5HP1A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and foscarnet, a pyrophosphate analog
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/inhibitor/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 152
structure length 553
sequence length 553
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hp1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hp1A05
4FJ9A 1S1TA 4KB7A 3M9MB 4CECA 4Y1CA 3QZ8A 1L3SA 4KV8B 1TKTB 2IJFA 3U3YA 1IKVB 4FZYA 4BWMA 4YFUA 1SKSA 5I3UA 2OZMA 1QE1B 5CZ1A 1T03B 3VQPA 5DG9A 3UPFA 3DMJB 5J2MB 4IRDA 3SYZA 1NJZA 1TKXB 3JSMB 4CHQA 4FBTA 4Y2AA 1BQNB 1HPZA 4XPEA 3LZIA 3OLAA 3K5MA 1HMVB 4CGDA 5F8NA 2C2DA 5D3GB 4AHSA 3KLIA 3QYYA 5DLGA 1BIUA 4HTUA 5KFPA 1U49A 4CJ3A 1TVRA 3FSIA 2RKIB 3AVGA 1TVRB 4CJFA 3H5UA 1VSLA 1S1WB 4NLUA 3DRSB 1XI1A 3CM6A 1QHTA 2DY4A 4PUOB 4F2RA 2OPRA 4DLGA 3Q8SB 2QXFA 1HQEA 4DEZA 4ZPCA 5L1IA 5KG7A 5KG2A 3HXMA 2G8KA 3DRPA 1LWFA 4N47A 2QV6A 3S9HA 2G8FA 3QESA 3LWLA 4FLYA 2DPIA 3SPYA 2IOCA 3SQ4A 4XO0A 3C6TA 1S9EA 4KI4A 5F8JA 2OPPB 4J9PA 2FBXA 4CCHA 4MK8A 1IKXA 3KNAA 4KTWA 3NKYA 2W7OA 1LWEA 2XI3A 4KAIA 4ELTA 2VG7B 1FKOB 3RB0A 2ASDA 4WYLA 4FJ5A 2F96A 3RAXA 1HYSB 4FW1A 1WAFA 3WNFA 4NLGA 4QW8A 3TWHA 4H8KA 1RT4B 1TL3A 4ZPBA 1S9FA 3NDKA 4CIGA 1RBVA 2ASJA 1WNSA 2IC3A 5KFQA 3ZSQA 2CJQA 2WB4A 3V6DA 4IBNA 5HBMA 1S5JA 1KLNA 4DU4A 1SKWA 1K6YA 4PUOA 4JLHA 4C8OA 1KLMA 1NK9A 2VA3A 3H40A 4YR0A 3SV3A 3AA2A 1DTTB 3DOLB 4TQSA 2UVWA 3MEDA 3KK1B 2R2RA 3I8DA 4ZMMA 3RRHA 3ITHA 3KHRA 1T05B 1WLJA 4B9UA 4CK1A 3THVA 2OPSA 2GUIA 5KFFA 5FRMA 1JXBA 2ASLA 4ED6A 1JLQA 2XGQA 2G8UA 4OLAA 4J9LA 1D9FA 1CLQA 1NNDA 1W9HA 3ISNC 4DLEA 5KT3A 3M8PB 2ALZA 4MKAA 5HRNA 4CJ4A 2IA6A 1JLAB 3IRXB 1SV5B 2IAJA 2AQ4A 5K14B 3TAQA 3OY9A 1GX5A 1BIZA 5KRTA 1IKXB 4DTOA 2WOMB 1YT3A 3GIMA 1IKYB 3Q8QB 4J9QA 4OGEA 1C1AA 1Q8IA 4DG1A 2AGQA 5C42A 3M8RA 3HVAA 4KFBA 1RTHB 2Z1HA 4Z4HA 3PY8A 3HP9A 4FCYA 2OH2A 3TAGA 5DK5A 4ECYA 4KTQA 1B92A 4K4ZA 4FM2A 1JLCA 1JIHA 1QSYA 2DFHA 2FVCA 3DRRA 4KHRA 4DF8A 4HVJA 3ITHB 2KW4A 4RW9B 1RT2A 1TAUA 3DLKB 5JUMA 1ZBUA 3AVBA 5T7BA 3GILA 3PW2A 1WSHA 3AVMA 3RTVA 4DSIA 3G0ZA 1S6PA 3VQ8A 4HCBA 1QSSA 2PZSA 1YTUA 4F4KA 3ZT1A 4Y1DA 4NLSA 1T7PA 4AHRA 1HJRA 1QS4A 4LD0A 3V9UA 3C6UA 4K4XA 1YVFA 2I1RA 4ELUA 4M45A 1S0OA 1GOAA 4KB0A 3M8QB 1KFSA 1SH2A 2X78A 3LP1A 4TN2A 3C95A 4CEEA 3AV9A 2O4IA 4CJQA 4IH5A 1NKCA 3T5JA 5CYQA 4HYKA 3DLBA 3NGDA 2DTUA 1ASWA 3M9NB 3BQ1A 3SPZA 1MU2B 1HARA 2JGUA 3PZPA 1QUVA 1S1TB 2RPIA 4KKOB 5F8LA 2V0NA 3AVJA 4C8LA 1KHVA 4IOBA 3S3MA 3LDSA 3OLBA 4E3SA 1D9DA 4FLUA 1N5YA 1NK0A 4JV1A 3AVFA 4Q43A 2ATQA 3DLKA 1OS5A 4RW9A 1LV5A 4IDKA 4M3XA 3CFRA 4ID5B 3M8SA 3V9ZA 3V81A 5J2QB 3V4IA 1JL1A 4ECTA 2DFEA 3OSNA 2EHGA 4CHNA 1TV6B 4OKKA 4ED2A 3OS2A 3N6LA 3TAFA 1JLBA 4O44A 3CDEA 2AWZA 3NF6A 3V1QA 3KLFA 1RDCA 3ZSVA 2YNIA 1YVUA 1ZYQA 1KFDA 2FVPA 3NBPB 4OLBA 3QERA 3KMSA 3OSPA 4RW4B 3KIOA 4NLVA 