5HNHA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
279
structure length
279
Chain Sequence
b'NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 107
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnhA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnhA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hnhA02
2VLAA 5HNHA 5HLTA 5HNFA
chains in the Genus database with same CATH superfamily
3MMYB 3WQSB 3MZ8A 1VQ5I 3S3MA 4P5OA 2Y75A 4E6KG 1ZREA 2L7ZA 5FB2A 3BCAA 1T2KA 3F23A 1IDYA 4YG2F 5JHFA 3A1YA 5F27A 2XGEA 2GIZA 3NWSA 1SFKA 1MIJA 1ZKGA 1VF9A 2HTJA 2E1CA 1S8NA 3VVLA 4IRIA 5EDNA 2G0EA 3EYIA 3AU9A 1P7IA 3TKYA 1YFHA 3HEFA 1QZEA 3CCSI 3JRDA 3WU1B 4CO8A 3JRCA 5J4VA 1QVUA 1TP4A 1MSEC 1PVEA 1X1CA 4IQ4A 1FLIA 2L9VA 3S15J 3BG9A 3H3UA 2IEKA 2R5YB 4ZW7A 5AIPA 2EPFA 2MW8A 2K02A 3CUOA 3BR0A 4CH7A 1IF1A 1OLTA 1XB4A 2ME0A 3M8JA 2R5YA 4LG3A 2OTJI 1ZRDA 3FTYA 4ZW6A 1R5ID 2NS7A 2BXZA 2M7BA 2CW7A 1ETOA 2HOSA 1FMWA 2WAEA 3IWZA 2HFHA 3CCJI 1CGPA 3U2RA 5L3BA 2CYYA 2PMZA 3ZHYA 3A0BC 2KFDA 1LFUP 2Q0OA 4PJMA 4AYSA 2FBHA 2K9QA 4F7ZA 2KP6A 2ME6A 1R36A 3I71A 5EG0A 1YJ9I 1GLNA 5CQEA 3AL0C 1EJ9A 2LG4A 5D5VB 3DTIA 4LMYA 3WU0A 2VBWA 3FTUA 2CUFA 3W6KB 3GTOJ 4MQVA 2R7VA 4A3KJ 4XMVA 4HOBA 4B3XA 3KIOA 1HW1A 2QJ1A 4P9FA 4XN3A 4HF0A 4XNDA 1MNEA 4RM3A 5JLXA 3E6BA 3H0GJ 2FSWA 3CF2A 3PUBA 3IC7A 4WXHA 4Y13A 3D5LA 3H9GA 2VXDA 5JVTA 5E3MA 2XRLA 2K4JA 4KA4A 2QM3A 3JRBA 1TNTA 4A3CJ 2L7FP 3COAC 2OQGA 1YX5A 2DW4A 2PMZN 4Y33A 2W85A 2DYSH 4LUPA 2X1DA 3GXOA 2QQAA 2ZMEC 3Q5FA 1ZH5A 3CHSA 4A12A 3I56I 1XMKA 1PP8F 3K4BA 4KMUX 4AR1A 2E1OA 3T1BA 2KMUA 4MO7A 4NQWB 1BN5A 2XDVA 3AKZA 3H0DA 3PNYA 4BXUA 1YHQI 4L9NA 2E2JJ 1F5TA 1EV7A 1GV2A 2Y31A 4NQWA 4XBFA 3IRRA 1LUJB 4WCGA 3B02A 2ZXGA 4QUOA 4UV8A 2ZSHB 2Q8KA 3HPHA 1A36A 4E7JA 1FT9A 1K61A 3M8FA 1MBJA 3J7AY 3HOXJ 1OCZH 1XGNA 2BEOA 2L0KA 2IA2A 4E7ZA 4OAYA 3QWLA 3D5SC 1ZR2A 3FTWA 3BQYA 2EH3A 4U7DA 3K69A 4XN2A 2M3AA 1I5ZA 5KHDA 3BZKA 2L02A 4BU2A 4HLYA 1TT5B 3X2QH 3CCLI 3UERA 2DOEA 4FX0A 2OD5A 1ZELA 4L9TA 2W7NA 3CHRA 3DBHB 4EGZA 2DOFA 3TEDA 3N97A 4XLPF 4K5NA 4CXFA 2BE5F 3RC3A 3DWLE 2JZYA 4M3DA 1WJCA 4AIDA 5F6FA 4M3GA 2E19A 2KIQA 2OTLI 4RAGA 2E1MB 4RCVA 1FYKA 4IOCF 4A0YA 2JCXA 2XAHA 3LQQA 3MQ0A 3ULQB 4IX7A 2JD2A 1TT0A 3V4GA 5LEJA 2DQLA 2DCEA 4D7MA 3OIPA 3CJRB 3E0JB 1XG1A 3WHBA 1C0WA 3ABLH 4MEXF 1EH6A 4JX6A 3FU5A 5EYRA 2QSHX 4RVBA 3RCOA 2LKSA 4M6VA 4N4NB 1AOYA 3G3ZA 4YIFA 5TGTA 2VC1A 4DNCA 1TWHJ 4KITB 1SFXA 4Q5SF 1TL8A 3GZ5A 4D1QA 3DPLC 1D8KA 2IJLA 3BTCA 4PDKA 2F4MB 5J3LA 1UG0A 2X4HA 3WTZA 2MFZA 2LSOA 4Y3OA 2PMHA 2RQPA 3E97A 2QCOA 1WKMA 2Z16A 3HUGB 1BJAA 2IAIA 2HVQA 1ZS2A 1NG7A 1NHAA 4JBAA 5F04A 1SANA 2XAJA 2IGMA 1MBFA 1TQIA 4WF2A 2JA6J 3CCMI 1X3ZB 4XLCA 1HXDA 1IN5A 1MBHA 2V6EA 2XVCA 4M72A 6PAXA 3I58A 5CVVA 1PDNC 1X3ZA 3H9JA 2VT2A 4B1RA 1KU9A 3K2AA 3RKXA 5LHIA 1U9OA 3ZRGA 4PGGA 4HX4A 4ENMA 3P5JA 3W6VA 2CV0A 4CCNA 3GTGJ 3FTXA 1HW2A 1OR7C 4Q4IA 2H94A 3LL7A 2FE3A 4BE2A 5F0FA 2WY7Q 2LVSA 2RV8A 3R4KA 1IG7A 3G2BA 2W48A 3QPHA 5DCMA 1IO2A 2R7XA 1W7PD 4GAAA 4OOEA 2VJ8A 5EF6A 5DYMA 4DBQA 3FH5A 4CYCB 2OC6A 2W24A 1LNWA 3M8EA 1X1BA 3B2XA 1W36C 2DQ6A 3GO5A 4E7HA 2O6GE 1Z7LA 2FX0A 3ERED 2KIMA 4DYRA 2HXIA 2VBYA 1BBYA 2B0LA 3C2HA 2O3FA 3I5UA 4FX4A 2IW5A 4NBQA 3SFIA 2DOAA 3J7ZI 1AKHA 5B66C 3CJNA 5EZHA 2E7WA 3BP8A 1W1WE 2MA3A 4XLHA 3HSFA 1TWAJ 2RC4A 1Z9CA 5A2QZ 3LSKA 2RQQA 3KP7A 4Y7NJ 3I64A 4C2TA 1XDSA 1DQUA 2A6TA 2A3SA 2STTA 1ETWA 4JOMA 2H6BA 3F8BA 3GZ6A 3HOVJ 3H92A 4X1EA 3C7JA 3VSLA 1ON2A 1KONA 5DD8A 2L4AA 2DK8A 3GTJJ 1X2MA 1TWGJ 2Q2EB 4U87A 4XKWA 4EATA 2E71A 1SAUA 1VQMI 1BOBA 1T98A 4EM1A 2VASA 2JSPA 5KAIC 1O7FA 1SMTA 1MJAA 4P1WA 3BZ6A 3KX2A 1QO0D 4G6TB 5B3SH 3OYHA 1DPRA 4KNYA 1W7PB 1WVRA 3PFIA 1S5LC 3Q43A 2KLOA 1R1VA 3O8GA 3RYRA 5H20A 5J4YA 3F8MA 4IHXA 2DJNA 3T8VA 3CUQC 4XO3A 4BDYA 2WWYA 2VOPA 4CUGA 4IJAA 3BROA 2JVGA 3FXUA 3Q9SA 4LLNA 5HLIA 4WWCA 1D8JA 3DBLB 3ZQFA 3A06A 2KQRA 3HSRA 3CCUI 4ZDOA 2M8EA 5LD2C 4BXFA 4BBRJ 1LPQA 5F0HA 4ESFA 3G1OA 1J5YA 2VN2A 2VKVA 2ZCWA 2JSCA 3HB9A 3WHCA 4YRVA 3JRFA 1QU3A 3VYUB 1P7JA 1E0EA 2V9PA 1J0RA 1JKOC 2FEZA 1GXQA 5K7HA 2JJ7A 1SD6A 4ON0A 4RSYA 1PUFB 1RZ4A 3IH4A 1HKTA 3V7CA 1R22A 1KU7A 4Y6PA 1WJDA 4XLEA 1V4RA 3HOSA 1PUFA 4ENKA 3TO9A 4GCVA 3FUMA 1ULYA 1RR8C 4XMTA 2KDZA 4PFOA 4D0PA 4G12A 2RAEA 3OR1C 4QPOA 1V5GA 1FJLA 2P81A 2A07F 5IOZA 1WGXA 2X48A 1ACIA 2PL5A 1IXCA 5IYCJ 2M1BA 3HRUA 3JREA 3QRFF 2OA4A 1FTTA 3MVPA 1D0YA 1MSFC 4G9YA 1RKWA 1XS9A 5JFRA 4NNJA 2NVXJ 1G2HA 2CUEA 2R4GA 1HCRA 3BWGA 1I39A 1XPXA 1A31A 2GWRA 2EWNA 4FISA 4MTDA 2LF8A 2VJIA 2B7EA 1MMNA 3VB2A 9ANTA 2ZBKA 1B9NA 5AIQA 1S7OA 2VJ5A 3ELKA 1ZGAA 5ICCA 3N05A 3KCCA 4KN7X 2WPGA 5FRNA 4EM2A 4RAFA 3LSJA 4FE7A 2F5DA 1O3TA 2C6YA 5EEAA 1JKQC 2M2EA 3CCYA 5D6EA 3F22A 2F4IA 1TQPA 2NS8A 4ZZDA 1GHCA 2HQNA 1MW1A 3K1NA 5JAZA 2VKDA 3L2WA 3VFZA 5LGNA 4MGRA 1HDPA 2YU9J 4E70A 1NK2P 1SC5A 1FIAA 4IRHA 4NC6A 1WHUA 3IKVA 2HVRA 4B43A 3VVMA 2GAUA 2XB0X 3FXQA 4F92B 2COBA 4UUSB 4BY7J 2M8GX 1X1DA 1G8XA 4ZX3A 1I3QJ 5FD6A 2QQBA 5DEQA 4B8XA 4M3FA 1R23A 3OSFA 2I8DA 4UUSA 2TCTA 3TOBA 3JSOA 2Y0SA 4CCMA 1A35A 4BE0A 5IT9Z 3OS2A 1UFMA 4PGHA 1SEUA 1XMAA 3GCMA 5CVUA 5JC1A 1U5TC 2Z1DA 5H6QA 4A3JJ 5K5RA 3TP3A 4CZCA 2IS2A 2L4MA 5LEKA 4UB6C 3B2PA 3M4OJ 3KZZA 1QPMA 4F91B 3S3NA 3I59B 1XCBA 1SMYF 2DPUA 1OKRA 1ZRCA 1ZG1A 1MMDA 4R79A 2RNJA 2RN7A 4IZZA 3B7SA 2R7FA 3OIOA 3BG3A 5F08A 1Z67A 5K7ZA 3C1DA 2A68F 3FBNB 2HOEA 4MQ9F 2OCEA 1QVTA 3FXKA 3NEUA 4HQMA 5D5WB 3BPXA 2JPCA 3LOCA 2E5NA 1B8IA 4X6AJ 2LR8A 5E8IA 4CHUA 4PK4A 2IS4A 4N4OB 3H3VK 4GGGA 3B73A 3GEZA 1FOXA 4EMSA 1RESA 2Y0SN 3OL3A 1AHDP 4JQFA 2HR3A 3H5AA 4HAMA 2FQ4A 3LFUA 2W84A 4M9XA 5HS7A 2R7OA 3S14J 3JCUC 3JR9A 2H27A 2YX4A 2NOGA 2P0WA 1MW3A 2VT3A 2XAFA 2XV4S 3ZHXA 2LF7A 4AICA 1NG6A 3H5RA 2QUFA 1V3FA 2BY1A 3DTEA 1USTA 2K40A 2Z3YA 3I4NJ 3Q44A 3KP4A 2XAQA 1P4AA 3OYJA 2JV7A 1GUUA 1R5GA 2AHQA 4FCYA 4ZW5A 3F8FA 1OYIA 4HX8A 3TW6A 4WK8F 1LDJA 4HSRA 3HGGA 3B7UX 3FX3A 5L3FA 4FTHA 4I2OA 3FHEA 2KJCA 1MZBA 1O7LA 2BW3B 1MH4A 3BJ6A 4LLGF 1JUMA 3DEWA 3ONQA 2XPWA 3M07A 2E2IJ 4M9ZA 1OFCX 4XRSA 4C3HJ 4EGYA 5D6FA 2XPVA 4Q48A 1MNMC 2DT6A 2UXXA 2BHYA 3DKXA 1D0ZA 4IRGA 3SEZA 5J8CA 2PQ8A 2XGXA 3DLAA 1V5EA 2IPQX 1XTAA 2LK2A 1DGRM 3CHQA 5FKOA 2BHZA 1IZ1A 1WPKA 1RI7A 4BEHB 4XMYA 4MFEA 3BTLA 4PJLA 2K4BA 3TQNA 4BGDA 2XSDC 3SHFA 5DD4A 4ASNA 1ENHA 4BEHA 3GFLA 3ABMH 3HXLA 1K6OA 3FKIJ 4RB2C 4FCAA 3CDHA 5GP9A 5LHGA 3Q3SA 1HBXG 3OYFA 3Q0UA 2GOMA 3GFJA 4N0BA 1QRYA 4V2GA 3ZMTA 4AUXA 1Q1VA 4AWXB 1Q1HA 3CESA 4C30A 4XNAA 3G71I 5BPIA 3FXLA 1U9NA 2A7OA 3FUNA 3CD6I 3ZI0A 4RB3C 3HKZA 4XN5A 3FWEA 2DA7A 1ZLKA 2JK3A 4ZZLA 1TTYA 1YYVA 1YITI 3HRSA 1K79A 1B4AA 1ON1A 2DA6A 1XGMA 1FP1D 2DMPA 3A03A 1G3WA 4HF1A 2OF7A 4LB5A 1BOAA 5ICEA 2XPYA 3DEUA 3QPTA 3O2PE 5LLQA 1RUOA 3FUKA 1BR1A 5LRRA 1ZQ3P 3UEQA 1RP3A 2HYJA 2L9NA 4XO4A 1T33A 4OIRF 2KPMA 5FWQA 2IP2A 2X6WA 4JX4A 1CF7B 2HQRA 1K7AA 1B59A 4ZQEA 2QENA 3EETA 3HSEA 3CZKA 5A2QK 3V8KA 2O8XA 3CLOA 4M71A 2NOJB 4OOFA 4LITA 2D2WA 1IC8A 4DYCA 3JRIA 4EV0A 2G9WA 5ILVA 2KT0A 1H9GA 1KQ9A 3O8HA 3A0HC 4OWRB 3FM5A 5CJ9A 3EUHA 4YELA 4LGWA 3IHUA 3QP6A 2ESHA 3HKZN 2BZTA 1ZARA 3C18A 4ETSA 1FSHA 3BTIA 1S72I 4F3QA 4ZJZA 1E2XA 1UHMA 2LBFB 3RPQA 3B7RL 5JO0A 1JHFA 2ISYA 4MLOA 5F1RA 2X6OA 3SZPA 1I3AA 5FKMA 2LC2A 5M5XJ 3CZ6A 2KKOA 4Y17A 3HOWJ 3CZEA 4N9IA 2MBFA 3K1PA 2P7VB 5HODA 2GA1A 2RNGA 4I76A 1OMIA 4NB5A 1T1SA 4XN0A 2LY9A 3RC8A 2HXOA 2L7KA 1JTYA 2VJJA 4MNUA 2B9SA 1QA6A 3RKWA 2PJPA 3VWBA 3B7TA 3J7AO 3RASA 3J80K 3SDGA 2FU4A 4IOAF 4XRMA 3QOEA 1AWCA 2QF7A 4O3MA 1TW2A 1KQ0A 1Y1VJ 4R5TA 3HRTA 2X6XA 2DA5A 2VODA 4EJWA 3B6AA 3UR3C 2H09A 2CRGA 2V79A 3E6MA 1U78A 5J47A 2OPTA 2E36A 3K4CA 1V54H 2DTZA 3OY9A 1ZLJA 4JX5A 1T1RA 1OCCH 3CP2A 1D1BA 4RGUA 2QQ9A 1MW7A 2F48A 3CXBA 2ZJRF 4NUBA 4AYBN 2OZ6A 2XUBA 4IQJA 1T6SA 1JGGA 2OCCH 3U1KA 2CJJA 2FXAA 4AVPA 2LP0A 2NNYA 1P4XA 1JJ8C 2W82A 1D1AA 4XMXA 2VQCA 1DUXC 1FYMA 3HW2A 1J7KA 4ZTJA 3AG1H 3HBLA 3MKZA 1ZGWA 3LMMA 2VUMJ 3HIFA 2COMA 2XPZA 1OYWA 2A61A 4QSHA 1D5VA 1BR4A 3I4PA 1R58A 4XO5A 4BJ5C 1RPWA 4HG2A 1MBGA 2HU9A 4QLCU 3S3OA 2KJBA 1FP2A 1VNDA 1GVDA 1VI0A 1Q0HA 1G3SA 1F43A 4X2UA 2M9HA 1K4TA 1HSJA 1WJ5A 2DI3A 5TJJA 5D8KB 3RQIA 2VOOA 5IYDJ 2IXSA 2P5VA 2Y69H 3GW2A 2ZJPF 1LEAA 1FOKA 1BJZA 4Y6RA 3MZYA 3MKLA 4XOPA 2DK5A 4NC7A 3UNGC 5JR3A 2KDOA 1J59A 2XSJC 4E4HA 4AC0A 4OIOF 3BLYA 1F1ZA 1S7AA 3D1NI 1ZG5A 3DU5A 1K6YA 2HS5A 2QZ8A 3A2KA 2L5QA 1SD5A 4JK1X 