5HNHA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
279
structure length
279
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Restriction endonuclease R.BpuJI
total genus 107
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnhA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnhA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hnhA02
5HNHA 2VLAA 5HNFA 5HLTA
chains in the Genus database with same CATH superfamily
4IF4A 2CWEA 3DKYA 4F55A 2BY2A 2RGVA 1GDTA 2P5VA 3CIAA 4BE0A 2M4KA 2NS8A 2CW0F 2NXNB 4L18B 3CD6I 2QWWA 4OAZA 2JPCA 1KONA 4YIRX 1P6RA 5GAGJ 2M87A 3S2HJ 1XD7A 1IG7A 2EBIA 4ZX4A 5E1ZB 2X6WA 4IHWA 2CSOA 3GEZA 4F93B 1XPXA 4A03A 3HOSA 1J9IA 3IHUA 5ILVA 5JC1A 2CQNA 3GW2A 1BW6A 2FD5A 1T0FC 1SD4A 2KT0A 2VPLA 2M7AA 1TQIA 2PUSA 4D9JA 4PCQA 3LSJA 4XKCA 5TISC 2M8EA 3HZJA 4JOMA 3JSZA 1ITYA 4LG3A 4ESFA 3HOVJ 1U8BA 2WB1N 5LEKA 4AICA 1NTCA 5A2QZ 2P81A 4XRFA 3QYEA 2MC4A 1ONNA 3BOQA 5EGOA 4MTDA 2D2WA 3HL2A 2XRLA 3ZMUA 3FTZA 2A6TA 2GXBA 2B61A 2VI6A 2KJBA 4RDUA 5TGTA 4PDKA 3FISA 2M0CA 4GXOA 2FMLA 5CYVA 1Y39A 4OOEA 1BW5A 1QHGA 3E1SA 4N0BA 1FIPA 1REPC 2FU4A 3JCUC 1HSJA 3B37A 5ERIA 2MA3A 3MZ8A 5C3EJ 4Z6YA 2CG4A 3H5RA 3TBIA 2LKXA 4QWQA 5J4YA 3M3YJ 3I4PA 3QOEA 2LBFB 1K78B 1ETVA 2JPBA 2JK3A 2ELKA 2KRCA 2LKSA 3WQQA 3LNQA 2MG4A 3GBGA 1I3AA 1RIOH 1XMKA 2HYGD 1QBJA 4XMXA 2QGUA 4BY7J 1FIAA 1A36A 1IV6A 5E3OA 4C30A 4BGDA 2OZUA 2EV0A 2Y9ZA 3GTOJ 3KP5A 3K69A 3D5RC 4B43A 4MFDA 4XMWA 4ZC3A 4LB6B 1K6YA 2RQQA 3JW4A 1IRZA 1IXSB 1DGWY 1QNTA 4HG2A 4R8HA 3F72A 3FULA 4ZN6A 4EQQA 2EPFA 1OCTC 3LSMA 1K5HA 1PDNC 2W1OA 2DQMA 1XN7A 3RC8A 5IT9K 3W2VA 1X1CA 1LE8A 4WXDA 4M73A 3W2WA 5ICGA 3ERED 2EFQA 3F22A 1S7AA 4LLGF 1KYWA 3I58A 1BOBA 1QPIA 1ZS2A 1JT6A 1FEXA 4C2TA 3CLQA 3CUQA 1FOXA 3ZQGA 3E6CC 1V5FA 1R22A 2VKHA 3FK7A 3AAFA 4LB5A 3NQOA 2HZDA 3OR2C 5KCMA 2R7TA 2V6CA 4ZQFA 2QLZA 5B3SH 3I4MJ 1LFBA 4A3LJ 5HLIA 2JTVA 4Y6RA 5ED4A 3Q0VA 4XRSA 2WA0A 3GTGJ 1DGRM 1U3EM 5B1AH 4Y6SA 1TQMA 4MGRA 1OCPA 1FZPB 4BXFA 3FTYA 1UELB 2ZXHA 1SMYF 2F4OB 3PQKA 2QQBA 1BJZA 3B7UX 2ELJA 1JTXA 4E7IA 4Y3OA 3SQNA 2DI3A 2K3FA 4XN9A 3J80Z 3ROUA 2CV2A 3LL7A 5F1JA 1ZHFA 1B8IA 2OPTA 3HRTA 1O57A 5LRSA 3UCQA 3BZCA 2XVCA 2HZTA 3FXKA 1WZ2A 1JJ8C 2O6GE 2LD5A 2KDZA 1IGNA 1ZRDA 2JMWA 1IUFA 1S8NA 2KIQA 5M5WJ 1JUMA 5E17F 2JA7J 1UZCA 3PUBA 3C2BA 5CVVA 4A0XA 1OYWA 3HOWJ 4A3DJ 5K5QA 1FOWA 1R4MB 3LSRA 5FFZA 4JYKA 3J7YJ 2ADUA 4MQVA 4XNAA 1X4OA 2XF5A 3H0DA 1XMXA 3BJOA 5J1RA 5HLGA 4UB8C 3B34A 1E3OC 1OMIA 5DCFA 4BACA 3UR3C 2I8DA 1X19A 3CMYA 4BDYA 1DU0A 2DDAA 4N9IA 3ZRGA 3RZOJ 2H94A 3F3XA 1FNNA 1T8IA 3GZNB 4B09A 1NG6A 1X3ZA 1V54H 4KISA 2DPDA 2EIMH 3FXUA 2AS5F 1DP3A 1XMAA 4LJZF 1JUPA 5D5WB 1D1CA 1IN7A 2A61A 4I09A 3CDIA 5DS9A 2DOEA 4UUTA 4XO5A 2O9LA 4EM0B 2CFXA 1QQIA 3E7LA 2IXSA 4I0AA 4RVBA 1LEAA 3FUNA 2IGMA 5JBIA 3OYIA 2CJJA 3S1QJ 4KT5C 3K4KA 2HEOA 3ZQFA 1MSFC 3WTUC 3S32A 2WZFA 3E6BA 2XB0X 3O3KA 4F52A 1BC8C 2DCEA 3IWZA 2F5DA 1MBGA 2AHQA 2EIJH 4KYWA 2MGQA 1ZG3A 3ZN0A 1XGMA 2OZ6A 4Y15A 3J7AY 2KIMA 2DA2A 1DQUA 4ZTFA 3ZI0A 4C9YA 1FTZA 2E35A 5HLTA 4V2FA 3M1EA 2BE5F 3DWLE 3ONQA 4MFEA 1J59A 1SQMA 2L9NA 2FJ1A 3BTCA 4IJAA 1HKTA 3BG3A 3TOBA 3IKTA 4P1WA 2OTLI 3WTZA 1ZLKA 2XV4S 3NWSA 3CLOA 3WG9A 1FBUA 3BR5A 1A6QA 3S3MA 3TL4X 3L2VA 3CZKA 5CVIA 2ESNA 1WFXA 3ZQHA 4I76A 4G6TB 4XLAA 3HOTA 3JRFA 2GLOA 4I0BA 2DT5A 3BR2A 4RS8A 4KMFA 1O7FA 3BCAA 1VQ9I 2E71A 3I56I 2IA1A 2Z33A 2YS9A 5FLMJ 1MSEC 4ZDOA 2LC2A 2FRHA 3D5LA 5K7FA 4ENJA 3F9KA 4BXUA 6PAXA 4FETA 1LE8B 1LFPA 5AIPA 3MEXA 1V5GA 1MW2A 2L4AA 3ML6A 3ULQB 2V9VA 3BG5A 4BEHB 4R7LA 4XN8A 3WTVC 2Z16A 5LHHA 2P5LC 2VJ8A 3M9AA 2JCYA 2WC2A 1G3WA 5F27A 2XB5A 3WTTC 4BQNA 5LBQA 3JTHA 2M7BA 3DBRB 4JX5A 4ZZDA 2WAFA 1BIBA 1UHWA 1T2KA 3U9WA 4KA4A 2C82A 1HW2A 2OQRA 3F8NA 2X4HA 3TKYA 1R0KA 4LIVA 2EZHA 2QUFA 1R23A 2Y2ZA 4XRSG 4ENNA 1VQ6I 3HOXJ 1PUFA 3DP7A 1S46A 3GLXA 2NNNA 3IAM2 1UAAA 4LGWA 3FX3A 3RYRA 2JUCA 4IRGA 1WRJA 2DMPA 3G1LA 4HOBA 4OOFA 1ODDA 1QZEA 4JBAA 2C6YA 1X2MA 3E5UA 3IUOA 3FTUA 5HLHA 2A07F 2OU2A 3I3LA 2DA5A 1MW1A 3ZQIA 1ZR2A 2OQGA 1XB4A 4P55A 2X1CA 4ETSA 2KP6A 3RPUD 1W5SA 2PMHA 4BHBA 1IN4A 1MBHA 2P0WA 1Q1HA 3KCCA 1YJWI 3C2HA 3LFUA 1IXCA 3DPLC 3I59B 3K9TA 4XOPA 4F3QA 2FBIA 5FKNA 1SVOA 2JQ7A 1UHSA 1G5AA 5FWQA 3HSFA 2HI3A 3PIPF 1QRYA 5CQGA 3G3ZA 2PJRB 3OL4A 3MCZA 2B0LA 3SZGA 4ZZLA 2D1VA 1ONPA 1E2XA 1WQ2A 1JT0A 2NNYA 2PEXA 3ZN1A 5EEAA 1P7JA 5C4JJ 3FU6A 2CH0A 1K6OA 1Q1VA 3WTYC 3IAS2 2A68F 4BQOA 4BBRJ 1J5YA 2VE8A 1UG2A 3WHCA 2FNAA 2XIGA 4DYQA 3AG1H 3U21A 4PSXA 3CC2I 4Y33A 3LSGA 3CCYA 3BP8A 4HX8A 4NHJA 2F4MB 4ASNA 2EV6A 4CSWA 4IHVA 5JLWA 1CF7A 4WWCA 4R1HA 1Y0UA 2IW5A 5HOOA 3V8KA 4EGZA 3UEQA 1JE8A 5E3MA 1TP4A 4XK4A 1T56A 1X1BA 4BJ6C 4X2UA 3GO5A 2V6EA 1W0UA 1HBXG 3A2KA 2DK5A 4QPOA 3G73A 5CLSA 4RGXA 2XGCA 1T95A 4FASD 4M3DA 2W7NA 3H3ZA 1YITI 2RN7A 4L5IA 3P9KA 3L2QA 1GXPA 2R7UA 4L5EA 1BN5A 1JVSA 3H1CA 4JQFA 1FY7A 4ESJA 4BHPA 2EA4A 4A3EJ 2CW7A 1SFOJ 1W7PA 4Q48A 4Y6PA 4P96A 1K4SA 1EA3A 3FXJA 3H9JA 2K5CA 2PG4A 2HKXA 3GFMA 4DPRA 3FM5A 2H09A 4IHSA 1MW3A 3WGGA 4BQAA 4HF1A 4HV6A 2IS2A 2VQLA 3FH5A 3BJAA 2ZNYA 2NAZA 1HCRA 1A6IA 1YW8A 5D8KB 3AU8A 2OJED 3F6OA 4BEHA 1TZLA 4EGYA 1TTYA 1B72A 3JR9A 5HNFA 1R1TA 4ZW6A 4FT8A 2H27A 3OIPA 2M34A 3TP0A 4KNYA 2H8RA 1XCBA 3BTLA 3H9GA 2VJIA 1YJNI 2FF4A 3FU5A 1S3JA 4XNBA 3MKLA 2FA5A 1LFUP 3S17J 4HV5A 3KZYA 4I01A 2IVMA 3QPTA 5DM6F 1EJ9A 3FKIJ 2JWTA 3OIOA 5E18F 4ZYDA 1LNWA 5EEHA 5K7ZA 2IAIA 3CUQC 1MKMA 2FX0A 1QVTA 4KICA 3CCVI 3IH2A 4B3AA 1NK3P 3W6VA 5KAFC 1SFKA 4HX4A 3CHSA 3KP3A 2EB7A 4F92B 3J81K 4YFXF 4BUPA 2O7OA 5AONA 3V7CA 1IRXA 4IHXA 4RLFA 2A05A 3TP3A 4IX7A 1VNDA 2XDVA 3K2ZA 1U5TA 4HAMA 5GP9A 2NVTJ 2GA2A 3FUIA 1TW2A 2TDXA 3DXJF 1U8RA 3FIWA 5L3BA 3AKZA 1CQTA 3PO2J 1ETKA 4O5VA 2K3PA 1TWAJ 3PUFA 3DPUA 2L7FP 3F8FA 4ITVA 2LF7A 2KFDA 1OKRA 4HLYA 3T1BA 1WH5A 3FXRA 1IZ1A 1D5YA 2EZLA 3DFGA 1ULYA 4HRIA 3T5XA 4EV0A 4Z2YA 3NARA 2R7OA 3QU6A 1RR7A 5CQEA 1ZG5A 3HUGB 3LA2A 2ZXGA 3NEUA 2Y1EA 2A6EF 1RUOA 5D4SA 2Y31A 4LIUA 3DEUA 3LA7A 1G3YA 3VVLA 4JP0A 1H88C 1S7OA 3VVMA 2Z99A 4GDFA 1BI2A 2QZ8A 2X51A 3OS0A 4XN3A 1A5JA 2TRTA 5JNLA 5IOZA 2QCOA 1HA8A 2STTA 1ZTRA 2ISZA 2IT0A 3K4CA 1TW3A 4TV7A 1WCMJ 4LLNA 1UFMA 3RKQA 3ZMVA 2H1LA 1T1RA 3SDGA 2BV6A 5EZGA 1APLC 4NDLA 3MZYA 4ZDPA 5JVTA 4XO3A 2VPRA 4QIRA 3H9QA 3TW7A 2IGNA 2CQ7A 4RAGA 1T98A 3DBHB 5EJCA 4L9JA 4CZZA 1G3SA 4HZFA 1SANA 1Z67A 1X2NA 3DKXA 3M8EA 1RC9A 1HF0A 3GTQJ 1HC8A 1JTYA 3OYKA 2UZKA 4L9TA 1KA8A 2XF7A 4RB1A 3JRIA 2HOSA 2A7OA 3EUAA 2ZB9A 2JRMA 4W1UA 4CCOA 2WWYA 3CHOA 4WF2A 1ZGJA 1HSTA 4ZQHA 4BXXJ 2WAQN 2O3FA 2XROA 2MH9A 3MKWB 1YJ9I 3FUFA 3CF2A 3HOUJ 1T33A 5HDGA 4PVBA 4XMVA 1P4AA 3VSKA 1DPRA 3K1NA 2NRAC 1I1SA 4KMUX 2JN6A 3BDDA 2J5OA 2VOPA 2Y1CA 5EDNA 1Z3XA 3CZLA 4IO9F 4I98B 5ICFA 4MO7A 4CCJA 1R5ID 5F04A 3OIQA 3ZQCA 3WE2A 5DUIA 3L2WA 2LR8A 2K02A 2QF7A 2HQ5A 1ZK8A 3AG4H 1K78A 4LLLA 1JXSA 2XPYA 2BY0A 1AHDP 3S3NA 3L1PA 1UHMA 2HR3A 1UG0A 2WPGA 1D0YA 4JNDA 3ZMTA 3ANMA 5LHIA 3HOZJ 3FTVA 3WU0A 2DO7A 4DBRA 5J8CA 2F5EA 4CYDA 3H0GJ 4A3MJ 5E79C 2X9DA 3ABLH 4ZYEA 2HWVA 5E3LA 3FKJA 1E0EA 3J7AO 2FSWA 1HDPA 2EFWA 2DFFA 1U9NA 1UB9A 3FXLA 2V9PA 3BZKA 4ZH4F 4RB2C 5F1RA 1BI1A 3FHZA 2E1MC 4HSRA 3RQIA 4ESBA 4BE1A 3FH7A 1ZG1A 2BY3A 4CCLA 3H3VK 3ZHXA 1YW7A 4D0PA 5IY5H 1Z9CA 2ID3A 5FJ8J 1GVJA 2QM3A 2L4MA 2KHMA 4DIQA 3R6SA 3HBLA 3RYPA 3OYFA 4NNJA 5J1YA 5IPAA 2JVGA 3O2PE 4AR9A 3OY9A 4IPAA 3PNTA 2VKDA 3Q0WA 5DLLA 3ELKA 2RQPA 5ILSA 2K86A 4A93J 1HW1A 3FF5A 5H6RA 3ZMDA 5EG0B 3DTKA 3H5AA 2EK5A 5F08A 3OR1C 2X1DA 5IP9J 1HOMA 1Q0LA 4MS6A 4HNTA 4AVPA 3CF5F 3OMYA 3JAMK 5JAZA 4V2GA 1A35A 4RBOA 2X6OA 3PQJA 2D5VA 1TWGJ 2MW8A 4XN0A 3SYTA 3BG6A 3HGYA 3TO9A 1PVEA 3IWFA 1R58A 4QTRA 3ZPLA 3DPTA 1B4AA 1ETYA 1BC7C 4ZTJA 3BTJA 1B6AA 4RGRA 4ON0A 1D8JA 1D3YA 2EZIA 2RREA 1S72I 1DDNA 2KZGA 1H19A 3K70D 3IL2A 3KYCB 4QHPA 2VBYA 2B9SA 2MC3A 3VYRB 1FP1D 2O03A 1Z6TA 3CCJI 4UUSA 2P7CB 2R7WA 4FE4A 2VJ5A 3OOUA 1Y6IA 2OUMA 5IT3A 5D5VB 1DU6A 4XOTA 3MFKA 2FFLA 1IDZA 5E3NA 1J7KA 1TNTA 2E7WA 1OISA 3HKZN 4CZCA 2DU9A 2FUG2 2VN2A 3WTWC 3B2PA 3NWTA 2UXNA 4E6KG 1ON1A 4AR8A 5J1UA 1XSXA 2BW3A 4D5CA 4PFOA 2UWMA 1I27A 2K9NA 2ZJQF 2OCCH 1BR2A 5DYFA 4GRIA 3DCFA 1VQMI 3FUDA 4R79A 3AUAA 2XAHA 5HDKA 2HDCA 2P4WA 4GFBA 4LK0F 3K4LA 1W7PB 3UNGC 3O8GA 1XDSA 2VL8A 4OINF 4RB3C 3WG7H 2LOOA 1MBEA 2HQAA 1LQ1A 2NVQJ 3B3BA 4G6DA 1IN5A 1HDDC 1BR4A 3K4BA 1IAWA 5CVUA 2E2JJ 3K10A 4QUOA 2ZXJA 3DTEA 1YX3A 2NVUB 1CF7B 1UCRA 1YX5A 2ISYA 