5FDLB 1KTQA 1GX6A 1C6VA 4RNHA 4CJPA 3MR5A 3PR5B 4AILC 4QWDA 3T5HA 1KRPA 1L5UA 3SUQA 1C0UA 2C28A 1RDDA 3PX0A 4CHOA 4B9SA 3S3NA 1LAVA 1FKPB 1SV5A 2IAJB 5E41A 3S3OA 2OPPA 4IR9A 1I39A 3N6MA 3VQBA 1SH3A 4H4OA 3TQ1A 2RN2A 4NLTA 4E7LA 4CEFA 4EZ9A 3K58A 1A5WA 1DTQB 2W8KA 2ATLA 1T05A 2B6AB 4NYFA 1CXUA 3QEPA 4K4VA 3VQQA 5KFKA 1RBSA 1HQUA 3RR7A 2YKNB 4BDPA 4KKOA 1J54A 3SZ2A 4R0EA 4N41A 4M3UA 3EZUA 2JEJA 4K8XA 4Q0BB 5FROA 4RW6A 4I2QB 1RBUA 4QAGA 4FJMA 1CXQA 3MEEA 4I2PB 1NHVA 3MF5A 4FM0A 4E7IA 3I0SB 4KHSA 4X2BA 4I7FB 4KREA 5FDLA 1SH0A 1T03A 5KG6A 1S49A 4FJNA 3HPOA 2JC0A 5I42A 1JLFA 4DFPA 1UA0A 2QE5A 4ZPDA 4YR3A 3KLVA 2E4LA 3D5MA 2ZE2B 3O4NA 4ECXA 3T1AA 5KG4A 2YNHB 1JLAA 1NOYA 1RTJA 3JYTA 1VRTB 4CGHA 4W5TA 4K4TA 3TABA 2A1RA 4NLRA 3GIKA 5J1EA 1QSLA 3HK2A 4NCGB 4ID1A 4PY5A 4HKQA 2FC0A 3H2LA 4HUFA 3KLFB 4LQ3A 4ZHRA 3IS9B 4U6PA 2FBVA 1TKZA 2XY8A 3HPGA 4H4MB 3KD5E 1WAJA 3ZT3A 1RDRA 2WCXA 4FYDA 2IM0A 4FW2A 4E1NA 3HVWA 4IRKA 3A2FA 4MFBA 5CZ2A 4GMJB 2J6TA 2PYJA 1QE1A 4NRUA 3DMJA 4EYIB 4KSEB 2VG5B 5KT2A 1EP4B 4IG0A 1TGOA 2VG7A 2YNHA 2HHSA 2J6SA 4R5PB 4B9LA 4CESA 1HNIA 5KFUA 3OS0A 4JS4A 4LY7A 3E01B 3KK2B 2FJXA 1NJYA 4M3RA 5F9NA 3K5LA 1C2PA 2G8IA 4ZP6A 1S48A 2W9CA 3O3FA 4DMNA 3LP1B 1S0MA 3OYJA 2ILYA 3QLHB 4QWEA 2HNZA 5F8GA 4B9NA 2HWHA 2G8VA 4QWBA 2BE2B 5DQHA 1VSEA 3SUPA 3ISND 3LP2A 4DFMA 4FJGA 4I7FA 1HQUB 4J9NA 5EWEA 3QEWA 3B6OA 4OVLA 4LQ9A 3OYLA 2OPSB 3IRXA 4CHYA 4RW6B 2X6NA 1MMLA 3KLEB 3BSAA 4K4YA 5FRNA 1J53A 4DTUA 1TV6A 2UVUA 4ECRA 3V6DB 1NK6A 4FLWA 4OJRA 4FK2A 4Z4IA 3DM2A 4ECUA 3ZSWA 1TK5A 3K5NA 4ED1A 5DGAA 1T94A 3HO1A 4M3YA 3TANA 5T14A 3GV7B 3NL0A 4KAZA 4MKBA 1DTQA 4WZMA 1JLCB 2OA8A 4Q44A 1X1PA 4Q8EA 4DL7A 3DLEB 4FJHA 2GV9A 3NGZA 2XI2A 3E01A 4MK7A 5KG1A 3N6NA 3AO3A 2D0AA 1S1XB 4FS2A 4KI6A 4DU3A 3AVCA 5KT5A 2ZD1B 3VQEA 3TAEA 1Q9YA 2ZQBA 4B3OB 1QAIA 3CDWA 3H5XA 1LWCB 3HVTB 1S97A 4EBCA 3T19A 5K14A 3HHKA 3NBPA 3MR2A 4OKJA 4TY9A 2HHWA 3QINA 4J2BA 1U47A 3KJVB 4F3TA 3NGIA 2ILZA 2YHAA 5KFAA 2XWYA 3OHAA 2OZSA 1KVCA 2A1SA 2D0CA 3CFOA 3KLIB 3FQLA 4IG3B 3MR3A 5HLFA 3QIPB 5HROA 2B43A 4YNQA 3OYEA 4FJJA 4LSNA 1ZETA 3KHHA 2W42A 4DL4A 4BWJA 5DMRA 1RT6A 1RDBA 3CFPA 1VSFA 2KFZA 4CEDA 3NE6A 4CEQA 3MECB 4NCBA 4RU9A 4ZHRB 3DOKA 4CFCA 4NLDA 1J5OA 4QW9A 1UOCA 4DWIA 1WSIA 3CJ0A 2Z1GA 4O55A 3VQDA 4CERA 4NLXA 1YTAA 2R8KA 1U48A 3KOAA 3KLGB 4PA1A 3SI6A 1TAQA 2HHVA 3PVXA 2W8LA 4OKEA 1UA1A 2Z1IA 3KLGA 3QIDA 1S4FA 3QEVA 3RMBA 5KT6A 2BR0A 1A5XA 2G8WA 3PX6A 1RYSA 3AO2A 3LANA 1UWBB 2NUBA 4ECSA 3SI8A 3TR8A 1TK8A 4GC6A 3OYMA 3EPIA 4WYWA 3BDPA 4H54A 5KGWA 3K2PA 1RA7A 3MXIA 1TL1B 2YNFA 3CIZA 4E7HA 3CVKA 4Q45A 1XWLA 1JLBB 3P5JA 4BE2A 3DRPB 2RF2B 4RNMA 1VSMA 3QIPA 5HROB 2BDPA 5KT4A 4FVMA 2EC0A 4DS4A 1NKEA 3V9WA 4Z4EA 3QO9B 1X9WA 4LSNB 3VQSA 1NHUA 3GV8B 4CJSA 4TSXA 4EO8A 4Q0BA 4JRQA 1RBTA 1JKHA 1KCFA 4RW7B 1QAJA 1W25A 4K4UA 1N48A 4BE1A 3KK1A 1TKTA 2WRMA 