3CCRI 4HNVA 3HOZJ 3K4LA 3C2BA 1R00A 1Z3YA 3GFMA 1OCTC 2XPUA 3E5QA 3O3KA 1O3QA 2ICWG 1VFCA 4RA2A 2DDBA 3FMSA 2QEXI 2CV2A 5IT9K 2B63J 4A3DJ 1HKSA 2IBDA 4J01A 2CH0A 1RNLA 4OOIA 2Z9OA 2HI3A 3OWTA 3CMAI 2M45A 4G7ZF 1FC3A 5B1BH 1MW0A 3V7RA 5E79C 1YJNI 2ECBA 4FLQA 3CO7C 3E6DA 3L9FA 1A5JA 5DTDA 2GZWA 4E7LA 3CIAA 1QPIA 2LH9A 1RIOH 4XN8A 1BW5A 2VL8A 3TL4X 1IJWC 1W4MA 2L7MP 3GTQJ 1ZGJA 2BY2A 3F21A 2STWA 3QPLA 2PX9A 4XN1A 4DYQA 1FYLA 3G4SI 2NNNA 1X4OA 4E7SA 4QMEA 2JPBA 4BE1A 3FU3A 4BHCA 2JWTA 4K2EA 3P9KA 4IVNA 3SEQA 3D0SA 4HEA2 5C44J 3OYEA 1YE9A 2CUZA 4UB8C 3ZCOA 3ANMA 4C9YA 1Z91A 4XQFA 4K5OA 2K9SA 3BCBA 4LIUA 1S3JA 2CQXA 5E1ZB 5EJCA 4YEJA 4ZQTA 1ONOA 1MW2A 2R7SA 3F8NA 2L2OA 3ABKH 3HC7A 4S0HB 5GAEJ 3PIOF 4CZZA 4ANJA 4GDFA 3PUFA 2EA2A 3HUGA 4Y6SA 3FISA 4P9UA 4NC8A 1EKEA 3RPUD 2KL4A 2CW0F 1IXRC 4A3EJ 3CMYA 4FQGA 4DZJA 3E1SA 2X6YA 3G1MA 3SYTA 2DT7B 3WE2A 1JI8A 4K5LA 1FBSA 4I02A 1HC8A 2RREA 3IH3A 3BT9A 3HOUJ 2EINH 1FEXA 1Q0LA 4CA0A 1J2XA 3HHGA 1WJBA 3L09A 4BQNA 2BGCA 1F36A 2DFHA 3M9AA 1KYWA 1OPCA 3LSGA 1EA3A 1RKTA 3JW4A 4HA8A 3FU0A 1X3WB 4RLFA 2P5LC 2H8WA 3AL0B 2NVYJ 4IXAA 2A5WA 3GF2A 1R1TA 4A5MA 3OYCA 2JRTA 4AD9A 4YFNF 3BQZA 1LDDA 2X51A 5FLXZ 1X3WA 3PNTA 4M6XA 3OL4A 2LLKA 5K5QA 2KZGA 1IRGA 3FTSA 2GLOA 3G6EI 3I4MJ 3GTLJ 4EVIA 2FA5A 2DO7A 3GBGA 3KEQA 2W25A 1MBEA 3VSKA 5BS6A 1IUYA 4L0ZB 4G8XA 1U0JA 1AU7A 5BQTA 4ABZA 1LKXA 3CJQB 4S04A 1SD7A 3DU6A 4L2LA 2V6CA 4CSWA 2R7UA 3OR2C 4CYCA 1Y0UA 5J1UA 3U1DA 3P7NA 2NVQJ 3HHHA 2BY0A 2QBYB 3IKTA 1T39A 3HZJA 1VQ4I 1LQ1A 1YTYA 3TO6A 4RMNA 1X2NA 4BL0B 2JD0A 2IVMA 4LJZF 3LAJA 2QBYA 2A6EF 2MLGA 4A3LJ 5FJ8J 3R0JA 2ZMEB 5FFZA 5L3CA 2HOAA 3QODA 5LFAA 2EFWA 4U0YA 5B1AH 2EJRA 1KU2A 1YRNB 1TQMA 2CO5A 4L5IA 2KRHA 3RPUA 5FLVA 4L5JA 2VBZA 1QQIA 3K10A 4ARFA 1LE8B 3ASNH 1W5SA 1MNDA 5J6XA 2PMUA 3M3YJ 3G1LA 3U21A 2DODA 2EILH 3GTPJ 4JP0A 1SD4A 2V26A 3OYAA 1LE8A 3WG9A 4BHPA 3P9IA 5JHUA 2Q2EA 3NAUA 1B72B 1S6LA 1MMGA 2HDWA 3ZMDA 1ODDA 1HKQA 2PGGA 3DQVC 3CO6C 5ILSA 1GT0C 1Z77A 5HS9A 3F9KA 3GLLA 1JHHA 1MGTA 3DXJF 3ZGKA 4ZQHA 2HPMA 2ZSIB 4PU2A 2DMUA 2VKEA 4KUMA 1Z3XA 4KMFA 4V19K 3NARA 3QYFA 1Z1DA 1W7PA 1BI2A 3BG5A 3JRHA 2RJIA 4OINF 2LOOA 3KP6A 2Z99A 2PG4A 2HQ5A 2L9RA 5J40A 3HTSB 3BG6A 4F55A 4MKTA 4FLSA 5HNFA 3J80Z 1SG7A 3B3BA 2HOTA 2DFFA 1REPC 1FOWA 4PJNA 4UVCA 1A04A 1H88C 3RSNA 4IKFA 5GTIC 4KISA 3L00A 4R8HA 4EEFG 3PO3J 4A0XA 2XGDA 2HQAA 2DT5A 2RVCA 1B9MA 3LSHA 2EB7A 3FBIB 3JAMZ 5FFXA 2CU7A 3KYDB 1DU6A 4HLXA 4BACA 4C2MJ 3A14A 2EZHA 2CW8A 1W36D 4IF4A 1VQPI 2LY1A 3RTRA 4OIQF 3HJEA 1GDTA 4KP7A 4ZDLA 4HSTA 2R3SA 3RDIA 4A3MJ 3KYCB 1ZK8A 2DQMA 2IGKA 4PZJA 1XSVA 3ECOA 2O61A 2M5WA 2XHKA 2JCVA 3W2WA 3WGHA 4ZH4F 4DJAA 5HS8A 3LSPA 2HDCA 5E20A 3B34A 2AQEA 3PUUA 4A6EA 1JUSA 2XC7A 3E5XA 4P96A 5B5EC 5DYFA 2QKMB 1BI3A 3WTTC 3K0LA 2Z2SB 5IYBJ 3ZQGA 3ZQHA 3H9QA 4Y4RA 3MFKA 5AENA 1YIJI 3KETA 1EH8A 2EFQA 2KRCA 2HPTA 2Y9ZA 1J9IA 2YS9A 3QYBA 3FUDA 3EDPA 3EUAA 4ZYEA 4RLQA 2MGQA 4Y67A 4NHJA 1J09A 2HKOA 5FLMJ 1X58A 3OSGA 2GA2A 2V1NA 3FUJA 3EPZA 5IOYA 3EUKL 4KICA 2DMTA 2HDDA 2JA2A 3A02A 3HRMA 3LQRA 2R93J 3PQJA 1FOYA 1ONPA 2XF7A 3L2UA 3HL2A 1WFXA 1YW8A 2ESNA 3S2WA 4XORA 4ZYAA 4Q4ZF 4MIMA 3VEPA 2VE9A 4HDUA 1TBXA 1OR7A 3KP3A 4A6DA 4CYDA 5GPCA 3HPGA 3I55I 2K3FA 4XLAA 2IA0A 3A4CA 3PSFA 1B6AA 2ID6A 5AONA 4A69C 1JT6A 3WTUC 1P92A 4RB1A 1D0XA 2LDUA 4I0AA 3W2AA 1DDNA 3GVAA 4HV5A 4PSWA 4AIJA 2XQ0A 1UCRA 4KIBA 5EEHA 2Y1CA 2GTQA 1RRJA 2MG4A 5LHHA 4KDPA 4A93J 4HRIA 1WJAA 1I1GA 4A3GJ 1P4WA 4M3EA 4CCKA 2XGCA 2LREA 3OYIA 4B44A 3J7YJ 2DXIA 1HF0A 1UHSA 1G4DA 2O5RA 1SVLA 5KAFC 1U8BA 3PM1A 2GBYA 2ZB9A 3ZMSA 1LB2A 2P7CB 3BR6A 3J81Z 3MCZA 2JA8J 3HG9A 1ZR4A 1N77A 2N8GA 3ZHZA 3BOQA 2QSGX 3KP5A 3GUDA 3TP0A 3RI4A 4BJTA 4LFUA 2EZIA 3K4KA 1O3RA 3WTVC 5E17F 3GX4X 4XMUA 1AA7A 2ID3A 3ZQCA 3PIPF 3WQRA 4D7NA 4UXNA 3I59A 1NK3P 4ESBA 4A3BJ 2OAZA 2BY3A 2LRDA 4XKBA 2QGUA 3A01B 2JUCA 3FM3A 1I6XA 3EUHC 2K9MA 2E34A 2CSOA 3MKYB 3I9V2 1R9TJ 2EFPA 3AG2H 4B09A 5HOOA 2VQHA 4AR8A 3KEOA 2JTVA 2PJRB 1UJ8A 3CUQB 3TBIA 3CZLA 3FXOA 3F72A 3K4MA 3WE3A 4XRSG 3CDLA 3AU8A 1DU0A 2PJRA 1ERDA 3ML6A 2FBKA 2H1KA 3CUQA 1IN6A 2AXTC 1A6IA 2UXNA 1K83J 3VYTB 1U2WA 4B4CA 2MH9A 2FUG2 2G7HA 4N9HA 2K7LA 3JSPA 4I0BA 2HPIA 3EBHA 3ZQLA 3BG7A 4BUPA 3IV5A 3C3WA 3T0YA 2MABA 4XSZF 1Y8RB 2F5FA 1BL0A 2DPDA 4JNDA 4XN7A 4ZYHA 4ESJA 2V9VA 3HDDA 1KU3A 3DCFA 3KZIC 3K70C 2PUSA 2K9NA 4TV7A 2E1NA 2UUZA 1JT0A 4XKCA 1IV8A 2VLAA 2D45A 2A05A 1HS6A 3W2VA 1I1SA 2HPOA 3IL2A 1FPQA 2CUJA 4D5FA 2VXZA 4KT6A 1B1BA 1OJLA 2QVOA 1HW5A 2BW3A 3KZYA 2Y9YA 3DFGA 2LKXA 3MD2A 4MFDA 4UY8I 4BJ6C 5KVRA 5HVQC 1O57A 2YPRA 1T38A 4BHBA 5D5UB 2MAOA 2O9LA 5FKKA 2ZJ2A 2JCYA 3CLQA 2F5EA 5FD5A 5ILUA 3T8RA 3G73A 3JRAA 1WH5A 3OS0A 2CQKA 3IP4B 4UHTA 3QYEA 3OYBA 3OYDA 3FXMA 4LK1F 2W4SA 3FUFA 3MEXA 5EZGA 1OQYA 5GAGJ 3KYLA 3FTZA 2XKPA 1X19A 3HYIA 4C3JJ 2GIVA 2D1HA 3OMYA 2DBBA 3CHOA 3FXJA 2IS1A 2HNHA 2X9DA 4ITVA 1WSUA 1VTNC 2L3DA 1UELB 4I6ZA 1ZTRA 5BPDA 3S16J 2JD1A 3NWTA 5IT3A 1WZ2A 2DA3A 5JBIA 5TISC 1IN8A 1MJBA 5FLXK 3BY6A 4KN4X 1H19A 3FH8A 3B6CA 3ANLA 2XF5A 2EBIA 4RGRA 3SDBA 5L3EA 4M6YA 2CGPA 1T95A 2CQQA 3E3VA 1HSTA 4ZN6A 2OU2A 2DMNA 4LD5A 3IAS2 2DU9A 1X1PA 1YW9A 2VI6A 2V1UA 2W57A 3RKQA 5JMWA 1PYVA 1EF4A 2VE8A 4ZDPA 3JTGA 1Z7UA 2K5CA 5D5XB 1W0UA 1V5FA 3ZP5A 1SC7A 2XB5A 3LAPA 4FE4A 1Z0XA 5FROA 2HKXA 1Y8QB 5IPAA 3PJRA 3QOPA 4ZQGA 2E5ZA 1Y1WJ 2WZGA 4V2FA 2WBMA 2ZXJA 2M34A 1E3OC 1X4PA 4U7BA 3EQLF 3SXYA 4BXXJ 2V4JC 4DBRA 4DW6A 5LGUA 1CF7A 2VQGA 4EJOA 1U5TB 2DMQA 1MBKA 2WY8Q 2CFXA 3K7AJ 5E3OA 1YS6A 3MKWB 2DFIA 3M7GA 3PNVA 2R0QC 4OAZA 4Q4EA 4ZW8A 1YLFA 1SFUA 4C2UA 1U5TA 2WAFA 1GVJA 5HLTA 2FQ3A 4IO9F 1TNSA 1QNTA 2O0YA 4M3BA 3ZQIA 2NRAC 3S17J 3B37A 2K3PA 2ZNZA 2RDPA 2R5ZB 2VBXA 2RKHA 3H3ZA 1WH7A 1SFEA 1BR2A 5C3EJ 1XSDA 1FWZA 2LBFA 4IHTA 2E1MC 2LMDA 2P4WA 3ABTA 2R5ZA 2R7DA 1H0MA 1J75A 5KCMA 4AYBA 1SVOA 5J1RA 3EBIA 2Y48A 3GZNB 2YUSA 3SQNA 3VYRB 4R5VA 3OOUA 1POGA 3CC7I 2ZFWA 4HNUA 1VQNI 4GYGA 4BH9A 3FH7A 4B47A 1SAXA 4PCQA 2Y1GA 4QIRA 1STZA 2Q1ZB 4IPAA 1G3TA 4KJZA 3KE2A 2D1VA 4WXDA 4MS6A 2EZLA 4NDLA 3QU3A 1H89C 4LB6B 5CKTA 1YX3A 1JXSA 2TRTA 3DLLF 2Y1FA 1JUPA 4Q47A 1ZHFA 1O4XA 4D5CA 3WQQA 4BKXA 2EQRA 1K5HA 5LRSA 3JAMK 3LSRA 4FLOA 2LKPA 1P9QC 3E6CC 4L18B 1RR7A 5KK1A 1X3UA 2JRMA 4HV6A 5DS9A 5F1JA 2MSYA 5LGTA 2LNBA 3PL8A 4BYYA 2EFNA 5EEGA 4F93B 4XRFA 1FBUA 2QLZA 3GYHX 2P6SA 2WADA 4MEYF 1JG9A 3ESWB 3O6BB 1ETXA 1UB9A 2HTSA 2CV1A 1IDZA 4I99C 3FMQA 5EG0B 5CVIA 5D4RA 5J8FA 3S1MJ 2P5KA 3L2QA 1DPUA 5CVJA 4UVBA 3BR2A 2ELHA 3LSIA 2W1OA 5TRDA 1NH3A 2G7UA 3KEDA 3HM5A 4CICA 3ZQQA 1XGSA 2CFOA 1IV6A 2JMWA 1LVAA 4RGSA 5D4SA 3DKYA 2CWEA 1JKPC 5EV7A 2ADUA 2K86A 4XLFA 3M1CA 4OMZA 3GTKJ 4M9SA 4G94A 5BMZA 5JLWA 3BJOA 1M1EB 2Y0MA 1QHGA 4YFKF 4IHSA 2R92J 1WI9A 5E3NA 4XSXF 4QHPA 2EFOA 4HW0A 3AUAA 1Y6IA 4XK4A 4XIDA 3CCQI 2CQ7A 1G59A 5H6RA 3VPRA 1JTXA 1T0FA 4EQQA 4GYIA 4RAZA 5FRMA 1NTCA 4LK0F 1R5HA 5E1WA 5JMPA 1WQ2A 5F64A 3TDUC 3WODF 2KZVA 2LFBA 4R5XA 4EJVA 2X0LA 4GFBA 1ORKA 1HDDC 1BA5A 3U9WA 2KHMA 3CDIA 2FBIA 2C82A 1BW6A 4RM2A 5LBQA 3JT1A 4XL9A 3KLOA 3JRGA 3ANNA 4AIKA 3CMEI 4XMWA 5DUIA 2DFEA 2YU3A 1IXSB 4XR6A 3FXRA 5GPAA 2FMYA 3VYSB 3J81K 3BZCA 5M3FJ 5GTHC 5FKNA 4BQAA 1YOVB 3CHPA 4FETA 3FIWA 3JTHA 3SFZA 1O3SA 4ENNA 4K5MA 3T5XA 4W97A 1ZG3A 2IGOA 1KQ8A 1FZPB 2QVWA 3HGYA 3ZR8X 1QHHD 3FMRA 2PN6A 3SJMA 5J1YA 3LSTA 2NS0A 3DV8A 4L0YB 3Q0VA 1P2FA 3FK7A 1K78B 3CMMA 3RYPA 2MD0A 3DEEA 3NRVA 1KZHA 3D5RC 2GXAA 1X1AA 4HZFA 1Y0NA 2HWVA 3QP5A 1VQLI 4UUVA 2VJ4A 3SZTA 1FIPA 1W5CC 4BBSJ 3V42A 1K78A 2R70A 3BR1A 1L3LA 1VZ0A 3H5NA 2XASA 2L01A 1F4KA 3RKYA 1YQAA 1TZLA 5DUKA 4QPQA 2EA4A 2LTPA 5DCFA 1R49A 3ZMUA 2JA5J 4Y52J 2WB1A 1VQOI 2PLYA 4A5NA 2HGCA 2LD5A 2DJIA 5ERIA 1BIAA 1OCRH 1WI3A 5E3LA 4FLRA 3LA7A 2JVHA 1JGIA 5ICFA 4S05A 4PVBA 5DM7F 4ZC3A 1S29A 1LFBA 2I5UA 3W3CA 3LNQA 4PSXA 3WTYC 4XM3A 4BQOA 3V7SA 4CCJA 4BDZA 2MLKA 2UV1A 3DF8A 3TDZC 4XKVA 2IGNA 1N78A 3OIQA 3T8TA 4AVZA 1TWCJ 2ZXWH 1IN7A 1VQ7I 1S7EA 1R1UA 3C2GA 3OS1A 5BPPA 4L5EA 4Z6YA 3WG7H 1N25A 2L9SA 5CQGA 1H8AC 4JYKA 2J5PA 4M73A 2AQFA 1HQCA 3FKJA 3S2DJ 1IRZA 3TMOA 2Y1DA 5CVRA 3GTMJ 1HOMA 5FGMA 1KGSA 1R0KA 3CTAA 3KP2A 4DPRA 2EIKH 2K9LA 2NYXA 5IP9J 2A5YB 1VQ9I 4EJTA 2F2EA 2H1LA 2LYCA 1MD0A 2X1EA 2EIMH 4DOZA 3I54A 4BNCA 4Y15A 3H1CA 1UMQA 5IY5H 3HOYJ 3OYMA 1APLC 2XROA 4XN9A 1FBQA 4KIGA 5HDKA 1BC7C 3BJAA 2WB1N 2FD5A 2X1CA 3CF5F 4AIHA 2QA4I 2E2HJ 1TC3C 3CQZJ 5E1XA 2KIFA 2KRFA 2ZFUA 5DCMB 3F0CA 