2COBA 3LSPA 1X1AA 2ZSIB 3K1PA 1PP8F 4UB6C 1T38A 4PUSA 1B1BA 2L2OA 3OYLA 4RSYA 5L3GA 1J75A 2QVWA 1PP7U 2E5NA 2QVOA 3K6GA 1QHHD 3RZDJ 5CVRA 2QJ1A 1YW9A 3FUHA 4KN4X 1HQCA 3SFIA 3CJQB 1G6NA 2HGCA 2AXLA 3ZCOA 3MKZA 3OYJA 5FFXA 2VLAA 3C18A 2DPUA 5DDGA 4M9SA 3KP2A 3TDZC 1G59A 2HXIA 1WWXA 2W82A 3A01B 2KKOA 4BDZA 1P2FA 2R3SA 4A3FJ 2V4JC 2J5PA 3KE2A 5LGUA 3SDBA 2NVXJ 3HHHA 4OU0A 3SZPA 3V8JA 3B02A 1MD0A 4HQEA 2F2EA 2HFHA 4CCNA 4QIWN 4XMTA 3KETA 2E1OA 2K7LA 3P9IA 2Q1ZB 5D5UB 2MFZA 4YIFA 2DK8A 4G6QA 3FXOA 1J0RA 3PJRA 4C3HJ 1R1VA 2IPQX 2LREA 3ZP5A 1H3LA 1D0ZA 4L9VA 3WGHA 2L7KA 3FM3A 2XAQA 4CCMA 3LOCA 4KDPA 1V4RA 1WJDA 4XLPF 3ZQ7A 4I02A 1Y8QB 2HXOA 3HPHA 1XTAA 2OTJI 3EBGA 2E19A 2ZXWH 3BQZA 4CUGA 4RB0A 2PJRA 3WU2C 3VOEA 5JHFA 2LF8A 2LK2A 3BCBA 3SJMA 2A5WA 1R7JA 3BWGA 3GZ5A 4I99C 4ZYAA 3SFZA 4PJMA 1JI8A 2PL5A 1ZAOA 3I59A 2LFBA 4BHCA 2YR2A 3ZQQA 2DA4A 4EJVA 3ABKH 3W3CA 5FKKA 2WY8Q 2AQFA 2UUZA 2JJ7A 4NBQA 4X1EA 1SEUA 3LQRA 1U5TC 2CMPA 5AIQA 5J3LA 4ANJA 1ZGAA 1VQ4I 1VZ0A 4WK8F 2IA0A 5DM7F 1USSA 3BG7A 2MLKA 3B7TA 3RASA 3OYDA 3VYSB 1PUEE 2WB1A 4E7ZA 3VWBA 4M3BA 3BQYA 3LA3A 2M2EA 2DMNA 2KL4A 2VOOA 3CHRA 2M3AA 3R0JA 1TBXA 5LD2C 2H6BA 2NOJB 3FHEA 1IJWC 3CP2A 5LHGA 1MNEA 2F5VA 1FWZA 2V1XA 2GBYA 1OPCA 2E34A 2IBDA 4MNUA 4G12A 1HW5A 3HB9A 3S2WA 1MBKA 2W84A 1AOYA 2HDWA 2KISA 2BHZA 1VTNC 1F43A 4B1RA 3B2XA 2AO9A 4LOCA 2YUSA 1SFEA 2HU9A 3S1NJ 1O3QA 2CUFA 3FBNB 4IEJA 2V1NA 3EYYA 2E60A 5F0HA 4O6JA 1I6HJ 3HTSB 4DBQA 1FYLA 4IHTA 3F6VA 4XLHA 3EPZA 3FBIB 1MMGA 5IOYA 1W36C 2CW8A 4MIMA 3E97A 3ABTA 1TL8A 1DPUA 4A0YA 5TRDA 3COAC 5FKOA 4CHUA 1B59A 5ICCA 4IL6C 2BBYA 1LB2A 1KQ8A 1Z1DA 1KQ9A 1C0WA 2PMUA 4CICA 4Y13A 1X1PA 1Z91A 1FMWA 3K1MA 3HRMA 4DJAA 3QPLA 5FRMA 1XX5A 4AUXA 2PJPA 1WJCA 4J01A 2R5ZB 4HF0A 2X1EA 3C7JA 3MWMA 4G94A 3BY6A 2GXGA 3VB2A 4C2MJ 2LH9A 1R9TJ 3ANNA 4EJTA 2WAQA 4IKFA 3JRGA 3Q5FA 2ZJPF 4OIRF 2R5YB 3RIRA 3AFHA 3R61A 2E1MB 3GWZA 3HIFA 5D6FA 4L0YB 1X58A 3LMMA 4U0VA 3QQAA 3KP6A 2R7FA 4K5LA 3FXMA 2DQLA 3CMAI 3GLLA 3W6KB 5GTIC 5GPCA 3HRUA 1RI7A 1UMQA 1WVRA 4FISA 1MBFA 5LGTA 3A01A 5EV7A 1Y1WJ 3E0JB 4IVNA 4LG0A 1O7LA 2AXTC 3OL3A 2CUZA 3F8MA 2FEZA 4K5MA 2XGDA 1LDKB 2X48A 4XN2A 4LG0B 3E6MA 1ZH5A 1OCOH 2BY1A 1QZYA 3KLNA 1WJBA 1JGSA 3FXQA 1RKTA 3MKYB 3DBLB 1V3FA 3IV5A 4FLQA 3SEZA 4FCAA 4K2EA 4EM1A 3ECOA 1ZREA 5HS7A 1ZQ3P 2ZMEA 4AIJA 2RAEA 2QKLB 3CCLI 2IS1A 2Z3YA 2L54A 2F6CA 4D1QA 4GAEA 2DODA 5GAHJ 1D1BA 2MH2A 1HKSA 3CC4I 4FLSA 4XRMA 1O3RA 2G9WA 4CXFA 2M9HA 3H3UA 4E7LA 2K85A 2EH3A 2Q2EA 2VASA 5F64A 4XIDA 2HPOA 3F8BA 2XHKA 3GMEA 4Q4ZF 2L7MP 2XQ0A 3I55I 3A4CA 1Y56A 4ZW8A 5JVGF 4FX0A 1CGPA 3ISPA 3VYUB 1YFHA 2JVHA 3H5NA 3DLAA 4FLOA 3EETA 2M4GA 1HS6A 5J4VA 1TWCJ 1LKXA 3OYEA 1K7AA 4J19A 2FNPA 2Y1DA 1OYYA 3WODF 3UERA 3CCEI 3DQVC 1STZA 2DFEA 4AYBN 1B72B 1R6RA 2DDBA 3BPXA 2O8XA 1K61A 2GM4A 2XAFA 2M0MA 2Y48A 3KEOA 4XQFA 2JZYA 3NRVA 3L2CA 4ZQGA 4HQMA 1R5HA 2F5CA 2W00A 3L00A 5C44J 1T6SA 3LAPA 3IIEA 4EM2A 2XAGA 2BXZA 4ZX5A 1J09A 1GVDA 3C2GA 4NC6A 2Y1GA 1W0TA 4A2UA 4M3EA 1ZYRF 3Q9VA 3B73A 4EJWA 5LGNA 2CV1A 1Q0QA 3KZIC 2R59A 2DAOA 3R4KA 1VQPI 4C2UA 4HDUA 4L9NA 3CMMA 1YIOA 2FQ3A 3ZHYA 3CJNA 3KZZA 3OYHA 2W4SA 5DV5A 4D7MA 4ZW7A 3EYIA 5D6EA 1RESA 2W85A 4DGWB 2X6YA 3A0BC 1I50J 4E7SA 3JSPA 2FXAA 1EV7A 1N78A 4KFCA 2CRGA 5EYRA 5HS9A 3TGNA 1NHAA 4EMSA 2VJ4A 5JFRA 2RKHA 3OS1A 4OIOF 4PSWA 1W7PD 1VQ7I 3M4OJ 1S5LC 2E5ZA 5E20A 3K4NA 2ACJA 1PYVA 5BMZA 4XMZA 2YPRA 2XPUA 2JUGA 4HLXA 5F0FA 3AG3H 1ACIA 1F36A 4MEXF 5FO5A 3HKZA 1OR7C 1F9NA 4HYEA 3VFZA 4GYIA 2VUMJ 4A5NA 2VKVA 4OWRB 5BQTA 3OV8A 2DOAA 4CA0A 3I4NJ 2G0EA 1WGXA 4G7HF 3OYGA 4CH7A 2XC7A 1TT0A 3KIOA 4KIFA 3VYTB 5KNLA 1X3WA 2R7QA 2K27A 4ZX6A 3HSEA 3KEDA 3DEWA 1V55H 2QYOA 5IP7J 3I0TA 2VQGA 2LVSA 1VI0A 2DA3A 4JK1X 5DTDA 3GTJJ 3OYCA 3R0IA 3J7ZI 5FRNA 2DW4A 5JR3A 1E3PA 2KRFA 2BZTA 4K5PA 3CCRI 4B8XA 1YRNA 3G1MA 2F4IA 3BZ6A 1POGA 3OYNA 1O4XA 2JA2A 2NS7A 2OBPA 3QAHA 3R0AA 2R92J 3I53A 2P7VB 2ZNZA 3M7GA 3G4SI 3HC7A 3DF8A 3V42A 4ABZA 1MJBA 2W57A 2L9VA 1GXQA 1B9NA 4EEFG 2LY1A 4FLRA 1FYKA 3LQQA 4P5OA 4AYSA 1RR8C 3A02A 3ANLA 2DMTA 4BE2A 2HVQA 3PM1A 2VKEA 3PIOF 4A3BJ 1SD5A 2ME0A 4M6XA 1IF1A 4LFUA 2JRTA 4QSHA 3E5XA 4YEJA 3C3WA 2R5ZA 2PFBA 3MN2A 2HYJA 5HODA 1BI0A 1FSEA 1LVKA 2VC0A 2VIXA 2M5WA 4GCVA 5CKTA 3GX4X 3AL0C 4RMNA 1B9MA 1X3ZB 2H8WA 3EUKL 4RGUA 4BKXA 4DYCA 5BPPA 3KP7A 4NQWB 4HX7A 2JCVA 1SC7A 4UV8A 3VODA 3PUUA 1XC5A 3L2UA 2V26A 3OYAA 2EA2A 4XLCA 2NYXA 2WADA 3PO3J 2JD1A 3FUJA 1MIJA 2W25A 3BPVA 4RCVA 2VBWA 1GT0C 2WZGA 4A3KJ 4B48A 3ZQLA 3T8VA 1MGTA 2K9LA 5FLVA 1ETXA 4G9YA 4KT6A 4MHGA 1KU9A 2KIFA 4AU7A 4O3MA 3SXYA 2P8TA 5J8FA 5FB2A 1NH3A 1KU7A 2DA6A 3A1YA 2P6TA 1WJEA 3TW6A 1H89C 4PJJA 2ECBA 4DW6A 5J47A 3QP5A 1TWHJ 5FKMA 5ILUA 3ZXSA 2DBBA 3IRRA 5A2QK 3K2AA 1R0LA 5FLXZ 4YELA 4XSZF 3GTLJ 2XGEA 4HPQA 4HEA2 1X4PA 1HLVA 4HW0A 4XKVA 1MMAA 2V1DA 1V5EA 3PL8A 4I7HA 1JHFA 3HSRA 1I1GA 1W5TA 5CPRB 1MW0A 4M9XA 1YG2A 1M1EB 3GF2A 4C3IJ 4UV9A 3OYMA 2DA1A 2LLKA 1SC5A 3P9CA 5CVJA 2KIUA 1SG7A 4ZW3A 3QPSA 3QYFA 4XBFA 2O0YA 4X6AJ 2L3DA 3U1DA 3CO7C 1OQYA 2ZMEB 1F5TA 4F7ZA 1D8KA 2Y1FA 1X3UA 3DEEA 4II3A 2JV7A 2V7FA 2QENA 2CUEA 2LYCA 5FROA 2ZC2A 1FMVA 5B1BH 4XNFA 3KEYA 1S6LA 1XDUA 3PNYA 3FMRA 4BY1J 3EUHC 1VF9A 2N8GA 2MD5A 1GV2A 3LFKA 1LEBA 3S14J 5LLQA 1H0MA 2HPTA 2EIKH 2RVCA 2I5UA 1MDMB 2A5YB 2M30A 2R4GA 4LMYA 1QPMA 5LFAA 4IZZA 2ID6A 2K9SA 1P92A 2CQQA 5LRRA 4UVBA 2LNBA 1ZARA 2RC4A 3OOPA 1A04A 5JMPA 4N4NB 5HVQC 1BA5A 1ZRCA 1R5GA 3N4MA 2VODA 4A3JJ 2UV1A 5IT9Z 2IGOA 1RRJA 2ZJ2A 2R0QC 2DA7A 1MMNA 5FKLA 1H9GA 3I9V2 1LUJB 3O6BB 4S0HB 1ONOA 2OF7A 2Y75A 1LJ9A 3RSNA 4D7NA 1Z6RA 4DOZA 3FWEA 1IRFA 5L3FA 3JREA 1SFUA 1MZBA 1N75A 4FX4A 9ANTA 1MH3A 4CGZA 5L3CA 2KZVA 2ZCWA 2EFOA 2VBZA 4OOIA 1R1UA 2FOWA 4RAFA 1MJ9A 3REOA 4B44A 4G8XA 3RKXA 2QSHX 3L2RA 4Y7NJ 3CJTB 1I6XA 1D5VA 3GYHX 1Y0NA 3BJ6A 1GW6A 4MTEA 2MAPA 3K7AJ 4FQGA 1ZR4A 5EGOB 2IP2A 2WY7Q 1T39A 4HDVA 4AYBA 1ON2A 2A69F 2BOLA 2GA1A 3ZHZA 1FYMA 1OJLA 2VT3A 3H35A 3IRQA 2ICWG 3G1OA 3J80K 3JRAA 4E7JA 2A6HF 3CZ6A 1I5ZA 1USTA 3HGGA 2HTJA 2PBIA 2DOFA 2ECCA 3WHBA 3RPUA 1EH8A 3CTAA 4G7ZF 4A12A 2VB6A 3DTIA 2Z9OA 3W6JB 2GXAA 4BQQA 2W48A 2HVRA 4K5OA 1ZLJA 2VC1A 3KPHA 4M3GA 4FTHA 2HOTA 4CYCA 1BOAA 3BROA 2LTPA 1IV8A 2JSCA 3S2DJ 3T8TA 3KP4A 1FC3A 2WV0A 4A69C 2HKOA 3P5JA 4PJLA 2L02A 2H6CA 2BVLA 4CYCB 2HYFA 2EGHA 1ZKGA 2L0KA 4AIKA 3KYDB 4A6DA 2JD2A 1ERDA 3VSLA 2EV5A 3Q9SA 1H8AC 2Z2SB 1A31A 3RPQA 4YRVA 3ABUA 2GZWA 4ZJZA 2R7RA 2Q2EB 5H6QA 2HDDA 4R5TA 1I3QJ 2GOMA 2JA5J 1FP2A 2Y69H 2RDPA 1XSVA 4OIQF 2X0LA 4EATA 3SEQA 3L09A 1QO0D 3V7RA 1YYVA 3PFYA 4P9FA 5EEGA 3B7SA 3CUQB 2PMZA 1EKEA 1QGPA 2Z5UA 2ZFWA 4H0EA 4XN7A 4S05A 1GUUA 1WHUA 1TQPA 3GVAA 3B7RL 4ARFA 1G3TA 4BAYA 3QP6A 2QBYA 2LDUA 2LY9A 3PNVA 3WTXC 4J00A 4XLFA 2DJIA 1TNSA 5KHDA 3N97A 3DLLF 2LG4A 2X6XA 3R60A 1G4DA 4PK4A 1YTYA 2K9MA 3W2AA 5K1YA 4FHTA 3IH4A 3LWFA 2VXZA 1UJ8A 1W36D 4UHTA 4QLCU 3CDHA 4LK1F 5BOXA 1BIAA 1U6GA 5GADJ 1BBYA 1ZELA 2HTSA 3PSFA 1GLNA 2X85A 1RUNA 2R70A 2HS5A 3RCOA 3EDPA 2ME6A 3ASOH 4XICA 4JX6A 2KJCA 1Z21A 3QODA 1WJAA 2L9RA 3HEFA 1PUFB 3VDXA 4Q4EA 2Y0MA 4UVAA 3EBHA 2VONA 2R7XA 2L5QA 2Y9YA 2KRHA 2K9QA 4BJTA 1I39A 3QYBA 1IN8A 3RJPA 4ENKA 1YRNB 1K83J 4BJ5C 1FOKA 3CESA 1P9QC 4Y67A 3SHFA 4U0WA 4XSXF 2PGGA 3CHQA 1IN6A 2MABA 2OC6A 2DTRA 4U7DA 3BR1A 1FBQA 5DEQA 2FMYA 1VQNI 1SVLA 2BYVE 2DQ6A 2HQNA 4A3GJ 2YSRA 2DN0A 5M5YJ 3FMQA 1TT5B 4WCGA 4MEYF 2BGCA 1T1SA 2XKPA 2IEKA 3TOAA 2F48A 2COMA 4ZDLA 4E70A 2QSGX 4PU2A 5H20A 3T0YA 4C3JJ 1WSUA 2KLOA 3HXLA 3SZTA 2CFOA 1MW7A 1XGSA 4UUVA 4L2LA 3E5QA 2CUJA 2EFNA 2WAEA 1FBSA 3TO6A 3KLOA 1IUYA 4HNUA 2NS0A 2YX7A 3OS2A 1G2HA 2XGXA 3M8FA 4ZQTA 2L9SA 1JG9A 2XRNA 3DV8A 4B47A 3QU3A 4BYYA 3FU0A 3UKGA 1FOYA 1EH7A 1SMTA 5M3FJ 2XSJC 4EVIA 5K7HA 4IXAA 2CGPA 3HPGA 2E2HJ 2R93J 3LSIA 2JT1A 3DU6A 3K4JA 4GO1A 1BR1A 1QZZA 2QQ8A 4B3XA 5DCMB 3WQSB 5BS6A 2O8KA 2EFPA 1U78A 4B4CA 3CZEA 1GV5A 3X2QH 3MVPA 1LDJA 5K5RA 2E7XA 2ELHA 1S29A 3TMOA 1FX7A 3A14A 3MQ0A 2MSYA 2MAOA 4XNDA 1SFXA 3I5UA 4EJUA 4BNCA 3A06A 1HXDA 3FHNA 5F6FA 1N77A 2K4JA 4W97A 4IQJA 3M07A 1FTTA 2GTQA 3BTIA 2HOEA 3LAJA 3GTMJ 1VQ5I 1D0XA 3BT9A 3D1NI 3CZGA 1RKWA 1R71A 1JKPC 1BL0A 2K40A 4RAZA 3KYLA 2VE9A 3CCSI 1VQKI 5BPDA 4V19K 1MVYA 2IA2A 1AKHB 2FE3A 3MZHA 3S8PA 2WTEA 5D8LB 2VJJA 5GTHC 3D5SC 4PJNA 2B63J 2AQEA 2GIVA 4IQ4A 3N05A 1O3SA 2LY2A 2BVMA 2QKMB 4M72A 3JRBA 3GTKJ 4YFKF 5KAIC 3RKWA 3T8RA 3FK6A 2EWNA 5DD4A 2IS4A 4FCYA 2V1UA 4PW4A 