XA 1F4KA 3HPGA 3VSLA 2L02A 1GT0C 3IWFA 4EJWA 1XMAA 3TKYA 3MKYB 3ZMSA 2V1UA 2JA5J 4ZX3A 3GF2A 1SVLA 2DTZA 2Y69H 4A03A 2GLOA 1UCRA 2W25A 2QWWA 2A6TA 5E3LA 3QU6A 4I98B 4RGSA 1TWCJ 2Y48A 3D0SA 5HVQC 2V9VA 5L3GA 1V3FA 1BR4A 2IGKA 2ME6A 4FX4A 1VQLI 4W97A 1ZG1A 3KLNA 3CMAI 4RM3A 1HBXG 3DFGA 4BACA 3K4JA 4O3MA 2HR3A 2VC0A 2IA0A 2V1NA 5HDKA 1YE9A 1MMDA 2K9SA 1ZQ3P 5F04A 1JXSA 5H20A 4LG3A 2LD5A 4QSHA 2VC1A 1LNWA 4C3IJ 2EA2A 1QVUA 3JAMK 2AXTC 2DOEA 1R36A 2O7GA 3B02A 4P55A 1WPKA 4L9JA 3HTSB 1LKXA 5BPIA 4XLFA 3PFIA 1YRNB 1XB4A 2EZHA 3OL4A 4XKBA 5ICGA 3J7AO 4A0ZA 2O9LA 3LFUA 1MBKA 2GXGA 4HAMA 2JRTA 5EG0A 3JRFA 3L2WA 3CCRI 2M0CA 1R22A 2JWTA 2R7DA 3DBRB 4XN5A 2VQCA 2Y1CA 3DEWA 1P6RA 1JUSA 3L1PA 4FLQA 3GXOA 4ZQGA 2LFBA 1G3SA 1POGA 4L9NA 2EH3A 2X6YA 3K1MA 1IRFA 1VQ7I 4MHGA 1QBJA 4XKCA 1LQ1A 1J9IA 3IP4B 3MZ8A 4CYCA 1VQPI 3DV8A 3GUDA 3E6CC 2MABA 2KIFA 2IA1A 3MQ0A 2H09A 2R0QC 1ETQA 1FY7A 2ME0A 1I27A 2LTPA 2XB0X 2C82A 3VVMA 4FCAA 3EYIA 1DDNA 3EUHC 4QTRA 2XSJC 4RGRA 3CCJI 4PGHA 5TISC 4HYEA 1QPIA 3VDXA 1S5LC 1G4DA 4BQQA 2CQ7A 4ZC3A 2M4KA 3T1BA 1MW2A 1QZYA 3BDDA 3BC8A 1R6RA 2Q8KA 2OPTA 5ICCA 2V79A 3IH3A 2L4AA 2ZB9A 2F4OB 4Y6RA 1X1DA 2DLLA 1USSA 2HQNA 3H9JA 4I01A 1LPQA 1XD7A 3F8MA 5K5RA 4CGZA 4JYKA 3H0DA 3CJQB 3ZN0A 1U9NA 3LQRA 3BTJA 2EFOA 2ADUA 4BNCA 3EYYA 2MFZA 2VKEA 4MKTA 5J1UA 2PBIA 4UHTA 3WHBA 4BJ6C 5KCMA 1R1UA 3A0HC 1T98A 3DPLC 2L7MP 4RA2A 2OCCH 1RIOH 1VI0A 1YRNA 1HW5A 4BEHA 3D5LA 3OS2A 1O3QA 3V8JA 3T8TA 4A3JJ 4Y33A 5FD5A 1MJBA 2VQGA 4BU2A 5LEKA 4J19A 1OMIA 1ZREA 2PGGA 4XMWA 5HOOA 4R5VA 2VQHA 2GBYA 2E34A 4E7KA 3OYFA 3OMYA 2P6SA 4B43A 1IXRC 2FQ3A 2WA0A 3HPHA 3VYSB 1PUFB 2KIMA 1HDDC 2DW4A 1JG9A 1RZ4A 1QNTA 4XLPF 1USTA 1MMAA 3GBGA 3HIFA 4NC6A 3V7RA 2TDXA 2XIGA 5J4YA 3JT1A 3JSZA 3IL2A 3IRQA 4KIBA 1UHSA 3CC7I 4OMYA 4HG2A 1DPUA 2CYYA 3VYUB 3TW6A 2WB1A 4XN8A 2W82A 3I55I 5LGNA 1HW2A 1IRGA 2UV1A 3Q0WA 3CMYA 3S1MJ 1I39A 3GLLA 1O3RA 4ZQEA 1XG1A 3HDDA 4OAYA 1Y1WJ 4FLSA 4EJUA 3A2KA 1NTCA 1SD7A 4LIVA 1NK2P 4IEJA 3ZQIA 2DFEA 3ERMA 1BIAA 1SFUA 3OOUA 3BG5A 4B8XA 3GFIA 2ZJRF 2VODA 4FLOA 3QYFA 3W2WA 1FT9A 2VL8A 4AYBA 2VOOA 5GAHJ 1WWXA 2KHMA 2QBYB 2ID6A 2ELJA 2QKLB 3CP2A 4GAEA 2M0MA 2XPVA 5JVGF 2EB7A 4ETSA 3CHPA 1MMGA 2G7HA 3I5UA 2Q0OA 1MMSA 4OOIA 3JCUC 2X1DA 3Q43A 1O57A 4L0ZB 4RB2C 1Y8QB 5J4VA 4HW0A 5IYBJ 1X1PA 3BZCA 3K4MA 2LP0A 2IS6A 4ZX5A 1MD0A 3MD2A 4NB5A 2DT6A 1X1BA 1YI2I 3FH8A 1TLHB 1SFKA 5L3DA 4QHPA 1PUFA 3BTIA 5CVVA 3V7CA 5HS8A 2M7AA 4RBOA 2W84A 4E7LA 1DP3A 1UG0A 4EGYA 2HPIA 1CF7B 4M73A 1FPQA 1I5ZA 4BKXA 2P8TA 2DO7A 5AONA 2WZFA 2QA4I 3GTKJ 3FZVA 4R5TA 3LWFA 3E0JB 1PP8F 5JAZA 4LMYA 3J81Z 5FO5A 2DT7B 3BY6A 4HRIA 5FLVA 4CHUA 4K2EA 4XMUA 3PQJA 1B4AA 4NQWA 2NS7A 2JA2A 3QWLA 2BY3A 1VZ0A 5L3CA 2OU2A 3FUMA 3HRMA 4OIQF 3IKVA 2JCXA 3TP3A 2L4MA 4UB6C 1BI3A 5LHIA 3HOSA 2KT0A 2KPMA 1HW1A 2P5KA 5ED4A 2GXBA 2GAUA 2L0KA 1WI3A 4ZTJA 4MEXF 2NVTJ 2ZSHB 3LFKA 1EV7A 3M4OJ 1FTTA 3LSJA 3A06A 3OV8A 3I56I 3D1NI 3HOZJ 4A6EA 2QBYA 1R1TA 2L9VA 1PDNC 2XAGA 2XQ0A 3R60A 5CVJA 3I59B 3S1NJ 2XAQA 3MMYB 1ZLJA 2KMUA 4M74A 2QM3A 1YG2A 1BJZA 3K10A 4HNUA 4UY8I 5IYDJ 3SJMA 1TQIA 1YW9A 2RNGA 1JGIA 1BJAA 1R7JA 2IEKA 2X51A 4V2GA 4A2UA 4OINF 3F21A 2K02A 2HOTA 2JN6A 3BJ6A 2BYVE 1TQPA 4WCGA 1A6IA 4NDLA 3L00A 5CQGA 5KAFC 1YITI 5LEJA 4AICA 1ON1A 3DXJF 1FIAA 2UUZA 2BE5F 3IH2A 1HKSA 3PFYA 1J0RA 3LSMA 1CF7A 1HF0A 4M9ZA 3KCCA 4L2LA 4LK1F 1TP4A 5E1ZB 1UB9A 4I0AA 3Q9SA 2R93J 2Z33A 2EV5A 2X6WA 5HNFA 2CMPA 4P96A 1OKRA 2XGCA 4E7IA 2IS2A 2K85A 2ZXHA 2K3PA 1FMVA 4ZYEA 2IRFG 3GFJA 2JCYA 2E1MB 5IT9K 2JCVA 4MFDA 4EJTA 2RN7A 4G6TB 4IQ4A 1I3QJ 4G12A 2YS9A 4XICA 5J47A 2JRMA 2M2EA 2QVWA 2WV0A 2FOWA 4LITA 3RASA 1H89C 3GTMJ 3UCQA 3I59A 2KRFA 2QQBA 2P6TA 3W3CA 1QRYA 2VIXA 2VONA 2KIQA 1Y56A 4A3FJ 2RDPA 2HZDA 4YIFA 2CUZA 1DGRM 4FCYA 4HDUA 4XNFA 1U0JA 1WZ2A 3RC3A 3FIWA 1FYKA 1Y8RB 4HX4A 3PUFA 2V6EA 1D0YA 1A35A 2YR2A 2M3AA 1TWHJ 3CXBA 5CVRA 4UUSA 1W0TA 1JKRC 2ZXGA 1XSXA 2WV1A 4QPOA 2GQQA 3RPUA 4CCMA 1HSTA 5F6FA 2HQAA 3JRHA 1U5TB 2Q1ZB 3HRTA 1IC8A 2PJPA 3PSIA 3BJOA 3LSTA 5JHFA 2DCEA 2FXAA 1JKQC 1VQ5I 3ZHZA 5E3NA 1JGGA 1ZRCA 1IGNA 2LKPA 4CO8A 4QPQA 1STZA 5IOZA 5LBQA 3BZKA 3QPSA 1X3UA 1RP3A 1F1ZA 1DPRA 3GVAA 3I4PA 3QU3A 3U21A 1D0ZA 2GOXB 1YIJI 4A6DA 2WPGA 1IZ1A 2ZXIA 3UKGA 1IV8A 5DEQA 2ELKA 2WB1N 2LSOA 3ZPLA 1TNTA 4HSRA 3M7GA 4UV8A 2XROA 2TCTA 3RKXA 4Q4ZF 3BLYA 3ZQGA 4RDUA 1N25A 4KMUX 3VWBA 2J5PA 4QLCU 2DK8A 2JSCA 3ZQ7A 4XMZA 2KIUA 2DODA 2A69F 2EFPA 4A3MJ 1Z67A 3PNYA 2JPBA 4BBRJ 2N8GA 1S46A 2EPFA 4P9UA 5BMZA 2BXZA 4AYBN 3WODF 4YFKF 3BCAA 1E17A 2WC2A 3E97A 4LJZF 1LFUP 3BP8A 4AIJA 1OR7A 2R92J 4DIQA 3K6GA 3DTKA 2XPUA 1VQ4I 2WY7Q 3TOAA 5J6XA 3MN2A 4ANJA 3NEUA 5CQEA 4XMVA 2QQ8A 3OYHA 4RLFA 1IO2A 1Z05A 3E6DA 4ZH4F 1REPC 2EZKA 1D5VA 4ZZLA 4ENMA 2Y30A 2ISZA 3CCYA 1U5TA 2NNNA 3ZQHA 3QPTA 5D5XB 3B37A 2HDCA 4PFPA 2O3FA 2ECBA 5EEHA 2H94A 2ZNZA 4XOPA 2QSFX 5IP6A 4ENKA 1LEAA 4WXDA 3CCVI 1WI9A 3E1SA 1HC8A 3WQSB 4NHJA 1TT5B 2YU3A 3HGYA 3FTVA 2E1OA 2RNJA 3CESA 1VNDA 4MFEA 1RPWA 1FZPB 2QSHX 4ZQHA 2DMTA 3PIPF 3QRFF 2HEOA 1GUUA 3DF8A 4C2TA 1G3YA 2XGDA 4DGWB 1ITYA 4V19K 3I71A 4MGRA 4Q4EA 3H0GJ 5D4RA 4X6AJ 1H19A 3AUAA 3ZI0A 3FH5A 1QHHD 3DEUA 3BPVA 5K5QA 2MGQA 2EFNA 1XPXA 2KZGA 4AU7A 2FSWA 2XB5A 4XN3A 3TDZC 4BDYA 4ZDLA 1GW6A 2FE3A 4KT6A 4PU2A 4IVNA 1TWGJ 1HDPA 2IPQX 3E7LA 1P2FA 4MLOA 3ESWB 3G2BA 2BW3B 3E5QA 5DLLA 1ZN2A 2LVSA 5D6FA 3B7RL 4B47A 4FQGA 3L9FA 1OFCX 3K1PA 2YSRA 4MQVA 5LGUA 1RUNA 3FU3A 2KJCA 4B48A 2XAJA 2HQRA 3FM5A 3JTHA 4XKVA 2EWNA 2Y1GA 2E36A 3FTUA 2X9DA 4Q5SF 2M34A 4G9YA 3PUBA 3RZDJ 4E7JA 3MKLA 1ONNA 2FJ1A 3ZQCA 3DKWA 2CH0A 3G6EI 4JX4A 4IHSA 1MMNA 2M7BA 4NC8A 4Z6YA 1YQAA 5BOXA 4IPAA 3CUQA 1S3JA 2ESHA 3L2CA 2UWMA 1DUXC 2XF6A 2DOAA 4KDPA 1LB2A 3G1OA 4I2OA 3S3MA 1WCMJ 1Z3YA 2DQ6A 2V26A 3FUHA 2XAFA 3IV5A 3VYTB 4KT5C 2QEXI 1AA7A 1NH3A 2KP6A 2ZMEC 3RTRA 3JAMZ 5ICEA 1UELB 4BE2A 5K7FA 1K61A 2NOGA 1NHAA 3BTCA 4L18B 3CO7C 4XKWA 2EK5A 5C3EJ 4I0BA 3E6MA 3RPUD 4GYGA 4HBLA 2HVQA 3WTYC 3H5NA 4PCQA 1Y6IA 2XF7A 3H9QA 2GZWA 1UHMA 2Y0SA 3LA3A 1DP7P 4XRMA 3FTZA 1J75A 4ON0A 2KL4A 3P9KA 3PIOF 3FHZA 3M8EA 3PSFA 4Q48A 2BW3A 2KRHA 4LG0B 2HWVA 2CV0A 2O61A 4ARFA 4ITVA 1OISA 5HLIA 1W36C 1V55H 1FJLA 4XRSG 2IW5A 2P7VB 2DU9A 4FE7A 1A04A 2MH9A 2V6CA 4AVPA 1JT0A 5HLHA 2QUFA 5GPAA 1XX5A 2R7TA 5KAIC 4XBFA 2A3SA 4CCOA 5B1AH 1J2XA 3S32A 2OV7A 3GTPJ 4AR8A 1BR1A 3WTZA 2EZLA 4XO5A 2EV6A 3DTIA 3R6SA 2I10A 3QOEA 4B3AA 5JLWA 2CO5A 3JSPA 2VB6A 2GTQA 4M3DA 4ZX6A 3S2WA 1T1SA 1Y0UA 3RSNA 4II2A 3GFLA 1QA6A 3H35A 3FXLA 2DQLA 5FLXK 2KLOA 2E35A 2LK2A 3K1NA 1XMKA 4KJZA 2VE9A 2DMQA 4BAYA 4Y15A 3I3LA 2D45A 4K5PA 4ZYDA 1SFEA 4C30A 2DTRA 2L7ZA 4Y13A 2QJ1A 2Z16A 4ESJA 3ABKH 3NWTA 4RAYA 4HLYA 2IBDA 3RQ4A 1Z7UA 2JA8J 1DU6A 1SMYF 5FFZA 2PFBA 4RAFA 3SHFA 4B44A 1ETWA 4K5LA 1WGXA 3FMSA 4RGXA 2VJ5A 4LG0A 4H4KC 4XN4A 2HI3A 5KVRA 4PSXA 3MZHA 2P5LC 1T8IA 2X48A 2VBZA 4GAAA 3K0LA 1EJ9A 2R7QA 1VQOI 4O6JA 2X1EA 1JT6A 3TDUC 4DBRA 2XPZA 1PYVA 1P9QC 2M5WA 1Q0HA 3D5SC 1UAAA 4OIPF 2F4MB 1BW6A 1B72B 3Q9VA 1H88C 2B61A 2DK5A 2CRGA 2WY8Q 3CUQC 4BHBA 1ETVA 1FP1D 2ISYA 3F3XA 2HPMA 2VJ4A 5HS7A 3SXYA 1T39A 4R79A 5IT3A 2MYSA 1U6GA 1FOXA 2VJ8A 3CZ6A 4XN1A 1FOYA 