2V1XA 1OCPA 4BAYA 2F4OB 1E3PA 3ZQ7A 1HA8A 2IT0A 2DA1A 3I53A 3ZMVA 2DDAA 4ZX5A 1YJWI 2IS6A 1I50J 1RETA 1PUEE 3DKWA 2DA2A 4XNBA 2ACJA 1R6RA 2C5ZA 1ZN2A 1UG2A 3KPHA 3OYKA 1W0TA 3TO7A 1R4NB 4KYWA 2Y30A 2VC0A 3R6SA 2BXYA 2HYFA 2ZMEA 4BS9A 1FX7A 1Y39A 4U88A 3WTXC 4A3IJ 3OV8A 3VOEA 1UAAA 4R7LA 3L7WA 2P6TA 1YRNA 1AKHB 3CC2I 2GXGA 1G5AA 1EH7A 5K5OA 3RZDJ 3IUOA 3S32A 4PW4A 4J00A 4CCLA 1IRFA 5DLLA 4G7HF 3AFHA 4XOTA 1OCOH 2O7OA 3NQOA 4I09A 1WJFA 4QWQA 2OZUA 5L3DA 2H8RA 2I10A 5JI6A 1BIBA 3S1QJ 1N75A 1TWFJ 3I0TA 2IRFG 3DP7A 4RS8A 2MC4A 1DP3A 1WJEA 1VQ6I 1PJRA 2A69F 2XIGA 1B72A 2XRNA 3M1EA 4B48A 4XICA 2OV7A 1HLVA 4FT8A 4E7KA 4DZPA 1RUNA 4XMZA 4EM0B 2HZDA 2PBIA 1PP7U 2Y1EA 3KFWX 1IW7F 5GADJ 1IAWA 2MYSA 3UKGA 4M74A 1YG2A 2CQNA 4PJJA 1MDMB 3PO2J 1BC8C 1Z6TA 1ETYA 1LVKA 2FJ1A 3K4NA 3IIEA 2MAPA 1YW7A 4U0WA 1MDMA 3HTUA 1FMVA 3ECHA 1VQKI 5HLGA 1T8IA 4B3AA 3V8LA 1JE8A 5HDNA 1DP7P 5BNGA 2BYVE 1MKMA 3KEYA 4ZX4A 1MVYA 2QSFX 1R4MB 2BVLA 4O6JA 5CLSA 3OYGA 1R71A 3FULA 1IRXA 2VPRA 3F6OA 3P9CA 3AG4H 2FOWA 2VQLA 4H4KC 1YI2I 2M0CA 3CC4I 3CCEI 1E3HA 1RC9A 2EIJH 1U8RA 1ETQA 2AO9A 2D5VA 1P6RA 1XN7A 4HDVA 1UZCA 1ZAOA 3AAFA 1E17A 1G6NA 2PFBA 3IWFA 2EZKA 1LFPA 4I7HA 4CGZA 4OIPF 2R72A 5E8GA 3R0AA 1WWXA 5M5YJ 1GV5A 3L2CA 1ZRFA 1CQTA 3L2VA 2WZFA 1JJ6C 4IEJA 3VODA 2V9KA 3PSIA 3Q0WA 4J3BA 2JUGA 2FOKA 4ZTFA 4GXOA 5HDGA 3FUEA 2PI0A 1Z05A 5H2FC 3FU6A 2CS3A 2M87A 2YR2A 2V7FA 2P8TA 5KNLA 2GQQA 4X0GA 1XSXA 3BPVA 2M4GA 3LFKA 1XMXA 1FNNA 4C3IJ 2R7ZJ 2GOXB 3K9TA 4F52A 1OISA 3R61A 3WU2C 1VQ8I 1W5TA 4KT5C 2DQRA 2YX7A 4LLLA 4EJUA 3KLNA 3ERMA 1WCMJ 4XONA 1H3LA 4DQ2A 3F6VA 3MWMA 3TOAA 3H35A 2XAUA 3CJTB 3Q9VA 4L9JA 5FKLA 1Z6RA 2E7XA 3QQAA 3BR3A 3DPUA 3V8JA 2HEOA 4H0EA 2WAQA 3ABUA 2DTRA 1YIOA 4K5PA 3BR5A 4ZYGA 3ZN0A 2IA1A 4W1UA 5IP6A 2MH2A 2OQRA 5E18F 3OYNA 2FNAA 2WA0A 2L54A 4OMYA 5JVGF 2QQ8A 4CCOA 1OYYA 2FNPA 3FTVA 1ETKA 2QYOA 3RQ4A 5DDGA 2JQ7A 3W6JB 3ROUA 4MHGA 3H36A 5ICGA 1IN4A 3F8CA 1SFOJ 2GXBA 2JA7J 4QPEA 2MC3A 4PUSA 2Z5UA 1QGPA 5CPRB 3N4MA 2DN0A 3FHZA 2JT1A 4L9VA 2M30A 3FZVA 2JN6A 2VPLA 2GM4A 3CCVI 3PFYA 4RBOA 5K7FA 2WV0A 1MH3A 4HYEA 4RDUA 4ZX6A 2ZJQF 2DYRH 4GRIA 2FFLA 5BOXA 1XGOA 2EV0A 4WXCA 2M0MA 5ED4A 2VB6A 2O8KA 1IUFA 3MZHA 3DBRB 1TW3A 1XD7A 3TGNA 2E35A 2WAQN 2ZXHA 1GW6A 2WC2A 1K4SA 1ZYRF 3UCQA 3MAJA 3GLXA 3FUIA 3FUHA 3ASOH 5IP7J 3CP8A 1QZZA 4MTEA 3A01A 4BY1J 2Y2ZA 1I6HJ 2DLLA 2ISZA 5FO5A 4II3A 1JKRC 3S8PA 1U3EM 3K4JA 4O5VA 1YS7A 2NXNB 2PEXA 4ZYDA 2E60A 4RB0A 3ZN1A 1B8IB 2J5OA 2XKOA 2CMPA 1YO5C 3R0IA 3REOA 4YFXF 1I27A 2ETHA 2FRHA 3WTSC 4HNTA 2CG4A 1V55H 3K1MA 2LY2A 4I01A 1KYZA 3FDYA 4IL6C 4CDGA 1SVMA 3LSMA 3QPSA 3WTWC 4IHWA 3WGGA 2A6HF 4UV9A 4Z2YA 1GXPA 4DGWB 4DIQA 4XN4A 2VONA 3ISPA 2M7AA 3BDDA 4I98B 3EBGA 2F5CA 3BTJA 3S1RJ 1UHWA 3I3LA 4G6DA 4YIRX 3K2ZA 3IRQA 1T08B 4RGXA 2BV6A 5GAHJ 5C4JJ 4RAYA 3RIRA 4U0VA 3U9GA 2BOLA 2UZKA 3K6GA 4AR9A 3RJPA 2Z33A 5HLHA 2ZNYA 4UVAA 2BBYA 1S9HA 5CYVA 2ZKZA 4QTRA 1L0OC 2F6CA 4HBLA 3SZGA 1DGWY 4PJ0C 4G6QA 5F0CA 5M3MJ 3DTKA 4WX9A 4HF2A 2HZTA 3AG3H 4IHYA 1R0LA 4YIIA 4J19A 5L3GA 3EYYA 2EK5A 1TLHB 2X85A 4II2A 5EGOB 1KA8A 2AXLA 4A03A 1H9TA 3ZMZA 3S93A 1SQMA 4LOCA 4R1HA 2NVUB 2MD5A 4AU7A 4ZW3A 2BVMA 1XC5A 2K27A 4GO1A 4ENJA 1BI1A 2OBPA 5EGOA 3HOTA 5JNLA 2R7RA 1MMSA 1A6QA 2NVTJ 2R7TA 2FMLA 1D1CA 2VIXA 2K85A 4D9JA 1BI0A 1XDUA 3FK6A 1Z21A 5C4XJ 2W00A 1FSEA 5DV5A 3GWZA 1T56A 2WTEA 5D8LB 1Y56A 3QJXA 3PQKA 3ZPLA 2ELKA 3ZXSA 2UWMA 3LA2A 4E7IA 3CZGA 4LIVA 3BC8A 3QU6A 2XF6A 1D3YA 1R7JA 2ZO4A 3L1PA 3LWFA 3OOPA 2ELJA 2ECCA 1LJ9A 3DPTA 3E5UA 4XLNF 3E7LA 4HPQA 4FASD 4A0ZA 4FHTA 4UNOA 1F9NA 2HYGD 2EV6A 2QWWA 5DULA 1ITYA 1USSA 3GMEA 1QZYA 1U6GA 2FF4A 1T0FC 2M4KA 2RGVA 3FF5A 2VKHA 3FHNA 4PFPA 1S46A 3S2HJ 2KISA 2H6CA 3IAM2 1MJ9A 2R7QA 2EGHA 3VDXA 1D5YA 4G7OF 2V1DA 3GFIA 1LDKB 2EV5A 5M5WJ 1XCVA 1FTZA 1MMAA 4OU0A 5HNHA 3F3XA 4AM3A 1ETVA 2O03A 2NAZA 4BQQA 1IGNA 1BM9A 3QAHA 3K70D 1XX5A 3LA3A 2QKLB 1G3YA 1QBJA 3RZOJ 1ONNA 2YSRA 2HVSA 3R60A 2KIUA 4P55A 4XNFA 4IHVA 4LG0B 1Q0QA 4KIFA 1LEBA 2R7WA 3MN2A 5DM6F 3IH2A 2ZC2A 3TW7A 3S1NJ 2B61A 4HX7A 3OYLA 1JVSA 1ONVA 1WRJA 2WV1A 4LG0A 4A2UA 2DAOA 1JGSA 2TDXA 4GAEA 1FY7A 2F5VA 2DA4A 2OJED 3WGIA 2R59A 5K1YA 3L2RA 4UUTA 2O7GA 4QIWN 2OUMA 4A3FJ 4HQEA 2AS5F 3JSZA 4ZQFA 2XAGA 2ZXIA 4KFCA 3ZOBA
chains in the Genus database with same CATH topology
3MMYB 3WQSB 3CMMA 2MD0A 2E5NA 3DEEA 3S3MA 3D5RC 4P5OA 1X1AA 3BG6A 4E6KG 4F55A 4PK4A 2IS4A 4MKTA 4FLSA 3BCAA 5HNFA 1SG7A 3B3BA 4N4OB 2VJ4A 2R70A 3V42A 5JHFA 3OL3A 3A1YA 4PJNA 3RSNA 4JQFA 3NWSA 1SFKA 1VZ0A 3H5NA 3H5AA 3LFUA 4IKFA 4KISA 2R7OA 3VVLA 1TZLA 2P0WA 1MW3A 3AU9A 2HQAA 3LSHA 4QPQA 3FBIB 3ZHXA 4AICA 1NG6A 3H5RA 4BACA 3A14A 3DTEA 1X1CA 4IQ4A 2WB1A 2CW8A 1W36D 3Q44A 2DJIA 2LY1A 3RTRA 3OYJA 2JV7A 4ZW7A 4KP7A 4FLRA 4ZW5A 4ZDLA 4HSTA 2JVHA 1JGIA 4HSRA 4PVBA 3B7UX 4ZC3A 4CH7A 2DQMA 1OLTA 3M8JA 3W3CA 4PSXA 4LG3A 4XM3A 4BQOA 4CCJA 4BDZA 2UV1A 3FHEA 2BW3B 2IGKA 4XKVA 2IGNA 3FTYA 4ZW6A 1N78A 3OIQA 4AVZA 2M7BA 2JCVA 3ONQA 2CW7A 3W2WA 3PUUA 3B34A 4DJAA 1FMWA 2WAEA 3C2GA 3OS1A 5BPPA 2AQEA 3ZHYA 2PMZA 2XC7A 2L9SA 5CQGA 5DYFA 2QKMB 2Z2SB 2AQFA 2DT6A 3H9QA 4Y4RA 3SEZA 3FKJA 3DKXA 1D0ZA 5AENA 4PJMA 3TMOA 3DLAA 2Y1DA 4AYSA 1V5EA 2KRCA 1DGRM 2KP6A 1R0KA 3CHQA 2HPTA 4DPRA 2K9LA 1GLNA 5CQEA 3AL0C 3QYBA 3FUDA 2LG4A 3EUAA 4BEHB 4RLQA 2LYCA 4XMYA 4Y67A 1J09A 2X1EA 3DTIA 4DOZA 4PJLA 3FTUA 2V1NA 3FUJA 3EPZA 4BGDA 3EUKL 2R7VA 3OYMA 4XN9A 4BEHA 2JA2A 4XMVA 4B3XA 3HXLA 2XF7A 1ONPA 2QJ1A 2X1CA 4FCAA 3L2UA 3HL2A 1WFXA 4XN3A 4XORA 4ZYAA 4XNDA 2ZFUA 1OR7A 1MNEA 4RM3A 3OYFA 3HPGA 2GOMA 1HA8A 3CF2A 3PUBA 4XLAA 3A4CA 3PSFA 4ZX5A 3D5LA 3H9GA 3CESA 2IS6A 4C30A 2VXDA 4XNAA 1D0XA 3W2AA 4PSWA 2A7OA 2XQ0A 2Y1CA 3FUNA 4XNBA 1R6RA 2C5ZA 2GTQA 3OYKA 3ZI0A 3HKZA 4XN5A 1YX5A 4Y33A 4LUPA 2X1DA 4HRIA 4BS9A 3CHSA 1WJAA 4CCKA 1UAAA 4R7LA 2LREA 3OYIA 4B44A 2DXIA 3K4BA 4AR1A 2KMUA 2O5RA 4NQWB 1G5AA 2XPYA 2XDVA 3IUOA 3S32A 3PNYA 3AKZA 4CCLA 3H0DA 4J00A 3FUKA 4PW4A 5DLLA 1BR1A 3AFHA 3UEQA 3HG9A 4XOTA 1N77A 4NQWA 3ZHZA 1WJFA 1RP3A 2L9NA 4XO4A 4QUOA 2ZXGA 4BJTA 2KPMA 2ZSHB 5FWQA 3HPHA 2X6WA 1N75A 3K4KA 4E7JA 2MC4A 1DP3A 3J7AY 1WJEA 1AA7A 4XMUA 4ZQEA 1PJRA 4E7ZA 4OAYA 3D5SC 3CZKA 3FTWA 3WQRA 4B48A 2OV7A 2NOJB 4OOFA 4XN2A 4E7KA 4LITA 2LRDA 2M3AA 4XKBA 5KHDA 4BU2A 3UERA 4XMZA 2HZDA 4OWRB 2Y1EA 1ZELA 3EUHC 4YELA 2W7NA 3CHRA 2MYSA 2K9MA 3MKYB 3I9V2 4PJJA 4K5NA 4CXFA 5HOOA 3DWLE 3RC3A 2VQHA 4AR8A 4F3QA 4ZJZA 1WJCA 2PJRB 2LBFB 1LVKA 3IIEA 3K4NA 3B7RL 4RCVA 2E1MB 5JO0A 2MAPA 1FMVA 4MLOA 3TBIA 2JCXA 2JD2A 4IX7A 3K4MA 3CZLA 1TT0A 2LC2A 3CZ6A 3AU8A 2DCEA 2PJRA 3CZEA 3KEYA 3OIPA 3CJRB 1ERDA 1MVYA 4ZX4A 2BVLA 3OYGA 3E0JB 3FULA 1IRXA 3VYTB 2RNGA 2FUG2 1T1SA 3FU5A 4RVBA 2VQLA 4XN0A 3RCOA 2HPIA 4N4NB 4H4KC 3EBHA 3BG7A 5TGTA 4BUPA 3RC8A 2L7KA 4KITB 3T0YA 2VJJA 2MABA 4D1QA 3VWBA 4JNDA 3B7TA 4XN7A 3DPLC 3RASA 3K70C 1UG0A 3QOEA 2PUSA 2MFZA 2UUZA 4Y3OA 4XKCA 2VLAA 4R5TA 1HS6A 2Z16A 3W2VA 1LFPA 2X6XA 3HUGB 2HPOA 2HVQA 2CUJA 3UR3C 2VXZA 4KT6A 1NG7A 1ZS2A 2R72A 2BW3A 2IGMA 3L2VA 3MD2A 2WZFA 2V9KA 3K4CA 4BJ6C 3PSIA 5HVQC 4J3BA 2JUGA 4XLCA 3OY9A 4ZTFA 2MAOA 2V6EA 3FUEA 2JCYA 1T1RA 1X3ZA 3CP2A 1D1BA 2CS3A 3H9JA 3FU6A 2V7FA 5KNLA 1MW7A 4X0GA 4NUBA 3ZRGA 3OS0A 2M4GA 3IP4B 3OYDA 3QYEA 3OYBA 4IQJA 2CV0A 2GOXB 4CCNA 4F52A 2W4SA 3FUFA 3KYLA 3FTZA 2W82A 1X19A 1D1AA 3FTXA 3OMYA 4XONA 1H3LA 4XMXA 3CHOA 2VQCA 2IS1A 2HNHA 4ITVA 3H35A 1OR7C 4ZTJA 3LL7A 4Q4IA 2XAUA 1UELB 3MKZA 4BE2A 3LMMA 2JD1A 3DPUA 2WY7Q 3NWTA 2XPZA 5JBIA 3G2BA 2WAQA 1BR4A 4XO5A 2R7XA 4K5PA 1H19A 4BJ5C 3FH8A 4HG2A 4GAAA 2HU9A 3S3OA 4OOEA 2VJ8A 3OYNA 3ANLA 2XF5A 1Q0HA 4DBQA 2WA0A 3SDBA 3FH5A 2OC6A 4X2UA 1T95A 1X1BA 3B2XA 1W36C 2DQ6A 4ZN6A 4E7HA 4CCOA 1WJ5A 1Z7LA 3IAS2 3FTVA 3RQ4A 5JMWA 2IXSA 1PYVA 4Y6RA 3C2HA 4ZDPA 4QPEA 2K5CA 4XOPA 4PUSA 1V5FA 4NC7A 5CPRB 3UNGC 2DOAA 5FROA 2KDOA 2VPLA 2XSJC 3PJRA 4E4HA 4ZQGA 3BLYA 2E5ZA 3PFYA 2WZGA 3DU5A 2WBMA 4XLHA 1K6YA 4ZX6A 3A2KA 2L5QA 4GRIA 2FFLA 3K4LA 3LSKA 1X4PA 2RQQA 4U7BA 1Z3YA 4C2TA 2M0MA 1DQUA 2A6TA 2V4JC 2VB6A 4DBRA 4JOMA 2VQGA 2WY8Q 3VSLA 1KONA 3MKWB 2CV2A 2ZXHA 1GW6A 2Q2EB 3PNVA 4U87A 4OAZA 4XKWA 4EATA 4Q4EA 4J01A 4C2UA 4ZW8A 2CH0A 1SAUA 2WAFA 3OWTA 5HLTA 1BOBA 2VASA 3UCQA 2JSPA 3FUIA 3FUHA 1MW0A 3CP8A 3B37A 4FLQA 2K3PA 4P1WA 3KX2A 4G6TB 3OYHA 4E7LA 3CIAA 3Q43A 4II3A 1BR2A 3S8PA 2LH9A 4XN8A 2KLOA 3K4JA 2VL8A 3TL4X 2LBFA 3T8VA 2E1MC 2E60A 4XO3A 4BDYA 2CMPA 5KCMA 4AYBA 