3GCMA 1IO2A 3L9FA 4XN1A 1T0FA 3P7NA 4AWXB 4OMZA 2M8GX 5JI6A 5DUKA 1YS7A 4M71A 2XPZA 4FE7A 3EUHA 1SAXA 2H1KA 4L5JA 2O5RA 2DYRH 2EINH 2G7HA 2LKPA 5J6XA 3WGIA 4NQWA 4NUBA 4L0ZB 2DMQA 1Z0XA 2OV7A 3ZOBA 3KX2A 2XPWA 1H9TA 3QJXA 2FOKA 3BR0A 2C5ZA 3S15J 3ZGKA 5GAEJ 3HUGA 2DMUA 4XMYA 4E4HA 4MQ9F 2CQKA 4U87A 3WTSC 4JX4A 4M9ZA 1AU7A 2R7SA 2HPIA 3EBIA 1KQ0A 2GIZA 3ZMSA 3G2BA 4DZPA 1NG7A 1AA7A 2O61A 2XSDC 1JUSA 3M1CA 1MMSA 3Q3SA 1SD7A 4PFPA 2VBXA 4AM3A 5EG0A 1R36A 3AU9A 1ENHA 3IC7A 3CC7I 5L3DA 4Q5SF 1R00A 1U0JA 2NVYJ 3FZVA 2ZXIA 1G8XA 3RTRA 5BNGA 1DUXC 4Q47A 2D45A 1QVUA 4K5NA 3S93A 4CDGA 3GTPJ 5E1XA 5JHUA 3ERMA 1YLFA 1W4MA 2LRDA 2DFHA 2LSOA 3ASNH 4RA2A 4DQ2A 4KITB 4IOCF 3CDLA 2XAJA 4XR6A 4XORA 1Q0HA 2VXDA 1U2WA 3Q0UA 3HRSA 4IHYA 1MBJA 2BEOA 2ZBKA 4U88A 3BLYA 1X3WB 1IXRC 3C1DA 1Z7LA 2G7UA 1MDMA 2Q0OA 3D0SA 3JTGA 1OCCH 2JCXA 3BR3A 4XN5A 3HTUA 5J40A 2R7VA 2DJNA 2E1CA 2GAUA 3G71I 2V9KA 4ZW5A 3DU5A 1OCZH 2W24A 2GWRA 4A3IJ 2R72A 2UXXA 1YI2I 3CCMI 5FLXK 1XSDA 2CQXA 1RZ4A 5JO0A 4QPEA 2QA4I 4X0GA 1WJ5A 3FMSA 2BXYA 2CO5A 1P4XA 2R7ZJ 3CHPA 3S1MJ 4AIHA 1N25A 3TO7A 2PLYA 2DT6A 1IDYA 1Z7UA 3HYIA 4J3BA 1JGGA 2GOXB 1EH6A 2ESHA 3M8JA 1KU2A 2V79A 1VQ8I 4BU2A 3GZ6A 1OCRH 4ZYHA 2LP0A 2MD0A 5FGMA 2JD0A 1WPKA 3TEDA 4ZX3A 4AR1A 3V7SA 1FJLA 4E7HA 2NOGA 3HHGA 1EF4A 2HVSA 3CCQI 2BHYA 3F21A 1TLHB 3BG9A 4R5VA 1F1ZA 4LD5A 4D5FA 3MAJA 5JMWA 3G6EI 5DULA 3H92A 4LUPA 4KN7X 4BH9A 4BS9A 5IYBJ 4H4KC 3WQRA 4XKWA 5FD6A 2A3SA 4A6EA 3IH3A 5E1WA 2XUBA 3OSFA 1FSHA 3MD2A 1O3TA 1GHCA 4UXNA 2Y30A 4YFNF 1W1WE 3CCUI 4WXHA 4E7KA 1L3LA 2STWA 1S7EA 4NC8A 2FQ4A 3QPHA 3HOYJ 2DYSH 2GQQA 3K4MA 1YIJI 5ICEA 3V8LA 4XL9A 1J2XA 2CYYA 3CQZJ 3TQNA 1VQOI 2M45A 1YS6A 3PFIA 1XGNA 1FT9A 2LBFA 4ZYGA 2KDOA 4R5XA 2OA4A 1YQAA 3FUKA 2HOAA 2F5FA 4A0ZA 1K79A 1LVAA 4WX9A 4EJOA 1F4KA 3GFLA 1B8IB 2PQ8A 3IKVA 5HNHA 3FUEA 3E3VA 4RGSA 1L0OC 3Q44A 1KU3A 5TJJA 2YX4A 4U0YA 4KIGA 5D5XB 4UY8I 1JKOC 4Y17A 2D1HA 2VQCA 3CP8A 3HJEA 4XONA 4NB5A 4RLQA 3RC3A 5BPIA 2QQ9A 2JA6J 3FTXA 5C4XJ 2MYSA 4M3FA 1YHQI 1K4TA 1RETA 3CUOA 3LSKA 4PGGA 2DTZA 2E36A 1WH7A 5M5XJ 5IYCJ 2QQAA 3KFWX 4AVZA 1QA6A 2P6SA 4MKTA 3VPRA 4M6VA 4I6ZA 3FDYA 3LSHA 2DT7B 1JGIA 5F0CA 3ABMH 1IC8A 3F8CA 4GGGA 3QWLA 4IRIA 4UNOA 3JSOA 3JRHA 2OCEA 1DP7P 3WE3A 1ETOA 1JKQC 4RAYA 2WBMA 3BC8A 4XM3A 1ETQA 4DYRA 2YU3A 1Z05A 2L7ZA 1BM9A 2B7EA 4AD9A 2RNGA 3A03A 1VQLI 2O7GA 2IJLA 4A3CJ 4RM2A 5HS8A 5GPAA 2ZKZA 5B66C 1IRGA 1OFCX 1XGOA 1X1DA 4S04A 1W5CC 1PJRA 2DLLA 2TCTA 4DZJA 1Z3YA 1E17A 3S1RJ 2IRFG 2RJIA 3JRCA 3CMEI 2RNJA 2Y0SA 1OR7A 1U9OA 2XAUA 4P9UA 3RI4A 3GUDA 4II2A 3OYBA 3E6DA 2PI0A 4NC7A 3J81Z 4M74A 3GFIA 1WI9A 2XPVA 3I54A 3FH8A 2ZSHB 4HNVA 3RQ4A 2HQRA 2Y0SN 1OLTA 3U1KA 5M3MJ 3FUMA 4QMEA 3JAMZ 3H36A 2DFIA 1KZHA 2VT2A 3I71A 4HBLA 2ZJRF 1TWFJ 1VFCA 1YE9A 3TDUC 2BW3B 1YO5C 1FPQA 2IGKA 3JT1A 1FLIA 4XN4A 5DYMA 4PJ0C 5LEJA 2XF6A 5E8GA 2KQRA 3HM5A 1HKQA 1Y1VJ 4KIBA 1RNLA 2M1BA 3JRDA 4G7OF 2Z1DA 5EF6A 1ORKA 1ETWA 1WKMA 1ZN2A 4HSTA 2PMZN 3KEQA 4XLNF 3S3OA 5B5EC 2DXIA 3VEPA 4F91B 4U7BA 3OSGA 3V4GA 4OIPF 4YIIA 3O8HA 4UUSB 4PGHA 1ZGWA 3K70C 2P5KA 1TC3C 1P4WA 1XS9A 4OAYA 1NK2P 5EZHA 3RKYA 5FD5A 1SD6A 3B6CA 1T08B 3AL0B 3A0HC 3ESWB 3NAUA 5H2FC 1WI3A 2EILH 2L01A 4N9HA 2IS6A 3MMYB 4HF2A 4OMYA 1QU3A 3PSIA 3DKWA 2EJRA 1LDDA 2EZKA 4M6YA 5AENA 2CV0A 4XMUA 3QOPA 1E3HA 4KJZA 2JA8J 2R5YA 2OAZA 4KUMA 1IW7F 5KVRA 2HPMA 2K4BA 5IYDJ 5E8IA 3EQLF 5HDNA 2XKOA 3IP4B 3OWTA 4ZQEA 4GAAA 2EQRA 2I10A 3AG2H 3F0CA 2WV1A 1MH4A 3Q43A 2ZO4A 4KP7A 4Q4IA 2RV8A 3ZR8X 4GYGA 4YG2F 4DNCA 1RP3A 4ENMA 2YU9J 3CO6C 3HDDA 1YOVB 1AWCA 1RPWA 4A5MA 1BJAA 2OD5A 2XASA 4BBSJ 1D1AA 2KPMA 5K5OA 5IP6A 4AIDA 1BI3A 3ECHA 3U9GA 2Q8KA 5JLXA 1WJFA 1R49A 1OYIA 3ZMZA 2PX9A 2QSFX 3FTWA 2MBFA 1SAUA 1XG1A 5L3EA 3S16J 1MNDA 1KGSA 1P7IA 1SVMA 2CU7A 2VQHA 3HG9A 4MLOA 4BL0B 4UVCA 1KYZA 3BR6A 3K0LA 5KK1A 4HA8A 1JKRC 3HW2A 2FBKA 4XLEA 1ONVA 1R4NB 4PZJA 4LITA 1MJAA 2E2IJ 3B6AA 1MNMC 1U5TB 2R7DA 3F23A 4IRHA 4QPQA 2DQRA 2QBYB 1JHHA 1MMDA 3CXBA 5CJ9A 3RDIA 4I2OA 4N4OB 5DCMA 4RM3A 4IOAF 2HNHA 1JJ6C 2ETHA 1LPQA 1XCVA 2PN6A 2QEXI 3GFJA 4Y4RA 3QRFF 5DD8A 3FTSA 3LSTA 4CO8A 3U2RA 4XO4A 1ZRFA 3WU1B 2E1NA 4AC0A 2MLGA 2LMDA 2CS3A 2ZFUA 4XKBA 3L7WA 2FBHA 3CJRB 1AKHA 1Z77A 3I64A 2KMUA 4CCKA 4Y52J 3GXOA 3FU3A 4WXCA 1S9HA 1Y8RB 2JSPA 2ZMEC 5D4RA
chains in the Genus database with same CATH topology
4D1QA 4GAEA 4LIUA 3FU0A 1D1BA 3DKYA 3VVLA 4F55A 2XSJC 3CIAA 4BE0A 3VVMA 4FLSA 2M4KA 3HPGA 2X51A 3LSIA 3OS0A 3K4JA 3DU6A 1KONA 4OAZA 1BR1A 4XN3A 4B3XA 4E7LA 5JNLA 3WQSB 2VASA 2HPOA 1HA8A 3CZEA 4ZX4A 2XQ0A 2X6WA 3A4CA 4F93B 1Y56A 4ZW8A 3K4CA 3TMOA 3HOSA 4A03A 3A14A 5JC1A 3VYUB 2JVHA 3H5NA 3DLAA 1T0FC 2MAOA 4FLOA 4XNDA 2VPLA 1T1RA 2M7AA 2PUSA 2M4GA 1HS6A 3A06A 1LKXA 3FHNA 3OYEA 4ZDPA 1N77A 4IQJA 4XO3A 2Y1DA 4D9JA 3UERA 4QIRA 4XKCA 2GTQA 3DQVC 3H9QA 1D0XA 2IGNA 4JOMA 3JSZA 3CZGA 1R6RA 4LG3A 3KYLA 1MVYA 2M0MA 4AICA 3DKXA 4XQFA 3QYEA 2MC4A 3S8PA 1ONNA 4ZQGA 2W00A 2VJJA 3HL2A 3D5SC 4PJNA 3IIEA 3FTZA 2A6TA 2AQEA 4IQ4A 2B61A 3N05A 2LY2A 2BVMA 3OYKA 2QKMB 4ZX5A 1J09A 3C2GA 5TGTA 2XF7A 2Y1GA 2A7OA 3EUAA 3CHOA 4CCOA 2CV1A 4OOEA 2IS4A 1Q0QA 1QHGA 3E1SA 2R59A 4PW4A 4C2UA 4ZQHA 4XN1A 3MKWB 3CMMA 3FUFA 3ZHYA 3B37A 3CF2A 4PVBA 3OYHA 2W4SA 4XMVA 2XPZA 3H5RA 4ZW7A 3TBIA 3VSKA 3QOEA 2LBFB 4DGWB 2KRCA 3WQQA 2X6YA 2O5RA 4E7SA 3GBGA 2Y1CA 4XMXA 1N78A 1Z3XA 3CZLA 4NQWA 4NUBA 4CCJA 4C30A 4BGDA 2OV7A 2VJ4A 3KX2A 3D5RC 3OIQA 3OS1A 4PSWA 4B43A 3QJXA 2C5ZA 3L2WA 4XMWA 4ZC3A 3ZGKA 2E5ZA 1K6YA 2RQQA 3K4NA 1PYVA 4XMYA 4E4HA 4XMZA 1DGWY 4HG2A 2XPYA 4U87A 3FULA 2R7SA 4ZN6A 2JUGA 2HPIA 3EBIA 3S3NA 3HKZA 3G2BA 1OR7C 1NG7A 1UG0A 1AA7A 3LSMA 1K5HA 2W1OA 4OWRB 2DQMA 2WPGA 2DOAA 3M1CA 4CA0A 1D0YA 3W2VA 4JNDA 3RC8A 1X1CA 4CH7A 3OYGA 2XC7A 3ANMA 3FTVA 4PFPA 4DBRA 3W2WA 1TT0A 3VYTB 5KNLA 1X3WA 3AU9A 2R7QA 4ZX6A 1U0JA 3KEDA 2ZXIA 1BOBA 1ZS2A 1G8XA 3FKJA 3RTRA 1E0EA 4C2TA 2VQGA 3R0IA 3OYCA 5FRNA 2VKHA 1V5FA 4K5NA 2R7TA 3S93A 4ZW6A 2HZDA 3OR2C 5KCMA 4ZQFA 4K5PA 2E1MC 4HSRA 3OYNA 2F4IA 2LRDA 4KITB 2JA2A 4BE1A 3FH7A 4CCLA 4XORA 4Y6RA 4XR6A 2WA0A 2VXDA 1Q0HA 3ZHXA 1DGRM 4Y6SA 3BLYA 3HC7A 3V42A 1Z7LA 2KHMA 4BXFA 4DIQA 3FTYA 1UELB 2ZXHA 3OYFA 2JCXA 2LY1A 4FLRA 4P5OA 4NNJA 4XN5A 4AYSA 2JVGA 3ANLA 2R7VA 4BE2A 4AR9A 3B7UX 2ELJA 2HVQA 3OY9A 4E7IA 4Y3OA 3PNTA 2VKDA 5DLLA 4XN9A 4YEJA 2CV2A 2V9KA 4ZW5A 3LL7A 3DU5A 2R72A 3DTKA 3H5AA 3UCQA 3OR1C 2X1DA 1LVKA 2VIXA 1Q0LA 4MS6A 4HNTA 5CKTA 3OMYA 3AL0C 3PUBA 4RMNA 5JAZA 5JO0A 4QPEA 4X0GA 1WJ5A 3EUKL 4BKXA 4XN0A 3SYTA 3BG6A 5BPPA 4NQWB 3CHPA 2JCVA 4XNAA 1X4OA 2XF5A 3DPTA 3H0DA 2DT6A 3PUUA 3L2UA 3B34A 2V26A 3OYAA 4ZTJA 4J3BA 2GOXB 4XLCA 2WADA 4BACA 2JD1A 3FUJA 3UR3C 2I8DA 1X19A 4BDYA 3M8JA 2RREA 4RCVA 3ZRGA 1H19A 3K70D 4BU2A 4QHPA 2WZGA 4B48A 1NG6A 2MD0A 3VYRB 3T8VA 2K9LA 2JD0A 2R7WA 1X3ZA 4KISA 4ZX3A 2VJ5A 1DP3A 3OOUA 4KT6A 4AU7A 4AR1A 4E7HA 1Y6IA 2OUMA 1D1CA 4XOTA 2HVSA 2FFLA 4XO5A 3A1YA 1WJEA 4PJJA 4CZCA 4R5VA 2FUG2 3B2PA 3ZXSA 2IXSA 3NWTA 1R0LA 4E6KG 4AR8A 5JMWA 4YELA 3FUNA 4RVBA 5DULA 2BW3A 2IGMA 5JBIA 3OYIA 4PFOA 4LUPA 2UWMA 4HPQA 3K4KA 4BS9A 4HEA2 1X4PA 1BR2A 4H4KC 5DYFA 4XKWA 4XKVA 4GRIA 3S32A 1MMAA 2WZFA 3WQRA 1V5EA 3FUDA 3MD2A 3PL8A 4R79A 3AUAA 4F52A 5CPRB 1MW0A 2DCEA 3K4LA 4E7KA 3UNGC 4NC8A 3OYMA 2VL8A 1SC5A 2LOOA 3K4MA 3J7AY 2HQAA 1SG7A 3B3BA 1DQUA 4ZTFA 4ZW3A 4XL9A 4C9YA 3ZI0A 1BR4A 3QYFA 3K4BA 5HLTA 2LBFA 2Y1FA 3DWLE 2KDOA 3ONQA 4R5XA 1SQMA 2L9NA 3DEEA 3FUKA 3K10A 4II3A 2JV7A 2V7FA 4P1WA 4QUOA 2LYCA 5FROA 3NWSA 1FMVA 3DTEA 4XNFA 1YX3A 3KEYA 3PNYA 5HNHA 3FUEA 1YX5A 3S3MA 3EUHC 3TL4X 3L2VA 3CZKA 1X1AA 2ZSIB 1WFXA 3Q44A 4G6TB 4XLAA 3HOTA 4PUSA 2HPTA 2L2OA 3OYLA 4RSYA 2QVWA 2R4GA 2VQCA 4IZZA 2E5NA 3CP8A 5LFAA 3BCAA 3K6GA 4XONA 1QHHD 4RLQA 3RC3A 4ZDOA 2QJ1A 2LC2A 3FTXA 3D5LA 3FUHA 5JMPA 4N4NB 2MYSA 3CJQB 5HVQC 3F9KA 3LSKA 4FETA 3ZCOA 2UV1A 3MKZA 2IGOA 3OYJA 1LFPA 2VLAA 1V5GA 4AVZA 1MW2A 4BEHB 1MMNA 4MKTA 1G59A 4R7LA 4XN8A 2W82A 3FDYA 3I9V2 3LSHA 4BDZA 2DT7B 2Z16A 1JGIA 1ONOA 2VJ8A 2V4JC 2JCYA 3RSNA 4DOZA 3SDBA 4BQNA 2M7BA 2WBMA 2WAFA 1N75A 3BC8A 4XM3A 2KZVA 4CCNA 3U9WA 4XMTA 2C82A 2Q1ZB 2RNGA 1R0KA 2O7GA 4LIVA 4RM2A 2MFZA 4B44A 1X1DA 3L2RA 3PJRA 1PJRA 1S46A 2LREA 1H3LA 1UAAA 3IAM2 1D0ZA 1Z3YA 2L7KA 1GW6A 2MAPA 4CCMA 2RJIA 4CXFA 2WY7Q 4AYBA 4OOFA 1WJDA 2BOLA 2Y0SA 1OR7A 2XAUA 3ZHZA 4II2A 3OYBA 3H35A 3IUOA 3HPHA 3FTUA 4NC7A 3EBGA 3I3LA 1MW1A 4CUGA 4E7JA 2PJRA 5JHFA 3FH8A 3BCBA 2ZSHB 