3ZT2A 4IDKB 3CJ4A 3G86A 4ECVA 3E51A 3KLHA 2DFFA 4MH8A 1BQNA 3L2QA 3DLGB 1TKXA 4EBEA 2E6MA 2XRIA 4C8NA 4RNNA 2VG6B 4OL8A 3AVIA 1IKVA 3H5YA 4DG1B 4KHWA 2AX0A 4J9KA 4XIUA 1NK4A 4H4OB 4ED7A 1T3NA 1JLGB 3PUFA 1RT1A 4IFVB 3ZSOA 4BDZA 3DI6B 3MTKA 2BGGA 4W5OA 3OYHA 2BQ3A 2WTFA 4N76A 1S1VA 2C22A 3T5LA 2BRKA 1JX4A 4KPYA 3KHGA 1BL3A 3AVHA 4BE0A 3RB6A 2FVQA 1BGXT 2I5JA 5KFNA 4W5QA 4CHZA 4NLQA 4I9LA 4NCAA 5F8IA 4LSLB 1B9DA 1JKHB 3RB4A 2ZKUA 4ZTJA 4MIAA 4DQSA 2FLPA 1JL2A 4GW6A 4CEOA 3BSNA 4CFBA 4J9RA 4ICLA 2IS3A 4CJRA 3DLHA 2W9AA 1RT4A 1TL3B 2IC3B 4B8AB 1ASUA 4NLWA 2P5OA 2E9RX 3SJJA 1REVB 2B5JB 1TP7A 4YP3A 5HBMB 4Q8FA 1VSKA 4FK4A 3MXJA 2W9CB 3IG1B 3LWMA 5KFCA 3SUNA 2WONA 4K50A 4F4YA 1NOZA 4LH5A 1S1XA 4IFVA 2BANA 3BJYA 4C8MA 4FM1A 5J2NA 1R0AB 3V6JA 1D5AA 4B3OA 3MECA 4AHUA 3SQ1A 1N6QB 1D8YA 4O4GA 1R0AA 4JRPA 3ZCMA 1Q9XA 3RR8A 3ICLA 1IKWB 2R2UA 1JLFB 3UQSA 4M3WA 5KFXA 2UVRA 2E9ZA 3OYKA 3M8PA 5DG8A 3LALA 1IO2A 3GIIA 4ZTFA 3HJFA 3GQCA 2VWKA 1Z26A 2W7PA 5KFDA 3UR0A 2VG5A 3EYZA 3V1OA 2HHQA 4DTJA 2V9WA 4WXOA 4G1QB 3RMCA 4M94A 4NCGA 4M95A 4RUAA 4KHYA 2IM3A 3V9SA 2YNGA 2Y1IA 3PV8A 1S6QA 1VRTA 3SFGA 5F8MA 4KV8A 5L1JA 3L2WA 5EU7A 4AHVA 4CF2A 1BI4B 3VA3A 4O4GB 2XY7A 5SWMA 1IKWA 3CM5A 5F9LA 5J2MA 4W5RA 2R2SA 1NJWA 4O3RA 3C94A 5KFWA 1RT7A 2YKMA 1U09A 3LAMA 4NRTA 3CDUA 4PQUB 4EP5A 1S1UA 3MXMA 4F3OA 3PO5A 3O3GA 4CFAA 1VSHA 4K8ZA 3FRZA 4Z4CA 3CQ8A 4DTMA 4WZQA 5KFIA 3NFAA 4M3ZA 5KFYA 3OYAA 5KFLA 3DDKA 4FK0A 1RAJA 4KHMA 3NMAA 4CEZA 2FBTA 3EZ5A 2HW3A 4LH4A 1IKYA 3DRSA 1U04A 4E1MA 1JLEA 2R8IA 3OYGA 4TY8A 4KRFA 1HQEB 2FJWA 4CK3A 4CF8A 1FK9A 3OJUA 2D41A 1S1WA 5KFJA 3ZSYA 1RILA 3WNGA 1FK9B 3NHGA 2FVSA 2B6AA 5J2PA 4DTSA 3V6KA 1WSEA 2GC8A 4FS1A 4IKFA 3QEIA 3HT3A 2KZMA 2BE2A 2IM1A 3BR9A 4ECQA 3MEGA 3AO1A 1DLOB 4JUZA 4R8UA 2UUTA 1RT2B 4NYNA 1LWCA 3LZJA 3RAQA 1J9AA 4BACA 1C1BB 2AX1A 3KJVA 4I9QA 3I5AA 4JS5A 4DTRA 4CJUA 4M3TA 3QGGA 1IG9A 1ZTWA 4CFDA 1XR6A 4OPJA 4DL5A 2V4RA 4MIBA 3I5BA 4DSFA 2QKBA 1JLGA 3I5CA 3H08A 2V4QA 2VG6A 4EO6A 3FDSA 4DTPA 2R2TA 3KHLA 4W5NA 2W9BA 4CF0A 3OYNA 2YKNA 2HAIA 3OYIA 3G6YA 4DQQA 3LP0A 3RMDA 3TVKA 3H98A 4KO0B 1J5OB 3K59A 3SFUA 4CJEA 1TKZB 2YNGB 1DLOA 4DFJA 2KTQA 4RW7A 1C0MA 5KG5A 5KGXA 3WNHA 2RDJA 3TAMB 3CO9A 4DSLA 4TXSA 1VRUA 4G3IA 2AU0A 1KSPA 1HMVA 1VRUB 4CGIA 4QWAA 1EX4A 2OYQA 3OYBA 4GC7A 5C24A 5JS2A 1UWBA 4DF4A 1ASVA 3NF9A 5CYMB 2XCPA 2FLNA 1U45A 4J2DA 4O3SA 4O3OA 4EYHB 1RTJB 3JYTB 3B6PA 5HP1A 4QCLA 2R8GA 3RBEA 3ZSZA 4RW8B 3TARA 3P1GA 3TAPA 5C42B 1IM4A 2HB5A 4B9MA 1NK8A 3QLHA 4NZ0A 4FJ8A 3LP0B 3AVAA 3IG1A 1RT3A 4XPCA 4ECWA 1S10A 4NYZA 1S0NA 2B5JA 3KD1E 1VSDA 4URSA 2D3UA 3OL7A 4RNFA 1UAXA 3QNOA 1N6QA 3OS1A 1RT5B 3KK3A 4HUGA 5JS1A 3MEEB 1HNVB 1BCOA 1BQMA 3H59A 3IS9A 4DFKA 1ZBIA 2JEFA 2GIRA 5DLFA 3GIJA 2XC9A 3L2VA 1X9SA 2PYLA 3MFHA 1NKBA 1A5VA 4KHQA 2IJNA 2WK4A 2XHBA 3L2UA 1XHXA 2IGIA 3LPTA 3UDLA 3ZT0A 4HHTA 