3R0IA 4XN1A 3EBIA 1X4OA 4CUGA 4R5VA 3VYRB 4E7SA 3OOUA 4QMEA 2JVGA 4HNUA 4BE1A 3FU3A 4HNTA 3FH7A 2LY2A 4B47A 3FDYA 3LSMA 2Y1GA 3A06A 2KQRA 4QIRA 2Q1ZB 3SEQA 4HEA2 4ZDOA 3OYEA 5LD2C 1YE9A 4KJZA 4BXFA 2CUZA 4DGWB 3ZCOA 4DIQA 3ANMA 4XN4A 4MS6A 4C9YA 2M7AA 5CKTA 1YX3A 4XQFA 3EBGA 4K5OA 4YRVA 3BCBA 4LIUA 1QU3A 3VYUB 4YEJA 4ZQTA 1E0EA 1ONOA 2Y1FA 1MW2A 2R7SA 3I3LA 2L2OA 3HC7A 4RSYA 3WQQA 4ANJA 4BKXA 1K5HA 2BOLA 3K6GA 4FLOA 4Y6SA 4AR9A 1P9QC 4Y6PA 4NC8A 1WJDA 4XLEA 1S9HA 2KL4A 3RPUD 3HOSA 2F6CA 3SZGA 3FUMA 1DGWY 3DTKA 3E1SA 2X6YA 4XMTA 3PL8A 4PFOA 2DT7B 3SYTA 1JI8A 4K5LA 1R0LA 4F93B 3OR1C 4QPOA 2RREA 1V5GA 2WADA 1JG9A 1Q0LA 2X85A 4II2A 4CA0A 1WJBA 4BQNA 4A03A 2CV1A 3LSGA 3S93A 2PL5A 1SQMA 1EA3A 4AU7A 4ZW3A 2BVMA 3FU0A 4RLFA 1D0YA 3AL0B 3HOTA 4NNJA 5JNLA 2R7RA 2A5WA 2R4GA 3L2QA 3OYCA 2R7TA 1D1CA 2VIXA 2X51A 3LSIA 2W1OA 4D9JA 1X3WA 2VJIA 3PNTA 3KEDA 1Z21A 3OL4A 2W00A 1MMNA 3ZQQA 3FTSA 2CFOA 1Y56A 2VJ5A 3GBGA 3DKYA 3VSKA 3N05A 3QJXA 5EV7A 3ZXSA 2UWMA 1U0JA 4XLFA 4E7IA 2WPGA 1LKXA 3CJQB 3M1CA 4LIVA 3BC8A 5FRNA 3CZGA 3DU6A 4L2LA 2XF6A 4CSWA 1QHGA 2R7UA 2ELJA 3DPTA 3OR2C 2F4IA 4HPQA 4FASD 4QHPA 1MW1A 3AUAA 1Y6IA 5JAZA 2VKDA 3L2WA 5DULA 4RMNA 4BL0B 2JD0A 1G59A 1T0FC 2M4KA 1SC5A 2VKHA 3FHNA 4PFPA 5FRMA 1S46A 2HVRA 4B43A 3QODA 5LFAA 3VVMA 3IAM2 4F92B 5JMPA 2R7QA 2EGHA 3VDXA 4ZX3A 1X1DA 1G8XA 2KZVA 1LDKB 4R5XA 1MMAA 2I8DA 5HNHA 2KRHA 2Y0SA 4CCMA 3U9WA 4BE0A 2KHMA 4BQQA 2C82A 3OS2A 3K10A 4RM2A 4ARFA 3K70D 3JT1A 4XL9A 2QKLB 1MNDA 3ANNA 4XMWA 1ONNA 2HVSA 5JC1A 2Z1DA 4XR6A 3U21A 4XNFA 4CZCA 2V26A 3VYSB 3OYAA 2IS2A 1Q0QA 3B2PA 2R7WA 2HDWA 1MMGA 3CHPA 4FETA 2PGGA 4F91B 3S3NA 3OYLA 2B61A 3DQVC 1JVSA 1MMDA 3F9KA 4R79A 4GAEA 2F5VA 4IZZA 3B7SA 3ZGKA 2R59A 2HPMA 2IGOA 2ZSIB 4K5MA 4PU2A 4ZQHA 3L2RA 2O7GA 2QVWA 1Z3XA 2OUMA 3ZR8X 1QHHD 3QYFA 3JSZA 4ZQFA 2RJIA 3FBNB 2LOOA 2ZXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLA A;  5HNH A;  5HLT A;  5HNF A; 
#chains in the Genus database with same CATH topology
 3MMY B;  3WQS B;  3MZ8 A;  1VQ5 I;  3S3M A;  4P5O A;  2Y75 A;  4E6K G;  1ZRE A;  2L7Z A;  5FB2 A;  3BCA A;  1T2K A;  3F23 A;  1IDY A;  4YG2 F;  5JHF A;  3A1Y A;  5F27 A;  2XGE A;  2GIZ A;  3NWS A;  1SFK A;  1MIJ A;  1ZKG A;  1VF9 A;  2HTJ A;  2E1C A;  1S8N A;  3VVL A;  4IRI A;  5EDN A;  2G0E A;  3EYI A;  3AU9 A;  1P7I A;  3TKY A;  1YFH A;  3HEF A;  1QZE A;  3CCS I;  3JRD A;  3WU1 B;  4CO8 A;  3JRC A;  5J4V A;  1QVU A;  1TP4 A;  1MSE C;  1PVE A;  1X1C A;  4IQ4 A;  1FLI A;  2L9V A;  3S15 J;  3BG9 A;  3H3U A;  2IEK A;  2R5Y B;  4ZW7 A;  5AIP A;  2EPF A;  2MW8 A;  2K02 A;  3CUO A;  3BR0 A;  4CH7 A;  1IF1 A;  1OLT A;  1XB4 A;  2ME0 A;  3M8J A;  2R5Y A;  4LG3 A;  2OTJ I;  1ZRD A;  3FTY A;  4ZW6 A;  1R5I D;  2NS7 A;  2BXZ A;  2M7B A;  2CW7 A;  1ETO A;  2HOS A;  1FMW A;  2WAE A;  3IWZ A;  2HFH A;  3CCJ I;  1CGP A;  3U2R A;  5L3B A;  2CYY A;  2PMZ A;  3ZHY A;  3A0B C;  2KFD A;  1LFU P;  2Q0O A;  4PJM A;  4AYS A;  2FBH A;  2K9Q A;  4F7Z A;  2KP6 A;  2ME6 A;  1R36 A;  3I71 A;  5EG0 A;  1YJ9 I;  1GLN A;  5CQE A;  3AL0 C;  1EJ9 A;  2LG4 A;  5D5V B;  3DTI A;  4LMY A;  3WU0 A;  2VBW A;  3FTU A;  2CUF A;  3W6K B;  3GTO J;  4MQV A;  2R7V A;  4A3K J;  4XMV A;  4HOB A;  4B3X A;  3KIO A;  1HW1 A;  2QJ1 A;  4P9F A;  4XN3 A;  4HF0 A;  4XND A;  1MNE A;  4RM3 A;  5JLX A;  3E6B A;  3H0G J;  2FSW A;  3CF2 A;  3PUB A;  3IC7 A;  4WXH A;  4Y13 A;  3D5L A;  3H9G A;  2VXD A;  5JVT A;  5E3M A;  2XRL A;  2K4J A;  4KA4 A;  2QM3 A;  3JRB A;  1TNT A;  4A3C J;  2L7F P;  3COA C;  2OQG A;  1YX5 A;  2DW4 A;  2PMZ N;  4Y33 A;  2W85 A;  2DYS H;  4LUP A;  2X1D A;  3GXO A;  2QQA A;  2ZME C;  3Q5F A;  1ZH5 A;  3CHS A;  4A12 A;  3I56 I;  1XMK A;  1PP8 F;  3K4B A;  4KMU X;  4AR1 A;  2E1O A;  3T1B A;  2KMU A;  4MO7 A;  4NQW B;  1BN5 A;  2XDV A;  3AKZ A;  3H0D A;  3PNY A;  4BXU A;  1YHQ I;  4L9N A;  2E2J J;  1F5T A;  1EV7 A;  1GV2 A;  2Y31 A;  4NQW A;  4XBF A;  3IRR A;  1LUJ B;  4WCG A;  3B02 A;  2ZXG A;  4QUO A;  4UV8 A;  2ZSH B;  2Q8K A;  3HPH A;  1A36 A;  4E7J A;  1FT9 A;  1K61 A;  3M8F A;  1MBJ A;  3J7A Y;  3HOX J;  1OCZ H;  1XGN A;  2BEO A;  2L0K A;  2IA2 A;  4E7Z A;  4OAY A;  3QWL A;  3D5S C;  1ZR2 A;  3FTW A;  3BQY A;  2EH3 A;  4U7D A;  3K69 A;  4XN2 A;  2M3A A;  1I5Z A;  5KHD A;  3BZK A;  2L02 A;  4BU2 A;  4HLY A;  1TT5 B;  3X2Q H;  3CCL I;  3UER A;  2DOE A;  4FX0 A;  2OD5 A;  1ZEL A;  4L9T A;  2W7N A;  3CHR A;  3DBH B;  4EGZ A;  2DOF A;  3TED A;  3N97 A;  4XLP F;  4K5N A;  4CXF A;  2BE5 F;  3RC3 A;  3DWL E;  2JZY A;  4M3D A;  1WJC A;  4AID A;  5F6F A;  4M3G A;  2E19 A;  2KIQ A;  2OTL I;  4RAG A;  2E1M B;  4RCV A;  1FYK A;  4IOC F;  4A0Y A;  2JCX A;  2XAH A;  3LQQ A;  3MQ0 A;  3ULQ B;  4IX7 A;  2JD2 A;  1TT0 A;  3V4G A;  5LEJ A;  2DQL A;  2DCE A;  4D7M A;  3OIP A;  3CJR B;  3E0J B;  1XG1 A;  3WHB A;  1C0W A;  3ABL H;  4MEX F;  1EH6 A;  4JX6 A;  3FU5 A;  5EYR A;  2QSH X;  4RVB A;  3RCO A;  2LKS A;  4M6V A;  4N4N B;  1AOY A;  3G3Z A;  4YIF A;  5TGT A;  2VC1 A;  4DNC A;  1TWH J;  4KIT B;  1SFX A;  4Q5S F;  1TL8 A;  3GZ5 A;  4D1Q A;  3DPL C;  1D8K A;  2IJL A;  3BTC A;  4PDK A;  2F4M B;  5J3L A;  1UG0 A;  2X4H A;  3WTZ A;  2MFZ A;  2LSO A;  4Y3O A;  2PMH A;  2RQP A;  3E97 A;  2QCO A;  1WKM A;  2Z16 A;  3HUG B;  1BJA A;  2IAI A;  2HVQ A;  1ZS2 A;  1NG7 A;  1NHA A;  4JBA A;  5F04 A;  1SAN A;  2XAJ A;  2IGM A;  1MBF A;  1TQI A;  4WF2 A;  2JA6 J;  3CCM I;  1X3Z B;  4XLC A;  1HXD A;  1IN5 A;  1MBH A;  2V6E A;  2XVC A;  4M72 A;  6PAX A;  3I58 A;  5CVV A;  1PDN C;  1X3Z A;  3H9J A;  2VT2 A;  4B1R A;  1KU9 A;  3K2A A;  3RKX A;  5LHI A;  1U9O A;  3ZRG A;  4PGG A;  4HX4 A;  4ENM A;  3P5J A;  3W6V A;  2CV0 A;  4CCN A;  3GTG J;  3FTX A;  1HW2 A;  1OR7 C;  4Q4I A;  2H94 A;  3LL7 A;  2FE3 A;  4BE2 A;  5F0F A;  2WY7 Q;  2LVS A;  2RV8 A;  3R4K A;  1IG7 A;  3G2B A;  2W48 A;  3QPH A;  5DCM A;  1IO2 A;  2R7X A;  1W7P D;  4GAA A;  4OOE A;  2VJ8 A;  5EF6 A;  5DYM A;  4DBQ A;  3FH5 A;  4CYC B;  2OC6 A;  2W24 A;  1LNW A;  3M8E A;  1X1B A;  3B2X A;  1W36 C;  2DQ6 A;  3GO5 A;  4E7H A;  2O6G E;  1Z7L A;  2FX0 A;  3ERE D;  2KIM A;  4DYR A;  2HXI A;  2VBY A;  1BBY A;  2B0L A;  3C2H A;  2O3F A;  3I5U A;  4FX4 A;  2IW5 A;  4NBQ A;  3SFI A;  2DOA A;  3J7Z I;  1AKH A;  5B66 C;  3CJN A;  5EZH A;  2E7W A;  3BP8 A;  1W1W E;  2MA3 A;  4XLH A;  3HSF A;  1TWA J;  2RC4 A;  1Z9C A;  5A2Q Z;  3LSK A;  2RQQ A;  3KP7 A;  4Y7N J;  3I64 A;  4C2T A;  1XDS A;  1DQU A;  2A6T A;  2A3S A;  2STT A;  1ETW A;  4JOM A;  2H6B A;  3F8B A;  3GZ6 A;  3HOV J;  3H92 A;  4X1E A;  3C7J A;  3VSL A;  1ON2 A;  1KON A;  5DD8 A;  2L4A A;  2DK8 A;  3GTJ J;  1X2M A;  1TWG J;  2Q2E B;  4U87 A;  4XKW A;  4EAT A;  2E71 A;  1SAU A;  1VQM I;  1BOB A;  1T98 A;  4EM1 A;  2VAS A;  2JSP A;  5KAI C;  1O7F A;  1SMT A;  1MJA A;  4P1W A;  3BZ6 A;  3KX2 A;  1QO0 D;  4G6T B;  5B3S H;  3OYH A;  1DPR A;  4KNY A;  1W7P B;  1WVR A;  3PFI A;  1S5L C;  3Q43 A;  2KLO A;  1R1V A;  3O8G A;  3RYR A;  5H20 A;  5J4Y A;  3F8M A;  4IHX A;  2DJN A;  3T8V A;  3CUQ C;  4XO3 A;  4BDY A;  2WWY A;  2VOP A;  4CUG A;  4IJA A;  3BRO A;  2JVG A;  3FXU A;  3Q9S A;  4LLN A;  5HLI A;  4WWC A;  1D8J A;  3DBL B;  3ZQF A;  3A06 A;  2KQR A;  3HSR A;  3CCU I;  4ZDO A;  2M8E A;  5LD2 C;  4BXF A;  4BBR J;  1LPQ A;  5F0H A;  4ESF A;  3G1O A;  1J5Y A;  2VN2 A;  2VKV A;  2ZCW A;  2JSC A;  3HB9 A;  3WHC A;  4YRV A;  3JRF A;  1QU3 A;  3VYU B;  1P7J A;  1E0E A;  2V9P A;  1J0R A;  1JKO C;  2FEZ A;  1GXQ A;  5K7H A;  2JJ7 A;  1SD6 A;  4ON0 A;  4RSY A;  1PUF B;  1RZ4 A;  3IH4 A;  1HKT A;  3V7C A;  1R22 A;  1KU7 A;  4Y6P A;  1WJD A;  4XLE A;  1V4R A;  3HOS A;  1PUF A;  4ENK A;  3TO9 A;  4GCV A;  3FUM A;  1ULY A;  1RR8 C;  4XMT A;  2KDZ A;  4PFO A;  4D0P A;  4G12 A;  2RAE A;  3OR1 C;  4QPO A;  1V5G A;  1FJL A;  2P81 A;  2A07 F;  5IOZ A;  1WGX A;  2X48 A;  1ACI A;  2PL5 A;  1IXC A;  5IYC J;  2M1B A;  3HRU A;  3JRE A;  3QRF F;  2OA4 A;  1FTT A;  3MVP A;  1D0Y A;  1MSF C;  4G9Y A;  1RKW A;  1XS9 A;  5JFR A;  4NNJ A;  2NVX J;  1G2H A;  2CUE A;  2R4G A;  1HCR A;  3BWG A;  1I39 A;  1XPX A;  1A31 A;  2GWR A;  2EWN A;  4FIS A;  4MTD A;  2LF8 A;  2VJI A;  2B7E A;  1MMN A;  3VB2 A;  9ANT A;  2ZBK A;  1B9N A;  5AIQ A;  1S7O A;  2VJ5 A;  3ELK A;  1ZGA A;  5ICC A;  3N05 A;  3KCC A;  4KN7 X;  2WPG A;  5FRN A;  4EM2 A;  4RAF A;  