3CZ6A 2A5WA 3RQ4A 2X1CA 4ZYAA 2KP6A 4PJMA 1OLTA 3RPUD 1JI8A 2PL5A 3FUMA 4QMEA 3ZQQA 2P0WA 3W3CA 1YE9A 2VB6A 3C2HA 2BW3B 3DTIA 3LFUA 2WY8Q 3DPLC 2AQFA 2IGKA 2UUZA 4XOPA 4BQQA 4F3QA 2HVRA 1G5AA 3JT1A 4XN4A 5FWQA 4K5OA 2XF6A 2KQRA 5CQGA 2PJRB 2CMPA 2Z1DA 3OL4A 3SZGA 4ANJA 1ONPA 1VZ0A 4HSTA 3S3OA 2DXIA 3BG7A 3B7TA 3RASA 4F91B 4U7BA 4PJLA 3FU6A 2BVLA 2CH0A 3OYDA 2EGHA 3VYSB 3IAS2 2WB1A 4E7ZA 3VWBA 4BQOA 3K70C 2JD2A 1ERDA 2KL4A 3VSLA 3CHRA 4OAYA 2M3AA 5LD2C 2Z2SB 2NOJB 3U21A 3FHEA 4PSXA 3CP2A 4Y33A 4YRVA 3LSGA 4ZJZA 1MNEA 2F5VA 2R7RA 2Q2EB 3AL0B 4CSWA 4R5TA 2IS6A 2GOMA 3MMYB 1QU3A 2HDWA 3PSIA 5HOOA 5AENA 3B2XA 2CV0A 4EATA 3UEQA 4XMUA 3SEQA 2HU9A 4BJ6C 1X1BA 4X2UA 4KJZA 2V6EA 3PFYA 3FBNB 2HPMA 3A2KA 4QPOA 3B7SA 2V1NA 2PMZA 1T95A 4XN7A 2E60A 4FASD 2W7NA 3L2QA 2R7UA 3B7RL 4DBQA 4ARFA 3IP4B 1JVSA 4JQFA 3OWTA 4ZQEA 2CW7A 4XLHA 3PNVA 4J00A 3EPZA 4GAAA 3FBIB 1MMGA 4XLFA 2DJIA 5KHDA 1W36C 2CW8A 4Y6PA 1EA3A 2LG4A 2X6XA 3Q43A 3H9JA 4KP7A 4Q4IA 3ZR8X 2K5CA 4PK4A 1RP3A 4DPRA 2K9MA 3W2AA 2VXZA 1W36D 1MW3A 2IS2A 1D1AA 2KPMA 2VQLA 3FH5A 1ZELA 1FMWA 3PSFA 4DJAA 1GLNA 1WJFA 2X85A 3AU8A 4BEHA 5FRMA 2R70A 1TZLA 3RCOA 3FTWA 1SAUA 1WJCA 4J01A 1MNDA 1Z21A 2VQHA 3HG9A 4MLOA 3QODA 1WJAA 4BL0B 5HNFA 2X1EA 3OIPA 3VDXA 4Q4EA 3EBHA 2LH9A 3ANNA 3H9GA 2R7XA 2L5QA 2VJIA 2KRHA 2WAQA 4BJTA 4IKFA 3QYBA 4XLEA 4LITA 4BJ5C 3FU5A 3AFHA 3CESA 1P9QC 4XNBA 2E1MB 4Y67A 4QPQA 3LMMA 1MMDA 2PGGA 3CHQA 2MABA 2OC6A 4N4OB 4K5LA 4RM3A 2HNHA 1SFKA 5EV7A 3CHSA 2DQ6A 3E0JB 4F92B 3OL3A 4BUPA 4Y4RA 2CUZA 4K5MA 1IRXA 4RLFA 3FTSA 1LDKB 4IX7A 2XDVA 1T1SA 4XN2A 4ZDLA 4XO4A 3FUIA 1WJBA 4PU2A 3AKZA 3T0YA 3MKYB 2CS3A 2ZFUA 3HXLA 2KLOA 2K3PA 4XKBA 3DPUA 2CFOA 1MW7A 3CJRB 3SEZA 4FCAA 4ITVA 4FLQA 4L2LA 2CUJA 2KMUA 2WAEA 4CCKA 3FU3A 4HNUA 3OS2A 1S9HA 4HRIA 2R7OA 5CQEA 2JSPA 2QKLB 2L9SA 1JG9A 4ZQTA 3HUGB 2IS1A 2ZXGA 4B47A 2Y1EA 2F6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNH A;  2VLA A;  5HNF A;  5HLT A; 
#chains in the Genus database with same CATH topology
 4IF4 A;  2CWE A;  3DKY A;  4F55 A;  2BY2 A;  2RGV A;  1GDT A;  2P5V A;  3CIA A;  4BE0 A;  2M4K A;  2NS8 A;  2CW0 F;  2NXN B;  4L18 B;  3CD6 I;  2QWW A;  4OAZ A;  2JPC A;  1KON A;  4YIR X;  1P6R A;  5GAG J;  2M87 A;  3S2H J;  1XD7 A;  1IG7 A;  2EBI A;  4ZX4 A;  5E1Z B;  2X6W A;  4IHW A;  2CSO A;  3GEZ A;  4F93 B;  1XPX A;  4A03 A;  3HOS A;  1J9I A;  3IHU A;  5ILV A;  5JC1 A;  2CQN A;  3GW2 A;  1BW6 A;  2FD5 A;  1T0F C;  1SD4 A;  2KT0 A;  2VPL A;  2M7A A;  1TQI A;  2PUS A;  4D9J A;  4PCQ A;  3LSJ A;  4XKC A;  5TIS C;  2M8E A;  3HZJ A;  4JOM A;  3JSZ A;  1ITY A;  4LG3 A;  4ESF A;  3HOV J;  1U8B A;  2WB1 N;  5LEK A;  4AIC A;  1NTC A;  5A2Q Z;  2P81 A;  4XRF A;  3QYE A;  2MC4 A;  1ONN A;  3BOQ A;  5EGO A;  4MTD A;  2D2W A;  3HL2 A;  2XRL A;  3ZMU A;  3FTZ A;  2A6T A;  2GXB A;  2B61 A;  2VI6 A;  2KJB A;  4RDU A;  5TGT A;  4PDK A;  3FIS A;  2M0C A;  4GXO A;  2FML A;  5CYV A;  1Y39 A;  4OOE A;  1BW5 A;  1QHG A;  3E1S A;  4N0B A;  1FIP A;  1REP C;  2FU4 A;  3JCU C;  1HSJ A;  3B37 A;  5ERI A;  2MA3 A;  3MZ8 A;  5C3E J;  4Z6Y A;  2CG4 A;  3H5R A;  3TBI A;  2LKX A;  4QWQ A;  5J4Y A;  3M3Y J;  3I4P A;  3QOE A;  2LBF B;  1K78 B;  1ETV A;  2JPB A;  2JK3 A;  2ELK A;  2KRC A;  2LKS A;  3WQQ A;  3LNQ A;  2MG4 A;  3GBG A;  1I3A A;  1RIO H;  1XMK A;  2HYG D;  1QBJ A;  4XMX A;  2QGU A;  4BY7 J;  1FIA A;  1A36 A;  1IV6 A;  5E3O A;  4C30 A;  4BGD A;  2OZU A;  2EV0 A;  2Y9Z A;  3GTO J;  3KP5 A;  3K69 A;  3D5R C;  4B43 A;  4MFD A;  4XMW A;  4ZC3 A;  4LB6 B;  1K6Y A;  2RQQ A;  3JW4 A;  1IRZ A;  1IXS B;  1DGW Y;  1QNT A;  4HG2 A;  4R8H A;  3F72 A;  3FUL A;  4ZN6 A;  4EQQ A;  2EPF A;  1OCT C;  3LSM A;  1K5H A;  1PDN C;  2W1O A;  2DQM A;  1XN7 A;  3RC8 A;  5IT9 K;  3W2V A;  1X1C A;  1LE8 A;  4WXD A;  4M73 A;  3W2W A;  5ICG A;  3ERE D;  2EFQ A;  3F22 A;  1S7A A;  4LLG F;  1KYW A;  3I58 A;  1BOB A;  1QPI A;  1ZS2 A;  1JT6 A;  1FEX A;  4C2T A;  3CLQ A;  3CUQ A;  1FOX A;  3ZQG A;  3E6C C;  1V5F A;  1R22 A;  2VKH A;  3FK7 A;  3AAF A;  4LB5 A;  3NQO A;  2HZD A;  3OR2 C;  5KCM A;  2R7T A;  2V6C A;  4ZQF A;  2QLZ A;  5B3S H;  3I4M J;  1LFB A;  4A3L J;  5HLI A;  2JTV A;  4Y6R A;  5ED4 A;  3Q0V A;  4XRS A;  2WA0 A;  3GTG J;  1DGR M;  1U3E M;  5B1A H;  4Y6S A;  1TQM A;  4MGR A;  1OCP A;  1FZP B;  4BXF A;  3FTY A;  1UEL B;  2ZXH A;  1SMY F;  2F4O B;  3PQK A;  2QQB A;  1BJZ A;  3B7U X;  2ELJ A;  1JTX A;  4E7I A;  4Y3O A;  3SQN A;  2DI3 A;  2K3F A;  4XN9 A;  3J80 Z;  3ROU A;  2CV2 A;  3LL7 A;  5F1J A;  1ZHF A;  1B8I A;  2OPT A;  3HRT A;  1O57 A;  5LRS A;  3UCQ A;  3BZC A;  2XVC A;  2HZT A;  3FXK A;  1WZ2 A;  1JJ8 C;  2O6G E;  2LD5 A;  2KDZ A;  1IGN A;  1ZRD A;  2JMW A;  1IUF A;  1S8N A;  2KIQ A;  5M5W J;  1JUM A;  5E17 F;  2JA7 J;  1UZC A;  3PUB A;  3C2B A;  5CVV A;  4A0X A;  1OYW A;  3HOW J;  4A3D J;  5K5Q A;  1FOW A;  1R4M B;  3LSR A;  5FFZ A;  4JYK A;  3J7Y J;  2ADU A;  4MQV A;  4XNA A;  1X4O A;  2XF5 A;  3H0D A;  1XMX A;  3BJO A;  5J1R A;  5HLG A;  4UB8 C;  3B34 A;  1E3O C;  1OMI A;  5DCF A;  4BAC A;  3UR3 C;  2I8D A;  1X19 A;  3CMY A;  4BDY A;  1DU0 A;  2DDA A;  4N9I A;  3ZRG A;  3RZO J;  2H94 A;  3F3X A;  1FNN A;  1T8I A;  3GZN B;  4B09 A;  1NG6 A;  1X3Z A;  1V54 H;  4KIS A;  2DPD A;  2EIM H;  3FXU A;  2AS5 F;  1DP3 A;  1XMA A;  4LJZ F;  1JUP A;  5D5W B;  1D1C A;  1IN7 A;  2A61 A;  4I09 A;  3CDI A;  5DS9 A;  2DOE A;  4UUT A;  4XO5 A;  2O9L A;  4EM0 B;  2CFX A;  1QQI A;  3E7L A;  2IXS A;  4I0A A;  4RVB A;  1LEA A;  3FUN A;  2IGM A;  5JBI A;  3OYI A;  2CJJ A;  3S1Q J;  4KT5 C;  3K4K A;  2HEO A;  3ZQF A;  1MSF C;  3WTU C;  3S32 A;  2WZF A;  3E6B A;  2XB0 X;  3O3K A;  4F52 A;  1BC8 C;  2DCE A;  3IWZ A;  2F5D A;  1MBG A;  2AHQ A;  2EIJ H;  4KYW A;  2MGQ A;  1ZG3 A;  3ZN0 A;  1XGM A;  2OZ6 A;  4Y15 A;  3J7A Y;  2KIM A;  2DA2 A;  1DQU A;  4ZTF A;  3ZI0 A;  4C9Y A;  1FTZ A;  2E35 A;  5HLT A;  4V2F A;  3M1E A;  2BE5 F;  3DWL E;  3ONQ A;  4MFE A;  1J59 A;  1SQM A;  2L9N A;  2FJ1 A;  3BTC A;  4IJA A;  1HKT A;  3BG3 A;  3TOB A;  3IKT A;  4P1W A;  2OTL I;  3WTZ A;  1ZLK A;  2XV4 S;  3NWS A;  3CLO A;  3WG9 A;  1FBU A;  3BR5 A;  1A6Q A;  3S3M A;  3TL4 X;  3L2V A;  3CZK A;  5CVI A;  2ESN A;  1WFX A;  3ZQH A;  4I76 A;  4G6T B;  4XLA A;  3HOT A;  3JRF A;  2GLO A;  4I0B A;  2DT5 A;  3BR2 A;  4RS8 A;  4KMF A;  1O7F A;  3BCA A;  1VQ9 I;  2E71 A;  3I56 I;  2IA1 A;  2Z33 A;  2YS9 A;  5FLM J;  1MSE C;  4ZDO A;  2LC2 A;  2FRH A;  3D5L A;  5K7F A;  4ENJ A;  3F9K A;  4BXU A;  6PAX A;  4FET A;  1LE8 B;  1LFP A;  5AIP A;  3MEX A;  1V5G A;  1MW2 A;  2L4A A;  3ML6 A;  3ULQ B;  2V9V A;  3BG5 A;  4BEH B;  4R7L A;  4XN8 A;  3WTV C;  2Z16 A;  5LHH A;  2P5L C;  2VJ8 A;  3M9A A;  2JCY A;  2WC2 A;  1G3W A;  5F27 A;  2XB5 A;  3WTT C;  4BQN A;  5LBQ A;  3JTH A;  2M7B A;  3DBR B;  4JX5 A;  4ZZD A;  2WAF A;  1BIB A;  1UHW A;  1T2K A;  3U9W A;  4KA4 A;  2C82 A;  1HW2 A;  2OQR A;  3F8N A;  2X4H A;  3TKY A;  1R0K A;  4LIV A;  2EZH A;  2QUF A;  1R23 A;  2Y2Z A;  4XRS G;  4ENN A;  1VQ6 I;  3HOX J;  1PUF A;  3DP7 A;  1S46 A;  3GLX A;  2NNN A;  3IAM 2;  1UAA A;  4LGW A;  3FX3 A;  3RYR A;  2JUC A;  4IRG A;  1WRJ A;  2DMP A;  3G1L A;  4HOB A;  4OOF A;  1ODD A;  1QZE A;  4JBA A;  2C6Y A;  1X2M A;  3E5U A;  3IUO A;  3FTU A;  5HLH A;  2A07 F;  2OU2 A;  3I3L A;  2DA5 A;  1MW1 A;  3ZQI A;  1ZR2 A;  2OQG A;  1XB4 A;  4P55 A;  2X1C A;  4ETS A;  2KP6 A;  3RPU D;  1W5S A;  2PMH A;  4BHB A;  1IN4 A;  1MBH A;  2P0W A;  1Q1H A;  3KCC A;  1YJW I;  3C2H A;  3LFU A;  1IXC A;  3DPL C;  3I59 B;  3K9T A;  4XOP A;  4F3Q A;  2FBI A;  5FKN A;  1SVO A;  2JQ7 A;  1UHS A;  1G5A A;  5FWQ A;  3HSF A;  2HI3 A;  3PIP F;  1QRY A;  5CQG A;  3G3Z A;  2PJR B;  3OL4 A;  3MCZ A;  2B0L A;  3SZG A;  4ZZL A;  2D1V A;  1ONP A;  1E2X A;  1WQ2 A;  1JT0 A;  2NNY A;  2PEX A;  3ZN1 A;  5EEA A;  1P7J A;  5C4J J;  3FU6 A;  2CH0 A;  1K6O A;  1Q1V A;  3WTY C;  3IAS 2;  2A68 F;  4BQO A;  4BBR J;  1J5Y A;  2VE8 A;  1UG2 A;  3WHC A;  2FNA A;  2XIG A;  4DYQ A;  3AG1 H;  3U21 A;  4PSX A;  3CC2 I;  4Y33 A;  3LSG A;  3CCY A;  3BP8 A;  4HX8 A;  4NHJ A;  2F4M B;  4ASN A;  2EV6 A;  4CSW A;  4IHV A;  5JLW A;  1CF7 A;  4WWC A;  4R1H A;  1Y0U A;  2IW5 A;  5HOO A;  3V8K A;  4EGZ A;  3UEQ A;  1JE8 A;  5E3M A;  1TP4 A;  4XK4 A;  1T56 A;  1X1B A;  4BJ6 C;  4X2U A;  3GO5 A;  2V6E A;  