4CEBA 1SKRA 4PWDA 1B9FA 3DOLA 3DRRB 3HP6A 5J1EB 1MU2A 3PR4A 4CHPA 2I5JB 4G1QA 1TL1A 2YNFB 3DI6A 3AVLA 1SUQB 1BISA 5C25B 3H5SA 1C1CB 4F2SA 3VQ9A 5KFEA 3PJXA 2BRLA 3K5OA 4QOZB 1CZ9A 1C1CA 2HNZB 4FJXA 4PQUA 4EEYA 3ASMA 2YKMB 2EX3A 2D3ZA 5KFGA 2JEIA 1XHZA 4DQIA 1D1UA 2WHOA 1FKOA 2HHXA 1L3VA 3G6VA 3DLRA 3ALYA 1C1BA 1I3AA 2FJVA 5KRSA 3QEXA 5KFZA 4FJ7A 4CJTA 2KFNA 1EP4A 1RT7B 1F21A 4CJVA 1TKDA 4WFXA 3H4BA 4FLVA 3L2RA 4FLZA 1HNIB 3G10A 3OL6A 4DSKA 4IG3A 3BSOA 2BQRA 3L3VA 5J2QA 4O5BA 1VSIA 4J2EA 3MFIA 5HLFB 1I6JA 1REVA 2C2RA 4FJIA 4CIEA 4O3NA 2RF2A 1DTTA 4DTXA 4KTZA 4J9SA 3K57A 4URQU 5CY4A 5KTQA 4NLYA 4O44B 3VQ4A 4B9VA 1TK0A 1HYZA 4NLPA 4KO0A 5J2PB 1CZBA 4B08A 3BQ2A 1RA6A 4IQXA 1RT5A 4F4ZA 4BDYA 4Q5VA 4MQ3A 3TI0A 2J6UA 3HKWA 5I3UB 3NAIA 3PW4A 2JEGA 4DQPA 4K4WA 3JSMA 4Y3CA 1X9MA 4O0JA 4IKAA 1HPZB 4ZPAA 2FBYA 5EUHA 4FZZA 4B8CA 3OL8A 4DL2A 4FJLA 1LWEB 1ZBHA 3L8BA 2QK9A 4FLTA 4R5PA 1RDAA 1SL2A 1BHLA 4N56A 4IFYA 3T3FA 3BREA 3KK2A 4CGJA 3OYFA 3VQ7A 4HUEA 4IG0B 1KHWA 2GBZA 1RTDA 5DQGA 1SUQA 1EETB 2AGPA 2X74A 4EZ6A 4J9MA 3SUOA 4AHTA 3D28A 4CJKA 4PWDB 1S6QB 1C0TA 3GV5B 2RKIA 2PY5A 2HMIB 3CJ5A 3M9OB 1LW0B 2HMIA 2XY5A 4YQWA 1HNVA 3QO9A 3UIQA 3O3HA 1QTMA 1VK0A 1LW2B 1RBRA 3CJ3A 5KFVA 4ED0A 5KG0A 2BQUA 2HNDB 4KHNA 3IGNA 4Z0UA 3BQ0A 4L8RB 1S6PB 2UVVA 4DS5A 3NH2A 3LP2B 2YV0X 3V81B 4FBUA 1HYSA 1N4LA 2AJQA 2FVRA 4ZVFA 1JLEB 2UUWA 3Q8PB 3PHEA 1K1SA 1KVBA 1KVAA 1HRHA 3U6FA 3CYMA 5HRPA 4AH9A 3HM9A 2ZE2A 2D7SA 2FLLA 3I0RA 4IH6A 4DL3A 1EXQA 2E6LA 5HRRA 5CYQB 2WONB 3HL8A 2IBKA 1G15A 1HYVA 4IFYB 2R8JA 2Y1JA 3HYFA 2F8SA 5KFOA 4NLOA 5DG7A 1RT1B 4AHCA 4I2PA 3M8QA 5KG3A 4ED8A 3I0SA 3NAHA 1JXEA 3NF7A 4WFYA 1W0HA 2GIQA 1L3TA 5HRSA 1BI4A 4KHUA 4WXWA 2F8EX 4IH7A 3MEDB 2DPJA 3QGIA 4EP4A 3AO4A 3AO5A 2E9TA 4EBDA 4Z4GA 1QQCA 1ZBLA 3AA5X 4CJLA 3OYDA 1LW0A 4MFBB 4DL6A 3KLHB 5EWGA 2HNDA 4ICLB 4LSLA 4MK9A 4TY8B 3OL9A 3RB3A 2R7YA 2F8TA 3IGVA 5C5JA 4F4WA 5KFSA 4M41A 1K1QA 2VWJA 4URGA 3OJSA 1RNHA 4IRCA 4TYBA 3SNNA 4WE1A 5J2NB 2LSNA 3BSCA 4WFZA 1RTIB 2C2EA 4K4SA 5KFTA 2VA2A 1RTHA 1NK5A 1RTIA 2OPQB 3VQAA 1S1VB 4FJKA 3IAYA 2KZZA 3SQ0A 5KFRA 1C0UB 3QNNA 1GOBA 2G8HA 2JC1A 5L9XA 4Y2CA 5C25A 3EY1A 3P83D 4RUCA 5I42B 2D0BA 1IH7A 3ULDA 1FXXA 3ZSRA 3VQCA 4CE9A 5KFMA 3HVRA 4YR2A 3CG7A 1S9GB 1JLQB 4ZP7A 5C24B 1SL0A 1U4BA 3I0RB 3AA4A 5D3GA 3PW5A 1JXLA 4TQRA 4ED3A 4ID5A 4RZRA 4CGFA 4UQGA 3D0PA 3U3GA 3V4IB 3V1RA 3HSTB 4TYAA 4FLXA 4Z4FA 3LAKA 4RNOA 3FQKA 1TQLA 3ZSXA 1L3UA 3F73A 4CIFA 1BCMA 3V6HA 3TAMA 3DYAB 2Q3SA 3QGHA 3PW0A 2JLEA 3G6XA 4O4RA 3QIOA 5L1LA 1XR5A 2RDIA 3ZT4A 1WSGA 4E19A 5KI6A 2ETJA 4CJ5A 1S1UB 2P1JA 1N5YB 3L3UA 3C6TB 3KK3B 4CK2A 1BQMB 4CGGA 4E7KA 1S9GA 3F9KA 4CF1A 4CJWA 3SV4A 2O5DA 1LWFB 3MR6A 1WN7A 4ZVEA 3KMQA 3VN5A 1LAWA 4E7JA 4GVMA 2Z1JA 4ZP8A 1CSJA 3MAQA 1RTDB 4ZVHA 2XY6A 3EPGA 4KE5A 4ECZA 4KB1A 4FXDA 4J9OA 4CEAA 2R8HA 1RCHA 5CYMA 3CJ2A 1VSJA 