2D1HA 4XM3A 2K7LA 3TQNA 4Y17A 2FNAA 1EKEA 2KZVA 2LF7A 3SYTA 1MNEA 4FX0A 3SZGA 4XL9A 5L3EA 2OTLI 2BXYA 1Y39A 1ZKGA 1W5SA 3ONQA 5L3FA 1CGPA 1HQCA 3KE2A 5E20A 5GAEJ 4MO7A 2QLZA 1MNMC 3CJTB 3M07A 3Q0UA 3PQKA 4A5NA 1I6XA 1XSVA 2X85A 4MIMA 4ZYGA 4PJJA 5DD8A 3OOPA 4CZZA 4N4NB 3KP4A 2CW8A 1ZK8A 3BWGA 5DCMB 2BBYA 1ORKA 3CJNA 1SQMA 1QHGA 5DDGA 5EV7A 3OYDA 2WAEA 1M1EB 1MJAA 3PO3J 3FUNA 3HEFA 3IAS2 3M9AA 2H6CA 1W5TA 3IIEA 1G6NA 3FK7A 1YJNI 4HLXA 3FBNB 3GCMA 3C3WA 4I09A 2DI3A 2MAOA 3OYBA 3CDHA 5JR3A 2CUEA 2HZTA 5J8FA 1LEBA 2RQQA 2QSGX 4Y6SA 3L7WA 1D0XA 1YX3A 2VN2A 3K9TA 3G73A 4PK4A 2PX9A 1B72A 2FFLA 1PJRA 4BHPA 1K4TA 2D5VA 1ETOA 1OCTC 2YU9J 1BOBA 4Y6PA 4A3IJ 4GO1A 5JMWA 3HRSA 5GAGJ 1TL8A 3FMQA 1T6SA 4I02A 1UG2A 3TL4X 1YLFA 5M3FJ 4M9SA 2CU7A 4C3HJ 2P5VA 4RB0A 1ONOA 3QODA 3EPZA 1Q1VA 2HPTA 2K5CA 3FDYA 5DCFA 4YFXF 2WZGA 3AG3H 3L2VA 1T0FA 1U8BA 3DKXA 2BY1A 3WU2C 2FQ4A 3I53A 2IGNA 1JTYA 4O5VA 3HOTA 3E3VA 4XSXF 1VQMI 2JZYA 1TQMA 3HSEA 2E5NA 3B7SA 2OJED 4E7HA 5CJ9A 3T8VA 4GCVA 5K7ZA 5DCMA 3MVPA 1XC5A 2K86A 1VQ9I 4M3EA 4WWCA 1YHQI 4DJAA 2B7EA 1XGNA 1ZELA 2DA2A 1DQUA 2DA3A 1RI7A 2DFIA 2E1NA 2K3FA 3DU5A 3SFIA 3AAFA 1ZGWA 2O8KA 5JMPA 4F52A 4YELA 2J5OA 4F55A 4HNTA 5K7HA 2NVQJ 3P5JA 5EJCA 3AL0B 1KU9A 3K2AA 5KNLA 5E18F 2R7UA 2Y0SN 2EJRA 5E79C 3OYIA 3JTGA 1QQIA 1BOAA 2O7OA 1O7LA 1AWCA 3HOYJ 1RESA 2LY2A 2H8RA 1ZS2A 1G2HA 2MA3A 1OLTA 1ZG5A 3FXQA 1OPCA 4ASNA 1BIBA 5D8KB 2A5YB 3Q44A 2HFHA 4A12A 1R0KA 1ACIA 4ESBA 2AQEA 3KYDB 1TBXA 1XTAA 2DBBA 1UFMA 5LFAA 4S04A 3W6VA 1VQKI 2A7OA 1VQNI 1G3TA 5IOYA 5E3MA 3F8FA 1IV6A 2DPDA 5IT9Z 2HKXA 3HOWJ 4XSZF 2HVRA 4IRHA 4OOEA 1KQ0A 1RR8C 4KN7X 2JTVA 5EZHA 5F1JA 3OYNA 2KDZA 5IP7J 1WJCA 5AIQA 1MBHA 2HNHA 1AKHB 2NS8A 5K1YA 2X6OA 1H3LA 4R5XA 3CZKA 3PO2J 2R7VA 1IRZA 4C2MJ 5ILVA 3IRRA 1KA8A 3WQRA 2CUJA 2AS5F 4WK8F 4U7BA 1MW3A 2X4HA 1FNNA 2NOJB 4ZQFA 4ZDOA 4EM1A 3GO5A 3KETA 1FP2A 4CCNA 2B63J 3F23A 3F8NA 2BY2A 2LY9A 3FUDA 5FKNA 3PNVA 4BJ5C 1A36A 2ELHA 3RJPA 4PDKA 1S6LA 3JREA 2O5RA 3U1KA 1ZG3A 1D1AA 2L9NA 4AIKA 3WGIA 1WJFA 3BZ6A 1WVRA 2HYJA 1HLVA 4PFOA 3WTUC 3K4BA 4ZW5A 3BCBA 4EEFG 3BG7A 1HXDA 1ZARA 4MQ9F 3GTLJ 4A3LJ 4HNVA 1PP7U 5TRDA 2YPRA 3KEYA 4BUPA 5M5WJ 1F9NA 4BQAA 3CZGA 5J3LA 4DW6A 3N97A 3NWSA 3WGHA 3SEQA 1R9TJ 2XKOA 4RAZA 1B1BA 1QZEA 3RYPA 3W2AA 3UERA 3TO6A 4RCVA 2IGOA 1UZCA 3I4NJ 3MKZA 2EBIA 3LSIA 1QU3A 1ZYRF 4BH9A 4IL6C 4U87A 2W24A 5D8LB 2PI0A 1K5HA 4KMFA 3T5XA 2KFDA 4HF1A 4LFUA 5ILSA 4M71A 1AKHA 4CCKA 3P7NA 3CIAA 1W5CC 2DJIA 1RR7A 2XDVA 1U2WA 3QYEA 2XF5A 2BZTA 1FSHA 4DBQA 2FMYA 2E71A 1WJEA 4D1QA 1IDZA 4J01A 4HOBA 1SANA 5F1RA 2LKSA 5FRMA 2E5ZA 3EDPA 4YIIA 4CUGA 4KFCA 3B3BA 3ZMVA 5H6RA 3EBGA 3KP7A 2FF4A 4FETA 4E6KG 3HYIA 3MWMA 4HV5A 4D5FA 1ZR2A 4IXAA 1AOYA 2H8WA 1FIPA 1JTXA 3LA2A 3KYLA 5DS9A 1WHUA 4K5OA 1TT0A 4FE4A 1U9OA 3WE3A 3HOVJ 2ZNYA 3MEXA 1TTYA 5HDNA 4F3QA 1TW3A 2LLKA 1S7AA 3ZOBA 2WTEA 1IAWA 3HRUA 1V5FA 1NG7A 4D5CA 2P7CB 1F36A 3HGGA 3J7YJ 2F48A 2RVCA 4D0PA 2HTSA 4LB6B 3ZP5A 9ANTA 1H9TA 1PVEA 3NQOA 5B5EC 4Y7NJ 3Q0VA 4IJAA 3S15J 5FWQA 3ERED 2F4IA 2A5WA 2A07F 2YX4A 3CP8A 2H1KA 5EF6A 4CH7A 3GTOJ 2R7RA 4FISA 1JKPC 4BL0B 4GFBA 3M8JA 4NBQA 2LYCA 4KUMA 1S72I 3TOBA 5TJJA 4F7ZA 3CZLA 1GXPA 1T38A 2KDOA 3P9CA 4EM2A 3CHQA 4IO9F 3OYLA 3AG1H 3HOUJ 5JC1A 2MSYA 4YRVA 2VPRA 2FBHA 1KYZA 2FUG2 1MVYA 1WJ5A 2G0EA 2Q2EB 1MW7A 2HOEA 1TC3C 1N75A 3GTJJ 1T1RA 2W85A 2ZFWA 1FMWA 1IXCA 1P4XA 1UJ8A 4YG2F 4XMXA 2Y9YA 1X1AA 3G71I 4RVBA 5A2QK 4MS6A 2DQMA 1IN4A 4I7HA 2DA7A 1A5JA 3K69A 3BOQA 4WXCA 4BY1J 3WTWC 1G5AA 3RKWA 5GADJ 3LSKA 3QAHA 2NVXJ 3O2PE 1MH3A 2GIZA 4BQNA 3S2DJ 5IY5H 2BY0A 4ABZA 3JRBA 3CCSI 2VUMJ 1MW1A 3DEEA 1GV2A 2HS5A 3KZZA 1MW0A 1YJ9I 2F2EA 1WQ2A 3L2QA 2QKMB 1B9MA 4KYWA 4ENNA 1HS6A 3EUKL 2FU4A 2CQQA 2VJJA 3AG2H 1KONA 2GOMA 1B9NA 2MLKA 2OZ6A 3WTTC 1LJ9A 1P92A 3BR6A 2RC4A 2OC6A 2HXIA 1K7AA 2OF7A 3DCFA 4CICA 1D5YA 2H6BA 2DMPA 3ZN1A 1KQ9A 5IPAA 4HF2A 2ZCWA 3VYRB 1BM9A 4KN4X 4AUXA 2E7XA 1IN8A
chains in the Genus database with same CATH topology
1Z3XA 2O7GA 4XKWA 2BVMA 1T0FC 2IGMA 1LKXA 3RPUD 4XLFA 2HVQA 4XOTA 3H5NA 3ZHYA 1Y6IA 2XF7A 2R7OA 3OL4A 3H9QA 2X1CA 4XKBA 2Y0SA 3LFUA 4K5NA 3ZHXA 3FTZA 3S8PA 4KISA 3L2WA 2RJIA 2PMZA 4FLRA 2KL4A 3PSFA 4XN5A 2BW3A 2KRHA 2VQCA 2Y1CA 4CCLA 4XMTA 2VLAA 2CV0A 4FLQA 2JUGA 4ARFA 4ZQGA 4ITVA 2VXDA 4NNJA 4BXFA 1W36C 4PW4A 2X6YA 1E0EA 4BE1A 4XKCA 3IP4B 3L2UA 4R7LA 2MABA 4Y4RA 3OYKA 2R7WA 4C2UA 3UEQA 2R7TA 4Y67A 4CCOA 2RREA 4RM2A 3S32A 2W00A 2C82A 3VVMA 2OV7A 3CZEA 4FCAA 4PJNA 3FTXA 4AR8A 1BR1A 3EUHC 3S93A 5FROA 3WQQA 2XSJC 2W4SA 4XO5A 3OIQA 3D5RC 4ZN6A 3DTIA 2LH9A 4RMNA 3VDXA 4BQQA 3QOEA 4RSYA 4ZC3A 2PJRA 2M4KA 2VB6A 2GTQA 1MW2A 3BC8A 3F9KA 4XLEA 1R6RA 2WBMA 4ZX6A 1T1SA 4Y6RA 3RSNA 2R7SA 4II2A 1X1DA 5KHDA 3H35A 3H9JA 2V9KA 3HXLA 3H0DA 3CJQB 2KLOA 2CFOA 2V7FA 1ONPA 3FULA 4QMEA 4Q4IA 4KJZA 1DGWY 1LDKB 5DYFA 3CJRB 3I3LA 1X4OA 2MFZA 4K5PA 3VVLA 4C30A 4MKTA 4XLCA 3N05A 1WFXA 4OWRB 2Z16A 4BJ6C 5KCMA 3K70D 2QJ1A 3DPLC 3FU5A 3NWTA 2X6XA 4D9JA 3RQ4A 4BEHA 2WAQA 3D5LA 3OS2A 5BPPA 3V42A 3H5RA 4Y33A 4B44A 3DPTA 4K5LA 2VQGA 3LSHA 4BU2A 3OY9A 3S3NA 3EUAA 4CCJA 4QPEA 2VJ5A 3CMMA 2PGGA 4XMWA 4ZW3A 4H4KC 3OYEA 5HOOA 4R5VA 5TGTA 1WJBA 2VQHA 3FUKA 4XQFA 4XN4A 4PSXA 3B34A 3FTYA 4N4OB 4XLAA 3OYFA 4E7KA 3OMYA 4B43A 3HPHA 4PJMA 2WA0A 2R7QA 3VYSB 4GAAA 2P0WA 1JG9A 4ZW7A 2X1EA 4DBRA 2XPZA 3SEZA 1PYVA 1P9QC 1Q0HA 3D5SC 1UAAA 1MMAA 3GBGA 3JT1A 1G8XA 3EBHA 3JSZA 4K5MA 4X2UA 4PSWA 4DPRA 2B61A 4HG2A 3AL0C 2WY8Q 3S3OA 3VYUB 2WB1A 2JSPA 2HPMA 4XN8A 1YX5A 2W82A 2VJ4A 3SDBA 4XO3A 4R79A 2LC2A 2MYSA 2UV1A 4XN9A 2VJ8A 3CZ6A 2JD0A 4XN1A 4XM3A 1V5GA 4ZQEA 5JBIA 4ZW6A 4BJTA 4OAYA 2KZVA 3FHEA 4XNBA 2L2OA 4FLSA 3A2KA 3SYTA 1MNEA 4LIVA 3SZGA 3OIPA 2R4GA 4XL9A 2ZFUA 4P1WA 1JVSA 3OOUA 4FLOA 5HLTA 3ONQA 3QYFA 3W2WA 2E1MC 2VL8A 3BG6A 4AYBA 2KHMA 2ELJA 2QKLB 3CP2A 4GAEA 2M0MA 3KX2A 2X85A 1R0LA 4J3BA 1HA8A 1N78A 2MC4A 2M4GA 3CHPA 1MMGA 2K9LA 4PJJA 3FH7A 2E60A 4N4NB 2X1DA 3Q43A 2CW8A 1X3ZA 3PNTA 1D1BA 1SQMA 3K4MA 1QHGA 2I8DA 2IS6A 4ZQTA 4ZX5A 3LL7A 5EV7A 1X1CA 3IUOA 2WAEA 3OYDA 3K4KA 3MD2A 4OAZA 3FUNA 2CV1A 2DT6A 3IAS2 1X1BA 3TBIA 3ZXSA 3FH8A 4LIUA 1SFKA 3CHOA 3IIEA 4QHPA 3J7AY 3FBNB 3FUIA 2MAOA 1OR7C 2M7AA 3OYBA 4E7LA 2JV7A 1DP3A 1UG0A 4Y6SA 2HPIA 2RQQA 4BDZA 1D0XA 1YX3A 4PK4A 4BKXA 4HEA2 2FFLA 1PJRA 3OYAA 3ANNA 2WZFA 3AU8A 1BOBA 3K70C 4II3A 2W7NA 4R5TA 4Y6PA 4JQFA 3E0JB 2VASA 3DU6A 3OYGA 5JAZA 5JMWA 2VPLA 4F93B 2DT7B 4IX7A 4HRIA 4IQJA 3HKZA 2BOLA 4XMUA 3TL4X 3HL2A 4KITB 4NQWA 2JA2A 3MKWB 1S9HA 1VZ0A 1ONOA 3FUMA 4BGDA 3QODA 2JCXA 3EPZA 2JD1A 3B2PA 2K5CA 4XN7A 3FDYA 2HPTA 3HOSA 2WZGA 2KPMA 4ZW8A 3L2VA 1Z21A 4ZTJA 1X19A 2ZSHB 3DKXA 3K4CA 4PJLA 3A06A 3B7UX 5JNLA 2IGNA 3HOTA 1SAUA 2XQ0A 4AR9A 2R72A 1K6YA 2E5NA 1Q0LA 3MMYB 3B7SA 4E7HA 2JVGA 2KMUA 5CKTA 1TZLA 2C5ZA 3T8VA 5LD2C 4IZZA 3K10A 4XO4A 4HNUA 2KQRA 4XONA 4J00A 2RNGA 4DJAA 1JGIA 2W1OA 1ZELA 1DQUA 2X51A 3DU5A 3RCOA 4BQOA 5JO0A 4X0GA 4QIRA 4DOZA 5JMPA 2IS4A 3PL8A 4F52A 4YELA 4F55A 4HNTA 3EBIA 3KEDA 5CQGA 3AL0B 5KNLA 3HG9A 2R7UA 3OYIA 2PL5A 2V4JC 4BE0A 4AICA 2LY2A 2F6CA 1D1CA 1ZS2A 1OLTA 3PFYA 2UUZA 3OWTA 1N77A 3LSMA 3Q44A 1WJAA 1R0KA 4L2LA 3TMOA 3DLAA 