1W0U A;  1HBX G;  3A2K A;  2DK5 A;  4QPO A;  3G73 A;  5CLS A;  4RGX A;  2XGC A;  1T95 A;  4FAS D;  4M3D A;  2W7N A;  3H3Z A;  1YIT I;  2RN7 A;  4L5I A;  3P9K A;  3L2Q A;  1GXP A;  2R7U A;  4L5E A;  1BN5 A;  1JVS A;  3H1C A;  4JQF A;  1FY7 A;  4ESJ A;  4BHP A;  2EA4 A;  4A3E J;  2CW7 A;  1SFO J;  1W7P A;  4Q48 A;  4Y6P A;  4P96 A;  1K4S A;  1EA3 A;  3FXJ A;  3H9J A;  2K5C A;  2PG4 A;  2HKX A;  3GFM A;  4DPR A;  3FM5 A;  2H09 A;  4IHS A;  1MW3 A;  3WGG A;  4BQA A;  4HF1 A;  4HV6 A;  2IS2 A;  2VQL A;  3FH5 A;  3BJA A;  2ZNY A;  2NAZ A;  1HCR A;  1A6I A;  1YW8 A;  5D8K B;  3AU8 A;  2OJE D;  3F6O A;  4BEH A;  1TZL A;  4EGY A;  1TTY A;  1B72 A;  3JR9 A;  5HNF A;  1R1T A;  4ZW6 A;  4FT8 A;  2H27 A;  3OIP A;  2M34 A;  3TP0 A;  4KNY A;  2H8R A;  1XCB A;  3BTL A;  3H9G A;  2VJI A;  1YJN I;  2FF4 A;  3FU5 A;  1S3J A;  4XNB A;  3MKL A;  2FA5 A;  1LFU P;  3S17 J;  4HV5 A;  3KZY A;  4I01 A;  2IVM A;  3QPT A;  5DM6 F;  1EJ9 A;  3FKI J;  2JWT A;  3OIO A;  5E18 F;  4ZYD A;  1LNW A;  5EEH A;  5K7Z A;  2IAI A;  3CUQ C;  1MKM A;  2FX0 A;  1QVT A;  4KIC A;  3CCV I;  3IH2 A;  4B3A A;  1NK3 P;  3W6V A;  5KAF C;  1SFK A;  4HX4 A;  3CHS A;  3KP3 A;  2EB7 A;  4F92 B;  3J81 K;  4YFX F;  4BUP A;  2O7O A;  5AON A;  3V7C A;  1IRX A;  4IHX A;  4RLF A;  2A05 A;  3TP3 A;  4IX7 A;  1VND A;  2XDV A;  3K2Z A;  1U5T A;  4HAM A;  5GP9 A;  2NVT J;  2GA2 A;  3FUI A;  1TW2 A;  2TDX A;  3DXJ F;  1U8R A;  3FIW A;  5L3B A;  3AKZ A;  1CQT A;  3PO2 J;  1ETK A;  4O5V A;  2K3P A;  1TWA J;  3PUF A;  3DPU A;  2L7F P;  3F8F A;  4ITV A;  2LF7 A;  2KFD A;  1OKR A;  4HLY A;  3T1B A;  1WH5 A;  3FXR A;  1IZ1 A;  1D5Y A;  2EZL A;  3DFG A;  1ULY A;  4HRI A;  3T5X A;  4EV0 A;  4Z2Y A;  3NAR A;  2R7O A;  3QU6 A;  1RR7 A;  5CQE A;  1ZG5 A;  3HUG B;  3LA2 A;  2ZXG A;  3NEU A;  2Y1E A;  2A6E F;  1RUO A;  5D4S A;  2Y31 A;  4LIU A;  3DEU A;  3LA7 A;  1G3Y A;  3VVL A;  4JP0 A;  1H88 C;  1S7O A;  3VVM A;  2Z99 A;  4GDF A;  1BI2 A;  2QZ8 A;  2X51 A;  3OS0 A;  4XN3 A;  1A5J A;  2TRT A;  5JNL A;  5IOZ A;  2QCO A;  1HA8 A;  2STT A;  1ZTR A;  2ISZ A;  2IT0 A;  3K4C A;  1TW3 A;  4TV7 A;  1WCM J;  4LLN A;  1UFM A;  3RKQ A;  3ZMV A;  2H1L A;  1T1R A;  3SDG A;  2BV6 A;  5EZG A;  1APL C;  4NDL A;  3MZY A;  4ZDP A;  5JVT A;  4XO3 A;  2VPR A;  4QIR A;  3H9Q A;  3TW7 A;  2IGN A;  2CQ7 A;  4RAG A;  1T98 A;  3DBH B;  5EJC A;  4L9J A;  4CZZ A;  1G3S A;  4HZF A;  1SAN A;  1Z67 A;  1X2N A;  3DKX A;  3M8E A;  1RC9 A;  1HF0 A;  3GTQ J;  1HC8 A;  1JTY A;  3OYK A;  2UZK A;  4L9T A;  1KA8 A;  2XF7 A;  4RB1 A;  3JRI A;  2HOS A;  2A7O A;  3EUA A;  2ZB9 A;  2JRM A;  4W1U A;  4CCO A;  2WWY A;  3CHO A;  4WF2 A;  1ZGJ A;  1HST A;  4ZQH A;  4BXX J;  2WAQ N;  2O3F A;  2XRO A;  2MH9 A;  3MKW B;  1YJ9 I;  3FUF A;  3CF2 A;  3HOU J;  1T33 A;  5HDG A;  4PVB A;  4XMV A;  1P4A A;  3VSK A;  1DPR A;  3K1N A;  2NRA C;  1I1S A;  4KMU X;  2JN6 A;  3BDD A;  2J5O A;  2VOP A;  2Y1C A;  5EDN A;  1Z3X A;  3CZL A;  4IO9 F;  4I98 B;  5ICF A;  4MO7 A;  4CCJ A;  1R5I D;  5F04 A;  3OIQ A;  3ZQC A;  3WE2 A;  5DUI A;  3L2W A;  2LR8 A;  2K02 A;  2QF7 A;  2HQ5 A;  1ZK8 A;  3AG4 H;  1K78 A;  4LLL A;  1JXS A;  2XPY A;  2BY0 A;  1AHD P;  3S3N A;  3L1P A;  1UHM A;  2HR3 A;  1UG0 A;  2WPG A;  1D0Y A;  4JND A;  3ZMT A;  3ANM A;  5LHI A;  3HOZ J;  3FTV A;  3WU0 A;  2DO7 A;  4DBR A;  5J8C A;  2F5E A;  4CYD A;  3H0G J;  4A3M J;  5E79 C;  2X9D A;  3ABL H;  4ZYE A;  2HWV A;  5E3L A;  3FKJ A;  1E0E A;  3J7A O;  2FSW A;  1HDP A;  2EFW A;  2DFF A;  1U9N A;  1UB9 A;  3FXL A;  2V9P A;  3BZK A;  4ZH4 F;  4RB2 C;  5F1R A;  1BI1 A;  3FHZ A;  2E1M C;  4HSR A;  3RQI A;  4ESB A;  4BE1 A;  3FH7 A;  1ZG1 A;  2BY3 A;  4CCL A;  3H3V K;  3ZHX A;  1YW7 A;  4D0P A;  5IY5 H;  1Z9C A;  2ID3 A;  5FJ8 J;  1GVJ A;  2QM3 A;  2L4M A;  2KHM A;  4DIQ A;  3R6S A;  3HBL A;  3RYP A;  3OYF A;  4NNJ A;  5J1Y A;  5IPA A;  2JVG A;  3O2P E;  4AR9 A;  3OY9 A;  4IPA A;  3PNT A;  2VKD A;  3Q0W A;  5DLL A;  3ELK A;  2RQP A;  5ILS A;  2K86 A;  4A93 J;  1HW1 A;  3FF5 A;  5H6R A;  3ZMD A;  5EG0 B;  3DTK A;  3H5A A;  2EK5 A;  5F08 A;  3OR1 C;  2X1D A;  5IP9 J;  1HOM A;  1Q0L A;  4MS6 A;  4HNT A;  4AVP A;  3CF5 F;  3OMY A;  3JAM K;  5JAZ A;  4V2G A;  1A35 A;  4RBO A;  2X6O A;  3PQJ A;  2D5V A;  1TWG J;  2MW8 A;  4XN0 A;  3SYT A;  3BG6 A;  3HGY A;  3TO9 A;  1PVE A;  3IWF A;  1R58 A;  4QTR A;  3ZPL A;  3DPT A;  1B4A A;  1ETY A;  1BC7 C;  4ZTJ A;  3BTJ A;  1B6A A;  4RGR A;  4ON0 A;  1D8J A;  1D3Y A;  2EZI A;  2RRE A;  1S72 I;  1DDN A;  2KZG A;  1H19 A;  3K70 D;  3IL2 A;  3KYC B;  4QHP A;  2VBY A;  2B9S A;  2MC3 A;  3VYR B;  1FP1 D;  2O03 A;  1Z6T A;  3CCJ I;  4UUS A;  2P7C B;  2R7W A;  4FE4 A;  2VJ5 A;  3OOU A;  1Y6I A;  2OUM A;  5IT3 A;  5D5V B;  1DU6 A;  4XOT A;  3MFK A;  2FFL A;  1IDZ A;  5E3N A;  1J7K A;  1TNT A;  2E7W A;  1OIS A;  3HKZ N;  4CZC A;  2DU9 A;  2FUG 2;  2VN2 A;  3WTW C;  3B2P A;  3NWT A;  2UXN A;  4E6K G;  1ON1 A;  4AR8 A;  5J1U A;  1XSX A;  2BW3 A;  4D5C A;  4PFO A;  2UWM A;  1I27 A;  2K9N A;  2ZJQ F;  2OCC H;  1BR2 A;  5DYF A;  4GRI A;  3DCF A;  1VQM I;  3FUD A;  4R79 A;  3AUA A;  2XAH A;  5HDK A;  2HDC A;  2P4W A;  4GFB A;  4LK0 F;  3K4L A;  1W7P B;  3UNG C;  3O8G A;  1XDS A;  2VL8 A;  4OIN F;  4RB3 C;  3WG7 H;  2LOO A;  1MBE A;  2HQA A;  1LQ1 A;  2NVQ J;  3B3B A;  4G6D A;  1IN5 A;  1HDD C;  1BR4 A;  3K4B A;  1IAW A;  5CVU A;  2E2J J;  3K10 A;  4QUO A;  2ZXJ A;  3DTE A;  1YX3 A;  2NVU B;  1CF7 B;  1UCR A;  1YX5 A;  2ISY A;  2COB A;  3LSP A;  1X1A A;  2ZSI B;  3K1P A;  1PP8 F;  4UB6 C;  1T38 A;  4PUS A;  1B1B A;  2L2O A;  3OYL A;  4RSY A;  5L3G A;  1J75 A;  2QVW A;  1PP7 U;  2E5N A;  2QVO A;  3K6G A;  1QHH D;  3RZD J;  5CVR A;  2QJ1 A;  1YW9 A;  3FUH A;  4KN4 X;  1HQC A;  3SFI A;  3CJQ B;  1G6N A;  2HGC A;  2AXL A;  3ZCO A;  3MKZ A;  3OYJ A;  5FFX A;  2VLA A;  3C18 A;  2DPU A;  5DDG A;  4M9S A;  3KP2 A;  3TDZ C;  1G59 A;  2HXI A;  1WWX A;  2W82 A;  3A01 B;  2KKO A;  4BDZ A;  1P2F A;  2R3S A;  4A3F J;  2V4J C;  2J5P A;  3KE2 A;  5LGU A;  3SDB A;  2NVX J;  3HHH A;  4OU0 A;  3SZP A;  3V8J A;  3B02 A;  1MD0 A;  4HQE A;  2F2E A;  2HFH A;  4CCN A;  4QIW N;  4XMT A;  3KET A;  2E1O A;  2K7L A;  3P9I A;  2Q1Z B;  5D5U B;  2MFZ A;  4YIF A;  2DK8 A;  4G6Q A;  3FXO A;  1J0R A;  3PJR A;  4C3H J;  1R1V A;  2IPQ X;  2LRE A;  3ZP5 A;  1H3L A;  1D0Z A;  4L9V A;  3WGH A;  2L7K A;  3FM3 A;  2XAQ A;  4CCM A;  3LOC A;  4KDP A;  1V4R A;  1WJD A;  4XLP F;  3ZQ7 A;  4I02 A;  1Y8Q B;  2HXO A;  3HPH A;  1XTA A;  2OTJ I;  3EBG A;  2E19 A;  2ZXW H;  3BQZ A;  4CUG A;  4RB0 A;  2PJR A;  3WU2 C;  3VOE A;  5JHF A;  2LF8 A;  2LK2 A;  3BCB A;  3SJM A;  2A5W A;  1R7J A;  3BWG A;  3GZ5 A;  4I99 C;  4ZYA A;  3SFZ A;  4PJM A;  1JI8 A;  2PL5 A;  1ZAO A;  3I59 A;  2LFB A;  4BHC A;  2YR2 A;  3ZQQ A;  2DA4 A;  4EJV A;  3ABK H;  3W3C A;  5FKK A;  2WY8 Q;  2AQF A;  2UUZ A;  2JJ7 A;  4NBQ A;  4X1E A;  1SEU A;  3LQR A;  1U5T C;  2CMP A;  5AIQ A;  5J3L A;  4ANJ A;  1ZGA A;  1VQ4 I;  1VZ0 A;  4WK8 F;  2IA0 A;  5DM7 F;  1USS A;  3BG7 A;  2MLK A;  3B7T A;  3RAS A;  3OYD A;  3VYS B;  1PUE E;  2WB1 A;  4E7Z A;  3VWB A;  4M3B A;  3BQY A;  3LA3 A;  2M2E A;  2DMN A;  2KL4 A;  2VOO A;  3CHR A;  2M3A A;  3R0J A;  1TBX A;  5LD2 C;  2H6B A;  2NOJ B;  3FHE A;  1IJW C;  3CP2 A;  5LHG A;  1MNE A;  2F5V A;  1FWZ A;  2V1X A;  2GBY A;  1OPC A;  2E34 A;  2IBD A;  4MNU A;  4G12 A;  1HW5 A;  3HB9 A;  3S2W A;  1MBK A;  2W84 A;  1AOY A;  2HDW A;  2KIS A;  2BHZ A;  1VTN C;  1F43 A;  4B1R A;  3B2X A;  2AO9 A;  4LOC A;  2YUS A;  1SFE A;  2HU9 A;  3S1N J;  1O3Q A;  2CUF A;  3FBN B;  4IEJ A;  2V1N A;  3EYY A;  2E60 A;  5F0H A;  4O6J A;  1I6H J;  3HTS B;  4DBQ A;  1FYL A;  4IHT A;  3F6V A;  4XLH A;  3EPZ A;  3FBI B;  1MMG A;  5IOY A;  1W36 C;  2CW8 A;  4MIM A;  3E97 A;  3ABT A;  1TL8 A;  1DPU A;  4A0Y A;  5TRD A;  3COA C;  5FKO A;  4CHU A;  1B59 A;  5ICC A;  4IL6 C;  2BBY A;  1LB2 A;  1KQ8 A;  1Z1D A;  1KQ9 A;  1C0W A;  2PMU A;  4CIC A;  4Y13 A;  1X1P A;  1Z91 A;  1FMW A;  3K1M A;  3HRM A;  4DJA A;  3QPL A;  5FRM A;  1XX5 A;  4AUX A;  2PJP A;  1WJC A;  4J01 A;  2R5Z B;  4HF0 A;  2X1E A;  3C7J A;  3MWM A;  4G94 A;  3BY6 A;  2GXG A;  3VB2 A;  4C2M J;  2LH9 A;  1R9T J;  3ANN A;  4EJT A;  2WAQ A;  4IKF A;  3JRG A;  3Q5F A;  2ZJP F;  4OIR F;  2R5Y B;  3RIR A;  3AFH