2YHBA 1ZTTA 5HP1B 1Z25A 3NAEA 4CF9A 4OPKA 4B9TA 3DLEA 3PX4A 2HNYA 3DYAA 3PW7A 1RT6B 3NCIA 1WSFA 2HNYB 3MEGB 3RBDA 3VQ5A 4R8UB 3AVKA 1NJXA 4F4XA 4F8RA 2P51A 1KLMB 1T8EA 3NGYA 2HWIA 3T5KA 4C8KA 5JXSA 1WNEA 4DSJA 4H4MA 5F8HA 4JV2A 1RYRA 3LPUA 2IM2A 2IMWP 4M42A 4OGCA 4O0IA 2XCAA 1FKPA 5L1KA 3VQ6A 2X6SA 3KKRA 3OHBA 3VA0A 3BGRA 1XR7A 4JV0A 1NK7A 5KFHA 3OVNA 1XC9A 3BGRB 2B4JA 2WOMA 3FFIA 3AVNA 3LP3A 2XGPA 3C6UB 2KQ2A 3FFIB 5DQIA 4F50A 2AGOA 1EKEA 3DOKB 3KKSA 4ELVA 3QETA 1N56A 3V9XA 4E89A 3OYCA 4TLRA 3RWUA 2BANB 3PJWA 1GOCA 4HCCA 1S9EB 2OPRB 1ITGA 4I2QA 4QPXA 3O4QA 2QKKA 5EDWA 3SCXA 4J2AA 1LW2A 4RW4A 2HHUA 2HHTA 1D0EA 3Q8RB 3QZ7A 3WNEA 1WSJA 4ZVGA 3H4DA 3NH0A 4E0DA 2IDOA 3CWJA 3PO4A 1O1WA 3D45A 1Z4UA 3DM2B 4O3QA 4DSEA 4ZP9A 5DGBA 5EWFA 4N5SA 4FZXC 4DU1A 3KLEA 2CKWA 5KFBA 3AA3A 2O4GA 3IN5A 4U7CA 4DQRA 2W9BB 3GYNA 4O3PA 1ZBFA 5KT7A 2HVIA 4KFBB 1Y97A 3SQ2A 1C0TB 2HVHA 4YMEA 3NF8A 4IR1A 4Y34A 2P5GA 2ZD1A 2ITGA 1EETA 5SZTA 4KBIA 4RW8A 2XO7A 2OPQA 3HPHA 2YNIB 1SL1A 2D5RA 3HVTA 3KTQA 3RRGA 4RG8A 3RMAA 1RT3B 3DLGA 4WE1B 4DTNA 4QWCA 3NH1A
chains in the Genus database with same CATH superfamily
4ER8A 4MDBA 1N33K 3M9MB 3VGTA 2M0GB 1GMWA 2L9NA 3BY5A 1IKVB 4BWMA 5I3UA 1QE1B 2LLZA 1KBRA 3S41A 3P45B 4USUA 4OJ3A 5DG9A 3VQPA 3LOUA 4IRDA 5J2MB 3UW1A 5JMNA 1NJZA 4FBTA 1BQNB 3LZIA 1FTCA 2QXLA 3P96A 3OLAA 1YTYA 1HMVB 4CGDA 3Q23A 5AXKA 5D3GB 5LMUK 2W4CA 2KM8B 3EXYA 3QYYA 5DLGA 4X4NA 3SJHA 4K5SA 1NEEA 1HW8A 4CJFA 4NLUA 3DRSB 3CM6A 4F2RA 3I6PA 4CZFA 1VBXA 4FKYA 5KG2A 3K0SA 1BA1A 4N47A 4BC3A 1WC4A 3S9HA 3MI7X 4B1WB 2IOCA 4XO0A 2QW9A 4LBHA 1VQ5S 1XC3A 4CCHA 2Y0BB 4MK8A 4C11B 1HX1A 1IKXA 1OY8A 1FWKA 3NKYA 2KYXA 2OJ3A 2O8DA 2VG7B 4JK9A 4WYLA 4FJ5A 2F96A 4RKUC 4F9OA 1AXQA 2FZGB 1QM9A 1IWAA 1RHKB 4ZPBA 4CIGA 2QA4N 1OSDA 3R5BA 1RBVA 5AE2A 3ZSQA 1MN7A 2WB4A 4Y2IA 3SDEB 4OMFG 4LFAK 2LU1A 1K6YA 4JLHA 4C8OA 4BCAA 2AKWB 5D4PA 3VERA 2XSJA 3B4MA 3MEDA 3BKTA 2QSWA 3KK1B 4ZMMA 4B3MK 4ZN3A 2AF6A 2V4JA 1WI8A 2J0XA 1UVKA 1T44A 4ES2A 2RD5C 4NXNF 5KFFA 5FRMA 3Q8VA 4EI2A 4J9LA 1N0UA 3SCKE 1M5SA 1IVZA 4FWOA 4GKKF 1W9HA 5C7PA 2GQ2A 3HHDA 1U1KA 4FYYB 4CJ4A 2IA6A 1JLAB 3WX4A 1N8RO 2IAJA 5K14B 4USIA 3TAQA 3OY9A 1BIZA 3OW2R 1IKXB 2D1CA 2WOMB 2HFNA 2IVOA 1LXJA 1K0TA 3M8RA 3HVAA 2DRBA 2OTLS 2CJBA 1YAGA 4CLLA 1VQYA 2ALYB 4ITSA 1R59O 3TVZA 3OT9A 3CF5Q 2IIRA 3US5A 4X64J 2J0SD 3R5DA 3F9MA 2EFPA 5DDPC 3GFYA 2DFHA 1Q7YT 3DRRA 1X4GA 2HQGA 2VB6A 1UVMA 1YZ7A 1NZAA 3GE1A 3ITHB 1RABB 1H38A 3QRQA 3OR1B 2KW4A 1RT2A 4OI0A 1XNQF 3FEYB 5T7BA 2LDIA 3RTVA 3G0ZA 4X62K 1QSSA 2PZSA 2N4CA 4Y1DA 3L7OA 1T7PA 1V4TA 1OY6A 1HJRA 3CCZA 1QS4A 4JI8F 3AAPA 1ZBTA 4LD0A 1PILA 5F3ZA 2ZH4A 4XTTA 1N54B 4CYUA 4NI2B 3L6QA 4ELUA 4M45A 4GV3A 1RU1A 4P9SA 1KFSA 2X78A 3T1HJ 4CEEA 2C3YA 1EKSA 3EICA 1NKCA 4HYKA 3N28A 4DUYJ 1QVFM 9RUBA 1ASWA 1X5OA 3SPZA 1AA1B 1YJUA 2RE1A 2QWOA 2BKPA 1GH8A 4E8UA 