3LSJ A;  4FE7 A;  2F5D A;  1O3T A;  2C6Y A;  5EEA A;  1JKQ C;  2M2E A;  3CCY A;  5D6E A;  3F22 A;  2F4I A;  1TQP A;  2NS8 A;  4ZZD A;  1GHC A;  2HQN A;  1MW1 A;  3K1N A;  5JAZ A;  2VKD A;  3L2W A;  3VFZ A;  5LGN A;  4MGR A;  1HDP A;  2YU9 J;  4E70 A;  1NK2 P;  1SC5 A;  1FIA A;  4IRH A;  4NC6 A;  1WHU A;  3IKV A;  2HVR A;  4B43 A;  3VVM A;  2GAU A;  2XB0 X;  3FXQ A;  4F92 B;  2COB A;  4UUS B;  4BY7 J;  2M8G X;  1X1D A;  1G8X A;  4ZX3 A;  1I3Q J;  5FD6 A;  2QQB A;  5DEQ A;  4B8X A;  4M3F A;  1R23 A;  3OSF A;  2I8D A;  4UUS A;  2TCT A;  3TOB A;  3JSO A;  2Y0S A;  4CCM A;  1A35 A;  4BE0 A;  5IT9 Z;  3OS2 A;  1UFM A;  4PGH A;  1SEU A;  1XMA A;  3GCM A;  5CVU A;  5JC1 A;  1U5T C;  2Z1D A;  5H6Q A;  4A3J J;  5K5R A;  3TP3 A;  4CZC A;  2IS2 A;  2L4M A;  5LEK A;  4UB6 C;  3B2P A;  3M4O J;  3KZZ A;  1QPM A;  4F91 B;  3S3N A;  3I59 B;  1XCB A;  1SMY F;  2DPU A;  1OKR A;  1ZRC A;  1ZG1 A;  1MMD A;  4R79 A;  2RNJ A;  2RN7 A;  4IZZ A;  3B7S A;  2R7F A;  3OIO A;  3BG3 A;  5F08 A;  1Z67 A;  5K7Z A;  3C1D A;  2A68 F;  3FBN B;  2HOE A;  4MQ9 F;  2OCE A;  1QVT A;  3FXK A;  3NEU A;  4HQM A;  5D5W B;  3BPX A;  2JPC A;  3LOC A;  2E5N A;  1B8I A;  4X6A J;  2LR8 A;  5E8I A;  4CHU A;  4PK4 A;  2IS4 A;  4N4O B;  3H3V K;  4GGG A;  3B73 A;  3GEZ A;  1FOX A;  4EMS A;  1RES A;  2Y0S N;  3OL3 A;  1AHD P;  4JQF A;  2HR3 A;  3H5A A;  4HAM A;  2FQ4 A;  3LFU A;  2W84 A;  4M9X A;  5HS7 A;  2R7O A;  3S14 J;  3JCU C;  3JR9 A;  2H27 A;  2YX4 A;  2NOG A;  2P0W A;  1MW3 A;  2VT3 A;  2XAF A;  2XV4 S;  3ZHX A;  2LF7 A;  4AIC A;  1NG6 A;  3H5R A;  2QUF A;  1V3F A;  2BY1 A;  3DTE A;  1UST A;  2K40 A;  2Z3Y A;  3I4N J;  3Q44 A;  3KP4 A;  2XAQ A;  1P4A A;  3OYJ A;  2JV7 A;  1GUU A;  1R5G A;  2AHQ A;  4FCY A;  4ZW5 A;  3F8F A;  1OYI A;  4HX8 A;  3TW6 A;  4WK8 F;  1LDJ A;  4HSR A;  3HGG A;  3B7U X;  3FX3 A;  5L3F A;  4FTH A;  4I2O A;  3FHE A;  2KJC A;  1MZB A;  1O7L A;  2BW3 B;  1MH4 A;  3BJ6 A;  4LLG F;  1JUM A;  3DEW A;  3ONQ A;  2XPW A;  3M07 A;  2E2I J;  4M9Z A;  1OFC X;  4XRS A;  4C3H J;  4EGY A;  5D6F A;  2XPV A;  4Q48 A;  1MNM C;  2DT6 A;  2UXX A;  2BHY A;  3DKX A;  1D0Z A;  4IRG A;  3SEZ A;  5J8C A;  2PQ8 A;  2XGX A;  3DLA A;  1V5E A;  2IPQ X;  1XTA A;  2LK2 A;  1DGR M;  3CHQ A;  5FKO A;  2BHZ A;  1IZ1 A;  1WPK A;  1RI7 A;  4BEH B;  4XMY A;  4MFE A;  3BTL A;  4PJL A;  2K4B A;  3TQN A;  4BGD A;  2XSD C;  3SHF A;  5DD4 A;  4ASN A;  1ENH A;  4BEH A;  3GFL A;  3ABM H;  3HXL A;  1K6O A;  3FKI J;  4RB2 C;  4FCA A;  3CDH A;  5GP9 A;  5LHG A;  3Q3S A;  1HBX G;  3OYF A;  3Q0U A;  2GOM A;  3GFJ A;  4N0B A;  1QRY A;  4V2G A;  3ZMT A;  4AUX A;  1Q1V A;  4AWX B;  1Q1H A;  3CES A;  4C30 A;  4XNA A;  3G71 I;  5BPI A;  3FXL A;  1U9N A;  2A7O A;  3FUN A;  3CD6 I;  3ZI0 A;  4RB3 C;  3HKZ A;  4XN5 A;  3FWE A;  2DA7 A;  1ZLK A;  2JK3 A;  4ZZL A;  1TTY A;  1YYV A;  1YIT I;  3HRS A;  1K79 A;  1B4A A;  1ON1 A;  2DA6 A;  1XGM A;  1FP1 D;  2DMP A;  3A03 A;  1G3W A;  4HF1 A;  2OF7 A;  4LB5 A;  1BOA A;  5ICE A;  2XPY A;  3DEU A;  3QPT A;  3O2P E;  5LLQ A;  1RUO A;  3FUK A;  1BR1 A;  5LRR A;  1ZQ3 P;  3UEQ A;  1RP3 A;  2HYJ A;  2L9N A;  4XO4 A;  1T33 A;  4OIR F;  2KPM A;  5FWQ A;  2IP2 A;  2X6W A;  4JX4 A;  1CF7 B;  2HQR A;  1K7A A;  1B59 A;  4ZQE A;  2QEN A;  3EET A;  3HSE A;  3CZK A;  5A2Q K;  3V8K A;  2O8X A;  3CLO A;  4M71 A;  2NOJ B;  4OOF A;  4LIT A;  2D2W A;  1IC8 A;  4DYC A;  3JRI A;  4EV0 A;  2G9W A;  5ILV A;  2KT0 A;  1H9G A;  1KQ9 A;  3O8H A;  3A0H C;  4OWR B;  3FM5 A;  5CJ9 A;  3EUH A;  4YEL A;  4LGW A;  3IHU A;  3QP6 A;  2ESH A;  3HKZ N;  2BZT A;  1ZAR A;  3C18 A;  4ETS A;  1FSH A;  3BTI A;  1S72 I;  4F3Q A;  4ZJZ A;  1E2X A;  1UHM A;  2LBF B;  3RPQ A;  3B7R L;  5JO0 A;  1JHF A;  2ISY A;  4MLO A;  5F1R A;  2X6O A;  3SZP A;  1I3A A;  5FKM A;  2LC2 A;  5M5X J;  3CZ6 A;  2KKO A;  4Y17 A;  3HOW J;  3CZE A;  4N9I A;  2MBF A;  3K1P A;  2P7V B;  5HOD A;  2GA1 A;  2RNG A;  4I76 A;  1OMI A;  4NB5 A;  1T1S A;  4XN0 A;  2LY9 A;  3RC8 A;  2HXO A;  2L7K A;  1JTY A;  2VJJ A;  4MNU A;  2B9S A;  1QA6 A;  3RKW A;  2PJP A;  3VWB A;  3B7T A;  3J7A O;  3RAS A;  3J80 K;  3SDG A;  2FU4 A;  4IOA F;  4XRM A;  3QOE A;  1AWC A;  2QF7 A;  4O3M A;  1TW2 A;  1KQ0 A;  1Y1V J;  4R5T A;  3HRT A;  2X6X A;  2DA5 A;  2VOD A;  4EJW A;  3B6A A;  3UR3 C;  2H09 A;  2CRG A;  2V79 A;  3E6M A;  1U78 A;  5J47 A;  2OPT A;  2E36 A;  3K4C A;  1V54 H;  2DTZ A;  3OY9 A;  1ZLJ A;  4JX5 A;  1T1R A;  1OCC H;  3CP2 A;  1D1B A;  4RGU A;  2QQ9 A;  1MW7 A;  2F48 A;  3CXB A;  2ZJR F;  4NUB A;  4AYB N;  2OZ6 A;  2XUB A;  4IQJ A;  1T6S A;  1JGG A;  2OCC H;  3U1K A;  2CJJ A;  2FXA A;  4AVP A;  2LP0 A;  2NNY A;  1P4X A;  1JJ8 C;  2W82 A;  1D1A A;  4XMX A;  2VQC A;  1DUX C;  1FYM A;  3HW2 A;  1J7K A;  4ZTJ A;  3AG1 H;  3HBL A;  3MKZ A;  1ZGW A;  3LMM A;  2VUM J;  3HIF A;  2COM A;  2XPZ A;  1OYW A;  2A61 A;  4QSH A;  1D5V A;  1BR4 A;  3I4P A;  1R58 A;  4XO5 A;  4BJ5 C;  1RPW A;  4HG2 A;  1MBG A;  2HU9 A;  4QLC U;  3S3O A;  2KJB A;  1FP2 A;  1VND A;  1GVD A;  1VI0 A;  1Q0H A;  1G3S A;  1F43 A;  4X2U A;  2M9H A;  1K4T A;  1HSJ A;  1WJ5 A;  2DI3 A;  5TJJ A;  5D8K B;  3RQI A;  2VOO A;  5IYD J;  2IXS A;  2P5V A;  2Y69 H;  3GW2 A;  2ZJP F;  1LEA A;  1FOK A;  1BJZ A;  4Y6R A;  3MZY A;  3MKL A;  4XOP A;  2DK5 A;  4NC7 A;  3UNG C;  5JR3 A;  2KDO A;  1J59 A;  2XSJ C;  4E4H A;  4AC0 A;  4OIO F;  3BLY A;  1F1Z A;  1S7A A;  3D1N I;  1ZG5 A;  3DU5 A;  1K6Y A;  2HS5 A;  2QZ8 A;  3A2K A;  2L5Q A;  1SD5 A;  4JK1 X;  3CCR I;  4HNV A;  3HOZ J;  3K4L A;  3C2B A;  1R00 A;  1Z3Y A;  3GFM A;  1OCT C;  2XPU A;  3E5Q A;  3O3K A;  1O3Q A;  2ICW G;  1VFC A;  4RA2 A;  2DDB A;  3FMS A;  2QEX I;  2CV2 A;  5IT9 K;  2B63 J;  4A3D J;  1HKS A;  2IBD A;  4J01 A;  2CH0 A;  1RNL A;  4OOI A;  2Z9O A;  2HI3 A;  3OWT A;  3CMA I;  2M45 A;  4G7Z F;  1FC3 A;  5B1B H;  1MW0 A;  3V7R A;  5E79 C;  1YJN I;  2ECB A;  4FLQ A;  3CO7 C;  3E6D A;  3L9F A;  1A5J A;  5DTD A;  2GZW A;  4E7L A;  3CIA A;  1QPI A;  2LH9 A;  1RIO H;  4XN8 A;  1BW5 A;  2VL8 A;  3TL4 X;  1IJW C;  1W4M A;  2L7M P;  3GTQ J;  1ZGJ A;  2BY2 A;  3F21 A;  2STW A;  3QPL A;  2PX9 A;  4XN1 A;  4DYQ A;  1FYL A;  3G4S I;  2NNN A;  1X4O A;  4E7S A;  4QME A;  2JPB A;  4BE1 A;  3FU3 A;  4BHC A;  2JWT A;  4K2E A;  3P9K A;  4IVN A;  3SEQ A;  3D0S A;  4HEA 2;  5C44 J;  3OYE A;  1YE9 A;  2CUZ A;  4UB8 C;  3ZCO A;  3ANM A;  4C9Y A;  1Z91 A;  4XQF A;  4K5O A;  2K9S A;  3BCB A;  4LIU A;  1S3J A;  2CQX A;  5E1Z B;  5EJC A;  4YEJ A;  4ZQT A;  1ONO A;  1MW2 A;  2R7S A;  3F8N A;  2L2O A;  3ABK H;  3HC7 A;  4S0H B;  5GAE J;  3PIO F;  4CZZ A;  4ANJ A;  4GDF A;  3PUF A;  2EA2 A;  3HUG A;  4Y6S A;  3FIS A;  4P9U A;  4NC8 A;  1EKE A;  3RPU D;  2KL4 A;  2CW0 F;  1IXR C;  4A3E J;  3CMY A;  4FQG A;  4DZJ A;  3E1S A;  2X6Y A;  3G1M A;  3SYT A;  2DT7 B;  3WE2 A;  1JI8 A;  4K5L A;  1FBS A;  4I02 A;  1HC8 A;  2RRE A;  3IH3 A;  3BT9 A;  3HOU J;  2EIN H;  1FEX A;  1Q0L A;  4CA0 A;  1J2X A;  3HHG A;  1WJB A;  3L09 A;  4BQN A;  2BGC A;  1F36 A;  2DFH A;  3M9A A;  1KYW A;  1OPC A;  3LSG A;  1EA3 A;  1RKT A;  3JW4 A;  4HA8 A;  3FU0 A;  1X3W B;  4RLF A;  2P5L C;  2H8W A;  3AL0 B;  2NVY J;  4IXA A;  2A5W A;  3GF2 A;  1R1T A;  4A5M A;  3OYC A;  2JRT A;  4AD9 A;  4YFN F;  3BQZ A;  1LDD A;  2X51 A;  5FLX Z;  1X3W A;  3PNT A;  4M6X A;  3OL4 A;  2LLK A;  5K5Q A;  2KZG A;  1IRG A;  3FTS A;  2GLO A;  3G6E I;  3I4M J;  3GTL J;  4EVI A;  2FA5 A;  2DO7 A;  3GBG A;  3KEQ A;  2W25 A;  1MBE A;  3VSK A;  5BS6 A;  1IUY A;  4L0Z B;  4G8X A;  1U0J A;  1AU7 A;  5BQT A;  4ABZ A;  1LKX A;  3CJQ B;  4S04 A;  1SD7 A;  3DU6 A;  4L2L A;  2V6C A;  4CSW A;  2R7U A;  3OR2 C;  4CYC A;  1Y0U A;  5J1U A;  3U1D A;  3P7N A;  2NVQ J;  3HHH A;  2BY0 A;  2QBY B;  3IKT A;  1T39 A;  3HZJ A;  1VQ4 I;  1LQ1 A;  1YTY A;  3TO6 A;  4RMN A;  1X2N A;  4BL0 B;  2JD0 A;  2IVM A;  4LJZ F;  3LAJ A;  2QBY A;  2A6E F;  2MLG A;  4A3L J;  5FJ8 J;  3R0J A;  2ZME B;  5FFZ A;  5L3C A;  2HOA A;  3QOD A;  5LFA A;  2EFW A;  4U0Y A;  5B1A H;  2EJR A;  1KU2 A;  1YRN B;  1TQM A;  2CO5 A;  4L5I A;  2KRH A;  3RPU A;  5FLV A;  4L5J A;  2VBZ A;  1QQI A;  3K10 A;  4ARF A;  1LE8 B;  3ASN H;  1W5S A;  1MND A;  5J6X A;  2PMU A;  3M3Y J;  3G1L A;  3U21 A;  2DOD A;  2EIL H;  3GTP J;  4JP0 A;  1SD4 A;  2V26 A;  3OYA A;  1LE8 A;  3WG9 A;  4BHP A;  3P9I A;  5JHU A;  2Q2E A;  3NAU A;  1B72 B;  1S6L A;  1MMG A;  2HDW A;  3ZMD A;  1ODD A;  1HKQ A;  2PGG A;  3DQV C;  3CO6 C;  5ILS A;  1GT0 C;  1Z77 A;  5HS9 A;  3F9K A;  3GLL A;  1JHH A;  1MGT A;  3DXJ F;  3ZGK A;  4ZQH A;  2HPM A;  2ZSI B;  4PU2 A;  2DMU A;  2VKE A;  4KUM A;  1Z3X A;  4KMF A;  4V19 K;  3NAR A;  3QYF A;  1Z1D A;  1W7P A;  1BI2 A;  3BG5 A;  3JRH A;  2RJI A;  4OIN F;  2LOO A;  3KP6 A;  2Z99 A;  2PG4 A;  2HQ5 A;  2L9R A;  5J40 A;  3HTS B;  3BG6 A;  4F55 A;  4MKT A;  4FLS A;  5HNF A;  3J80 Z;  1SG7 A;  3B3B A;  2HOT A;  2DFF A;  1REP C;  1FOW A;  4PJN A;  4UVC A;  1A04 A;  1H88 C;  3RSN A;  4IKF A;  5GTI C;  4KIS A;  3L00 A;  4R8H A;  4EEF G;  3PO3 J;  4A0X A;  2XGD A;  2HQA A;  2DT5 A;  2RVC A;  1B9M A;  3LSH A;  2EB7 A;  3FBI B;  3JAM Z;  5FFX A;  2CU7 A;  3KYD B;  1DU6 A;  4HLX A;  4BAC A;  4C2M J;  3A14 A;  2EZH A;  2CW8 A;  1W36 D;  4IF4 A;  1VQP I;  2LY1 A;  3RTR A;  4OIQ F;  3HJE A;  1GDT A;  4KP7 A;  4ZDL A;  4HST A;  2R3S A;  3RDI A;  4A3M J;  3KYC B;  1ZK8 A;  2DQM A;  2IGK A;  4PZJ A;  1XSV A;  3ECO A;  2O61 A;  2M5W A;  2XHK A;  2JCV A;  3W2W A;  3WGH A;  4ZH4 F;  4DJA A;  5HS8 A;  3LSP A;  2HDC A;  5E20 A;  3B34 A;  2AQE A;  3PUU A;  4A6E A;  1JUS A;  2XC7 A;  3E5X A;  4P96 A;  5B5E C;  5DYF A;  2QKM B;  1BI3 A;  3WTT C;  3K0L A;  2Z2S B;  5IYB J;  3ZQG A;  3ZQH A;  3H9Q A;  4Y4R A;  3MFK A;  5AEN A;  1YIJ I;  3KET A;  1EH8 A;  2EFQ A;  2KRC A;  2HPT A;  2Y9Z A;  1J9I A;  2YS9 A;  3QYB A;  3FUD A;  3EDP A;  3EUA A;  4ZYE A;  4RLQ A;  2MGQ A;  4Y67 A;  4NHJ A;  1J09 A;  2HKO A;  5FLM J;  1X58 A;  3OSG A;  2GA2 A;  2V1N A;  3FUJ A;  3EPZ A;  5IOY A;  3EUK L;  4KIC A;  2DMT A;  2HDD A;  2JA2 A;  3A02 A;  3HRM A;  3LQR A;  2R93 J;  3PQJ A;  1FOY A;  1ONP A;  2XF7 A;  3L2U A;  3HL2 A;  1WFX A;  1YW8 A;  2ESN A;  3S2W A;  4XOR A;  4ZYA A;  4Q4Z F;  4MIM A;  3VEP A;  2VE9 A;  4HDU A;  1TBX A;  1OR7 A;  3KP3 A;  4A6D A;  4CYD A;  5GPC A;  3HPG A;  3I55 I;  2K3F A;  4XLA A;  2IA0 A;  3A4C A;  3PSF A;  1B6A A;  2ID6 A;  5AON A;  4A69 C;  1JT6 A;  3WTU C;  1P92 A;  4RB1 A;  1D0X A;  2LDU A;  4I0A A;  3W2A A;  1DDN A;  3GVA A;  4HV5 A;  4PSW A;  4AIJ A;  2XQ0 A;  1UCR A;  4KIB A;  5EEH A;  2Y1C A;  2GTQ A;  1RRJ A;  2MG4 A;  5LHH A;  4KDP A;  4A93 J;  4HRI A;  1WJA A;  1I1G A;  4A3G J;  1P4W A;  4M3E A;  4CCK A;  2XGC A;  2LRE A;  3OYI A;  4B44 A;  3J7Y J;  2DXI A;  1HF0 A;  1UHS A;  1G4D A;  2O5R A;  1SVL A;  5KAF C;  1U8B A;  3PM1 A;  2GBY A;  2ZB9 A;  3ZMS A;  1LB2 A;  2P7C B;  3BR6 A;  3J81 Z;  3MCZ A;  2JA8 J;  3HG9 A;  1ZR4 A;  1N77 A;  2N8G A;  3ZHZ A;  3BOQ A;  2QSG X;  3KP5 A;  3GUD A;  3TP0 A;  3RI4 A;  4BJT A;  4LFU A;  2EZI A;  3K4K A;  1O3R A;  3WTV C;  5E17 F;  3GX4 X;  4XMU A;  1AA7 A;  2ID3 A;  3ZQC A;  3PIP F;  3WQR A;  4D7N A;  4UXN A;  3I59 A;  1NK3 P;  4ESB A;  4A3B J;  2OAZ A;  2BY3 A;  2LRD A;  4XKB A;  2QGU A;  3A01 B;  2JUC A;  3FM3 A;  1I6X A;  3EUH C;  2K9M A;  2E34 A;  2CSO A;  3MKY B;  3I9V 2;  1R9T J;  2EFP A;  3AG2 H;  4B09 A;  5HOO A;  2VQH A;  4AR8 A;  3KEO A;  2JTV A;  2PJR B;  1UJ8 A;  3CUQ B;  3TBI A;  3CZL A;  3FXO A;  3F72 A;  3K4M A;  3WE3 A;  4XRS G;  3CDL A;  3AU8 A;  1DU0 A;  2PJR A;  1ERD A;  3ML6 A;  2FBK A;  2H1K A;  3CUQ A;  1IN6 A;  2AXT C;  1A6I A;  2UXN A;  1K83 J;  3VYT B;  1U2W A;  4B4C A;  2MH9 A;  2FUG 2;  2G7H A;  4N9H A;  2K7L A;  3JSP A;  4I0B A;  2HPI A;  3EBH A;  3ZQL A;  3BG7 A;  4BUP A;  3IV5 A;  3C3W A;  3T0Y A;  2MAB A;  4XSZ F;  1Y8R B;  2F5F A;  1BL0 A;  2DPD A;  4JND A;  4XN7 A;  4ZYH A;  4ESJ A;  2V9V A;  3HDD A;  1KU3 A;  3DCF A;  3KZI C;  3K70 C;  2PUS A;  2K9N A;  4TV7 A;  2E1N A;  2UUZ A;  1JT0 A;  4XKC A;  1IV8 A;  2VLA A;  2D45 A;  2A05 A;  1HS6 A;  3W2V A;  1I1S A;  2HPO A;  3IL2 A;  1FPQ A;  2CUJ A;  4D5F A;  2VXZ A;  4KT6 A;  1B1B A;  1OJL A;  2QVO A;  1HW5 A;  2BW3 A;  3KZY A;  2Y9Y A;  3DFG A;  2LKX A;  3MD2 A;  4MFD A;  4UY8 I;  4BJ6 C;  5KVR A;  5HVQ C;  1O57 A;  2YPR A;  1T38 A;  4BHB A;  5D5U B;  2MAO A;  2O9L A;  5FKK A;  2ZJ2 A;  2JCY A;  3CLQ A;  2F5E A;  5FD5 A;  5ILU A;  3T8R A;  3G73 A;  3JRA A;  1WH5 A;  3OS0 A;  2CQK A;  3IP4 B;  4UHT A;  3QYE A;  3OYB A;  3OYD A;  3FXM A;  4LK1 F;  2W4S A;  3FUF A;  3MEX A;  5EZG A;  1OQY A;  5GAG J;  3KYL A;  3FTZ A;  2XKP A;  1X19 A;  3HYI A;  4C3J J;  2GIV A;  2D1H A;  3OMY A;  2DBB A;  3CHO A;  3FXJ A;  2IS1 A;  2HNH A;  2X9D A;  4ITV A;  1WSU A;  1VTN C;  2L3D A;  1UEL B;  4I6Z A;  1ZTR A;  5BPD A;  3S16 J;  2JD1 A;  3NWT A;  5IT3 A;  1WZ2 A;  2DA3 A;  5JBI A;  5TIS C;  1IN8 A;  1MJB A;  5FLX K;  3BY6 A;  4KN4 X;  1H19 A;  3FH8 A;  3B6C A;  3ANL A;  2XF5 A;  2EBI A;  4RGR A;  3SDB A;  5L3E A;  4M6Y A;  2CGP A;  1T95 A;  2CQQ A;  3E3V A;  1HST A;  4ZN6 A;  2OU2 A;  2DMN A;  4LD5 A;  3IAS 2;  2DU9 A;  1X1P A;  1YW9 A;  2VI6 A;  2V1U A;  2W57 A;  3RKQ A;  5JMW A;  1PYV A;  1EF4 A;  2VE8 A;  4ZDP A;  3JTG A;  1Z7U A;  2K5C A;  5D5X B;  1W0U A;  1V5F A;  3ZP5 A;  1SC7 A;  2XB5 A;  3LAP A;  4FE4 A;  1Z0X A;  5FRO A;  2HKX A;  1Y8Q B;  5IPA A;  3PJR A;  3QOP A;  4ZQG A;  2E5Z A;  1Y1W J;  2WZG A;  4V2F A;  2WBM A;  2ZXJ A;  2M34 A;  1E3O C;  1X4P A;  4U7B A;  3EQL F;  3SXY A;  4BXX J;  2V4J C;  4DBR A;  4DW6 A;  5LGU A;  1CF7 A;  2VQG A;  4EJO A;  1U5T B;  2DMQ A;  1MBK A;  2WY8 Q;  2CFX A;  3K7A J;  5E3O A;  1YS6 A;  3MKW B;  2DFI A;  3M7G A;  3PNV A;  2R0Q C;  4OAZ A;  4Q4E A;  4ZW8 A;  1YLF A;  1SFU A;  4C2U A;  1U5T A;  2WAF A;  1GVJ A;  5HLT A;  2FQ3 A;  4IO9 F;  1TNS A;  1QNT A;  2O0Y A;  4M3B A;  3ZQI A;  2NRA C;  3S17 J;  3B37 A;  2K3P A;  2ZNZ A;  2RDP A;  2R5Z B;  2VBX A;  2RKH A;  3H3Z A;  1WH7 A;  1SFE A;  1BR2 A;  5C3E J;  1XSD A;  1FWZ A;  2LBF A;  4IHT A;  2E1M C;  2LMD A;  2P4W A;  3ABT A;  2R5Z A;  2R7D A;  1H0M A;  1J75 A;  5KCM A;  4AYB A;  1SVO A;  5J1R A;  3EBI A;  2Y48 A;  3GZN B;  2YUS A;  3SQN A;  3VYR B;  4R5V A;  3OOU A;  1POG A;  3CC7 I;  2ZFW A;  4HNU A;  1VQN I;  4GYG A;  4BH9 A;  3FH7 A;  4B47 A;  1SAX A;  4PCQ A;  2Y1G A;  4QIR A;  1STZ A;  2Q1Z B;  4IPA A;  1G3T A;  4KJZ A;  3KE2 A;  2D1V A;  4WXD A;  4MS6 A;  2EZL A;  4NDL A;  3QU3 A;  1H89 C;  4LB6 B;  5CKT A;  1YX3 A;  1JXS A;  2TRT A;  3DLL F;  2Y1F A;  1JUP A;  4Q47 A;  1ZHF A;  1O4X A;  4D5C A;  3WQQ A;  4BKX A;  2EQR A;  1K5H A;  5LRS A;  3JAM K;  3LSR A;  4FLO A;  2LKP A;  1P9Q C;  3E6C C;  4L18 B;  1RR7 A;  5KK1 A;  1X3U A;  2JRM A;  4HV6 A;  5DS9 A;  5F1J A;  2MSY A;  5LGT A;  2LNB A;  3PL8 A;  4BYY A;  2EFN A;  5EEG A;  4F93 B;  4XRF A;  1FBU A;  2QLZ A;  3GYH X;  2P6S A;  2WAD A;  4MEY F;  1JG9 A;  3ESW B;  3O6B B;  1ETX A;  1UB9 A;  2HTS A;  2CV1 A;  1IDZ A;  4I99 C;  3FMQ A;  5EG0 B;  5CVI A;  5D4R A;  5J8F A;  3S1M J;  2P5K A;  3L2Q A;  1DPU A;  5CVJ A;  4UVB A;  3BR2 A;  2ELH A;  3LSI A;  2W1O A;  5TRD A;  1NH3 A;  2G7U A;  3KED A;  3HM5 A;  4CIC A;  3ZQQ A;  1XGS A;  2CFO A;  1IV6 A;  2JMW A;  1LVA A;  4RGS A;  5D4S A;  3DKY A;  2CWE A;  1JKP C;  5EV7 A;  2ADU A;  2K86 A;  4XLF A;  3M1C A;  4OMZ A;  3GTK J;  4M9S A;  4G94 A;  5BMZ A;  5JLW A;  3BJO A;  1M1E B;  2Y0M A;  1QHG A;  4YFK F;  4IHS A;  2R92 J;  1WI9 A;  5E3N A;  4XSX F;  4QHP A;  2EFO A;  4HW0 A;  3AUA A;  1Y6I A;  4XK4 A;  4XID A;  3CCQ I;  2CQ7 A;  1G59 A;  5H6R A;  3VPR A;  1JTX A;  1T0F A;  4EQQ A;  4GYI A;  4RAZ A;  5FRM A;  1NTC A;  4LK0 F;  1R5H A;  5E1W A;  5JMP A;  1WQ2 A;  5F64 A;  3TDU C;  3WOD F;  2KZV A;  2LFB A;  4R5X A;  4EJV A;  2X0L A;  4GFB A;  1ORK A;  1HDD C;  1BA5 A;  3U9W A;  2KHM A;  3CDI A;  2FBI A;  2C82 A;  1BW6 A;  4RM2 A;  5LBQ A;  3JT1 A;  4XL9 A;  3KLO A;  3JRG A;  3ANN A;  4AIK A;  3CME I;  4XMW A;  5DUI A;  2DFE A;  2YU3 A;  1IXS B;  4XR6 A;  3FXR A;  5GPA A;  2FMY A;  3VYS B;  3J81 K;  3BZC A;  5M3F J;  5GTH C;  5FKN A;  4BQA A;  1YOV B;  3CHP A;  4FET A;  3FIW A;  3JTH A;  3SFZ A;  1O3S A;  4ENN A;  4K5M A;  3T5X A;  4W97 A;  1ZG3 A;  2IGO A;  1KQ8 A;  1FZP B;  2QVW A;  3HGY A;  3ZR8 X;  1QHH D;  3FMR A;  2PN6 A;  3SJM A;  5J1Y A;  3LST A;  2NS0 A;  3DV8 A;  4L0Y B;  3Q0V A;  1P2F A;  3FK7 A;  1K78 B;  3CMM A;  3RYP A;  2MD0 A;  3DEE A;  3NRV A;  1KZH A;  3D5R C;  2GXA A;  1X1A A;  4HZF A;  1Y0N A;  2HWV A;  3QP5 A;  1VQL I;  4UUV A;  2VJ4 A;  3SZT A;  1FIP A;  1W5C C;  4BBS J;  3V42 