A;  3R61 A;  2E1M B;  3GWZ A;  3HIF A;  5D6F A;  4L0Y B;  1X58 A;  3LMM A;  4U0V A;  3QQA A;  3KP6 A;  2R7F A;  4K5L A;  3FXM A;  2DQL A;  3CMA I;  3GLL A;  3W6K B;  5GTI C;  5GPC A;  3HRU A;  1RI7 A;  1UMQ A;  1WVR A;  4FIS A;  1MBF A;  5LGT A;  3A01 A;  5EV7 A;  1Y1W J;  3E0J B;  4IVN A;  4LG0 A;  1O7L A;  2AXT C;  3OL3 A;  2CUZ A;  3F8M A;  2FEZ A;  4K5M A;  2XGD A;  1LDK B;  2X48 A;  4XN2 A;  4LG0 B;  3E6M A;  1ZH5 A;  1OCO H;  2BY1 A;  1QZY A;  3KLN A;  1WJB A;  1JGS A;  3FXQ A;  1RKT A;  3MKY B;  3DBL B;  1V3F A;  3IV5 A;  4FLQ A;  3SEZ A;  4FCA A;  4K2E A;  4EM1 A;  3ECO A;  1ZRE A;  5HS7 A;  1ZQ3 P;  2ZME A;  4AIJ A;  2RAE A;  2QKL B;  3CCL I;  2IS1 A;  2Z3Y A;  2L54 A;  2F6C A;  4D1Q A;  4GAE A;  2DOD A;  5GAH J;  1D1B A;  2MH2 A;  1HKS A;  3CC4 I;  4FLS A;  4XRM A;  1O3R A;  2G9W A;  4CXF A;  2M9H A;  3H3U A;  4E7L A;  2K85 A;  2EH3 A;  2Q2E A;  2VAS A;  5F64 A;  4XID A;  2HPO A;  3F8B A;  2XHK A;  3GME A;  4Q4Z F;  2L7M P;  2XQ0 A;  3I55 I;  3A4C A;  1Y56 A;  4ZW8 A;  5JVG F;  4FX0 A;  1CGP A;  3ISP A;  3VYU B;  1YFH A;  2JVH A;  3H5N A;  3DLA A;  4FLO A;  3EET A;  2M4G A;  1HS6 A;  5J4V A;  1TWC J;  1LKX A;  3OYE A;  1K7A A;  4J19 A;  2FNP A;  2Y1D A;  1OYY A;  3WOD F;  3UER A;  3CCE I;  3DQV C;  1STZ A;  2DFE A;  4AYB N;  1B72 B;  1R6R A;  2DDB A;  3BPX A;  2O8X A;  1K61 A;  2GM4 A;  2XAF A;  2M0M A;  2Y48 A;  3KEO A;  4XQF A;  2JZY A;  3NRV A;  3L2C A;  4ZQG A;  4HQM A;  1R5H A;  2F5C A;  2W00 A;  3L00 A;  5C44 J;  1T6S A;  3LAP A;  3IIE A;  4EM2 A;  2XAG A;  2BXZ A;  4ZX5 A;  1J09 A;  1GVD A;  3C2G A;  4NC6 A;  2Y1G A;  1W0T A;  4A2U A;  4M3E A;  1ZYR F;  3Q9V A;  3B73 A;  4EJW A;  5LGN A;  2CV1 A;  1Q0Q A;  3KZI C;  2R59 A;  2DAO A;  3R4K A;  1VQP I;  4C2U A;  4HDU A;  4L9N A;  3CMM A;  1YIO A;  2FQ3 A;  3ZHY A;  3CJN A;  3KZZ A;  3OYH A;  2W4S A;  5DV5 A;  4D7M A;  4ZW7 A;  3EYI A;  5D6E A;  1RES A;  2W85 A;  4DGW B;  2X6Y A;  3A0B C;  1I50 J;  4E7S A;  3JSP A;  2FXA A;  1EV7 A;  1N78 A;  4KFC A;  2CRG A;  5EYR A;  5HS9 A;  3TGN A;  1NHA A;  4EMS A;  2VJ4 A;  5JFR A;  2RKH A;  3OS1 A;  4OIO F;  4PSW A;  1W7P D;  1VQ7 I;  3M4O J;  1S5L C;  2E5Z A;  5E20 A;  3K4N A;  2ACJ A;  1PYV A;  5BMZ A;  4XMZ A;  2YPR A;  2XPU A;  2JUG A;  4HLX A;  5F0F A;  3AG3 H;  1ACI A;  1F36 A;  4MEX F;  5FO5 A;  3HKZ A;  1OR7 C;  1F9N A;  4HYE A;  3VFZ A;  4GYI A;  2VUM J;  4A5N A;  2VKV A;  4OWR B;  5BQT A;  3OV8 A;  2DOA A;  4CA0 A;  3I4N J;  2G0E A;  1WGX A;  4G7H F;  3OYG A;  4CH7 A;  2XC7 A;  1TT0 A;  3KIO A;  4KIF A;  3VYT B;  5KNL A;  1X3W A;  2R7Q A;  2K27 A;  4ZX6 A;  3HSE A;  3KED A;  3DEW A;  1V55 H;  2QYO A;  5IP7 J;  3I0T A;  2VQG A;  2LVS A;  1VI0 A;  2DA3 A;  4JK1 X;  5DTD A;  3GTJ J;  3OYC A;  3R0I A;  3J7Z I;  5FRN A;  2DW4 A;  5JR3 A;  1E3P A;  2KRF A;  2BZT A;  4K5P A;  3CCR I;  4B8X A;  1YRN A;  3G1M A;  2F4I A;  3BZ6 A;  1POG A;  3OYN A;  1O4X A;  2JA2 A;  2NS7 A;  2OBP A;  3QAH A;  3R0A A;  2R92 J;  3I53 A;  2P7V B;  2ZNZ A;  3M7G A;  3G4S I;  3HC7 A;  3DF8 A;  3V42 A;  4ABZ A;  1MJB A;  2W57 A;  2L9V A;  1GXQ A;  1B9N A;  4EEF G;  2LY1 A;  4FLR A;  1FYK A;  3LQQ A;  4P5O A;  4AYS A;  1RR8 C;  3A02 A;  3ANL A;  2DMT A;  4BE2 A;  2HVQ A;  3PM1 A;  2VKE A;  3PIO F;  4A3B J;  1SD5 A;  2ME0 A;  4M6X A;  1IF1 A;  4LFU A;  2JRT A;  4QSH A;  3E5X A;  4YEJ A;  3C3W A;  2R5Z A;  2PFB A;  3MN2 A;  2HYJ A;  5HOD A;  1BI0 A;  1FSE A;  1LVK A;  2VC0 A;  2VIX A;  2M5W A;  4GCV A;  5CKT A;  3GX4 X;  3AL0 C;  4RMN A;  1B9M A;  1X3Z B;  2H8W A;  3EUK L;  4RGU A;  4BKX A;  4DYC A;  5BPP A;  3KP7 A;  4NQW B;  4HX7 A;  2JCV A;  1SC7 A;  4UV8 A;  3VOD A;  3PUU A;  1XC5 A;  3L2U A;  2V26 A;  3OYA A;  2EA2 A;  4XLC A;  2NYX A;  2WAD A;  3PO3 J;  2JD1 A;  3FUJ A;  1MIJ A;  2W25 A;  3BPV A;  4RCV A;  2VBW A;  1GT0 C;  2WZG A;  4A3K J;  4B48 A;  3ZQL A;  3T8V A;  1MGT A;  2K9L A;  5FLV A;  1ETX A;  4G9Y A;  4KT6 A;  4MHG A;  1KU9 A;  2KIF A;  4AU7 A;  4O3M A;  3SXY A;  2P8T A;  5J8F A;  5FB2 A;  1NH3 A;  1KU7 A;  2DA6 A;  3A1Y A;  2P6T A;  1WJE A;  3TW6 A;  1H89 C;  4PJJ A;  2ECB A;  4DW6 A;  5J47 A;  3QP5 A;  1TWH J;  5FKM A;  5ILU A;  3ZXS A;  2DBB A;  3IRR A;  5A2Q K;  3K2A A;  1R0L A;  5FLX Z;  4YEL A;  4XSZ F;  3GTL J;  2XGE A;  4HPQ A;  4HEA 2;  1X4P A;  1HLV A;  4HW0 A;  4XKV A;  1MMA A;  2V1D A;  1V5E A;  3PL8 A;  4I7H A;  1JHF A;  3HSR A;  1I1G A;  1W5T A;  5CPR B;  1MW0 A;  4M9X A;  1YG2 A;  1M1E B;  3GF2 A;  4C3I J;  4UV9 A;  3OYM A;  2DA1 A;  2LLK A;  1SC5 A;  3P9C A;  5CVJ A;  2KIU A;  1SG7 A;  4ZW3 A;  3QPS A;  3QYF A;  4XBF A;  2O0Y A;  4X6A J;  2L3D A;  3U1D A;  3CO7 C;  1OQY A;  2ZME B;  1F5T A;  4F7Z A;  1D8K A;  2Y1F A;  1X3U A;  3DEE A;  4II3 A;  2JV7 A;  2V7F A;  2QEN A;  2CUE A;  2LYC A;  5FRO A;  2ZC2 A;  1FMV A;  5B1B H;  4XNF A;  3KEY A;  1S6L A;  1XDU A;  3PNY A;  3FMR A;  4BY1 J;  3EUH C;  1VF9 A;  2N8G A;  2MD5 A;  1GV2 A;  3LFK A;  1LEB A;  3S14 J;  5LLQ A;  1H0M A;  2HPT A;  2EIK H;  2RVC A;  2I5U A;  1MDM B;  2A5Y B;  2M30 A;  2R4G A;  4LMY A;  1QPM A;  5LFA A;  4IZZ A;  2ID6 A;  2K9S A;  1P92 A;  2CQQ A;  5LRR A;  4UVB A;  2LNB A;  1ZAR A;  2RC4 A;  3OOP A;  1A04 A;  5JMP A;  4N4N B;  5HVQ C;  1BA5 A;  1ZRC A;  1R5G A;  3N4M A;  2VOD A;  4A3J J;  2UV1 A;  5IT9 Z;  2IGO A;  1RRJ A;  2ZJ2 A;  2R0Q C;  2DA7 A;  1MMN A;  5FKL A;  1H9G A;  3I9V 2;  1LUJ B;  3O6B B;  4S0H B;  1ONO A;  2OF7 A;  2Y75 A;  1LJ9 A;  3RSN A;  4D7N A;  1Z6R A;  4DOZ A;  3FWE A;  1IRF A;  5L3F A;  3JRE A;  1SFU A;  1MZB A;  1N75 A;  4FX4 A;  9ANT A;  1MH3 A;  4CGZ A;  5L3C A;  2KZV A;  2ZCW A;  2EFO A;  2VBZ A;  4OOI A;  1R1U A;  2FOW A;  4RAF A;  1MJ9 A;  3REO A;  4B44 A;  4G8X A;  3RKX A;  2QSH X;  3L2R A;  4Y7N J;  3CJT B;  1I6X A;  1D5V A;  3GYH X;  1Y0N A;  3BJ6 A;  1GW6 A;  4MTE A;  2MAP A;  3K7A J;  4FQG A;  1ZR4 A;  5EGO B;  2IP2 A;  2WY7 Q;  1T39 A;  4HDV A;  4AYB A;  1ON2 A;  2A69 F;  2BOL A;  2GA1 A;  3ZHZ A;  1FYM A;  1OJL A;  2VT3 A;  3H35 A;  3IRQ A;  2ICW G;  3G1O A;  3J80 K;  3JRA A;  4E7J A;  2A6H F;  3CZ6 A;  1I5Z A;  1UST A;  3HGG A;  2HTJ A;  2PBI A;  2DOF A;  2ECC A;  3WHB A;  3RPU A;  1EH8 A;  3CTA A;  4G7Z F;  4A12 A;  2VB6 A;  3DTI A;  2Z9O A;  3W6J B;  2GXA A;  4BQQ A;  2W48 A;  2HVR A;  4K5O A;  1ZLJ A;  2VC1 A;  3KPH A;  4M3G A;  4FTH A;  2HOT A;  4CYC A;  1BOA A;  3BRO A;  2LTP A;  1IV8 A;  2JSC A;  3S2D J;  3T8T A;  3KP4 A;  1FC3 A;  2WV0 A;  4A69 C;  2HKO A;  3P5J A;  4PJL A;  2L02 A;  2H6C A;  2BVL A;  4CYC B;  2HYF A;  2EGH A;  1ZKG A;  2L0K A;  4AIK A;  3KYD B;  4A6D A;  2JD2 A;  1ERD A;  3VSL A;  2EV5 A;  3Q9S A;  1H8A C;  2Z2S B;  1A31 A;  3RPQ A;  4YRV A;  3ABU A;  2GZW A;  4ZJZ A;  2R7R A;  2Q2E B;  5H6Q A;  2HDD A;  4R5T A;  1I3Q J;  2GOM A;  2JA5 J;  1FP2 A;  2Y69 H;  2RDP A;  1XSV A;  4OIQ F;  2X0L A;  4EAT A;  3SEQ A;  3L09 A;  1QO0 D;  3V7R A;  1YYV A;  3PFY A;  4P9F A;  5EEG A;  3B7S A;  3CUQ B;  2PMZ A;  1EKE A;  1QGP A;  2Z5U A;  2ZFW A;  4H0E A;  4XN7 A;  4S05 A;  1GUU A;  1WHU A;  1TQP A;  3GVA A;  3B7R L;  4ARF A;  1G3T A;  4BAY A;  3QP6 A;  2QBY A;  2LDU A;  2LY9 A;  3PNV A;  3WTX C;  4J00 A;  4XLF A;  2DJI A;  1TNS A;  5KHD A;  3N97 A;  3DLL F;  2LG4 A;  2X6X A;  3R60 A;  1G4D A;  4PK4 A;  1YTY A;  2K9M A;  3W2A A;  5K1Y A;  4FHT A;  3IH4 A;  3LWF A;  2VXZ A;  1UJ8 A;  1W36 D;  4UHT A;  4QLC U;  3CDH A;  4LK1 F;  5BOX A;  1BIA A;  1U6G A;  5GAD J;  1BBY A;  1ZEL A;  2HTS A;  3PSF A;  1GLN A;  2X85 A;  1RUN A;  2R70 A;  2HS5 A;  3RCO A;  3EDP A;  2ME6 A;  3ASO H;  4XIC A;  4JX6 A;  2KJC A;  1Z21 A;  3QOD A;  1WJA A;  2L9R A;  3HEF A;  1PUF B;  3VDX A;  4Q4E A;  2Y0M A;  4UVA A;  3EBH A;  2VON A;  2R7X A;  2L5Q A;  2Y9Y A;  2KRH A;  2K9Q A;  4BJT A;  1I39 A;  3QYB A;  1IN8 A;  3RJP A;  4ENK A;  1YRN B;  1K83 J;  4BJ5 C;  1FOK A;  3CES A;  1P9Q C;  4Y67 A;  3SHF A;  4U0W A;  4XSX F;  2PGG A;  3CHQ A;  1IN6 A;  2MAB A;  2OC6 A;  2DTR A;  4U7D A;  3BR1 A;  1FBQ A;  5DEQ A;  2FMY A;  1VQN I;  1SVL A;  2BYV E;  2DQ6 A;  2HQN A;  4A3G J;  2YSR A;  2DN0 A;  5M5Y J;  3FMQ A;  1TT5 B;  4WCG A;  4MEY F;  2BGC A;  1T1S A;  2XKP A;  2IEK A;  3TOA A;  2F48 A;  2COM A;  4ZDL A;  4E70 A;  2QSG X;  4PU2 A;  5H20 A;  3T0Y A;  4C3J J;  1WSU A;  2KLO A;  3HXL A;  3SZT A;  2CFO A;  1MW7 A;  1XGS A;  4UUV