3T0YA 3QJXA 2VQLA 3HUGB 2AQEA 3OR2C 2HPOA 3A14A 3ZR8X 1X3WA 4PUSA 2X6WA 5LFAA 5HNFA 2CMPA 4ZYAA 2A7OA 4XLHA 4E7IA 2IS2A 3CF2A 2LREA 2ZXHA 2K3PA 2HVRA 1FMVA 4OOEA 2JCYA 2E1MB 2JCVA 4KP7A 3OYNA 4G6TB 1WJCA 4IQ4A 4ZDPA 5AENA 2L7KA 2HNHA 2OUMA 3FUJA 4R5XA 1H3LA 2MAPA 3CZKA 3LSGA 2R7VA 4BE2A 3FUFA 2Y1EA 3DKYA 3ZGKA 4Y3OA 2QVWA 3U9WA 3WQRA 4LITA 2CUJA 3RASA 1V5EA 4U7BA 1MW3A 4ZQFA 2NOJB 2JD2A 4P5OA 3UCQA 4ZDOA 3OL3A 3R0IA 4ZX4A 2XAUA 4CCNA 3H5AA 3C2HA 3IAM2 3FUDA 3PNVA 1X4PA 4XR6A 3W3CA 4BJ5C 3OS1A 2LY1A 2VIXA 3ZCOA 4AR1A 1Y56A 2O5RA 2HZDA 3OR1C 2CUZA 4JNDA 1DGRM 2LOOA 3FTSA 1D1AA 2L9NA 1U0JA 3DWLE 4XNFA 3RC3A 2LG4A 3B7TA 1WJFA 2WADA 2V6EA 1D0YA 2M3AA 4PFOA 4CA0A 2IS1A 1GLNA 1LFPA 2VKHA 3K4BA 2F5VA 2LBFB 2ZXGA 4ZW5A 3BCBA 3PUUA 3BG7A 4QPOA 4AVZA 4CCMA 2HQAA 4F92B 2Q1ZB 3OYMA 5FRNA 3QYBA 4OOFA 3OS0A 3PSIA 2HDWA 5JHFA 2CS3A 4XNAA 2DCEA 3ZHZA 2VJIA 3KEYA 4BUPA 3FTWA 3CZGA 4IKFA 4XORA 4QPQA 4E7SA 3NWSA 3DQVC 3SEQA 1RP3A 3FKJA 3W2AA 3HC7A 3UERA 2Y1FA 1LVKA 4RCVA 2IGOA 2VXZA 3U21A 3FU0A 3MKZA 4ZJZA 4XN2A 3LSIA 1D0ZA 2GOXB 3ZQQA 1QU3A 3OYCA 1Q0QA 4U87A 2WPGA 5DULA 2ZXIA 1K5HA 3L2RA 4BEHB 4CXFA 2CV2A 4HSRA 3AKZA 4CCKA 4CSWA 4FASD 3CIAA 2KRCA 2DJIA 4QUOA 2XDVA 3RC8A 3BLYA 3QYEA 2XF5A 4YEJA 3VWBA 4XN0A 4HSTA 3A4CA 4E7ZA 4DBQA 4XMZA 3C2GA 3AU9A 1WJEA 4D1QA 4J01A 1NG6A 3PNYA 2VKDA 1S46A 5FRMA 2E5ZA 4ZTFA 3K4NA 4CUGA 3BCAA 1WJDA 2EGHA 3B3BA 2BVLA 4LUPA 3DTEA 1OR7A 4DIQA 3OYJA 3EBGA 2Z2SB 3K6GA 3DTKA 2WY7Q 4FETA 4E6KG 4EATA 4ANJA 4XMVA 5CQEA 4HPQA 3OYHA 4RLFA 2L5QA 2LBFA 3ANMA 4NUBA 4NC7A 3B2XA 3KYLA 4K5OA 1TT0A 2LRDA 4GRIA 3FU6A 4B3XA 2HU9A 4BS9A 3B37A 2R70A 4PFPA 3VSKA 4F3QA 3A1YA 4RLQA 3UNGC 4XOPA 1MNDA 2Z1DA 1V5FA 3E1SA 1NG7A 3WQSB 1BR2A 4PVBA 4XMYA 3FTVA 3CESA 1G59A 2Y1DA 4ZQHA 1W36D 3ANLA 3UR3C 2AQFA 3W2VA 4C2TA 5FWQA 3ZRGA 2XC7A 1J09A 2F4IA 2A5WA 4DGWB 1ERDA 3CP8A 4Q4EA 4CH7A 1H19A 3AUAA 3ZI0A 2R7RA 3FH5A 1QHHD 4BL0B 3M8JA 2LYCA 3CZLA 2KDOA 4AU7A 3CHQA 3FBIB 4XN3A 4BDYA 4ZDLA 3OYLA 1GW6A 3I9V2 5JC1A 4YRVA 2CW7A 4KT6A 2PUSA 4PU2A 5HNHA 2MD0A 2FUG2 1MVYA 1WJ5A 2Q2EB 3H9GA 4MLOA 3G2BA 4CZCA 1MW7A 2BW3B 1N75A 5DLLA 3CHSA 1SG7A 1T1RA 3K4LA 3B7RL 2K9MA 2WAFA 1FMWA 3M1CA 1T95A 2JVHA 4B47A 3AFHA 3CHRA 4XMXA 1X1AA 3LMMA 2DXIA 3FU3A 4B48A 4RVBA 4MS6A 2DQMA 3FUEA 2R7XA 2IXSA 3HPGA 4XKVA 3VSLA 2Y1GA 3MKYB 3FTUA 1JI8A 1G5AA 4E4HA 3DPUA 3PUBA 4ZX3A 3PJRA 3LSKA 4A03A 4E7JA 4NQWB 1ONNA 4XNDA 4BQNA 2XPYA 2A6TA 2CH0A 2L9SA 4AYSA 1MMNA 2M7BA 4NC8A 3DEEA 1MW1A 5HVQC 1MW0A 2ZSIB 3L2QA 2PJRB 2UWMA 1BR4A 2IGKA 2QKMB 2XF6A 1Z7LA 4C9YA 2DOAA 1HS6A 3EUKL 2HVSA 2VJJA 3FHNA 4RM3A 1KONA 2GOMA 4JOMA 4BACA 3K4JA 5CPRB 1IRXA 3S3MA 1Z3YA 3FUHA 2DQ6A 2OC6A 2V26A 2V1NA 3VYTB 1YE9A 1MMDA 1EA3A 1AA7A 2KP6A 3RTRA 1SC5A 4LG3A 3VYRB 4F91B 1UELB 2R59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLA A;  5HLT A;  5HNF A;  5HNH A; 
#chains in the Genus database with same CATH topology
 5FKM A;  1SD6 A;  2BVM A;  3SZP A;  4XOT A;  4A3G J;  1J59 A;  3G1L A;  2X1C A;  1ODD A;  1X2M A;  3U2R A;  3S8P A;  3BG9 A;  5FD6 A;  1YYV A;  1V54 H;  2Q2E A;  1RUO A;  3ABL H;  4FT8 A;  1FSE A;  4CCL A;  5AIP A;  2PN6 A;  4NNJ A;  3GWZ A;  3G1M A;  3QPL A;  2O03 A;  4PW4 A;  5CVI A;  1E0E A;  4BE1 A;  4ZZD A;  4AID A;  2CQK A;  5GPC A;  2D2W A;  3I58 A;  4LLN A;  3OYK A;  4C2U A;  1RKW A;  3UEQ A;  1Z0X A;  3PM1 A;  2R3S A;  2RRE A;  3CLO A;  5H2F C;  2G9W A;  2XRN A;  3SQN A;  3ABM H;  2XPW A;  3ISP A;  2D1V A;  2JPC A;  3FM3 A;  3VOD A;  3KEQ A;  3WQQ A;  1ENH A;  2I5U A;  5FRO A;  2W4S A;  4XID A;  1ETX A;  3D5R C;  2CGP A;  4ZN6 A;  3G3Z A;  2UZK A;  2LKX A;  4RSY A;  2ESN A;  4R8H A;  3F9K A;  4GGG A;  2FD5 A;  2WBM A;  1IN7 A;  2FRH A;  2R7S A;  5FKO A;  1S8N A;  1SVO A;  2A6E F;  4IHW A;  2EQR A;  5FLX Z;  2CW0 F;  2Y75 A;  3I54 A;  3VEP A;  3NAR A;  3VB2 A;  1ZLK A;  4BXU A;  1EH7 A;  1ONP A;  2OBP A;  2V7F A;  4QME A;  1OCR H;  4IOA F;  4Q4I A;  3CCM I;  3CJR B;  2OCE A;  2CWE A;  4XLC A;  1U8R A;  3N05 A;  1WFX A;  4OWR B;  3JR9 A;  3K70 D;  1FC3 A;  2M30 A;  3HB9 A;  1GVD A;  4D9J A;  1IW7 F;  1G3W A;  3H5R A;  2JUC A;  3DPT A;  3ZMZ A;  3LSH A;  3OY9 A;  3EUA A;  4CCJ A;  3HZJ A;  3GZ6 A;  3CMM A;  2OQR A;  3W6J B;  4ZW3 A;  3OYE A;  1WJB A;  5CVU A;  3FUK A;  4XQF A;  4N4O B;  4XLA A;  2FEZ A;  4G7Z F;  3ECO A;  2VOP A;  1MJ9 A;  3Q5F A;  3S16 J;  4HX7 A;  2NYX A;  2QYO A;  3SEZ A;  1J7K A;  1SFX A;  2TRT A;  4IRG A;  4WXH A;  1GVJ A;  1WKM A;  1IUF A;  4I99 C;  4DPR A;  3R61 A;  3H3U A;  3S3O A;  1W4M A;  2LR8 A;  5M5X J;  1T08 B;  1YX5 A;  1KU7 A;  2JQ7 A;  3SDB A;  4EQQ A;  3RQI A;  2XUB A;  1SEU A;  2LC2 A;  2XGX A;  4XN9 A;  1Z9C A;  2QZ8 A;  2JD0 A;  2ETH A;  1Z6R A;  4KIF A;  4UUT A;  3G4S I;  4IHX A;  2YX7 A;  4I6Z A;  4BJT A;  4ESF A;  3ABU A;  2DMN A;  3OIP A;  2QCO A;  2NXN B;  5F08 A;  5D5V B;  1OYW A;  3RKQ A;  2DOF A;  2E1M C;  3BG6 A;  1ONV A;  1S29 A;  4XLN F;  1IDY A;  3KX2 A;  3CC2 I;  1R0L A;  4J3B A;  1HA8 A;  1KU3 A;  4ZYH A;  3KZY A;  1F43 A;  1D1B A;  4C3J J;  3ZMU A;  4L5J A;  5C4X J;  2QGU A;  2DYR H;  5FLM J;  2NS0 A;  2NNY A;  3BPX A;  2XRL A;  4RB1 A;  2CV1 A;  4A3B J;  4CYD A;  4BHC A;  3TBI A;  2BGC A;  4LIU A;  4UVC A;  3CHO A;  2HYF A;  3KFW X;  2G7U A;  5DUK A;  4UXN A;  3TGN A;  5M5Y J;  1OR7 C;  1FTZ A;  4PGG A;  4BDZ A;  2B9S A;  3FK6 A;  5F0C A;  1YOV B;  3ROU A;  4UUV A;  3OYA A;  3LAP A;  3WGG A;  5JFR A;  3ANN A;  3AU8 A;  1JUP A;  2WWY A;  4II3 A;  4JQF A;  3DU6 A;  1HCR A;  2CQX A;  2EIK H;  4IHY A;  1U78 A;  1U5T C;  4F93 B;  4IX7 A;  4LLG F;  1B8I B;  3CDI A;  1TWA J;  4EVI A;  1HOM A;  3I0T A;  3FXK A;  3WU0 A;  2MBF A;  4U0Y A;  2FBI A;  4P9F A;  2DJN A;  3ASN H;  4BGD A;  1ULY A;  2JD1 A;  3B2P A;  4XN7 A;  1RET A;  2K4B A;  5LGT A;  5J8C A;  3R0J A;  2FBK A;  1Z21 A;  5LRS A;  4A3C J;  1OYY A;  3GYH X;  3B7U X;  5JNL A;  2DA1 A;  1O3T A;  2EIM H;  1FBU A;  5EYR A;  1SAU A;  1QO0 D;  4AR9 A;  2ZO4 A;  2GWR A;  4IHV A;  2R72 A;  3S1Q J;  1Q0L A;  3FF5 A;  3BR3 A;  3KZI C;  1TZL A;  4A5M A;  2RV8 A;  2C5Z A;  1B59 A;  5LD2 C;  2DN0 A;  4IZZ A;  3B73 A;  1YS7 A;  4XO4 A;  4N9H A;  4DYC A;  4XON A;  4S0H B;  3RIR A;  3R0A A;  4S05 A;  4WF2 A;  2O0Y A;  4BQO A;  3NRV A;  3BR1 A;  4QIR A;  3H3Z A;  5JHU A;  3X2Q H;  3BG3 A;  3PL8 A;  4B4C A;  4DNC A;  1OYI A;  1ON2 A;  5EDN A;  1MSF C;  2ZC2 A;  1A31 A;  1R58 A;  3HG9 A;  4LGW A;  5IYC J;  2A61 A;  5J1R A;  2V4J C;  3EUH A;  1T56 A;  2F6C A;  1D1C A;  5EGO B;  3VFZ A;  2PG4 A;  1WJA A;  3HM5 A;  3T0Y A;  3TMO A;  2DT5 A;  3CF5 F;  2FNP A;  1XGO A;  4N0B A;  1BI1 A;  3HUG B;  3QJX A;  3OR2 C;  3FWE A;  1E3P A;  1S7E A;  1IUY A;  2HPO A;  3ZR8 X;  1YTY A;  2VE8 A;  4PUS A;  3HHG A;  3MZY A;  2RGV A;  1R5G A;  3F6V A;  1XCB A;  3TO7 A;  1B8I A;  2HDD A;  3CF2 A;  1OJL A;  2MD5 A;  1IJW C;  3H36 A;  1O7F A;  1MBE A;  4IRI A;  1Z6T A;  3M3Y J;  2E19 A;  4ZDP A;  5AEN A;  2XAH A;  3HW2 A;  1LFB A;  5EG0 B;  3TO9 A;  1ZRF A;  3FUJ A;  5GP9 A;  4QWQ A;  3FUF A;  1K83 J;  3TED A;  2Y1E A;  3DKY A;  3U9W A;  4XK4 A;  4OIR F;  3ELK A;  