2E7WA 2KJWA 3S3MA 1U02A 4U9RA 1GNKA 4J9UE 1D9DA 4J37A 1XK8A 1LNQA 3CD7A 3R27A 3AVFA 1OY9A 3S7RA 4RW9A 1FF2A 3DU6A 2LQJA 3CFRA 1Z6RA 1QAYA 4A8OA 3V9ZA 4F26A 2DH8A 1NG9A 3OSNA 2EHGA 3AOAA 2B4VA 2NZCA 2AJ2A 4KRWA 2JZ5A 3UE5A 1TV6B 2F1FA 4HHHA 4FWLA 1VQ8S 2ZM6K 4ED2A 2QWMA 2WSFC 2HOEA 2WSEC 2XMUA 1ZYQA 4QR1A 2BMBA 1T9VA 3NGTA 3OSPA 4RW4B 4NLVA 2ZBRA 1F5BA 2E5JA 5EVZA 1GX6A 1C6VA 4CJPA 4HTIA 3MR5A 4WPAA 3PR5B 2ZHBA 2BZ2A 1L5UA 4QR0A 2PA3A 1WF1A 1RDDA 5DM6L 4B9SA 4KC5A 1FERA 3ZX0A 5HANA 2FIUA 3VGLA 4YB5A 1SV5A 4IR9A 2NXNA 4TU9A 2ADCA 1GLFO 2RN2A 3M30B 4E7LA 4CLUA 4CEFA 3ULEB 4CH0S 3K58A 2NR0A 1IV0A 3D66A 3CDAA 4H0PA 2RE2A 2V94A 2WB1D 2Z2YB 1CXUA 3I4PA 1WF2A 3Q24A 4ANCA 2B0GA 4DHVA 4K4VA 3TQEA 3HZEA 1C0FA 1QTNB 3NRBA 2IDLA 2IVMA 4R0EA 1H2VZ 3BKFA 4M3UA 2BKOA 1RAHB 5FROA 4P2XA 2MKYA 3WIVA 3AJ2A 4I2QB 2Q3PA 2UXBJ 4E7IA 1E6YB 5AQYA 3ZTSA 2GAHC 1TMMA 1S49A 4FJNA 5I42A 2R7WA 4R25A 4QIWD 4OX9F 2L41A 1JLFA 2KM8C 4ZPDA 4UOFA 3PIOQ 4YR3A 2NSCA 4X4RA 4JI8K 4ECXA 1X9JA 4YDXA 2YNHB 5D8HB 1NOYA 2BUNA 2O66A 2EI5A 3LDNA 3MCOA 2P6SA 4DOZA 3PIPL 3M05A 3O9UA 3TABA 3HK2A 5A2QU 4NCGB 1GAOA 3GSDA 1RWVB 5FPNA 1U2CA 2EKNA 4ZHRA 3H2VE 2FBVA 2F7TA 3R5GA 2G2YA 1WAJA 2WCXA 2XM3A 1WACA 4E1NA 4K0KK 3A2FA 3BR8A 4JI3F 3MPVA 2D0PA 1Y7PA 4NX9A 2J6TA 2GAGC 3HJVA 3DMJA 4QU7A 4R79A 1VQPN 3J81Y 4DR6J 1EP4B 3DJCA 2WBNA 5BPMA 5CYJA 2YNHA 2ASOA 2HHSA 2HURA 2E8AA 4K5RA 2FJXA 4M3RA 1M0SA 4IJAA 1UKUA 3D0IE 4ZP6A 4OZ5A 5H9EJ 1QQMA 3LP1B 1D9AA 3F56A 1OVYA 4DCOB 3QLHB 2QL9B 4P6QA 2XMWA 1TUVA 2EBEA 2E1AA 2G8VA 2QLJB 2DXFA 3W9JA 5DQHA 4JYAK 3SUPA 3ISND 2PAVA 3VCDA 3OR1A 4W98A 4CWBA 4LQ9A 2ZM6J 2OPSB 2JFKA 2RQKA 1VLYA 4S0MA 2X6NA 3MTJA 2EWSA 4K4YA 5FRNA 1TV6A 4ECRA 5ETVA 1NK6A 2DGSA 4YOUA 3DRYA 2BXJA 3DM2A 4ECUA 5AZIB 4PWUA 3P3DA 3HO1A 5JVGQ 4M3YA 3FEZA 5GADI 2PSZA 2AEFA 2FHKA 4EHUA 1R8HA 3K8WA 1XMOJ 4YY3K 5AT1B 3U1LA 1K9MO 3DLEB 1R8PA 1W97L 2NRWA 3FK4A 2AYBA 1H98A 2D0AA 4PXDA 4KI6A 4DU3A 3AVCA 5KT5A 4BRLA 3TAEA 2ZQBA 4B3OB 1QAIA 4DV5J 2XS5A 1TL7A 1S59A 3T19A 1U24A 3RAMA 3MR2A 3EE9A 4OFZA 5F2RA 5DM7L 2HHWA 1ZBSA 2YKPA 1GMWD 4G1IA 4C0HA 5BXIA 4USTA 4OZ2A 3OHAA 3W3SA 2FB0A 1J5EJ 4CTAB 3TO8A 1NMEB 2D0CA 1X0FA 4USMA 2E2QA 4UZCA 1D09B 4OJ1A 3MR3A 4FWNA 4AFFA 2DEJA 4CO1A 1FNXH 4FJJA 2MLXA 2MKKA 2Q0RA 2W42A 1XTZA 4DL4A 3C7NA 5AXLA 3F5TA 2OTJN 1BD6A 1VSFA 3CMEN 1YJWN 3TX0A 4LC9B 3CD0A 4IOCQ 3MECB 4RCHA 4ZHRB 5DM6Q 1TZ0A 2GEMA 1VDHA 1VMBA 4BR9A 4DWIA 4ZVRB 1WSIA 5HOOA 2R8KA 1TUWA 3UD3P 4PA1A 3SI6A 4JV5F 1SZ2A 4FDFA 4OKEA 3KLGA 2BE7D 2H54B 1S4FA 2YWFA 3JSRA 1Y10A 4WTYA 4MLEA 2HFZA 4LF5K 2AP6A 3SI8A 2UUBK 4U8YA 3OYMA 4I69A 3K2PA 3MXIA 3CIZA 4DUZJ 4Q45A 1JLBB 3P5JA 1FVQA 3QIPA 5HROB 4HH1A 5KT4A 2EC0A 5GAEP 4Z4EA 1X9WA 3UE2A 4BQLA 4TSXA 1RBTA 1JKHA 3GE9A 4M63A 1QAJA 4M5IA 5AQGA 2CWKA 3KK1A 2BJ3A 3NS5A 4IDKB 3CJ4A 1VISA 1Q5YA 3G86A 3E51A 3KLHA 2DFFA 3L2QA 1QD1A 