A;  4L2L A;  3E5Q A;  2CUJ A;  2EFN A;  2WAE A;  1FBS A;  3TO6 A;  3KLO A;  1IUY A;  4HNU A;  2NS0 A;  2YX7 A;  3OS2 A;  1G2H A;  2XGX A;  3M8F A;  4ZQT A;  2L9S A;  1JG9 A;  2XRN A;  3DV8 A;  4B47 A;  3QU3 A;  4BYY A;  3FU0 A;  3UKG A;  1FOY A;  1EH7 A;  1SMT A;  5M3F J;  2XSJ C;  4EVI A;  5K7H A;  4IXA A;  2CGP A;  3HPG A;  2E2H J;  2R93 J;  3LSI A;  2JT1 A;  3DU6 A;  3K4J A;  4GO1 A;  1BR1 A;  1QZZ A;  2QQ8 A;  4B3X A;  5DCM B;  3WQS B;  5BS6 A;  2O8K A;  2EFP A;  1U78 A;  4B4C A;  3CZE A;  1GV5 A;  3X2Q H;  3MVP A;  1LDJ A;  5K5R A;  2E7X A;  2ELH A;  1S29 A;  3TMO A;  1FX7 A;  3A14 A;  3MQ0 A;  2MSY A;  2MAO A;  4XND A;  1SFX A;  3I5U A;  4EJU A;  4BNC A;  3A06 A;  1HXD A;  3FHN A;  5F6F A;  1N77 A;  2K4J A;  4W97 A;  4IQJ A;  3M07 A;  1FTT A;  2GTQ A;  3BTI A;  2HOE A;  3LAJ A;  3GTM J;  1VQ5 I;  1D0X A;  3BT9 A;  3D1N I;  3CZG A;  1RKW A;  1R71 A;  1JKP C;  1BL0 A;  2K40 A;  4RAZ A;  3KYL A;  2VE9 A;  3CCS I;  1VQK I;  5BPD A;  4V19 K;  1MVY A;  2IA2 A;  1AKH B;  2FE3 A;  3MZH A;  3S8P A;  2WTE A;  5D8L B;  2VJJ A;  5GTH C;  3D5S C;  4PJN A;  2B63 J;  2AQE A;  2GIV A;  4IQ4 A;  3N05 A;  1O3S A;  2LY2 A;  2BVM A;  2QKM B;  4M72 A;  3JRB A;  3GTK J;  4YFK F;  5KAI C;  3RKW A;  3T8R A;  3FK6 A;  2EWN A;  5DD4 A;  2IS4 A;  4FCY A;  2V1U A;  4PW4 A;  3GCM A;  1IO2 A;  3L9F A;  4XN1 A;  1T0F A;  3P7N A;  4AWX B;  4OMZ A;  2M8G X;  5JI6 A;  5DUK A;  1YS7 A;  4M71 A;  2XPZ A;  4FE7 A;  3EUH A;  1SAX A;  2H1K A;  4L5J A;  2O5R A;  2DYR H;  2EIN H;  2G7H A;  2LKP A;  5J6X A;  3WGI A;  4NQW A;  4NUB A;  4L0Z B;  2DMQ A;  1Z0X A;  2OV7 A;  3ZOB A;  3KX2 A;  2XPW A;  1H9T A;  3QJX A;  2FOK A;  3BR0 A;  2C5Z A;  3S15 J;  3ZGK A;  5GAE J;  3HUG A;  2DMU A;  4XMY A;  4E4H A;  4MQ9 F;  2CQK A;  4U87 A;  3WTS C;  4JX4 A;  4M9Z A;  1AU7 A;  2R7S A;  2HPI A;  3EBI A;  1KQ0 A;  2GIZ A;  3ZMS A;  3G2B A;  4DZP A;  1NG7 A;  1AA7 A;  2O61 A;  2XSD C;  1JUS A;  3M1C A;  1MMS A;  3Q3S A;  1SD7 A;  4PFP A;  2VBX A;  4AM3 A;  5EG0 A;  1R36 A;  3AU9 A;  1ENH A;  3IC7 A;  3CC7 I;  5L3D A;  4Q5S F;  1R00 A;  1U0J A;  2NVY J;  3FZV A;  2ZXI A;  1G8X A;  3RTR A;  5BNG A;  1DUX C;  4Q47 A;  2D45 A;  1QVU A;  4K5N A;  3S93 A;  4CDG A;  3GTP J;  5E1X A;  5JHU A;  3ERM A;  1YLF A;  1W4M A;  2LRD A;  2DFH A;  2LSO A;  3ASN H;  4RA2 A;  4DQ2 A;  4KIT B;  4IOC F;  3CDL A;  2XAJ A;  4XR6 A;  4XOR A;  1Q0H A;  2VXD A;  1U2W A;  3Q0U A;  3HRS A;  4IHY A;  1MBJ A;  2BEO A;  2ZBK A;  4U88 A;  3BLY A;  1X3W B;  1IXR C;  3C1D A;  1Z7L A;  2G7U A;  1MDM A;  2Q0O A;  3D0S A;  3JTG A;  1OCC H;  2JCX A;  3BR3 A;  4XN5 A;  3HTU A;  5J40 A;  2R7V A;  2DJN A;  2E1C A;  2GAU A;  3G71 I;  2V9K A;  4ZW5 A;  3DU5 A;  1OCZ H;  2W24 A;  2GWR A;  4A3I J;  2R72 A;  2UXX A;  1YI2 I;  3CCM I;  5FLX K;  1XSD A;  2CQX A;  1RZ4 A;  5JO0 A;  4QPE A;  2QA4 I;  4X0G A;  1WJ5 A;  3FMS A;  2BXY A;  2CO5 A;  1P4X A;  2R7Z J;  3CHP A;  3S1M J;  4AIH A;  1N25 A;  3TO7 A;  2PLY A;  2DT6 A;  1IDY A;  1Z7U A;  3HYI A;  4J3B A;  1JGG A;  2GOX B;  1EH6 A;  2ESH A;  3M8J A;  1KU2 A;  2V79 A;  1VQ8 I;  4BU2 A;  3GZ6 A;  1OCR H;  4ZYH A;  2LP0 A;  2MD0 A;  5FGM A;  2JD0 A;  1WPK A;  3TED A;  4ZX3 A;  4AR1 A;  3V7S A;  1FJL A;  4E7H A;  2NOG A;  3HHG A;  1EF4 A;  2HVS A;  3CCQ I;  2BHY A;  3F21 A;  1TLH B;  3BG9 A;  4R5V A;  1F1Z A;  4LD5 A;  4D5F A;  3MAJ A;  5JMW A;  3G6E I;  5DUL A;  3H92 A;  4LUP A;  4KN7 X;  4BH9 A;  4BS9 A;  5IYB J;  4H4K C;  3WQR A;  4XKW A;  5FD6 A;  2A3S A;  4A6E A;  3IH3 A;  5E1W A;  2XUB A;  3OSF A;  1FSH A;  3MD2 A;  1O3T A;  1GHC A;  4UXN A;  2Y30 A;  4YFN F;  1W1W E;  3CCU I;  4WXH A;  4E7K A;  1L3L A;  2STW A;  1S7E A;  4NC8 A;  2FQ4 A;  3QPH A;  3HOY J;  2DYS H;  2GQQ A;  3K4M A;  1YIJ I;  5ICE A;  3V8L A;  4XL9 A;  1J2X A;  2CYY A;  3CQZ J;  3TQN A;  1VQO I;  2M45 A;  1YS6 A;  3PFI A;  1XGN A;  1FT9 A;  2LBF A;  4ZYG A;  2KDO A;  4R5X A;  2OA4 A;  1YQA A;  3FUK A;  2HOA A;  2F5F A;  4A0Z A;  1K79 A;  1LVA A;  4WX9 A;  4EJO A;  1F4K A;  3GFL A;  1B8I B;  2PQ8 A;  3IKV A;  5HNH A;  3FUE A;  3E3V A;  4RGS A;  1L0O C;  3Q44 A;  1KU3 A;  5TJJ A;  2YX4 A;  4U0Y A;  4KIG A;  5D5X B;  4UY8 I;  1JKO C;  4Y17 A;  2D1H A;  2VQC A;  3CP8 A;  3HJE A;  4XON A;  4NB5 A;  4RLQ A;  3RC3 A;  5BPI A;  2QQ9 A;  2JA6 J;  3FTX A;  5C4X J;  2MYS A;  4M3F A;  1YHQ I;  1K4T A;  1RET A;  3CUO A;  3LSK A;  4PGG A;  2DTZ A;  2E36 A;  1WH7 A;  5M5X J;  5IYC J;  2QQA A;  3KFW X;  4AVZ A;  1QA6 A;  2P6S A;  4MKT A;  3VPR A;  4M6V A;  4I6Z A;  3FDY A;  3LSH A;  2DT7 B;  1JGI A;  5F0C A;  3ABM H;  1IC8 A;  3F8C A;  4GGG A;  3QWL A;  4IRI A;  4UNO A;  3JSO A;  3JRH A;  2OCE A;  1DP7 P;  3WE3 A;  1ETO A;  1JKQ C;  4RAY A;  2WBM A;  3BC8 A;  4XM3 A;  1ETQ A;  4DYR A;  2YU3 A;  1Z05 A;  2L7Z A;  1BM9 A;  2B7E A;  4AD9 A;  2RNG A;  3A03 A;  1VQL I;  2O7G A;  2IJL A;  4A3C J;  4RM2 A;  5HS8 A;  5GPA A;  2ZKZ A;  5B66 C;  1IRG A;  1OFC X;  1XGO A;  1X1D A;  4S04 A;  1W5C C;  1PJR A;  2DLL A;  2TCT A;  4DZJ A;  1Z3Y A;  1E17 A;  3S1R J;  2IRF G;  2RJI A;  3JRC A;  3CME I;  2RNJ A;  2Y0S A;  1OR7 A;  1U9O A;  2XAU A;  4P9U A;  3RI4 A;  3GUD A;  4II2 A;  3OYB A;  3E6D A;  2PI0 A;  4NC7 A;  3J81 Z;  4M74 A;  3GFI A;  1WI9 A;  2XPV A;  3I54 A;  3FH8 A;  2ZSH B;  4HNV A;  3RQ4 A;  2HQR A;  2Y0S N;  1OLT A;  3U1K A;  5M3M J;  3FUM A;  4QME A;  3JAM Z;  3H36 A;  2DFI A;  1KZH A;  2VT2 A;  3I71 A;  4HBL A;  2ZJR F;  1TWF J;  1VFC A;  1YE9 A;  3TDU C;  2BW3 B;  1YO5 C;  1FPQ A;  2IGK A;  3JT1 A;  1FLI A;  4XN4 A;  5DYM A;  4PJ0 C;  5LEJ A;  2XF6 A;  5E8G A;  2KQR A;  3HM5 A;  1HKQ A;  1Y1V J;  4KIB A;  1RNL A;  2M1B A;  3JRD A;  4G7O F;  2Z1D A;  5EF6 A;  1ORK A;  1ETW A;  1WKM A;  1ZN2 A;  4HST A;  2PMZ N;  3KEQ A;  4XLN F;  3S3O A;  5B5E C;  2DXI A;  3VEP A;  4F91 B;  4U7B A;  3OSG A;  3V4G A;  4OIP F;  4YII A;  3O8H A;  4UUS B;  4PGH A;  1ZGW A;  3K70 C;  2P5K A;  1TC3 C;  1P4W A;  1XS9 A;  4OAY A;  1NK2 P;  5EZH A;  3RKY A;  5FD5 A;  1SD6 A;  3B6C A;  1T08 B;  3AL0 B;  3A0H C;  3ESW B;  3NAU A;  5H2F C;  1WI3 A;  2EIL H;  2L01 A;  4N9H A;  2IS6 A;  3MMY B;  4HF2 A;  4OMY A;  1QU3 A;  3PSI A;  3DKW A;  2EJR A;  1LDD A;  2EZK A;  4M6Y A;  5AEN A;  2CV0 A;  4XMU A;  3QOP A;  1E3H A;  4KJZ A;  2JA8 J;  2R5Y A;  2OAZ A;  4KUM A;  1IW7 F;  5KVR A;  2HPM A;  2K4B A;  5IYD J;  5E8I A;  3EQL F;  5HDN A;  2XKO A;  3IP4 B;  3OWT A;  4ZQE A;  4GAA A;  2EQR A;  2I10 A;  3AG2 H;  3F0C A;  2WV1 A;  1MH4 A;  3Q43 A;  2ZO4 A;  4KP7 A;  4Q4I A;  2RV8 A;  3ZR8 X;  4GYG A;  4YG2 F;  4DNC A;  1RP3 A;  4ENM A;  2YU9 J;  3CO6 C;  3HDD A;  1YOV B;  1AWC A;  1RPW A;  4A5M A;  1BJA A;  2OD5 A;  2XAS A;  4BBS J;  1D1A A;  2KPM A;  5K5O A;  5IP6 A;  4AID A;  1BI3 A;  3ECH A;  3U9G A;  2Q8K A;  5JLX A;  1WJF A;  1R49 A;  1OYI A;  3ZMZ A;  2PX9 A;  2QSF X;  3FTW A;  2MBF A;  1SAU A;  1XG1 A;  5L3E A;  3S16 J;  1MND A;  1KGS A;  1P7I A;  1SVM A;  2CU7 A;  2VQH A;  3HG9 A;  4MLO A;  4BL0 B;  4UVC A;  1KYZ A;  3BR6 A;  3K0L A;  5KK1 A;  4HA8 A;  1JKR C;  3HW2 A;  2FBK A;  4XLE A;  1ONV A;  1R4N B;  4PZJ A;  4LIT A;  1MJA A;  2E2I J;  3B6A A;  1MNM C;  1U5T B;  2R7D A;  3F23 A;  4IRH A;  4QPQ A;  2DQR A;  2QBY B;  1JHH A;  1MMD A;  3CXB A;  5CJ9 A;  3RDI A;  4I2O A;  4N4O B;  5DCM A;  4RM3 A;  4IOA F;  2HNH A;  1JJ6 C;  2ETH A;  1LPQ A;  1XCV A;  2PN6 A;  2QEX I;  3GFJ A;  4Y4R A;  3QRF F;  5DD8 A;  3FTS A;  3LST A;  4CO8 A;  3U2R A;  4XO4 A;  1ZRF A;  3WU1 B;  2E1N A;  4AC0 A;  2MLG A;  2LMD A;  2CS3 A;  2ZFU A;  4XKB A;  3L7W A;  2FBH A;  3CJR B;  1AKH A;  1Z77 A;  3I64 A;  2KMU A;  4CCK A;  4Y52 J;  3GXO A;  3FU3 A;  4WXC A;  1S9H A;  1Y8R B;  2JSP A;  2ZME C;  5D4R A; 
#chains in the Genus database with same CATH homology