2JD2 A;  5DM6 F;  4P5O A;  4BXX J;  1HKT A;  3R0I A;  2EA4 A;  2F5D A;  3CC4 I;  1XS9 A;  3SZT A;  1YFH A;  5LLQ A;  3IAM 2;  4L9T A;  1X4P A;  3OS1 A;  3ZCO A;  5D6E A;  3VPR A;  1ZR4 A;  3OR1 C;  3FXJ A;  3GFM A;  4DYQ A;  4JND A;  2XSD C;  1TW2 A;  1P7I A;  4H0E A;  2JA7 J;  2W48 A;  1EF4 A;  2LG4 A;  3B7T A;  1MKM A;  1R5I D;  3TW7 A;  2VBY A;  5DTD A;  1ETY A;  5E3O A;  1SMT A;  1BBY A;  2RAE A;  4UVB A;  2IS1 A;  1V4R A;  1IXS B;  1LFP A;  2F5V A;  2LBF B;  4A0Y A;  3O3K A;  3PUU A;  4AVZ A;  2ACJ A;  1XGM A;  3P9I A;  5EGO A;  1Z1D A;  5FRN A;  4IF4 A;  5HS9 A;  2DA4 A;  3OS0 A;  5ILU A;  3TP0 A;  2ZXW H;  2HDW A;  3NAU A;  1W0U A;  2VT3 A;  2CS3 A;  4DQ2 A;  3S17 J;  3BT9 A;  3HUG A;  2K9N A;  3FTW A;  4IKF A;  3EQL F;  3M1E A;  3GZ5 A;  4E7S A;  1UMQ A;  2ICW G;  4MNU A;  3KP5 A;  4E70 A;  4WX9 A;  3MCZ A;  2COM A;  3GLX A;  1ZH5 A;  2VXZ A;  2YUS A;  4ZJZ A;  3FMR A;  3ZQQ A;  1JJ6 C;  3MFK A;  3OYC A;  1Q0Q A;  5DUL A;  1L0O C;  2MW8 A;  1E2X A;  3L2R A;  4BEH B;  1YIO A;  3O8H A;  2CV2 A;  1X2N A;  1U3E M;  3C18 A;  2X0L A;  1LDD A;  4CSW A;  2GA2 A;  3FXU A;  2OZU A;  3RC8 A;  1P4W A;  4YEJ A;  2OTJ I;  1XMX A;  2HGC A;  3A4C A;  4E7Z A;  2JMW A;  3O8G A;  2JJ7 A;  2CJJ A;  3C2G A;  4U7D A;  2A6H F;  3AU9 A;  4PZJ A;  5B1B H;  1TWF J;  3FXR A;  1NG6 A;  2H27 A;  1JE8 A;  1I3A A;  1JJ8 C;  4G6Q A;  1GDT A;  2QF7 A;  3RKY A;  3WG7 H;  4ENJ A;  3K4N A;  3ZMT A;  4ZTF A;  2EGH A;  1WJD A;  1B6A A;  3L09 A;  4XRS A;  5EEG A;  3DTE A;  3WTS C;  4BY7 J;  4GDF A;  2BHY A;  3IH4 A;  2M45 A;  4L5E A;  4EAT A;  4EV0 A;  5FFX A;  2OAZ A;  5JI6 A;  4HPQ A;  4EJV A;  2L5Q A;  2LBF A;  3ANM A;  4NUB A;  2A05 A;  3JRG A;  2DPU A;  3B2X A;  4GRI A;  3QQA A;  3FU6 A;  1P7J A;  1Z91 A;  1YO5 C;  1SC7 A;  3CCQ I;  2R70 A;  3CLQ A;  2UXX A;  3E6B A;  1FYL A;  3A1Y A;  3EET A;  4RLQ A;  1LDJ A;  3UNG C;  2GIV A;  1VFC A;  3KP6 A;  1MND A;  2Z1D A;  2EFQ A;  3LSP A;  1BR2 A;  4PVB A;  4RGU A;  1G59 A;  2Y1D A;  3ANL A;  1HKQ A;  3UR3 C;  2EIL H;  4G6D A;  4AC0 A;  1APL C;  1XSD A;  1A6Q A;  1YW7 A;  3FXM A;  3LOC A;  4HZF A;  3AG4 H;  4U0V A;  3LSR A;  2GXA A;  1J09 A;  2DFF A;  3S14 J;  2MH2 A;  2DA5 A;  3IHU A;  3WHC A;  4D7N A;  3JRI A;  4M3B A;  2M87 A;  2QQA A;  4FTH A;  1Y1V J;  4JX6 A;  4DZJ A;  3QP6 A;  5ERI A;  5DV5 A;  1I1S A;  2QVO A;  3CME I;  2CW7 A;  1OCP A;  1ZGA A;  2KIS A;  2PEX A;  4U0W A;  4MTE A;  3K7A J;  2MD0 A;  2L9R A;  1KU2 A;  4YIR X;  2K40 A;  3B6A A;  3CHS A;  3K4L A;  2WAF A;  1JUM A;  3FKI J;  1T95 A;  5JLX A;  3CCE I;  5A2Q Z;  3KP2 A;  3AFH A;  1OCZ H;  3JW4 A;  3CHR A;  1S7O A;  3H92 A;  4B1R A;  1VF9 A;  4MEY F;  1R71 A;  5EEA A;  4JX5 A;  2IXS A;  3F72 A;  2M1B A;  1SAX A;  2LNB A;  2R5Z B;  1JI8 A;  4E4H A;  3DPU A;  3PJR A;  3C7J A;  4NQW B;  4XND A;  2XPY A;  2AXL A;  4JBA A;  5HDG A;  2CG4 A;  1I6H J;  3F6O A;  2L9S A;  4AD9 A;  4AYS A;  3A01 B;  1XGS A;  4KIC A;  1I50 J;  5F27 A;  1R5H A;  2ZSI B;  2PJR B;  3RZO J;  4KIG A;  4EMS A;  2IAI A;  4HDV A;  1FYM A;  2JA6 J;  1Z7L A;  3U9G A;  4C9Y A;  3HBL A;  2HVS A;  3FHN A;  1KQ8 A;  5H6Q A;  3MAJ A;  4JOM A;  2BHZ A;  4LD5 A;  5CPR B;  1IRX A;  2DDB A;  3H1C A;  3T8R A;  1EA3 A;  3REO A;  2HKO A;  1SC5 A;  2F5F A;  4F91 B;  2E2J J;  5LHH A;  1WSU A;  2MC3 A;  2R59 A;  1Z3X A;  2DA6 A;  3O6B B;  1T0F C;  2IGM A;  3OSG A;  1ZRD A;  5C4J J;  3ZHY A;  1D8J A;  2R7O A;  3KP3 A;  2COB A;  2FA5 A;  5E8G A;  4K5N A;  3ZHX A;  4KIS A;  3JRD A;  5B66 C;  2ID3 A;  2PMZ A;  2RJI A;  4Z2Y A;  4FLR A;  2R7F A;  1FOK A;  3IC7 A;  4XMT A;  3W6K B;  2VLA A;  2JUG A;  4RB3 C;  2VXD A;  4BXF A;  2JK3 A;  4YFN F;  4M72 A;  4U88 A;  2R5Y B;  1BI0 A;  4UV9 A;  3L2U A;  3V8L A;  4MTD A;  4R7L A;  5C44 J;  5EZG A;  1IN6 A;  4Y4R A;  5FKL A;  2R7W A;  3QOP A;  4Y67 A;  2R5Z A;  4RM2 A;  5LHG A;  1ZHF A;  2W00 A;  4HA8 A;  3CZE A;  3BRO A;  4PJN A;  4A69 C;  3FTX A;  3GW2 A;  5HLG A;  3S93 A;  3HOX J;  2ZKZ A;  3OSF A;  3OIQ A;  3A01 A;  5BNG A;  3BTL A;  4RMN A;  1Z77 A;  2LH9 A;  4AWX B;  1O3S A;  4OIO F;  3DBL B;  4EM0 B;  2PJR A;  1R00 A;  4XLE A;  1L3L A;  3HHH A;  1R4N B;  5KHD A;  2DAO A;  2AHQ A;  1Q1H A;  2STW A;  1BN5 A;  2V9K A;  4D7M A;  5F0F A;  2P81 A;  2VI6 A;  4G7O F;  3HXL A;  3RDI A;  4BBS J;  3S2H J;  1OCC H;  4A93 J;  2CFO A;  3V8K A;  3GTG J;  3FUL A;  2L3D A;  2ZJ2 A;  1P4A A;  4CDG A;  1DGW Y;  4OMZ A;  1LDK B;  5DYF A;  1X4O A;  4M3G A;  1LE8 B;  3VVL A;  3BR2 A;  3CCL I;  2GM4 A;  4M6X A;  4PJ0 C;  2NAZ A;  3A03 A;  3FU5 A;  3BQY A;  2X6X A;  1SFO J;  1X3Z B;  3KIO A;  2XVC A;  2DMU A;  5BQT A;  1K78 B;  2WAQ A;  5BPD A;  5BPP A;  3V42 A;  2IVM A;  2L54 A;  1DU0 A;  4UUS B;  3JRC A;  3RYR A;  3S3N A;  3WG9 A;  1D8K A;  2Y31 A;  4QPE A;  1EH8 A;  4DYR A;  5TGT A;  3OIO A;  4LK0 F;  2LDU A;  3B34 A;  3FTY A;  3VOE A;  3GTQ J;  4PJM A;  2R5Y A;  2Z9O A;  1YW8 A;  2P0W A;  4ZW7 A;  5D4S A;  3I4M J;  4X1E A;  5LRR A;  1G8X A;  3EBH A;  4X2U A;  4K5M A;  3F22 A;  4PSW A;  4M6V A;  2E1C A;  2HOA A;  3GX4 X;  3AL0 C;  2Z5U A;  2AO9 A;  2EV0 A;  2JSP A;  4HQM A;  1K6O A;  2DYS H;  4XO3 A;  3IWZ A;  2PMU A;  1JKO C;  4A0X A;  3ECH A;  1T2K A;  3B6C A;  1V5G A;  2NVY J;  5JBI A;  4ZW6 A;  1LVA A;  2CUF A;  2ZME B;  4XNB A;  2FOK A;  3FHE A;  1IF1 A;  2L2O A;  1TNS A;  3I64 A;  1QVT A;  2K4J A;  4L5I A;  2R4G A;  3RPQ A;  2Z99 A;  2ZFU A;  4P1W A;  2PLY A;  1JVS A;  1JHH A;  5HLT A;  2Y0M A;  2OA4 A;  2E7W A;  1W7P B;  4G8X A;  4A3D J;  1BC7 C;  2CQN A;  3DBH B;  1LE8 A;  1GXQ A;  4LLL A;  3FH7 A;  3LAJ A;  2MC4 A;  2M4G A;  1N78 A;  2K9L A;  2E60 A;  4A3E J;  1X3Z A;  1K78 A;  1O4X A;  1MBF A;  3PNT A;  2E2H J;  2HYG D;  2I8D A;  2OD5 A;  4ZQT A;  3LL7 A;  1JGS A;  1X1C A;  3IUO A;  5DD4 A;  3K4K A;  1ZGJ A;  4OAZ A;  2DFH A;  4RAG A;  4JP0 A;  3V4G A;  2XHK A;  3JSO A;  3ZXS A;  1GHC A;  3CD6 I;  3WE2 A;  3J7A Y;  1Y0N A;  5JVT A;  3FUI A;  1D3Y A;  2JV7 A;  2STT A;  3BJA A;  5DYM A;  4A3K J;  5FJ8 J;  2OQG A;  1RNL A;  4HEA 2;  4M9X A;  4Q47 A;  1KYW A;  3CDL A;  3K70 C;  2W7N A;  1X3W B;  2VAS A;  3GEZ A;  3OYG A;  1MBJ A;  6PAX A;  2VPL A;  1FEX A;  3N4M A;  3E5X A;  1FWZ A;  4IQJ A;  3HKZ A;  3V7S A;  2BOL A;  3J81 K;  3HL2 A;  1OQY A;  4KIT B;  2E2I J;  3J80 Z;  2ZME A;  3MKW B;  1S9H A;  3CCU I;  4LB5 A;  3F8C A;  2KJB A;  2L01 A;  3J7Z I;  4ZW8 A;  1R4M B;  1R23 A;  1AU7 A;  1X19 A;  2MG4 A;  4HX8 A;  2H1L A;  3K4C A;  4PJL A;  1W7P A;  5M3M J;  5DM7 F;  4UNO A;  2M8G X;  2UXN A;  3FX3 A;  3HJE A;  4N9I A;  4UB8 C;  1KZH A;  2L7F P;  4EGZ A;  4IHT A;  2ECC A;  3LA7 A;  2XKP A;  3BQZ A;  3ZQL A;  1K6Y A;  3U1D A;  2ZJQ F;  1BA5 A;  2JVG A;  5CKT A;  5F0H A;  2EIJ H;  2VBW A;  2KQR A;  2CFX A;  4J00 A;  3CTA A;  4DZP A;  2W1O A;  5E8I A;  4V2F A;  3RCO A;  5JO0 A;  5L3B A;  2B0L A;  4X0G A;  2XV4 S;  5F64 A;  2O8X A;  4FHT A;  4DOZ A;  2IS4 A;  5E1W A;  3EBI A;  1RRJ A;  3KED A;  2M9H A;  4L0Y B;  3CUQ B;  4LOC A;  3SFZ A;  1E3O C;  2PL5 A;  4BE0 A;  1SD5 A;  4OU0 A;  5GTH C;  1VQ6 I;  2PMZ N;  1MGT A;  2Z3Y A;  3OWT A;  1N77 A;  1EH6 A;  3ML6 A;  1FBS A;  3DLA A;  2VQL A;  3WTV C;  1GV5 A;  4M6Y A;  3A14 A;  1HSJ A;  1LUJ B;  1X3W A;  2QQ9 A;  1WRJ A;  5FGM A;  4ZYA A;  2EFW A;  4XLH A;  1YS6 A;  3WU1 B;  2LRE A;  4KA4 A;  4HV6 A;  2HQ5 A;  2M8E A;  1IN5 A;  3HTU A;  3QP5 A;  2HTJ A;  3IKT A;  3F0C A;  4KP7 A;  1MDM B;  4AIH A;  3ASO H;  4G7H F;  4IOC F;  1ETK A;  3R4K A;  4KNY A;  2L7K A;  1FX7 A;  2OUM A;  3ZQF A;  3H3V K;  2EIN H;  2MAP A;  3LSG A;  1MSE C;  2Y2Z A;  5J1Y A;  3ZGK A;  1J5Y A;  4Y3O A;  5HOD A;  2O6G E;  1V5E A;  3FXO A;  4RS8 A;  3A02 A;  1CQT A;  2F5C A;  5IP9 J;  3OL3 A;  2NRA C;  5DUI A;  3KYC B;  4ZX4 A;  2XAU A;  4Y52 J;  3H5A A;  3C2H A;  4XR6 A;  2V1D A;  1SVM A;  1H9G A;  1WH5 A;  2LY1 A;  5E1X A;  4AR1 A;  2XAS A;  1R1V A;  1T33 A;  2LOO A;  3FTS A;  1K4S A;  2RKH A;  3M8F A;  1XDS A;  3DWL E;  2DDA A;  2WAD A;  1E3H A;  4HF0 A;  2W57 A;  1OCO H;  4CA0 A;  1GLN A;  3E5U A;  2VKH A;  3K2Z A;  4I76 A;  3QPH A;  1XDU A;  2WAQ N;  1FLI A;  1QPM A;  1QZZ A;  3GME A;  2HXO A;  2V1X A;  4F92 B;  3OYM A;  3QYB A;  4OOF A;  1MZB A;  1X58 A;  2EZI A;  5CYV A;  2PMH A;  4XNA A;  2GA1 A;  3DP7 A;  2VJI A;  1ZTR A;  1BI2 A;  4XOR A;  5CLS A;  3CUO A;  3DQV C;  2KKO A;  2IT0 A;  2LMD A;  4UVA A;  2XGE A;  3FKJ A;  1RC9 A;  1FBQ A;  2QEN A;  3HC7 A;  2Y1F A;  1LVK A;  2PQ8 A;  3FU0 A;  4XN2 A;  5FB2 A;  2NVU B;  3A0B C;  1XCV A;  2K27 A;  2IJL A;  1MDM A;  2FML A;  4CXF A;  3RI4 A;  4G94 A;  2K9Q A;  2VBX A;  1BC8 C;  3AKZ A;  1QGP A;  2IA2 A;  5ICF A;  2C6Y A;  4FAS D;  4BYY A;  2A68 F;  2KRC A;  4QUO A;  4EJO A;  3LQQ A;  3HSF A;  4XN0 A;  3J80 K;  5J40 A;  4HST A;  3JRA A;  1PUE E;  1RKT A;  2ZJP F;  3KPH A;  4AM3 A;  5FKK A;  1F5T A;  3CQZ J;  2VKD A;  5D5W B;  1R49 A;  3Q3S A;  1VQ8 I;  1MBG A;  3F8B A;  2V9P A;  1SD4 A;  2BVL A;  2JT1 A;  2RQP A;  4LUP A;  1K79 A;  3OYJ A;  2DQR A;  2Z2S B;  2MLG A;  2P4W A;  2BV6 A;  3ZMD A;  4QIW N;  3C1D A;  4NC7 A;  3ULQ B;  3SDG A;  3LNQ A;  4L9V A;  2ZXJ A;  4R1H A;  4W1U A;  2LRD A;  3KEO A;  1BL0 A;  1W7P D;  4B3X A;  1KGS A;  5K5O A;  4XRF A;  2HU9 A;  3ABT A;  4BS9 A;  1AHD P;  1VTN C;  3VSK A;  3COA C;  5E17 F;  1ZAO A;  3HSR A;  2VT2 A;  4XMY A;  1NK3 P;  3BR0 A;  4GXO A;  1JHF A;  1MIJ A;  1W36 D;  4GYI A;  2CSO A;  2HOS A;  2AQF A;  1W1W E;  2Y9Z A;  3W2V A;  1BW5 A;  1FOW A;  2BEO A;  3ZRG A;  2IP2 A;  2XC7 A;  3DLL F;  5KK1 A;  1ERD A;  4JK1 X;  3WTX C;  1MH4 A;  1WH7 A;  2R7Z J;  3C2B A;  5BS6 A;  1YJW I;  3S1R J;  2ZBK A;  3HKZ N;  4TV7 A;  1UHW A;  3FIS A;  3FBI B;  3I9V 2;  5D5U B;  2FX0 A;  2PUS A;  2LF8 A;  5HNH A;  1I1G A;  1H8A C;  3H9G A;  4CZC A;  1IG7 A;  1SG7 A;  2K9M A;  3M1C A;  3KLO A;  2JVH A;  1H0M A;  3CO6 C;  4M3F A;  1C0W A;  1XN7 A;  4B09 A;  4HQE A;  2VKV A;  3LMM A;  2DXI A;  5GTI C;  5B3S H;  3BR5 A;  2F5E A;  3FUE A;  4CYC B;  3GZN B;  2R7X A;  1F4K A;  3HPG A;  3VSL A;  2L02 A;  1GT0 C;  3IWF A;  4EJW A;  1XMA A;  3TKY A;  3MKY B;  3ZMS A;  2V1U A;  2JA5 J;  4ZX3 A;  3GF2 A;  1SVL A;  2DTZ A;  2Y69 H;  4A03 A;  2GLO A;  1UCR A;  2W25 A;  2QWW A;  2A6T A;  5E3L A;  3QU6 A;  4I98 B;  4RGS A;  1TWC J;  2Y48 A;  3D0S A;  5HVQ C;  2V9V A;  5L3G A;  1V3F A;  1BR4 A;  2IGK A;  2ME6 A;  4FX4 A;  1VQL I;  4W97 A;  1ZG1 A;  3KLN A;  3CMA I;  4RM3 A;  1HBX G;  3DFG A;  4BAC A;  3K4J A;  4O3M A;  2HR3 A;  2VC0 A;  2IA0 A;  2V1N A;  5HDK A;  1YE9 A;  1MMD A;  2K9S A;  1ZQ3 P;  5F04 A;  1JXS A;  5H20 A;  4LG3 A;  2LD5 A;  4QSH A;  2VC1 A;  1LNW A;  4C3I J;  2EA2 A;  1QVU A;  3JAM K;  2AXT C;  2DOE A;  1R36 A;  2O7G A;  3B02 A;  4P55 A;  1WPK A;  4L9J A;  3HTS B;  1LKX A;  5BPI A;  4XLF A;  3PFI A;  1YRN B;  1XB4 A;  2EZH A;  3OL4 A;  4XKB A;  5ICG A;  3J7A O;  4A0Z A;  2O9L A;  3LFU A;  1MBK A;  2GXG A;  4HAM A;  2JRT A;  5EG0 A;  3JRF A;  3L2W A;  3CCR I;  2M0C A;  1R22 A;  2JWT A;  2R7D A;  3DBR B;  4XN5 A;  2VQC A;  2Y1C A;  3DEW A;  1P6R A;  1JUS A;  3L1P A;  4FLQ A;  3GXO A;  4ZQG A;  2LFB A;  1G3S A;  1POG A;  4L9N A;  2EH3 A;  2X6Y A;  3K1M A;  1IRF A;  1VQ7 I;  4MHG A;  1QBJ A;  4XKC A;  1LQ1 A;  1J9I A;  3IP4 B;  3MZ8 A;  4CYC A;  1VQP I;  3DV8 A;  3GUD A;  3E6C C;  2MAB A;  2KIF A;  2IA1 A;  3MQ0 A;  2H09 A;  2R0Q C;  1ETQ A;  1FY7 A;  2ME0 A;  1I27 A;  2LTP A;  2XB0 X;  2C82 A;  3VVM A;  4FCA A;  3EYI A;  1DDN A;  3EUH C;  4QTR A;  2XSJ C;  4RGR A;  3CCJ I;  4PGH A;  5TIS C;  4HYE A;  1QPI A;  3VDX A;  1S5L C;  1G4D A;  4BQQ A;  2CQ7 A;  4ZC3 A;  2M4K A;  3T1B A;  1MW2 A;  1QZY A;  3BDD A;  3BC8 A;  1R6R A;  2Q8K A;  2OPT A;  5ICC A;  2V79 A;  3IH3 A;  2L4A A;  2ZB9 A;  2F4O B;  4Y6R A;  1X1D A;  2DLL A;  1USS A;  2HQN A;  3H9J A;  4I01 A;  1LPQ A;  1XD7 A;  3F8M A;  5K5R A;  4CGZ A;  4JYK A;  3H0D A;  3CJQ B;  3ZN0 A;  1U9N A;  3LQR A;  3BTJ A;  2EFO A;  2ADU A;  4BNC A;  3EYY A;  2MFZ A;  2VKE A;  4MKT A;  5J1U A;  2PBI A;  4UHT A;  3WHB A;  4BJ6 C;  5KCM A;  1R1U A;  3A0H C;  1T98 A;  3DPL C;  2L7M P;  4RA2 A;  2OCC H;  1RIO H;  1VI0 A;  1YRN A;  1HW5 A;  4BEH A;  3D5L A;  3OS2 A;  1O3Q A;  3V8J A;  3T8T A;  4A3J J;  4Y33 A;  5FD5 A;  1MJB A;  2VQG A;  4BU2 A;  5LEK A;  4J19 A;  1OMI A;  1ZRE A;  2PGG A;  4XMW A;  5HOO A;  4R5V A;  2VQH A;  2GBY A;  2E34 A;  4E7K A;  3OYF A;  3OMY A;  2P6S A;  4B43 A;  1IXR C;  2FQ3 A;  2WA0 A;  3HPH A;  3VYS B;  1PUF B;  2KIM A;  1HDD C;  2DW4 A;  1JG9 A;  1RZ4 A;  1QNT A;  4XLP F;  1UST A;  1MMA A;  3GBG A;  3HIF A;  4NC6 A;  3V7R A;  2TDX A;  2XIG A;  5J4Y A;  3JT1 A;  3JSZ A;  3IL2 A;  3IRQ A;  4KIB A;  1UHS A;  3CC7 I;  4OMY A;  4HG2 A;  1DPU A;  2CYY A;  3VYU B;  3TW6 A;  2WB1 A;  4XN8 A;  2W82 A;  3I55 I;  5LGN A;  1HW2 A;  1IRG A;  2UV1 A;  3Q0W A;  3CMY A;  3S1M J;  1I39 A;  3GLL A;  1O3R A;  4ZQE A;  1XG1 A;  3HDD A;  4OAY A;  1Y1W J;  4FLS A;  4EJU A;  3A2K A;  1NTC A;  1SD7 A;  4LIV A;  1NK2 P;  4IEJ A;  3ZQI A;  2DFE A;  3ERM A;  1BIA A;  1SFU A;  3OOU A;  3BG5 A;  4B8X A;  3GFI A;  2ZJR F;  2VOD A;  4FLO A;  3QYF A;  3W2W A;  1FT9 A;  2VL8 A;  4AYB A;  2VOO A;  5GAH J;  1WWX A;  2KHM A;  2QBY B;  2ID6 A;  2ELJ A;  2QKL B;  3CP2 A;  4GAE A;  2M0M A;  2XPV A;  5JVG F;  2EB7 A;  4ETS A;  3CHP A;  1MMG A;  2G7H A;  3I5U A;  2Q0O A;  1MMS A;  4OOI A;  3JCU C;  2X1D A;  3Q43 A;  1O57 A;  4L0Z B;  4RB2 C;  1Y8Q B;  5J4V A;  4HW0 A;  5IYB J;  1X1P A;  3BZC A;  3K4M A;  2LP0 A;  2IS6 A;  4ZX5 A;  1MD0 A;  3MD2 A;  4NB5 A;  2DT6 A;  1X1B A;  1YI2 I;  3FH8 A;  1TLH B;  1SFK A;  5L3D A;  4QHP A;  1PUF A;  3BTI A;  5CVV A;  3V7C A;  5HS8 A;  2M7A A;  4RBO A;  2W84 A;  4E7L A;  1DP3 A;  1UG0 A;  4EGY A;  2HPI A;  1CF7 B;  4M73 A;  1FPQ A;  1I5Z A;  4BKX A;  2P8T A;  2DO7 A;  5AON A;  2WZF A;  2QA4 I;  3GTK J;  3FZV A;  4R5T A;  3LWF A;  3E0J B;  1PP8 F;  5JAZ A;  4LMY A;  3J81 Z;  5FO5 A;  2DT7 B;  3BY6 A;  4HRI A;  5FLV A;  4CHU A;  4K2E A;  4XMU A;  3PQJ A;  1B4A A;  4NQW A;  2NS7 A;  2JA2 A;  3QWL A;  2BY3 A;  1VZ0 A;  5L3C A;  2OU2 A;  3FUM A;  3HRM A;  4OIQ F;  3IKV A;  2JCX A;  3TP3 A;  2L4M A;  4UB6 C;  1BI3 A;  