A;  1K78 A;  2R70 A;  3BR1 A;  1L3L A;  1VZ0 A;  3H5N A;  2XAS A;  2L01 A;  1F4K A;  3RKY A;  1YQA A;  1TZL A;  5DUK A;  4QPQ A;  2EA4 A;  2LTP A;  5DCF A;  1R49 A;  3ZMU A;  2JA5 J;  4Y52 J;  2WB1 A;  1VQO I;  2PLY A;  4A5N A;  2HGC A;  2LD5 A;  2DJI A;  5ERI A;  1BIA A;  1OCR H;  1WI3 A;  5E3L A;  4FLR A;  3LA7 A;  2JVH A;  1JGI A;  5ICF A;  4S05 A;  4PVB A;  5DM7 F;  4ZC3 A;  1S29 A;  1LFB A;  2I5U A;  3W3C A;  3LNQ A;  4PSX A;  3WTY C;  4XM3 A;  4BQO A;  3V7S A;  4CCJ A;  4BDZ A;  2MLK A;  2UV1 A;  3DF8 A;  3TDZ C;  4XKV A;  2IGN A;  1N78 A;  3OIQ A;  3T8T A;  4AVZ A;  1TWC J;  2ZXW H;  1IN7 A;  1VQ7 I;  1S7E A;  1R1U A;  3C2G A;  3OS1 A;  5BPP A;  4L5E A;  4Z6Y A;  3WG7 H;  1N25 A;  2L9S A;  5CQG A;  1H8A C;  4JYK A;  2J5P A;  4M73 A;  2AQF A;  1HQC A;  3FKJ A;  3S2D J;  1IRZ A;  3TMO A;  2Y1D A;  5CVR A;  3GTM J;  1HOM A;  5FGM A;  1KGS A;  1R0K A;  3CTA A;  3KP2 A;  4DPR A;  2EIK H;  2K9L A;  2NYX A;  5IP9 J;  2A5Y B;  1VQ9 I;  4EJT A;  2F2E A;  2H1L A;  2LYC A;  1MD0 A;  2X1E A;  2EIM H;  4DOZ A;  3I54 A;  4BNC A;  4Y15 A;  3H1C A;  1UMQ A;  5IY5 H;  3HOY J;  3OYM A;  1APL C;  2XRO A;  4XN9 A;  1FBQ A;  4KIG A;  5HDK A;  1BC7 C;  3BJA A;  2WB1 N;  2FD5 A;  2X1C A;  3CF5 F;  4AIH A;  2QA4 I;  2E2H J;  1TC3 C;  3CQZ J;  5E1X A;  2KIF A;  2KRF A;  2ZFU A;  5DCM B;  3F0C A;  2V1X A;  1OCP A;  4BAY A;  2F4O B;  1E3P A;  3ZQ7 A;  1HA8 A;  2IT0 A;  2DA1 A;  3I53 A;  3ZMV A;  2DDA A;  4ZX5 A;  1YJW I;  2IS6 A;  1I50 J;  1RET A;  1PUE E;  3DKW A;  2DA2 A;  4XNB A;  2ACJ A;  1R6R A;  2C5Z A;  1ZN2 A;  1UG2 A;  3KPH A;  3OYK A;  1W0T A;  3TO7 A;  1R4N B;  4KYW A;  2Y30 A;  2VC0 A;  3R6S A;  2BXY A;  2HYF A;  2ZME A;  4BS9 A;  1FX7 A;  1Y39 A;  4U88 A;  3WTX C;  4A3I J;  3OV8 A;  3VOE A;  1UAA A;  4R7L A;  3L7W A;  2P6T A;  1YRN A;  1AKH B;  3CC2 I;  2GXG A;  1G5A A;  1EH7 A;  5K5O A;  3RZD J;  3IUO A;  3S32 A;  4PW4 A;  4J00 A;  4CCL A;  1IRF A;  5DLL A;  4G7H F;  3AFH A;  4XOT A;  1OCO H;  2O7O A;  3NQO A;  4I09 A;  1WJF A;  4QWQ A;  2OZU A;  5L3D A;  2H8R A;  2I10 A;  5JI6 A;  1BIB A;  3S1Q J;  1N75 A;  1TWF J;  3I0T A;  2IRF G;  3DP7 A;  4RS8 A;  2MC4 A;  1DP3 A;  1WJE A;  1VQ6 I;  1PJR A;  2A69 F;  2XIG A;  1B72 A;  2XRN A;  3M1E A;  4B48 A;  4XIC A;  2OV7 A;  1HLV A;  4FT8 A;  4E7K A;  4DZP A;  1RUN A;  4XMZ A;  4EM0 B;  2HZD A;  2PBI A;  1PP7 U;  2Y1E A;  3KFW X;  1IW7 F;  5GAD J;  1IAW A;  2MYS A;  3UKG A;  4M74 A;  1YG2 A;  2CQN A;  4PJJ A;  1MDM B;  3PO2 J;  1BC8 C;  1Z6T A;  1ETY A;  1LVK A;  2FJ1 A;  3K4N A;  3IIE A;  2MAP A;  1YW7 A;  4U0W A;  1MDM A;  3HTU A;  1FMV A;  3ECH A;  1VQK I;  5HLG A;  1T8I A;  4B3A A;  3V8L A;  1JE8 A;  5HDN A;  1DP7 P;  5BNG A;  2BYV E;  1MKM A;  3KEY A;  4ZX4 A;  1MVY A;  2QSF X;  1R4M B;  2BVL A;  4O6J A;  5CLS A;  3OYG A;  1R71 A;  3FUL A;  1IRX A;  2VPR A;  3F6O A;  3P9C A;  3AG4 H;  2FOW A;  2VQL A;  4H4K C;  1YI2 I;  2M0C A;  3CC4 I;  3CCE I;  1E3H A;  1RC9 A;  2EIJ H;  1U8R A;  1ETQ A;  2AO9 A;  2D5V A;  1P6R A;  1XN7 A;  4HDV A;  1UZC A;  1ZAO A;  3AAF A;  1E17 A;  1G6N A;  2PFB A;  3IWF A;  2EZK A;  1LFP A;  4I7H A;  4CGZ A;  4OIP F;  2R72 A;  5E8G A;  3R0A A;  1WWX A;  5M5Y J;  1GV5 A;  3L2C A;  1ZRF A;  1CQT A;  3L2V A;  2WZF A;  1JJ6 C;  4IEJ A;  3VOD A;  2V9K A;  3PSI A;  3Q0W A;  4J3B A;  2JUG A;  2FOK A;  4ZTF A;  4GXO A;  5HDG A;  3FUE A;  2PI0 A;  1Z05 A;  5H2F C;  3FU6 A;  2CS3 A;  2M87 A;  2YR2 A;  2V7F A;  2P8T A;  5KNL A;  2GQQ A;  4X0G A;  1XSX A;  3BPV A;  2M4G A;  3LFK A;  1XMX A;  1FNN A;  4C3I J;  2R7Z J;  2GOX B;  3K9T A;  4F52 A;  1OIS A;  3R61 A;  3WU2 C;  1VQ8 I;  1W5T A;  4KT5 C;  2DQR A;  2YX7 A;  4LLL A;  4EJU A;  3KLN A;  3ERM A;  1WCM J;  4XON A;  1H3L A;  4DQ2 A;  3F6V A;  3MWM A;  3TOA A;  3H35 A;  2XAU A;  3CJT B;  3Q9V A;  4L9J A;  5FKL A;  1Z6R A;  2E7X A;  3QQA A;  3BR3 A;  3DPU A;  3V8J A;  2HEO A;  4H0E A;  2WAQ A;  3ABU A;  2DTR A;  1YIO A;  4K5P A;  3BR5 A;  4ZYG A;  3ZN0 A;  2IA1 A;  4W1U A;  5IP6 A;  2MH2 A;  2OQR A;  5E18 F;  3OYN A;  2FNA A;  2WA0 A;  2L54 A;  4OMY A;  5JVG F;  2QQ8 A;  4CCO A;  1OYY A;  2FNP A;  3FTV A;  1ETK A;  2QYO A;  3RQ4 A;  5DDG A;  2JQ7 A;  3W6J B;  3ROU A;  4MHG A;  3H36 A;  5ICG A;  1IN4 A;  3F8C A;  1SFO J;  2GXB A;  2JA7 J;  4QPE A;  2MC3 A;  4PUS A;  2Z5U A;  1QGP A;  5CPR B;  3N4M A;  2DN0 A;  3FHZ A;  2JT1 A;  4L9V A;  2M30 A;  3FZV A;  2JN6 A;  2VPL A;  2GM4 A;  3CCV I;  3PFY A;  4RBO A;  5K7F A;  2WV0 A;  1MH3 A;  4HYE A;  4RDU A;  4ZX6 A;  2ZJQ F;  2DYR H;  4GRI A;  2FFL A;  5BOX A;  1XGO A;  2EV0 A;  4WXC A;  2M0M A;  5ED4 A;  2VB6 A;  2O8K A;  1IUF A;  3MZH A;  3DBR B;  1TW3 A;  1XD7 A;  3TGN A;  2E35 A;  2WAQ N;  2ZXH A;  1GW6 A;  2WC2 A;  1K4S A;  1ZYR F;  3UCQ A;  3MAJ A;  3GLX A;  3FUI A;  3FUH A;  3ASO H;  5IP7 J;  3CP8 A;  1QZZ A;  4MTE A;  3A01 A;  4BY1 J;  2Y2Z A;  1I6H J;  2DLL A;  2ISZ A;  5FO5 A;  4II3 A;  1JKR C;  3S8P A;  1U3E M;  3K4J A;  4O5V A;  1YS7 A;  2NXN B;  2PEX A;  4ZYD A;  2E60 A;  4RB0 A;  3ZN1 A;  1B8I B;  2J5O A;  2XKO A;  2CMP A;  1YO5 C;  3R0I A;  3REO A;  4YFX F;  1I27 A;  2ETH A;  2FRH A;  3WTS C;  4HNT A;  2CG4 A;  1V55 H;  3K1M A;  2LY2 A;  4I01 A;  1KYZ A;  3FDY A;  4IL6 C;  4CDG A;  1SVM A;  3LSM A;  3QPS A;  3WTW C;  4IHW A;  3WGG A;  2A6H F;  4UV9 A;  4Z2Y A;  1GXP A;  4DGW B;  4DIQ A;  4XN4 A;  2VON A;  3ISP A;  2M7A A;  3BDD A;  4I98 B;  3EBG A;  2F5C A;  3BTJ A;  3S1R J;  1UHW A;  3I3L A;  4G6D A;  4YIR X;  3K2Z A;  3IRQ A;  1T08 B;  4RGX A;  2BV6 A;  5GAH J;  5C4J J;  4RAY A;  3RIR A;  4U0V A;  3U9G A;  2BOL A;  2UZK A;  3K6G A;  4AR9 A;  3RJP A;  2Z33 A;  5HLH A;  2ZNY A;  4UVA A;  2BBY A;  1S9H A;  5CYV A;  2ZKZ A;  4QTR A;  1L0O C;  2F6C A;  4HBL A;  3SZG A;  1DGW Y;  4PJ0 C;  4G6Q A;  5F0C A;  5M3M J;  3DTK A;  4WX9 A;  4HF2 A;  2HZT A;  3AG3 H;  4IHY A;  1R0L A;  4YII A;  4J19 A;  5L3G A;  3EYY A;  2EK5 A;  1TLH B;  2X85 A;  4II2 A;  5EGO B;  1KA8 A;  2AXL A;  4A03 A;  1H9T A;  3ZMZ A;  3S93 A;  1SQM A;  4LOC A;  4R1H A;  2NVU B;  2MD5 A;  4AU7 A;  4ZW3 A;  2BVM A;  1XC5 A;  2K27 A;  4GO1 A;  4ENJ A;  1BI1 A;  2OBP A;  5EGO A;  3HOT A;  5JNL A;  2R7R A;  1MMS A;  1A6Q A;  2NVT J;  2R7T A;  2FML A;  1D1C A;  2VIX A;  2K85 A;  4D9J A;  1BI0 A;  1XDU A;  3FK6 A;  1Z21 A;  5C4X J;  2W00 A;  1FSE A;  5DV5 A;  3GWZ A;  1T56 A;  2WTE A;  5D8L B;  1Y56 A;  3QJX A;  3PQK A;  3ZPL A;  2ELK A;  3ZXS A;  2UWM A;  3LA2 A;  4E7I A;  3CZG A;  4LIV A;  3BC8 A;  3QU6 A;  2XF6 A;  1D3Y A;  1R7J A;  2ZO4 A;  3L1P A;  3LWF A;  3OOP A;  2ELJ A;  2ECC A;  1LJ9 A;  3DPT A;  3E5U A;  4XLN F;  3E7L A;  4HPQ A;  4FAS D;  4A0Z A;  4FHT A;  4UNO A;  1F9N A;  2HYG D;  2EV6 A;  2QWW A;  5DUL A;  1ITY A;  1USS A;  3GME A;  1QZY A;  1U6G A;  2FF4 A;  1T0F C;  2M4K A;  2RGV A;  3FF5 A;  2VKH A;  3FHN A;  4PFP A;  1S46 A;  3S2H J;  2KIS A;  2H6C A;  3IAM 2;  1MJ9 A;  2R7Q A;  2EGH A;  3VDX A;  1D5Y A;  4G7O F;  2V1D A;  3GFI A;  1LDK B;  2EV5 A;  5M5W J;  1XCV A;  1FTZ A;  1MMA A;  4OU0 A;  5HNH A;  3F3X A;  4AM3 A;  1ETV A;  2O03 A;  2NAZ A;  4BQQ A;  1IGN A;  1BM9 A;  3QAH A;  3K70 D;  1XX5 A;  3LA3 A;  2QKL B;  1G3Y A;  1QBJ A;  3RZO J;  1ONN A;  2YSR A;  2HVS A;  3R60 A;  2KIU A;  4P55 A;  4XNF A;  4IHV A;  4LG0 B;  1Q0Q A;  4KIF A;  1LEB A;  2R7W A;  3MN2 A;  5DM6 F;  3IH2 A;  2ZC2 A;  3TW7 A;  3S1N J;  2B61 A;  4HX7 A;  3OYL A;  1JVS A;  1ONV A;  1WRJ A;  2WV1 A;  4LG0 A;  4A2U A;  2DAO A;  1JGS A;  2TDX A;  4GAE A;  1FY7 A;  2F5V A;  2DA4 A;  2OJE D;  3WGI A;  2R59 A;  5K1Y A;  3L2R A;  4UUT A;  2O7G A;  4QIW N;  2OUM A;  4A3F J;  4HQE A;  2AS5 F;  3JSZ A;  4ZQF A;  2XAG A;  2ZXI A;  4KFC A;  3ZOB A; 
#chains in the Genus database with same CATH homology