2A0FB 2LECA 1K8AO 2ZC4A 2E6MA 4RNNA 4OL8A 1M90T 4C6AA 3A5LC 3G6ES 5AZJA 3H5YA 1UPMB 5LJVA 5LM7E 2H9ZA 1B0PA 2CA9A 2AX0A 4CDIA 4J9KA 4XIUA 3A3OB 2LYVA 4IFVB 4ZPWR 3DI6B 4KBOA 4W5OA 3OYHA 2C22A 1SAZA 2BRKA 4CZLA 2QFIA 3M6UA 1VQLN 3RSEB 3QBXA 4C97A 4KPYA 3AA9A 1BL3A 2XNRA 2NS1B 1JJHA 2R7RA 1XQIA 2P9KA 3UI3A 4CHZA 4QZVB 3ENWA 5AQKA 4PXCA 3MPYA 4RLEA 4NLQA 2I9SA 3H42A 5ETTA 2QYGA 1B9DA 1JKHB 2BABA 3RB4A 4MIAA 1VQON 5EX0A 1UVJA 4DQSA 4ZVQB 4GW6A 4CFBA 1J5EK 2YTCA 4AXJA 3CUNA 3CCSN 2E9RX 5BJRA 2IRYA 5AE3A 2HGNA 2B5JB 5D77A 3A3NB 2LP4A 4Q8FA 4X62J 1VAZA 3MXJA 2X1BA 4MKVA 1PYOB 3E9PA 3N4QA 3OFGA 4I6MA 1TUGB 2OLWA 1NOZA 1B0VA 2UV8G 4IFVA 3BJYA 5E0OA 5J2NA 2V9KA 4HT5A 4H5WA 2GA7A 4B3OA 1PG5B 1REGX 1X7VA 1D8YA 4JI2F 2R7QA 2F9JA 4LF8K 3ZCMA 1HWUA 2J9EA 4Y6IA 3UQSA 4M3WA 5ELZA 4DV3J 2NRZA 2UUCK 3CMAN 5IFMA 5JJBA 3SMSA 3IA0A 2CPHA 4WFAL 1T02A 1O8BA 2BM1A 3QFWA 3HJFA 2CPYA 3GQCA 3BGLA 4MJKA 1M5PC 1Z26A 5AQSA 1A7GE 2VG5A 1HHSA 3TX8A 5AQFA 3V1OA 2RH3A 2MSSA 4WXOA 4ZIWA 5AQOA 3EX7B 4JI1K 4NCGA 2FSKA 1RUSA 1PJ7A 4RUAA 1L3KA 1H7XA 5F8MA 5L1JA 3L2WA 4V19S 5EU7A 2OKQA 1RAIB 2QYCA 4O4GB 3EE8A 5ETLA 3T1YK 3HHLC 1U09A 4WU3A 4PQUB 4EP5A 4LUBA 1JJ2R 3O3GA 1YLXA 2APOA 4OYIA 4LR9A 1S79A 3OYAA 5KFLA 3WQUA 4FK0A 3UN3A 1RAJA 3FSYA 4MAKA 2O8BB 3NMAA 4CEZA 3EVOA 2MZSA 4EIAA 2C2NA 3N0VA 3EZ5A 4TU8A 4QJVA 3OYGA 3JS6A 1V9OA 4KH5A 2F7VA 3HT0A 1YF5L 3CF5L 2D41A 1S1WA 5HN0A 3L95X 1ZOTA 4ID8A 2E66A 4KGKA 2YKOA 2ZKTA 4NXNK 2B6AA 3IMXA 4PPDA 3CTRA 4DTSA 1WSEA 2KVIA 4IKFA 2UP1A 4ANDA 1DLOB 4JUZA 1LWCA 3RAQA 2YH0A 4RPFA 4LF5F 5D4NA 5AQUA 3C19A 1C1BB 4JB8B 5B0CA 4UW2A 2B9EA 3QGGA 1FFGB 1IG9A 1UW4A 4CFDA 3NGKA 1RWNB 3O44A 3DXSX 3AB2B 3LGNA 2CPDA 1JLGA 3I5CA 3H08A 2FF6A 2MY7A 3FZBA 3R6LB 4CF0A 3OYNA 5GVQA 4YEAA 3U7JA 3MM9A 2NYHA 4A5BA 3CCLN 2Q1NA 2HQ3A 4A8QA 2P2CB 4DQQA 3LP0A 3CJKB 4BG9A 1RJJA 3F2KA 1J5OB 3K59A 3SFUA 1S72S 2FZKB 2YNGB 1KWMA 3CIPA 3R97A 5KGXA 2BTFA 1FEHA 3WNHA 2V51B 3AOCA 2R4FA 3AD8C 2G4BA 5B0EA 3W62A 1IG8A 3KDNA 4TXSA 2HKEA 2MTLA 2J5AA 1YK9A 2OEMA 4QWAA 1EX4A 1AROP 1SQEA 3K89A 4GC7A 4GVEA 2AJ4A 4A2AA 1ASVA 4JI3J 2GMHA 1U45A 3BZQA 4JK8A 4O3SA 4DU8A 1C4AA 3J80O 5HP1A 3L4IA 3NWGA 2R8GA 3PYGA 4JI5F 3JQMA 4RW8B 3TARA 4B9MA 1ITPA 1NK8A 3QLHA 2LVWA 1RT3A 3J7AP 1MLAA 1HBUA 4QYZK 1VQ6N 3HOTA 3N79A 1S0NA 2B5JA 3IKMA 4URSA 1IQTA 4OYOA 4DI6A 2B9YA 3G71S 2QMUB 2DNKA 4ZDNA 3DOMA 1N6QA 4AL7A 1UEKA 1HNVB 1BCOA 4JI2J 3RU0A 3IS9A 3J7YP 3M2RA 1X9SA 2PA8D 4FYVB 3QJJA 3D2EA 1UP1A 2NZTA 5AQLA 3O9TA 4WYBA 7FD1A 2IJNA 3QNWB 2A2CA 1U2FA 3H90A 2PBDA 2VQEF 3W2WA 1UPPA 4RX6A 4ISFA 5K8MA 3ZFVA 3SBMA 2Y9HA 1X5TA 2I5JB 1TL1A 2YNFB 4OZJA 3DI6A 3DU5A 5CA5A 3J7ZO 3H5SA 3R6GB 2B51A 5KFEA 4ZIVA 3I56S 2BRLA 3K5OA 3IP0A 3TYTA 4F02A 3UR3C 1C1CA 5DZ6A 3HFKA 1Y3KA 1XHZA 2EK1A 4DQIA 1FKOA 1L3VA 3G6VA 3R8YA 1C1BA 3IAS9 4FF3A 4TKTA 1TU0B 4DV6K 2N7CA 2Z2LA 3G10A 3OL6A 