5LHI A;  3HOS A;  2KT0 A;  2KPM A;  1HW1 A;  2P5K A;  5ED4 A;  2GXB A;  2GAU A;  2L0K A;  1WI3 A;  4ZTJ A;  4MEX F;  2NVT J;  2ZSH B;  3LFK A;  1EV7 A;  3M4O J;  1FTT A;  3LSJ A;  3A06 A;  3OV8 A;  3I56 I;  3D1N I;  3HOZ J;  4A6E A;  2QBY A;  1R1T A;  2L9V A;  1PDN C;  2XAG A;  2XQ0 A;  3R60 A;  5CVJ A;  3I59 B;  3S1N J;  2XAQ A;  3MMY B;  1ZLJ A;  2KMU A;  4M74 A;  2QM3 A;  1YG2 A;  1BJZ A;  3K10 A;  4HNU A;  4UY8 I;  5IYD J;  3SJM A;  1TQI A;  1YW9 A;  2RNG A;  1JGI A;  1BJA A;  1R7J A;  2IEK A;  2X51 A;  4V2G A;  4A2U A;  4OIN F;  3F21 A;  2K02 A;  2HOT A;  2JN6 A;  3BJ6 A;  2BYV E;  1TQP A;  4WCG A;  1A6I A;  4NDL A;  3L00 A;  5CQG A;  5KAF C;  1YIT I;  5LEJ A;  4AIC A;  1ON1 A;  3DXJ F;  1FIA A;  2UUZ A;  2BE5 F;  3IH2 A;  1HKS A;  3PFY A;  1J0R A;  3LSM A;  1CF7 A;  1HF0 A;  4M9Z A;  3KCC A;  4L2L A;  4LK1 F;  1TP4 A;  5E1Z B;  1UB9 A;  4I0A A;  3Q9S A;  2R93 J;  2Z33 A;  2EV5 A;  2X6W A;  5HNF A;  2CMP A;  4P96 A;  1OKR A;  2XGC A;  4E7I A;  2IS2 A;  2K85 A;  2ZXH A;  2K3P A;  1FMV A;  4ZYE A;  2IRF G;  3GFJ A;  2JCY A;  2E1M B;  5IT9 K;  2JCV A;  4MFD A;  4EJT A;  2RN7 A;  4G6T B;  4IQ4 A;  1I3Q J;  4G12 A;  2YS9 A;  4XIC A;  5J47 A;  2JRM A;  2M2E A;  2QVW A;  2WV0 A;  2FOW A;  4LIT A;  3RAS A;  1H89 C;  3GTM J;  3UCQ A;  3I59 A;  2KRF A;  2QQB A;  2P6T A;  3W3C A;  1QRY A;  2VIX A;  2VON A;  2KIQ A;  1Y56 A;  4A3F J;  2RDP A;  2HZD A;  4YIF A;  2CUZ A;  1DGR M;  4FCY A;  4HDU A;  4XNF A;  1U0J A;  1WZ2 A;  3RC3 A;  3FIW A;  1FYK A;  1Y8R B;  4HX4 A;  3PUF A;  2V6E A;  1D0Y A;  1A35 A;  2YR2 A;  2M3A A;  1TWH J;  3CXB A;  5CVR A;  4UUS A;  1W0T A;  1JKR C;  2ZXG A;  1XSX A;  2WV1 A;  4QPO A;  2GQQ A;  3RPU A;  4CCM A;  1HST A;  5F6F A;  2HQA A;  3JRH A;  1U5T B;  2Q1Z B;  3HRT A;  1IC8 A;  2PJP A;  3PSI A;  3BJO A;  3LST A;  5JHF A;  2DCE A;  2FXA A;  1JKQ C;  1VQ5 I;  3ZHZ A;  5E3N A;  1JGG A;  1ZRC A;  1IGN A;  2LKP A;  4CO8 A;  4QPQ A;  1STZ A;  5IOZ A;  5LBQ A;  3BZK A;  3QPS A;  1X3U A;  1RP3 A;  1F1Z A;  1DPR A;  3GVA A;  3I4P A;  3QU3 A;  3U21 A;  1D0Z A;  2GOX B;  1YIJ I;  4A6D A;  2WPG A;  1IZ1 A;  2ZXI A;  3UKG A;  1IV8 A;  5DEQ A;  2ELK A;  2WB1 N;  2LSO A;  3ZPL A;  1TNT A;  4HSR A;  3M7G A;  4UV8 A;  2XRO A;  2TCT A;  3RKX A;  4Q4Z F;  3BLY A;  3ZQG A;  4RDU A;  1N25 A;  4KMU X;  3VWB A;  2J5P A;  4QLC U;  2DK8 A;  2JSC A;  3ZQ7 A;  4XMZ A;  2KIU A;  2DOD A;  2A69 F;  2EFP A;  4A3M J;  1Z67 A;  3PNY A;  2JPB A;  4BBR J;  2N8G A;  1S46 A;  2EPF A;  4P9U A;  5BMZ A;  2BXZ A;  4AYB N;  3WOD F;  4YFK F;  3BCA A;  1E17 A;  2WC2 A;  3E97 A;  4LJZ F;  1LFU P;  3BP8 A;  4AIJ A;  1OR7 A;  2R92 J;  4DIQ A;  3K6G A;  3DTK A;  2XPU A;  1VQ4 I;  2WY7 Q;  3TOA A;  5J6X A;  3MN2 A;  4ANJ A;  3NEU A;  5CQE A;  4XMV A;  2QQ8 A;  3OYH A;  4RLF A;  1IO2 A;  1Z05 A;  3E6D A;  4ZH4 F;  1REP C;  2EZK A;  1D5V A;  4ZZL A;  4ENM A;  2Y30 A;  2ISZ A;  3CCY A;  1U5T A;  2NNN A;  3ZQH A;  3QPT A;  5D5X B;  3B37 A;  2HDC A;  4PFP A;  2O3F A;  2ECB A;  5EEH A;  2H94 A;  2ZNZ A;  4XOP A;  2QSF X;  5IP6 A;  4ENK A;  1LEA A;  4WXD A;  3CCV I;  1WI9 A;  3E1S A;  1HC8 A;  3WQS B;  4NHJ A;  1TT5 B;  2YU3 A;  3HGY A;  3FTV A;  2E1O A;  2RNJ A;  3CES A;  1VND A;  4MFE A;  1RPW A;  1FZP B;  2QSH X;  4ZQH A;  2DMT A;  3PIP F;  3QRF F;  2HEO A;  1GUU A;  3DF8 A;  4C2T A;  1G3Y A;  2XGD A;  4DGW B;  1ITY A;  4V19 K;  3I71 A;  4MGR A;  4Q4E A;  3H0G J;  5D4R A;  4X6A J;  1H19 A;  3AUA A;  3ZI0 A;  3FH5 A;  1QHH D;  3DEU A;  3BPV A;  5K5Q A;  2MGQ A;  2EFN A;  1XPX A;  2KZG A;  4AU7 A;  2FSW A;  2XB5 A;  4XN3 A;  3TDZ C;  4BDY A;  4ZDL A;  1GW6 A;  2FE3 A;  4KT6 A;  4PU2 A;  4IVN A;  1TWG J;  1HDP A;  2IPQ X;  3E7L A;  1P2F A;  4MLO A;  3ESW B;  3G2B A;  2BW3 B;  3E5Q A;  5DLL A;  1ZN2 A;  2LVS A;  5D6F A;  3B7R L;  4B47 A;  4FQG A;  3L9F A;  1OFC X;  3K1P A;  2YSR A;  4MQV A;  5LGU A;  1RUN A;  3FU3 A;  2KJC A;  4B48 A;  2XAJ A;  2HQR A;  3FM5 A;  3JTH A;  4XKV A;  2EWN A;  2Y1G A;  2E36 A;  3FTU A;  2X9D A;  4Q5S F;  2M34 A;  4G9Y A;  3PUB A;  3RZD J;  4E7J A;  3MKL A;  1ONN A;  2FJ1 A;  3ZQC A;  3DKW A;  2CH0 A;  3G6E I;  4JX4 A;  4IHS A;  1MMN A;  2M7B A;  4NC8 A;  4Z6Y A;  1YQA A;  5BOX A;  4IPA A;  3CUQ A;  1S3J A;  2ESH A;  3L2C A;  2UWM A;  1DUX C;  2XF6 A;  2DOA A;  4KDP A;  1LB2 A;  3G1O A;  4I2O A;  3S3M A;  1WCM J;  1Z3Y A;  2DQ6 A;  2V26 A;  3FUH A;  2XAF A;  3IV5 A;  3VYT B;  4KT5 C;  2QEX I;  1AA7 A;  1NH3 A;  2KP6 A;  2ZME C;  3RTR A;  3JAM Z;  5ICE A;  1UEL B;  4BE2 A;  5K7F A;  1K61 A;  2NOG A;  1NHA A;  3BTC A;  4L18 B;  3CO7 C;  4XKW A;  2EK5 A;  5C3E J;  4I0B A;  3E6M A;  3RPU D;  4GYG A;  4HBL A;  2HVQ A;  3WTY C;  3H5N A;  4PCQ A;  1Y6I A;  2XF7 A;  3H9Q A;  2GZW A;  1UHM A;  2Y0S A;  3LA3 A;  1DP7 P;  4XRM A;  3FTZ A;  1J75 A;  4ON0 A;  2KL4 A;  3P9K A;  3PIO F;  3FHZ A;  3M8E A;  3PSF A;  4Q48 A;  2BW3 A;  2KRH A;  4LG0 B;  2HWV A;  2CV0 A;  2O61 A;  4ARF A;  4ITV A;  1OIS A;  5HLI A;  1W36 C;  1V55 H;  1FJL A;  4XRS G;  2IW5 A;  2P7V B;  2DU9 A;  4FE7 A;  1A04 A;  2MH9 A;  2V6C A;  4AVP A;  1JT0 A;  5HLH A;  2QUF A;  5GPA A;  1XX5 A;  2R7T A;  5KAI C;  4XBF A;  2A3S A;  4CCO A;  5B1A H;  1J2X A;  3S32 A;  2OV7 A;  3GTP J;  4AR8 A;  1BR1 A;  3WTZ A;  2EZL A;  4XO5 A;  2EV6 A;  3DTI A;  3R6S A;  2I10 A;  3QOE A;  4B3A A;  5JLW A;  2CO5 A;  3JSP A;  2VB6 A;  2GTQ A;  4M3D A;  4ZX6 A;  3S2W A;  1T1S A;  1Y0U A;  3RSN A;  4II2 A;  3GFL A;  1QA6 A;  3H35 A;  3FXL A;  2DQL A;  5FLX K;  2KLO A;  2E35 A;  2LK2 A;  3K1N A;  1XMK A;  4KJZ A;  2VE9 A;  2DMQ A;  4BAY A;  4Y15 A;  3I3L A;  2D45 A;  4K5P A;  4ZYD A;  1SFE A;  4C30 A;  2DTR A;  2L7Z A;  4Y13 A;  2QJ1 A;  2Z16 A;  4ESJ A;  3ABK H;  3NWT A;  4RAY A;  4HLY A;  2IBD A;  3RQ4 A;  1Z7U A;  2JA8 J;  1DU6 A;  1SMY F;  5FFZ A;  2PFB A;  4RAF A;  3SHF A;  4B44 A;  1ETW A;  4K5L A;  1WGX A;  3FMS A;  4RGX A;  2VJ5 A;  4LG0 A;  4H4K C;  4XN4 A;  2HI3 A;  5KVR A;  4PSX A;  3MZH A;  2P5L C;  1T8I A;  2X48 A;  2VBZ A;  4GAA A;  3K0L A;  1EJ9 A;  2R7Q A;  1VQO I;  4O6J A;  2X1E A;  1JT6 A;  3TDU C;  4DBR A;  2XPZ A;  1PYV A;  1P9Q C;  2M5W A;  1Q0H A;  3D5S C;  1UAA A;  4OIP F;  2F4M B;  1BW6 A;  1B72 B;  3Q9V A;  1H88 C;  2B61 A;  2DK5 A;  2CRG A;  2WY8 Q;  3CUQ C;  4BHB A;  1ETV A;  1FP1 D;  2ISY A;  3F3X A;  2HPM A;  2VJ4 A;  5HS7 A;  3SXY A;  1T39 A;  4R79 A;  5IT3 A;  2MYS A;  1U6G A;  1FOX A;  2VJ8 A;  3CZ6 A;  4XN1 A;  1FOY A;  2D1H A;  4XM3 A;  2K7L A;  3TQN A;  4Y17 A;  2FNA A;  1EKE A;  2KZV A;  2LF7 A;  3SYT A;  1MNE A;  4FX0 A;  3SZG A;  4XL9 A;  5L3E A;  2OTL I;  2BXY A;  1Y39 A;  1ZKG A;  1W5S A;  3ONQ A;  5L3F A;  1CGP A;  1HQC A;  3KE2 A;  5E20 A;  5GAE J;  4MO7 A;  2QLZ A;  1MNM C;  3CJT B;  3M07 A;  3Q0U A;  3PQK A;  4A5N A;  1I6X A;  1XSV A;  2X85 A;  4MIM A;  4ZYG A;  4PJJ A;  5DD8 A;  3OOP A;  4CZZ A;  4N4N B;  3KP4 A;  2CW8 A;  1ZK8 A;  3BWG A;  5DCM B;  2BBY A;  1ORK A;  3CJN A;  1SQM A;  1QHG A;  5DDG A;  5EV7 A;  3OYD A;  2WAE A;  1M1E B;  1MJA A;  3PO3 J;  3FUN A;  3HEF A;  3IAS 2;  3M9A A;  2H6C