 3MMY B;  3WQS B;  3CMM A;  2MD0 A;  2E5N A;  3DEE A;  3S3M A;  3D5R C;  4P5O A;  1X1A A;  3BG6 A;  4E6K G;  4F55 A;  4PK4 A;  2IS4 A;  4MKT A;  4FLS A;  3BCA A;  5HNF A;  1SG7 A;  3B3B A;  4N4O B;  2VJ4 A;  2R70 A;  3V42 A;  5JHF A;  3OL3 A;  3A1Y A;  4PJN A;  3RSN A;  4JQF A;  3NWS A;  1SFK A;  1VZ0 A;  3H5N A;  3H5A A;  3LFU A;  4IKF A;  4KIS A;  2R7O A;  3VVL A;  1TZL A;  2P0W A;  1MW3 A;  3AU9 A;  2HQA A;  3LSH A;  4QPQ A;  3FBI B;  3ZHX A;  4AIC A;  1NG6 A;  3H5R A;  4BAC A;  3A14 A;  3DTE A;  1X1C A;  4IQ4 A;  2WB1 A;  2CW8 A;  1W36 D;  3Q44 A;  2DJI A;  2LY1 A;  3RTR A;  3OYJ A;  2JV7 A;  4ZW7 A;  4KP7 A;  4FLR A;  4ZW5 A;  4ZDL A;  4HST A;  2JVH A;  1JGI A;  4HSR A;  4PVB A;  3B7U X;  4ZC3 A;  4CH7 A;  2DQM A;  1OLT A;  3M8J A;  3W3C A;  4PSX A;  4LG3 A;  4XM3 A;  4BQO A;  4CCJ A;  4BDZ A;  2UV1 A;  3FHE A;  2BW3 B;  2IGK A;  4XKV A;  2IGN A;  3FTY A;  4ZW6 A;  1N78 A;  3OIQ A;  4AVZ A;  2M7B A;  2JCV A;  3ONQ A;  2CW7 A;  3W2W A;  3PUU A;  3B34 A;  4DJA A;  1FMW A;  2WAE A;  3C2G A;  3OS1 A;  5BPP A;  2AQE A;  3ZHY A;  2PMZ A;  2XC7 A;  2L9S A;  5CQG A;  5DYF A;  2QKM B;  2Z2S B;  2AQF A;  2DT6 A;  3H9Q A;  4Y4R A;  3SEZ A;  3FKJ A;  3DKX A;  1D0Z A;  5AEN A;  4PJM A;  3TMO A;  3DLA A;  2Y1D A;  4AYS A;  1V5E A;  2KRC A;  1DGR M;  2KP6 A;  1R0K A;  3CHQ A;  2HPT A;  4DPR A;  2K9L A;  1GLN A;  5CQE A;  3AL0 C;  3QYB A;  3FUD A;  2LG4 A;  3EUA A;  4BEH B;  4RLQ A;  2LYC A;  4XMY A;  4Y67 A;  1J09 A;  2X1E A;  3DTI A;  4DOZ A;  4PJL A;  3FTU A;  2V1N A;  3FUJ A;  3EPZ A;  4BGD A;  3EUK L;  2R7V A;  3OYM A;  4XN9 A;  4BEH A;  2JA2 A;  4XMV A;  4B3X A;  3HXL A;  2XF7 A;  1ONP A;  2QJ1 A;  2X1C A;  4FCA A;  3L2U A;  3HL2 A;  1WFX A;  4XN3 A;  4XOR A;  4ZYA A;  4XND A;  2ZFU A;  1OR7 A;  1MNE A;  4RM3 A;  3OYF A;  3HPG A;  2GOM A;  1HA8 A;  3CF2 A;  3PUB A;  4XLA A;  3A4C A;  3PSF A;  4ZX5 A;  3D5L A;  3H9G A;  3CES A;  2IS6 A;  4C30 A;  2VXD A;  4XNA A;  1D0X A;  3W2A A;  4PSW A;  2A7O A;  2XQ0 A;  2Y1C A;  3FUN A;  4XNB A;  1R6R A;  2C5Z A;  2GTQ A;  3OYK A;  3ZI0 A;  3HKZ A;  4XN5 A;  1YX5 A;  4Y33 A;  4LUP A;  2X1D A;  4HRI A;  4BS9 A;  3CHS A;  1WJA A;  4CCK A;  1UAA A;  4R7L A;  2LRE A;  3OYI A;  4B44 A;  2DXI A;  3K4B A;  4AR1 A;  2KMU A;  2O5R A;  4NQW B;  1G5A A;  2XPY A;  2XDV A;  3IUO A;  3S32 A;  3PNY A;  3AKZ A;  4CCL A;  3H0D A;  4J00 A;  3FUK A;  4PW4 A;  5DLL A;  1BR1 A;  3AFH A;  3UEQ A;  3HG9 A;  4XOT A;  1N77 A;  4NQW A;  3ZHZ A;  1WJF A;  1RP3 A;  2L9N A;  4XO4 A;  4QUO A;  2ZXG A;  4BJT A;  2KPM A;  2ZSH B;  5FWQ A;  3HPH A;  2X6W A;  1N75 A;  3K4K A;  4E7J A;  2MC4 A;  1DP3 A;  3J7A Y;  1WJE A;  1AA7 A;  4XMU A;  4ZQE A;  1PJR A;  4E7Z A;  4OAY A;  3D5S C;  3CZK A;  3FTW A;  3WQR A;  4B48 A;  2OV7 A;  2NOJ B;  4OOF A;  4XN2 A;  4E7K A;  4LIT A;  2LRD A;  2M3A A;  4XKB A;  5KHD A;  4BU2 A;  3UER A;  4XMZ A;  2HZD A;  4OWR B;  2Y1E A;  1ZEL A;  3EUH C;  4YEL A;  2W7N A;  3CHR A;  2MYS A;  2K9M A;  3MKY B;  3I9V 2;  4PJJ A;  4K5N A;  4CXF A;  5HOO A;  3DWL E;  3RC3 A;  2VQH A;  4AR8 A;  4F3Q A;  4ZJZ A;  1WJC A;  2PJR B;  2LBF B;  1LVK A;  3IIE A;  3K4N A;  3B7R L;  4RCV A;  2E1M B;  5JO0 A;  2MAP A;  1FMV A;  4MLO A;  3TBI A;  2JCX A;  2JD2 A;  4IX7 A;  3K4M A;  3CZL A;  1TT0 A;  2LC2 A;  3CZ6 A;  3AU8 A;  2DCE A;  2PJR A;  3CZE A;  3KEY A;  3OIP A;  3CJR B;  1ERD A;  1MVY A;  4ZX4 A;  2BVL A;  3OYG A;  3E0J B;  3FUL A;  1IRX A;  3VYT B;  2RNG A;  2FUG 2;  1T1S A;  3FU5 A;  4RVB A;  2VQL A;  4XN0 A;  3RCO A;  2HPI A;  4N4N B;  4H4K C;  3EBH A;  3BG7 A;  5TGT A;  4BUP A;  3RC8 A;  2L7K A;  4KIT B;  3T0Y A;  2VJJ A;  2MAB A;  4D1Q A;  3VWB A;  4JND A;  3B7T A;  4XN7 A;  3DPL C;  3RAS A;  3K70 C;  1UG0 A;  3QOE A;  2PUS A;  2MFZ A;  2UUZ A;  4Y3O A;  4XKC A;  2VLA A;  4R5T A;  1HS6 A;  2Z16 A;  3W2V A;  1LFP A;  2X6X A;  3HUG B;  2HPO A;  2HVQ A;  2CUJ A;  3UR3 C;  2VXZ A;  4KT6 A;  1NG7 A;  1ZS2 A;  2R72 A;  2BW3 A;  2IGM A;  3L2V A;  3MD2 A;  2WZF A;  2V9K A;  3K4C A;  4BJ6 C;  3PSI A;  5HVQ C;  4J3B A;  2JUG A;  4XLC A;  3OY9 A;  4ZTF A;  2MAO A;  2V6E A;  3FUE A;  2JCY A;  1T1R A;  1X3Z A;  3CP2 A;  1D1B A;  2CS3 A;  3H9J A;  3FU6 A;  2V7F A;  5KNL A;  1MW7 A;  4X0G A;  4NUB A;  3ZRG A;  3OS0 A;  2M4G A;  3IP4 B;  3OYD A;  3QYE A;  3OYB A;  4IQJ A;  2CV0 A;  2GOX B;  4CCN A;  4F52 A;  2W4S A;  3FUF A;  3KYL A;  3FTZ A;  2W82 A;  1X19 A;  1D1A A;  3FTX A;  3OMY A;  4XON A;  1H3L A;  4XMX A;  3CHO A;  2VQC A;  2IS1 A;  2HNH A;  4ITV A;  3H35 A;  1OR7 C;  4ZTJ A;  3LL7 A;  4Q4I A;  2XAU A;  1UEL B;  3MKZ A;  4BE2 A;  3LMM A;  2JD1 A;  3DPU A;  2WY7 Q;  3NWT A;  2XPZ A;  5JBI A;  3G2B A;  2WAQ A;  1BR4 A;  4XO5 A;  2R7X A;  4K5P A;  1H19 A;  4BJ5 C;  3FH8 A;  4HG2 A;  4GAA A;  2HU9 A;  3S3O A;  4OOE A;  2VJ8 A;  3OYN A;  3ANL A;  2XF5 A;  1Q0H A;  4DBQ A;  2WA0 A;  3SDB A;  3FH5 A;  2OC6 A;  4X2U A;  1T95 A;  1X1B A;  3B2X A;  1W36 C;  2DQ6 A;  4ZN6 A;  4E7H A;  4CCO A;  1WJ5 A;  1Z7L A;  3IAS 2;  3FTV A;  3RQ4 A;  5JMW A;  2IXS A;  1PYV A;  4Y6R A;  3C2H A;  4ZDP A;  4QPE A;  2K5C A;  4XOP A;  4PUS A;  1V5F A;  4NC7 A;  5CPR B;  3UNG C;  2DOA A;  5FRO A;  2KDO A;  2VPL A;  2XSJ C;  3PJR A;  4E4H A;  4ZQG A;  3BLY A;  2E5Z A;  3PFY A;  2WZG A;  3DU5 A;  2WBM A;  4XLH A;  1K6Y A;  4ZX6 A;  3A2K A;  2L5Q A;  4GRI A;  2FFL A;  3K4L A;  3LSK A;  1X4P A;  2RQQ A;  4U7B A;  1Z3Y A;  4C2T A;  2M0M A;  1DQU A;  2A6T A;  2V4J C;  2VB6 A;  4DBR A;  4JOM A;  2VQG A;  2WY8 Q;  3VSL A;  1KON A;  3MKW B;  2CV2 A;  2ZXH A;  1GW6 A;  2Q2E B;  3PNV A;  4U87 A;  4OAZ A;  4XKW A;  4EAT A;  4Q4E A;  4J01 A;  4C2U A;  4ZW8 A;  2CH0 A;  1SAU A;  2WAF A;  3OWT A;  5HLT A;  1BOB A;  2VAS A;  3UCQ A;  2JSP A;  3FUI A;  3FUH A;  1MW0 A;  3CP8 A;  3B37 A;  4FLQ A;  2K3P A;  4P1W A;  3KX2 A;  4G6T B;  3OYH A;  4E7L A;  3CIA A;  3Q43 A;  4II3 A;  1BR2 A;  3S8P A;  2LH9 A;  4XN8 A;  2KLO A;  3K4J A;  2VL8 A;  3TL4 X;  2LBF A;  3T8V A;  2E1M C;  2E60 A;  4XO3 A;  4BDY A;  2CMP A;  5KCM A;  4AYB A;  3R0I A;  4XN1 A;  3EBI A;  1X4O A;  4CUG A;  4R5V A;  3VYR B;  4E7S A;  3OOU A;  4QME A;  2JVG A;  4HNU A;  4BE1 A;  3FU3 A;  4HNT A;  3FH7 A;  2LY2 A;  4B47 A;  3FDY A;  3LSM A;  2Y1G A;  3A06 A;  2KQR A;  4QIR A;  2Q1Z B;  3SEQ A;  4HEA 2;  4ZDO A;  3OYE A;  5LD2 C;  1YE9 A;  4KJZ A;  4BXF A;  2CUZ A;  4DGW B;  3ZCO A;  4DIQ A;  3ANM A;  4XN4 A;  4MS6 A;  4C9Y A;  2M7A A;  5CKT A;  1YX3 A;  4XQF A;  3EBG A;  4K5O A;  4YRV A;  3BCB A;  4LIU A;  1QU3 A;  3VYU B;  4YEJ A;  4ZQT A;  1E0E A;  1ONO A;  2Y1F A;  1MW2 A;  2R7S A;  3I3L A;  2L2O A;  3HC7 A;  4RSY A;  3WQQ A;  4ANJ A;  4BKX A;  1K5H A;  2BOL A;  3K6G A;  4FLO A;  4Y6S A;  4AR9 A;  1P9Q C;  4Y6P A;  4NC8 A;  1WJD A;  4XLE A;  1S9H A;  2KL4 A;  3RPU D;  3HOS A;  2F6C A;  3SZG A;  3FUM A;  1DGW Y;  3DTK A;  3E1S A;  2X6Y A;  4XMT A;  3PL8 A;  4PFO A;  2DT7 B;  3SYT A;  1JI8 A;  4K5L A;  1R0L A;  4F93 B;  3OR1 C;  4QPO A;  2RRE A;  1V5G A;  2WAD A;  1JG9 A;  1Q0L A;  2X85 A;  4II2 A;  4CA0 A;  1WJB A;  4BQN A;  4A03 A;  2CV1 A;  3LSG A;  3S93 A;  2PL5 A;  1SQM A;  1EA3 A;  4AU7 A;  4ZW3 A;  2BVM A;  3FU0 A;  4RLF A;  1D0Y A;  3AL0 B;  3HOT A;  4NNJ A;  5JNL A;  2R7R A;  2A5W A;  2R4G A;  3L2Q A;  3OYC A;  2R7T A;  1D1C A;  2VIX A;  2X51 A;  3LSI A;  2W1O A;  4D9J A;  1X3W A;  2VJI A;  3PNT A;  3KED A;  1Z21 A;  3OL4 A;  2W00 A;  1MMN A;  3ZQQ A;  3FTS A;  2CFO A;  1Y56 A;  2VJ5 A;  3GBG A;  3DKY A;  3VSK A;  3N05 A;  3QJX A;  5EV7 A;  3ZXS A;  2UWM A;  1U0J A;  4XLF A;  4E7I A;  2WPG A;  1LKX A;  3CJQ B;  3M1C A;  4LIV A;  3BC8 A;  5FRN A;  3CZG A;  3DU6 A;  4L2L A;  2XF6 A;  4CSW A;  1QHG A;  2R7U A;  2ELJ A;  3DPT A;  3OR2 C;  2F4I A;  4HPQ A;  4FAS D;  4QHP A;  1MW1 A;  3AUA A;  1Y6I A;  5JAZ A;  2VKD A;  3L2W A;  5DUL A;  4RMN A;  4BL0 B;  2JD0 A;  1G59 A;  1T0F C;  2M4K A;  1SC5 A;  2VKH A;  3FHN A;  4PFP A;  5FRM A;  1S46 A;  2HVR A;  4B43 A;  3QOD A;  5LFA A;  3VVM A;  3IAM 2;  4F92 B;  5JMP A;  2R7Q A;  2EGH A;  3VDX A;  4ZX3 A;  1X1D A;  1G8X A;  2KZV A;  1LDK B;  4R5X A;  1MMA A;  2I8D A;  5HNH A;  2KRH A;  2Y0S A;  4CCM A;  3U9W A;  4BE0 A;  2KHM A;  4BQQ A;  2C82 A;  3OS2 A;  3K10 A;  4RM2 A;  4ARF A;  3K70 D;  3JT1 A;  4XL9 A;  2QKL B;  1MND A;  3ANN A;  4XMW A;  1ONN A;  2HVS A;  5JC1 A;  2Z1D A;  4XR6 A;  3U21 A;  4XNF A;  4CZC A;  2V26 A;  3VYS B;  3OYA A;  2IS2 A;  1Q0Q A;  3B2P A;  2R7W A;  2HDW A;  1MMG A;  3CHP A;  4FET A;  2PGG A;  4F91 B;  3S3N A;  3OYL A;  2B61 A;  3DQV C;  1JVS A;  1MMD A;  3F9K A;  4R79 A;  4GAE A;  2F5V A;  4IZZ A;  3B7S A;  3ZGK A;  2R59 A;  2HPM A;  2IGO A;  2ZSI B;  4K5M A;  4PU2 A;  4ZQH A;  3L2R A;  2O7G A;  2QVW A;  1Z3X A;  2OUM A;  3ZR8 X;  1QHH D;  3QYF A;  3JSZ A;  4ZQF A;  2RJI A;  3FBN B;  2LOO A;  2ZXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...