 4D1Q A;  4GAE A;  4LIU A;  3FU0 A;  1D1B A;  3DKY A;  3VVL A;  4F55 A;  2XSJ C;  3CIA A;  4BE0 A;  3VVM A;  4FLS A;  2M4K A;  3HPG A;  2X51 A;  3LSI A;  3OS0 A;  3K4J A;  3DU6 A;  1KON A;  4OAZ A;  1BR1 A;  4XN3 A;  4B3X A;  4E7L A;  5JNL A;  3WQS B;  2VAS A;  2HPO A;  1HA8 A;  3CZE A;  4ZX4 A;  2XQ0 A;  2X6W A;  3A4C A;  4F93 B;  1Y56 A;  4ZW8 A;  3K4C A;  3TMO A;  3HOS A;  4A03 A;  3A14 A;  5JC1 A;  3VYU B;  2JVH A;  3H5N A;  3DLA A;  1T0F C;  2MAO A;  4FLO A;  4XND A;  2VPL A;  1T1R A;  2M7A A;  2PUS A;  2M4G A;  1HS6 A;  3A06 A;  1LKX A;  3FHN A;  3OYE A;  4ZDP A;  1N77 A;  4IQJ A;  4XO3 A;  2Y1D A;  4D9J A;  3UER A;  4QIR A;  4XKC A;  2GTQ A;  3DQV C;  3H9Q A;  1D0X A;  2IGN A;  4JOM A;  3JSZ A;  3CZG A;  1R6R A;  4LG3 A;  3KYL A;  1MVY A;  2M0M A;  4AIC A;  3DKX A;  4XQF A;  3QYE A;  2MC4 A;  3S8P A;  1ONN A;  4ZQG A;  2W00 A;  2VJJ A;  3HL2 A;  3D5S C;  4PJN A;  3IIE A;  3FTZ A;  2A6T A;  2AQE A;  4IQ4 A;  2B61 A;  3N05 A;  2LY2 A;  2BVM A;  3OYK A;  2QKM B;  4ZX5 A;  1J09 A;  3C2G A;  5TGT A;  2XF7 A;  2Y1G A;  2A7O A;  3EUA A;  3CHO A;  4CCO A;  2CV1 A;  4OOE A;  2IS4 A;  1Q0Q A;  1QHG A;  3E1S A;  2R59 A;  4PW4 A;  4C2U A;  4ZQH A;  4XN1 A;  3MKW B;  3CMM A;  3FUF A;  3ZHY A;  3B37 A;  3CF2 A;  4PVB A;  3OYH A;  2W4S A;  4XMV A;  2XPZ A;  3H5R A;  4ZW7 A;  3TBI A;  3VSK A;  3QOE A;  2LBF B;  4DGW B;  2KRC A;  3WQQ A;  2X6Y A;  2O5R A;  4E7S A;  3GBG A;  2Y1C A;  4XMX A;  1N78 A;  1Z3X A;  3CZL A;  4NQW A;  4NUB A;  4CCJ A;  4C30 A;  4BGD A;  2OV7 A;  2VJ4 A;  3KX2 A;  3D5R C;  3OIQ A;  3OS1 A;  4PSW A;  4B43 A;  3QJX A;  2C5Z A;  3L2W A;  4XMW A;  4ZC3 A;  3ZGK A;  2E5Z A;  1K6Y A;  2RQQ A;  3K4N A;  1PYV A;  4XMY A;  4E4H A;  4XMZ A;  1DGW Y;  4HG2 A;  2XPY A;  4U87 A;  3FUL A;  2R7S A;  4ZN6 A;  2JUG A;  2HPI A;  3EBI A;  3S3N A;  3HKZ A;  3G2B A;  1OR7 C;  1NG7 A;  1UG0 A;  1AA7 A;  3LSM A;  1K5H A;  2W1O A;  4OWR B;  2DQM A;  2WPG A;  2DOA A;  3M1C A;  4CA0 A;  1D0Y A;  3W2V A;  4JND A;  3RC8 A;  1X1C A;  4CH7 A;  3OYG A;  2XC7 A;  3ANM A;  3FTV A;  4PFP A;  4DBR A;  3W2W A;  1TT0 A;  3VYT B;  5KNL A;  1X3W A;  3AU9 A;  2R7Q A;  4ZX6 A;  1U0J A;  3KED A;  2ZXI A;  1BOB A;  1ZS2 A;  1G8X A;  3FKJ A;  3RTR A;  1E0E A;  4C2T A;  2VQG A;  3R0I A;  3OYC A;  5FRN A;  2VKH A;  1V5F A;  4K5N A;  2R7T A;  3S93 A;  4ZW6 A;  2HZD A;  3OR2 C;  5KCM A;  4ZQF A;  4K5P A;  2E1M C;  4HSR A;  3OYN A;  2F4I A;  2LRD A;  4KIT B;  2JA2 A;  4BE1 A;  3FH7 A;  4CCL A;  4XOR A;  4Y6R A;  4XR6 A;  2WA0 A;  2VXD A;  1Q0H A;  3ZHX A;  1DGR M;  4Y6S A;  3BLY A;  3HC7 A;  3V42 A;  1Z7L A;  2KHM A;  4BXF A;  4DIQ A;  3FTY A;  1UEL B;  2ZXH A;  3OYF A;  2JCX A;  2LY1 A;  4FLR A;  4P5O A;  4NNJ A;  4XN5 A;  4AYS A;  2JVG A;  3ANL A;  2R7V A;  4BE2 A;  4AR9 A;  3B7U X;  2ELJ A;  2HVQ A;  3OY9 A;  4E7I A;  4Y3O A;  3PNT A;  2VKD A;  5DLL A;  4XN9 A;  4YEJ A;  2CV2 A;  2V9K A;  4ZW5 A;  3LL7 A;  3DU5 A;  2R72 A;  3DTK A;  3H5A A;  3UCQ A;  3OR1 C;  2X1D A;  1LVK A;  2VIX A;  1Q0L A;  4MS6 A;  4HNT A;  5CKT A;  3OMY A;  3AL0 C;  3PUB A;  4RMN A;  5JAZ A;  5JO0 A;  4QPE A;  4X0G A;  1WJ5 A;  3EUK L;  4BKX A;  4XN0 A;  3SYT A;  3BG6 A;  5BPP A;  4NQW B;  3CHP A;  2JCV A;  4XNA A;  1X4O A;  2XF5 A;  3DPT A;  3H0D A;  2DT6 A;  3PUU A;  3L2U A;  3B34 A;  2V26 A;  3OYA A;  4ZTJ A;  4J3B A;  2GOX B;  4XLC A;  2WAD A;  4BAC A;  2JD1 A;  3FUJ A;  3UR3 C;  2I8D A;  1X19 A;  4BDY A;  3M8J A;  2RRE A;  4RCV A;  3ZRG A;  1H19 A;  3K70 D;  4BU2 A;  4QHP A;  2WZG A;  4B48 A;  1NG6 A;  2MD0 A;  3VYR B;  3T8V A;  2K9L A;  2JD0 A;  2R7W A;  1X3Z A;  4KIS A;  4ZX3 A;  2VJ5 A;  1DP3 A;  3OOU A;  4KT6 A;  4AU7 A;  4AR1 A;  4E7H A;  1Y6I A;  2OUM A;  1D1C A;  4XOT A;  2HVS A;  2FFL A;  4XO5 A;  3A1Y A;  1WJE A;  4PJJ A;  4CZC A;  4R5V A;  2FUG 2;  3B2P A;  3ZXS A;  2IXS A;  3NWT A;  1R0L A;  4E6K G;  4AR8 A;  5JMW A;  4YEL A;  3FUN A;  4RVB A;  5DUL A;  2BW3 A;  2IGM A;  5JBI A;  3OYI A;  4PFO A;  4LUP A;  2UWM A;  4HPQ A;  3K4K A;  4BS9 A;  4HEA 2;  1X4P A;  1BR2 A;  4H4K C;  5DYF A;  4XKW A;  4XKV A;  4GRI A;  3S32 A;  1MMA A;  2WZF A;  3WQR A;  1V5E A;  3FUD A;  3MD2 A;  3PL8 A;  4R79 A;  3AUA A;  4F52 A;  5CPR B;  1MW0 A;  2DCE A;  3K4L A;  4E7K A;  3UNG C;  4NC8 A;  3OYM A;  2VL8 A;  1SC5 A;  2LOO A;  3K4M A;  3J7A Y;  2HQA A;  1SG7 A;  3B3B A;  1DQU A;  4ZTF A;  4ZW3 A;  4XL9 A;  4C9Y A;  3ZI0 A;  1BR4 A;  3QYF A;  3K4B A;  5HLT A;  2LBF A;  2Y1F A;  3DWL E;  2KDO A;  3ONQ A;  4R5X A;  1SQM A;  2L9N A;  3DEE A;  3FUK A;  3K10 A;  4II3 A;  2JV7 A;  2V7F A;  4P1W A;  4QUO A;  2LYC A;  5FRO A;  3NWS A;  1FMV A;  3DTE A;  4XNF A;  1YX3 A;  3KEY A;  3PNY A;  5HNH A;  3FUE A;  1YX5 A;  3S3M A;  3EUH C;  3TL4 X;  3L2V A;  3CZK A;  1X1A A;  2ZSI B;  1WFX A;  3Q44 A;  4G6T B;  4XLA A;  3HOT A;  4PUS A;  2HPT A;  2L2O A;  3OYL A;  4RSY A;  2QVW A;  2R4G A;  2VQC A;  4IZZ A;  2E5N A;  3CP8 A;  5LFA A;  3BCA A;  3K6G A;  4XON A;  1QHH D;  4RLQ A;  3RC3 A;  4ZDO A;  2QJ1 A;  2LC2 A;  3FTX A;  3D5L A;  3FUH A;  5JMP A;  4N4N B;  2MYS A;  3CJQ B;  5HVQ C;  3F9K A;  3LSK A;  4FET A;  3ZCO A;  2UV1 A;  3MKZ A;  2IGO A;  3OYJ A;  1LFP A;  2VLA A;  1V5G A;  4AVZ A;  1MW2 A;  4BEH B;  1MMN A;  4MKT A;  1G59 A;  4R7L A;  4XN8 A;  2W82 A;  3FDY A;  3I9V 2;  3LSH A;  4BDZ A;  2DT7 B;  2Z16 A;  1JGI A;  1ONO A;  2VJ8 A;  2V4J C;  2JCY A;  3RSN A;  4DOZ A;  3SDB A;  4BQN A;  2M7B A;  2WBM A;  2WAF A;  1N75 A;  3BC8 A;  4XM3 A;  2KZV A;  4CCN A;  3U9W A;  4XMT A;  2C82 A;  2Q1Z B;  2RNG A;  1R0K A;  2O7G A;  4LIV A;  4RM2 A;  2MFZ A;  4B44 A;  1X1D A;  3L2R A;  3PJR A;  1PJR A;  1S46 A;  2LRE A;  1H3L A;  1UAA A;  3IAM 2;  1D0Z A;  1Z3Y A;  2L7K A;  1GW6 A;  2MAP A;  4CCM A;  2RJI A;  4CXF A;  2WY7 Q;  4AYB A;  4OOF A;  1WJD A;  2BOL A;  2Y0S A;  1OR7 A;  2XAU A;  3ZHZ A;  4II2 A;  3OYB A;  3H35 A;  3IUO A;  3HPH A;  3FTU A;  4NC7 A;  3EBG A;  3I3L A;  1MW1 A;  4CUG A;  4E7J A;  2PJR A;  5JHF A;  3FH8 A;  3BCB A;  2ZSH B;  3CZ6 A;  2A5W A;  3RQ4 A;  2X1C A;  4ZYA A;  2KP6 A;  4PJM A;  1OLT A;  3RPU D;  1JI8 A;  2PL5 A;  3FUM A;  4QME A;  3ZQQ A;  2P0W A;  3W3C A;  1YE9 A;  2VB6 A;  3C2H A;  2BW3 B;  3DTI A;  3LFU A;  2WY8 Q;  3DPL C;  2AQF A;  2IGK A;  2UUZ A;  4XOP A;  4BQQ A;  4F3Q A;  2HVR A;  1G5A A;  3JT1 A;  4XN4 A;  5FWQ A;  4K5O A;  2XF6 A;  2KQR A;  5CQG A;  2PJR B;  2CMP A;  2Z1D A;  3OL4 A;  3SZG A;  4ANJ A;  1ONP A;  1VZ0 A;  4HST A;  3S3O A;  2DXI A;  3BG7 A;  3B7T A;  3RAS A;  4F91 B;  4U7B A;  4PJL A;  3FU6 A;  2BVL A;  2CH0 A;  3OYD A;  2EGH A;  3VYS B;  3IAS 2;  2WB1 A;  4E7Z A;  3VWB A;  4BQO A;  3K70 C;  2JD2 A;  1ERD A;  2KL4 A;  3VSL A;  3CHR A;  4OAY A;  2M3A A;  5LD2 C;  2Z2S B;  2NOJ B;  3U21 A;  3FHE A;  4PSX A;  3CP2 A;  4Y33 A;  4YRV A;  3LSG A;  4ZJZ A;  1MNE A;  2F5V A;  2R7R A;  2Q2E B;  3AL0 B;  4CSW A;  4R5T A;  2IS6 A;  2GOM A;  3MMY B;  1QU3 A;  2HDW A;  3PSI A;  5HOO A;  5AEN A;  3B2X A;  2CV0 A;  4EAT A;  3UEQ A;  4XMU A;  3SEQ A;  2HU9 A;  4BJ6 C;  1X1B A;  4X2U A;  4KJZ A;  2V6E A;  3PFY A;  3FBN B;  2HPM A;  3A2K A;  4QPO A;  3B7S A;  2V1N A;  2PMZ A;  1T95 A;  4XN7 A;  2E60 A;  4FAS D;  2W7N A;  3L2Q A;  2R7U A;  3B7R L;  4DBQ A;  4ARF A;  3IP4 B;  1JVS A;  4JQF A;  3OWT A;  4ZQE A;  2CW7 A;  4XLH A;  3PNV A;  4J00 A;  3EPZ A;  4GAA A;  3FBI B;  1MMG A;  4XLF A;  2DJI A;  5KHD A;  1W36 C;  2CW8 A;  4Y6P A;  1EA3 A;  2LG4 A;  2X6X A;  3Q43 A;  3H9J A;  4KP7 A;  4Q4I A;  3ZR8 X;  2K5C A;  4PK4 A;  1RP3 A;  4DPR A;  2K9M A;  3W2A A;  2VXZ A;  1W36 D;  1MW3 A;  2IS2 A;  1D1A A;  2KPM A;  2VQL A;  3FH5 A;  1ZEL A;  1FMW A;  3PSF A;  4DJA A;  1GLN A;  1WJF A;  2X85 A;  3AU8 A;  4BEH A;  5FRM A;  2R70 A;  1TZL A;  3RCO A;  3FTW A;  1SAU A;  1WJC A;  4J01 A;  1MND A;  1Z21 A;  2VQH A;  3HG9 A;  4MLO A;  3QOD A;  1WJA A;  4BL0 B;  5HNF A;  2X1E A;  3OIP A;  3VDX A;  4Q4E A;  3EBH A;  2LH9 A;  3ANN A;  3H9G A;  2R7X A;  2L5Q A;  2VJI A;  2KRH A;  2WAQ A;  4BJT A;  4IKF A;  3QYB A;  4XLE A;  4LIT A;  4BJ5 C;  3FU5 A;  3AFH A;  3CES A;  1P9Q C;  4XNB A;  2E1M B;  4Y67 A;  4QPQ A;  3LMM A;  1MMD A;  2PGG A;  3CHQ A;  2MAB A;  2OC6 A;  4N4O B;  4K5L A;  4RM3 A;  2HNH A;  1SFK A;  5EV7 A;  3CHS A;  2DQ6 A;  3E0J B;  4F92 B;  3OL3 A;  4BUP A;  4Y4R A;  2CUZ A;  4K5M A;  1IRX A;  4RLF A;  3FTS A;  1LDK B;  4IX7 A;  2XDV A;  1T1S A;  4XN2 A;  4ZDL A;  4XO4 A;  3FUI A;  1WJB A;  4PU2 A;  3AKZ A;  3T0Y A;  3MKY B;  2CS3 A;  2ZFU A;  3HXL A;  2KLO A;  2K3P A;  4XKB A;  3DPU A;  2CFO A;  1MW7 A;  3CJR B;  3SEZ A;  4FCA A;  4ITV A;  4FLQ A;  4L2L A;  2CUJ A;  2KMU A;  2WAE A;  4CCK A;  3FU3 A;  4HNU A;  3OS2 A;  1S9H A;  4HRI A;  2R7O A;  5CQE A;  2JSP A;  2QKL B;  2L9S A;  1JG9 A;  4ZQT A;  3HUG B;  2IS1 A;  2ZXG A;  4B47 A;  2Y1E A;  2F6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...