A;  1W5T A;  3IIE A;  1G6N A;  3FK7 A;  1YJN I;  4HLX A;  3FBN B;  3GCM A;  3C3W A;  4I09 A;  2DI3 A;  2MAO A;  3OYB A;  3CDH A;  5JR3 A;  2CUE A;  2HZT A;  5J8F A;  1LEB A;  2RQQ A;  2QSG X;  4Y6S A;  3L7W A;  1D0X A;  1YX3 A;  2VN2 A;  3K9T A;  3G73 A;  4PK4 A;  2PX9 A;  1B72 A;  2FFL A;  1PJR A;  4BHP A;  1K4T A;  2D5V A;  1ETO A;  1OCT C;  2YU9 J;  1BOB A;  4Y6P A;  4A3I J;  4GO1 A;  5JMW A;  3HRS A;  5GAG J;  1TL8 A;  3FMQ A;  1T6S A;  4I02 A;  1UG2 A;  3TL4 X;  1YLF A;  5M3F J;  4M9S A;  2CU7 A;  4C3H J;  2P5V A;  4RB0 A;  1ONO A;  3QOD A;  3EPZ A;  1Q1V A;  2HPT A;  2K5C A;  3FDY A;  5DCF A;  4YFX F;  2WZG A;  3AG3 H;  3L2V A;  1T0F A;  1U8B A;  3DKX A;  2BY1 A;  3WU2 C;  2FQ4 A;  3I53 A;  2IGN A;  1JTY A;  4O5V A;  3HOT A;  3E3V A;  4XSX F;  1VQM I;  2JZY A;  1TQM A;  3HSE A;  2E5N A;  3B7S A;  2OJE D;  4E7H A;  5CJ9 A;  3T8V A;  4GCV A;  5K7Z A;  5DCM A;  3MVP A;  1XC5 A;  2K86 A;  1VQ9 I;  4M3E A;  4WWC A;  1YHQ I;  4DJA A;  2B7E A;  1XGN A;  1ZEL A;  2DA2 A;  1DQU A;  2DA3 A;  1RI7 A;  2DFI A;  2E1N A;  2K3F A;  3DU5 A;  3SFI A;  3AAF A;  1ZGW A;  2O8K A;  5JMP A;  4F52 A;  4YEL A;  2J5O A;  4F55 A;  4HNT A;  5K7H A;  2NVQ J;  3P5J A;  5EJC A;  3AL0 B;  1KU9 A;  3K2A A;  5KNL A;  5E18 F;  2R7U A;  2Y0S N;  2EJR A;  5E79 C;  3OYI A;  3JTG A;  1QQI A;  1BOA A;  2O7O A;  1O7L A;  1AWC A;  3HOY J;  1RES A;  2LY2 A;  2H8R A;  1ZS2 A;  1G2H A;  2MA3 A;  1OLT A;  1ZG5 A;  3FXQ A;  1OPC A;  4ASN A;  1BIB A;  5D8K B;  2A5Y B;  3Q44 A;  2HFH A;  4A12 A;  1R0K A;  1ACI A;  4ESB A;  2AQE A;  3KYD B;  1TBX A;  1XTA A;  2DBB A;  1UFM A;  5LFA A;  4S04 A;  3W6V A;  1VQK I;  2A7O A;  1VQN I;  1G3T A;  5IOY A;  5E3M A;  3F8F A;  1IV6 A;  2DPD A;  5IT9 Z;  2HKX A;  3HOW J;  4XSZ F;  2HVR A;  4IRH A;  4OOE A;  1KQ0 A;  1RR8 C;  4KN7 X;  2JTV A;  5EZH A;  5F1J A;  3OYN A;  2KDZ A;  5IP7 J;  1WJC A;  5AIQ A;  1MBH A;  2HNH A;  1AKH B;  2NS8 A;  5K1Y A;  2X6O A;  1H3L A;  4R5X A;  3CZK A;  3PO2 J;  2R7V A;  1IRZ A;  4C2M J;  5ILV A;  3IRR A;  1KA8 A;  3WQR A;  2CUJ A;  2AS5 F;  4WK8 F;  4U7B A;  1MW3 A;  2X4H A;  1FNN A;  2NOJ B;  4ZQF A;  4ZDO A;  4EM1 A;  3GO5 A;  3KET A;  1FP2 A;  4CCN A;  2B63 J;  3F23 A;  3F8N A;  2BY2 A;  2LY9 A;  3FUD A;  5FKN A;  3PNV A;  4BJ5 C;  1A36 A;  2ELH A;  3RJP A;  4PDK A;  1S6L A;  3JRE A;  2O5R A;  3U1K A;  1ZG3 A;  1D1A A;  2L9N A;  4AIK A;  3WGI A;  1WJF A;  3BZ6 A;  1WVR A;  2HYJ A;  1HLV A;  4PFO A;  3WTU C;  3K4B A;  4ZW5 A;  3BCB A;  4EEF G;  3BG7 A;  1HXD A;  1ZAR A;  4MQ9 F;  3GTL J;  4A3L J;  4HNV A;  1PP7 U;  5TRD A;  2YPR A;  3KEY A;  4BUP A;  5M5W J;  1F9N A;  4BQA A;  3CZG A;  5J3L A;  4DW6 A;  3N97 A;  3NWS A;  3WGH A;  3SEQ A;  1R9T J;  2XKO A;  4RAZ A;  1B1B A;  1QZE A;  3RYP A;  3W2A A;  3UER A;  3TO6 A;  4RCV A;  2IGO A;  1UZC A;  3I4N J;  3MKZ A;  2EBI A;  3LSI A;  1QU3 A;  1ZYR F;  4BH9 A;  4IL6 C;  4U87 A;  2W24 A;  5D8L B;  2PI0 A;  1K5H A;  4KMF A;  3T5X A;  2KFD A;  4HF1 A;  4LFU A;  5ILS A;  4M71 A;  1AKH A;  4CCK A;  3P7N A;  3CIA A;  1W5C C;  2DJI A;  1RR7 A;  2XDV A;  1U2W A;  3QYE A;  2XF5 A;  2BZT A;  1FSH A;  4DBQ A;  2FMY A;  2E71 A;  1WJE A;  4D1Q A;  1IDZ A;  4J01 A;  4HOB A;  1SAN A;  5F1R A;  2LKS A;  5FRM A;  2E5Z A;  3EDP A;  4YII A;  4CUG A;  4KFC A;  3B3B A;  3ZMV A;  5H6R A;  3EBG A;  3KP7 A;  2FF4 A;  4FET A;  4E6K G;  3HYI A;  3MWM A;  4HV5 A;  4D5F A;  1ZR2 A;  4IXA A;  1AOY A;  2H8W A;  1FIP A;  1JTX A;  3LA2 A;  3KYL A;  5DS9 A;  1WHU A;  4K5O A;  1TT0 A;  4FE4 A;  1U9O A;  3WE3 A;  3HOV J;  2ZNY A;  3MEX A;  1TTY A;  5HDN A;  4F3Q A;  1TW3 A;  2LLK A;  1S7A A;  3ZOB A;  2WTE A;  1IAW A;  3HRU A;  1V5F A;  1NG7 A;  4D5C A;  2P7C B;  1F36 A;  3HGG A;  3J7Y J;  2F48 A;  2RVC A;  4D0P A;  2HTS A;  4LB6 B;  3ZP5 A;  9ANT A;  1H9T A;  1PVE A;  3NQO A;  5B5E C;  4Y7N J;  3Q0V A;  4IJA A;  3S15 J;  5FWQ A;  3ERE D;  2F4I A;  2A5W A;  2A07 F;  2YX4 A;  3CP8 A;  2H1K A;  5EF6 A;  4CH7 A;  3GTO J;  2R7R A;  4FIS A;  1JKP C;  4BL0 B;  4GFB A;  3M8J A;  4NBQ A;  2LYC A;  4KUM A;  1S72 I;  3TOB A;  5TJJ A;  4F7Z A;  3CZL A;  1GXP A;  1T38 A;  2KDO A;  3P9C A;  4EM2 A;  3CHQ A;  4IO9 F;  3OYL A;  3AG1 H;  3HOU J;  5JC1 A;  2MSY A;  4YRV A;  2VPR A;  2FBH A;  1KYZ A;  2FUG 2;  1MVY A;  1WJ5 A;  2G0E A;  2Q2E B;  1MW7 A;  2HOE A;  1TC3 C;  1N75 A;  3GTJ J;  1T1R A;  2W85 A;  2ZFW A;  1FMW A;  1IXC A;  1P4X A;  1UJ8 A;  4YG2 F;  4XMX A;  2Y9Y A;  1X1A A;  3G71 I;  4RVB A;  5A2Q K;  4MS6 A;  2DQM A;  1IN4 A;  4I7H A;  2DA7 A;  1A5J A;  3K69 A;  3BOQ A;  4WXC A;  4BY1 J;  3WTW C;  1G5A A;  3RKW A;  5GAD J;  3LSK A;  3QAH A;  2NVX J;  3O2P E;  1MH3 A;  2GIZ A;  4BQN A;  3S2D J;  5IY5 H;  2BY0 A;  4ABZ A;  3JRB A;  3CCS I;  2VUM J;  1MW1 A;  3DEE A;  1GV2 A;  2HS5 A;  3KZZ A;  1MW0 A;  1YJ9 I;  2F2E A;  1WQ2 A;  3L2Q A;  2QKM B;  1B9M A;  4KYW A;  4ENN A;  1HS6 A;  3EUK L;  2FU4 A;  2CQQ A;  2VJJ A;  3AG2 H;  1KON A;  2GOM A;  1B9N A;  2MLK A;  2OZ6 A;  3WTT C;  1LJ9 A;  1P92 A;  3BR6 A;  2RC4 A;  2OC6 A;  2HXI A;  1K7A A;  2OF7 A;  3DCF A;  4CIC A;  1D5Y A;  2H6B A;  2DMP A;  3ZN1 A;  1KQ9 A;  5IPA A;  4HF2 A;  2ZCW A;  3VYR B;  1BM9 A;  4KN4 X;  4AUX A;  2E7X A;  1IN8 A; 
#chains in the Genus database with same CATH homology
 1Z3X A;  2O7G A;  4XKW A;  2BVM A;  1T0F C;  2IGM A;  1LKX A;  3RPU D;  4XLF A;  2HVQ A;  4XOT A;  3H5N A;  3ZHY A;  1Y6I A;  2XF7 A;  2R7O A;  3OL4 A;  3H9Q A;  2X1C A;  4XKB A;  2Y0S A;  3LFU A;  4K5N A;  3ZHX A;  3FTZ A;  3S8P A;  4KIS A;  3L2W A;  2RJI A;  2PMZ A;  4FLR A;  2KL4 A;  3PSF A;  4XN5 A;  2BW3 A;  2KRH A;  2VQC A;  2Y1C A;  4CCL A;  4XMT A;  2VLA A;  2CV0 A;  4FLQ A;  2JUG A;  4ARF A;  4ZQG A;  4ITV A;  2VXD A;  4NNJ A;  4BXF A;  1W36 C;  4PW4 A;  2X6Y A;  1E0E A;  4BE1 A;  4XKC A;  3IP4 B;  3L2U A;  4R7L A;  2MAB A;  4Y4R A;  3OYK A;  2R7W A;  4C2U A;  3UEQ A;  2R7T A;  4Y67 A;  4CCO A;  2RRE A;  4RM2 A;  3S32 A;  2W00 A;  2C82 A;  3VVM A;  2OV7 A;  3CZE A;  4FCA A;  4PJN A;  3FTX A;  4AR8 A;  1BR1 A;  3EUH C;  3S93 A;  5FRO A;  3WQQ A;  2XSJ C;  2W4S A;  4XO5 A;  3OIQ A;  3D5R C;  4ZN6 A;  3DTI A;  2LH9 A;  4RMN A;  3VDX A;  4BQQ A;  3QOE A;  4RSY A;  4ZC3 A;  2PJR A;  2M4K A;  2VB6 A;  2GTQ A;  1MW2 A;  3BC8 A;  3F9K A;  4XLE A;  1R6R A;  2WBM A;  4ZX6 A;  1T1S A;  4Y6R A;  3RSN A;  2R7S A;  4II2 A;  1X1D A;  5KHD A;  3H35 A;  3H9J A;  2V9K A;  3HXL A;  3H0D A;  3CJQ B;  2KLO A;  2CFO A;  2V7F A;  1ONP A;  3FUL A;  4QME A;  4Q4I A;  4KJZ A;  1DGW Y;  1LDK B;  5DYF A;  3CJR B;  3I3L A;  1X4O A;  2MFZ A;  4K5P A;  3VVL A;  4C30 A;  4MKT A;  4XLC A;  3N05 A;  1WFX A;  4OWR B;  2Z16 A;  4BJ6 C;  5KCM A;  3K70 D;  2QJ1 A;  3DPL C;  3FU5 A;  3NWT A;  2X6X A;  4D9J A;  3RQ4 A;  4BEH A;  2WAQ A;  3D5L A;  3OS2 A;  5BPP A;  3V42 A;  3H5R A;  4Y33 A;  4B44 A;  3DPT A;  4K5L A;  2VQG A;  3LSH A;  4BU2 A;  3OY9 A;  3S3N A;  3EUA A;  4CCJ A;  4QPE A;  2VJ5 A;  3CMM A;  2PGG A;  4XMW A;  4ZW3 A;  4H4K C;  3OYE A;  5HOO A;  4R5V A;  5TGT A;  1WJB A;  2VQH A;  3FUK A;  4XQF A;  4XN4 A;  4PSX A;  3B34 A;  3FTY A;  4N4O B;  4XLA A;  3OYF A;  4E7K A;  3OMY A;  4B43 A;  3HPH A;  4PJM A;  2WA0 A;  2R7Q A;  3VYS B;  4GAA A;  2P0W A;  1JG9 A;  4ZW7 A;  2X1E A;  4DBR A;  2XPZ A;  3SEZ A;  1PYV A;  1P9Q C;  1Q0H A;  3D5S C;  1UAA A;  1MMA A;  3GBG A;  3JT1 A;  1G8X A;  3EBH A;  3JSZ A;  4K5M A;  4X2U A;  4PSW A;  4DPR A;  2B61 A;  4HG2 A;  3AL0 C;  2WY8 Q;  3S3O A;  3VYU B;  2WB1 A;  2JSP A;  2HPM A;  4XN8 A;  1YX5 A;  2W82 A;  2VJ4 A;  3SDB A;  4XO3 A;  4R79 A;  2LC2 A;  2MYS A;  2UV1 A;  4XN9 A;  2VJ8 A;  3CZ6 A;  2JD0 A;  4XN1 A;  4XM3 A;  1V5G A;  4ZQE A;  5JBI A;  4ZW6 A;  4BJT A;  4OAY A;  2KZV A;  3FHE A;  4XNB A;  2L2O A;  4FLS A;  3A2K A;  3SYT A;  1MNE A;  4LIV A;  3SZG A;  3OIP A;  2R4G A;  4XL9 A;  2ZFU A;  4P1W A;  1JVS A;  3OOU A;  4FLO A;  5HLT A;  3ONQ A;  3QYF A;  3W2W A;  2E1M C;  2VL8 A;  3BG6 A;  4AYB A;  2KHM A;  2ELJ A;  2QKL B;  3CP2 A;  4GAE A;  2M0M A;  3KX2 A;  2X85 A;  1R0L A;  4J3B A;  1HA8 A;  1N78 A;  2MC4 A;  2M4G A;  3CHP A;  1MMG A;  2K9L A;  4PJJ A;  3FH7 A;  2E60 A;  4N4N B;  2X1D A;  3Q43 A;  2CW8 A;  1X3Z A;  3PNT A;  1D1B A;  1SQM A;  3K4M A;  1QHG A;  2I8D A;  2IS6 A;  4ZQT A;  4ZX5 A;  3LL7 A;  5EV7 A;  1X1C A;  3IUO A;  2WAE A;  3OYD A;  3K4K A;  3MD2 A;  4OAZ A;  3FUN A;  2CV1 A;  2DT6 A;  3IAS 2;  1X1B A;  3TBI A;  3ZXS A;  3FH8 A;  4LIU A;  1SFK A;  3CHO A;  3IIE A;  4QHP A;  3J7A Y;  3FBN B;  3FUI A;  2MAO A;  1OR7 C;  2M7A A;  3OYB A;  4E7L A;  2JV7 A;  1DP3 A;  1UG0 A;  4Y6S A;  2HPI A;  2RQQ A;  4BDZ A;  1D0X A;  1YX3 A;  4PK4 A;  4BKX A;  4HEA 2;  2FFL A;  1PJR A;  3OYA A;  3ANN A;  2WZF A;  3AU8 A;  1BOB A;  3K70 C;  4II3 A;  2W7N A;  4R5T A;  4Y6P A;  4JQF A;  3E0J B;  2VAS A;  3DU6 A;  3OYG A;  5JAZ A;  5JMW A;  2VPL A;  4F93 B;  2DT7 B;  4IX7 A;  4HRI A;  4IQJ A;  3HKZ A;  2BOL A;  4XMU A;  3TL4 X;  3HL2 A;  4KIT B;  4NQW A;  2JA2 A;  3MKW B;  1S9H A;  1VZ0 A;  1ONO A;  3FUM A;  4BGD A;  3QOD A;  2JCX A;  3EPZ A;  2JD1 A;  3B2P A;  2K5C A;  4XN7 A;  3FDY A;  2HPT A;  3HOS A;  2WZG A;  2KPM A;  4ZW8 A;  3L2V A;  1Z21 A;  4ZTJ A;  1X19 A;  2ZSH B;  3DKX A;  3K4C A;  4PJL A;  3A06 A;  3B7U X;  5JNL A;  2IGN A;  3HOT A;  1SAU A;  2XQ0 A;  4AR9 A;  2R72 A;  1K6Y A;  2E5N A;  1Q0L A;  3MMY B;  3B7S A;  4E7H A;  2JVG A;  2KMU A;  5CKT A;  1TZL A;  2C5Z A;  3T8V A;  5LD2 C;  4IZZ A;  3K10 A;  4XO4 A;  4HNU A;  2KQR A;  4XON A;  4J00 A;  2RNG A;  4DJA A;  1JGI A;  2W1O A;  1ZEL A;  1DQU A;  2X51 A;  3DU5 A;  3RCO A;  4BQO A;  5JO0 A;  4X0G A;  4QIR A;  4DOZ A;  5JMP A;  2IS4 A;  3PL8 A;  4F52 A;  4YEL A;  4F55 A;  4HNT A;  3EBI A;  3KED A;  5CQG A;  3AL0 B;  5KNL A;  3HG9 A;  2R7U A;  3OYI A;  2PL5 A;  2V4J C;  4BE0 A;  4AIC A;  2LY2 A;  2F6C A;  1D1C A;  1ZS2 A;  1OLT A;  3PFY A;  2UUZ A;  3OWT A;  1N77 A;  3LSM A;  3Q44 A;  1WJA A;  1R0K A;  4L2L A;  3TMO A;  3DLA A;  3T0Y A;  3QJX A;  2VQL A;  3HUG B;  2AQE A;  3OR2 C;  2HPO A;  3A14 A;  3ZR8 X;  1X3W A;  4PUS A;  2X6W A;  5LFA A;  5HNF A;  2CMP A;  4ZYA A;  2A7O A;  4XLH A;  4E7I A;  2IS2 A;  3CF2 A;  2LRE A;  2ZXH A;  2K3P A;  2HVR A;  1FMV A;  4OOE A;  2JCY A;  2E1M B;  2JCV A;  4KP7 A;  3OYN A;  4G6T B;  1WJC A;  4IQ4 A;  4ZDP A;  5AEN A;  2L7K A;  2HNH A;  2OUM A;  3FUJ A;  4R5X A;  1H3L A;  2MAP A;  3CZK A;  3LSG A;  2R7V A;  4BE2 A;  3FUF A;  2Y1E A;  3DKY A;  3ZGK A;  4Y3O A;  2QVW A;  3U9W A;  3WQR A;  4LIT A;  2CUJ A;  3RAS A;  1V5E A;  4U7B A;  1MW3 A;  4ZQF A;  2NOJ B;  2JD2 A;  4P5O A;  3UCQ A;  4ZDO A;  3OL3 A;  3R0I A;  4ZX4 A;  2XAU A;  4CCN A;  3H5A A;  3C2H A;  3IAM 2;  3FUD A;  3PNV A;  1X4P A;  4XR6 A;  3W3C A;  4BJ5 C;  3OS1 A;  2LY1 A;  2VIX A;  3ZCO A;  4AR1 A;  1Y56 A;  2O5R A;  2HZD A;  3OR1 C;  2CUZ A;  4JND A;  1DGR M;  2LOO A;  3FTS A;  1D1A A;  2L9N A;  1U0J A;  3DWL E;  4XNF A;  3RC3 A;  2LG4 A;  3B7T A;  1WJF A;  2WAD A;  2V6E A;  1D0Y A;  2M3A A;  4PFO A;  4CA0 A;  2IS1 A;  1GLN A;  1LFP A;  2VKH A;  3K4B A;  2F5V A;  2LBF B;  2ZXG A;  4ZW5 A;  3BCB A;  3PUU A;  3BG7 A;  4QPO A;  4AVZ A;  4CCM A;  2HQA A;  4F92 B;  2Q1Z B;  3OYM A;  5FRN A;  3QYB A;  4OOF A;  3OS0 A;  3PSI A;  2HDW A;  5JHF A;  2CS3 A;  4XNA A;  2DCE A;  3ZHZ A;  2VJI A;  3KEY A;  4BUP A;  3FTW A;  3CZG A;  4IKF A;  4XOR A;  4QPQ A;  4E7S A;  3NWS A;  3DQV C;  3SEQ A;  1RP3 A;  3FKJ A;  3W2A A;  3HC7 A;  3UER A;  2Y1F A;  1LVK A;  4RCV A;  2IGO A;  2VXZ A;  3U21 A;  3FU0 A;  3MKZ A;  4ZJZ A;  4XN2 A;  3LSI A;  1D0Z A;  2GOX B;  3ZQQ A;  1QU3 A;  3OYC A;  1Q0Q A;  4U87 A;  2WPG A;  5DUL A;  2ZXI A;  1K5H A;  3L2R A;  4BEH B;  4CXF A;  2CV2 A;  4HSR A;  3AKZ A;  4CCK A;  4CSW A;  4FAS D;  3CIA A;  2KRC A;  2DJI A;  4QUO A;  2XDV A;  3RC8 A;  3BLY A;  3QYE A;  2XF5 A;  4YEJ A;  3VWB A;  4XN0 A;  4HST A;  3A4C A;  4E7Z A;  4DBQ A;  4XMZ A;  3C2G A;  3AU9 A;  1WJE A;  4D1Q A;  4J01 A;  1NG6 A;  3PNY A;  2VKD A;  1S46 A;  5FRM A;  2E5Z A;  4ZTF A;  3K4N A;  4CUG A;  3BCA A;  1WJD A;  2EGH A;  3B3B A;  2BVL A;  4LUP A;  3DTE A;  1OR7 A;  4DIQ A;  3OYJ A;  3EBG A;  2Z2S B;  3K6G A;  3DTK A;  2WY7 Q;  4FET A;  4E6K G;  4EAT A;  4ANJ A;  4XMV A;  5CQE A;  4HPQ A;  3OYH A;  4RLF A;  2L5Q A;  2LBF A;  3ANM A;  4NUB A;  4NC7 A;  3B2X A;  3KYL A;  4K5O A;  1TT0 A;  2LRD A;  4GRI A;  3FU6 A;  4B3X A;  2HU9 A;  4BS9 A;  3B37 A;  2R70 A;  4PFP A;  3VSK A;  4F3Q A;  3A1Y A;  4RLQ A;  3UNG C;  4XOP A;  1MND A;  2Z1D A;  1V5F A;  3E1S A;  1NG7 A;  3WQS B;  1BR2 A;  4PVB A;  4XMY A;  3FTV A;  3CES A;  1G59 A;  2Y1D A;  4ZQH A;  1W36 D;  3ANL A;  3UR3 C;  2AQF A;  3W2V A;  4C2T A;  5FWQ A;  3ZRG A;  2XC7 A;  1J09 A;  2F4I A;  2A5W A;  4DGW B;  1ERD A;  3CP8 A;  4Q4E A;  4CH7 A;  1H19 A;  3AUA A;  3ZI0 A;  2R7R A;  3FH5 A;  1QHH D;  4BL0 B;  3M8J A;  2LYC A;  3CZL A;  2KDO A;  4AU7 A;  3CHQ A;  3FBI B;  4XN3 A;  4BDY A;  4ZDL A;  3OYL A;  1GW6 A;  3I9V 2;  5JC1 A;  4YRV A;  2CW7 A;  4KT6 A;  2PUS A;  4PU2 A;  5HNH A;  2MD0 A;  2FUG 2;  1MVY A;  1WJ5 A;  2Q2E B;  3H9G A;  4MLO A;  3G2B A;  4CZC A;  1MW7 A;  2BW3 B;  1N75 A;  5DLL A;  3CHS A;  1SG7 A;  1T1R A;  3K4L A;  3B7R L;  2K9M A;  2WAF A;  1FMW A;  3M1C A;  1T95 A;  2JVH A;  4B47 A;  3AFH A;  3CHR A;  4XMX A;  1X1A A;  3LMM A;  2DXI A;  3FU3 A;  4B48 A;  4RVB A;  4MS6 A;  2DQM A;  3FUE A;  2R7X A;  2IXS A;  3HPG A;  4XKV A;  3VSL A;  2Y1G A;  3MKY B;  3FTU A;  1JI8 A;  1G5A A;  4E4H A;  3DPU A;  3PUB A;  4ZX3 A;  3PJR A;  3LSK A;  4A03 A;  4E7J A;  4NQW B;  1ONN A;  4XND A;  4BQN A;  2XPY A;  2A6T A;  2CH0 A;  2L9S A;  4AYS A;  1MMN A;  2M7B A;  4NC8 A;  3DEE A;  1MW1 A;  5HVQ C;  1MW0 A;  2ZSI B;  3L2Q A;  2PJR B;  2UWM A;  1BR4 A;  2IGK A;  2QKM B;  2XF6 A;  1Z7L A;  4C9Y A;  2DOA A;  1HS6 A;  3EUK L;  2HVS A;  2VJJ A;  3FHN A;  4RM3 A;  1KON A;  2GOM A;  4JOM A;  4BAC A;  3K4J A;  5CPR B;  1IRX A;  3S3M A;  1Z3Y A;  3FUH A;  2DQ6 A;  2OC6 A;  2V26 A;  2V1N A;  3VYT B;  1YE9 A;  1MMD A;  1EA3 A;  1AA7 A;  2KP6 A;  3RTR A;  1SC5 A;  4LG3 A;  3VYR B;  4F91 B;  1UEL B;  2R59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...