2DIVA 4IG3A 3BSOA 1FNMA 2BQRA 5J2QA 1F5CA 5HLFB 1RHQB 1YJVA 5AE1A 2R7UA 2DR6A 2ZDPA 2C2RA 3O9SA 2ASMA 3VTHA 4KTZA 4J9SA 3K57A 1XMQJ 2MLYA 4URQU 3JTPA 4I56A 3VQ4A 2VFRA 3MM7B 1HYZA 5K8PA 2V34A 4N8NA 4DUZF 3PEHA 1RA6A 1F2GA 4F4ZA 3NVMA 1N33F 4CJ7A 4FPIA 2J6UA 2WUSA 5I3UB 3NAIA 4X64K 5IQQA 1AB8A 4PPZA 4K4WA 2QWLA 5D0EA 3JSMA 4FP9A 4O0JA 4WKRA 3BH6B 5EUHA 4K7QA 5GADP 4UUXA 1CZAN 4X84A 1HD1A 2J7UA 1LWEB 3GTYX 3L8BA 3D0HE 1BWFO 4R5PA 5LSRA 3AY9A 1TTHB 4RUBA 3NLCA 3BREA 2PEBA 1JJ2M 1AZSA 1NGCA 1RTDA 5ETKA 2CPEA 1MW7A 2BYCA 4UY8T 3GG0A 2AJ0A 2X74A 4J9MA 2I38A 1J27A 4UZBA 4OYBA 4RJVA 2FY1A 3NOCA 4LF9K 2XG8A 2PY5A 1NDKA 2VFVA 1FFWB 3CJ5A 1CJKB 1MNEA 2XY5A 4CNZA 2CQ1A 1ZAVA 3DLLL 3QO9A 1RDUA 3M6GA 2HS3A 2XMJA 3EDQB 4KHNA 3TSQA 4Z0UA 2OO4A 2RS8A 3A3PB 2CPXA 3V81B 4WQ4A 4FBUA 2AJQA 2FVRA 2B8PA 2O8BA 3IM8A 1HLUA 1K1SA 2VUGA 1GLEG 3GFHA 4QS9A 3UD4P 1YZ6A 5HRPA 4AH9A 3EVWA 2ZE2A 2GELA 2D7SA 1UFWA 4WQ5A 4KT0C 4NL5A 3CCJS 3C0BA 2DH7A 1WC1A 3HL8A 2G1DA 4AL6A 5F0UA 4AL5A 1LK5A 3D6FB 2Y1JA 2F8SA 1RADB 4NLOA 3LH2S 4I2PA 5KG3A 5IT9Y 3I0SA 4CIOA 2ZDOA 3J80Y 2XLJA 1FDDA 4NXMK 1L3TA 3ULHA 1B7YB 2Z8QA 1BI4A 4KHUA 2F8EX 4IH7A 4IJNA 4KH4A 2NPFA 3QGIA 4EP4A 3AO5A 4Z4GA 5ADXA 4GV6A 4CJLA 4DL6A 2XQCA 1EQMA 5E3PA 3KLHB 1OH7A 4LFBK 3ILOA 2R7YA 1XMOF 5C5JA 5FD1A 1J6ZA 1R31A 1Q95G 1MN9A 1Y5LB 4M41A 1SI9A 2R7VA 4ZS6A 4USWA 3ENVA 1SBRA 4WE1A 4IO8A 3MMJA 4A47A 4ILJA 2C2EA 3H25A 4H0VB 2G2OA 3SAHA 1DJ0A 4FYXB 3C6HA 2OIHA 3GMGA 4QS8A 2ZITA 5L9XA 2O8FB 2VOPA 1Q82O 2AJ1A 2XTJP 4RUCA 3ZSRA 3TJ8A 4YR2A 1VIXA 4OV6A 4CLZA 1FO1A 3CCRS 1SL0A 2GW8A 2NXCA 2AV5A 2FJAB 2Q2RA 3D0PA 4OLPA 3FR0A 3HSTB 1U2VA 1XNRK 1EO1A 4MKYA 4F7VA 1PC5A 4CO0A 1X4BA 3V6HA 2D9OA 3GR1A 4B1UB 5M1KA 1OSCA 1N36F 1CC7A 3PYFA 2VIHA 2JLEA 2IVPA 1R0CB 1WSGA 5KI6A 1EARA 8ATCB 3HRGA 1OQ6A 5L38A 4B3RF 3C6TB 2E2NA 1RSCA 4CGGA 1Q8KA 4CJWA 3L3CA 2RJZA 1LWFB 3MR6A 1WN7A 3VN5A 1OH8A 3VAKA 1LAWA 4GVMA 3G82B 5B8HA 3BO4A 1KP6A 1DRZA 2XY6A 2RU3A 1WOQA 2QWQA 3MMCA 2ZH1A 4KB1A 4FXDA 3AH6A 4J9OA 2VC0A 1QUPA 1RXOB 4ALZA 4NYPA 1BC6A 1SJQA 3DXBA 7AT1B 4J90A 1X4CA 4CT8A 1UEUA 1ZH5A 3NAEA 1S72N 2DH9A 3DYAA 5U47A 1RWPB 3PW7A 2O8CB 1WSFA 3W8GA 5D78A 3AB4B 1KLMB 1T8EA 1CJKA 1VHXA 2DKOB 5F3TA 3NGYA 1R89A 1F9FA 2HWIA 4CLFA 3T5KA 3P5TL 2DR8A 3CO0P 1WNEA 3QAUA 1RCOB 2VL1A 1VYAA 1VQNN 2QX0A 2VDHA 3CULA 3OR2B 2IM2A 2LA4A 3GP9A 2BJ7A 1FKPA 3VQ6A 4JI7F 2X6SA 4BR5A 3BGRA 4YN3B 1JJCB 5KFHA 3OVNA 2B4JA 3NS6A 3S01A 3LP3A 5TKWA 2XGPA 3C6UB 3BEXA 4DXLA 2V5HG 4KH0B 4DV7K 1EKEA 2DR9A 1X4AA 2DTJA 1YWXA 2V8DA 2CDRB 3OYCA 4V19J 4TLRA 1EAYC 3EUNA 3P39A 4HCCA 2OPRB 2H4YB 4QPXA 5E26A 3EJMA 2P9UB 3SCXA 1WHVA 5GAGI 3AXKA 5F0WA 3QZ7A 4F3QA 3WNEA 2CJAA 2FSJA 4JI7J 1CBKA 4O3QA 3NEKA 1Z2ZA 5HQLA 4DMZA 4CLKA 4DU1A 3ZETB 5K8NA 2ERRA 3EGNA 1BWVA 5KFBA 3IN5A 1YJNN 4DQRA 2W9BB 3TJ9A 2EG2A 5KT7A 3OUYB 1Y97A 2WW4A 2MEWA 2HEKA 1UMJA 3L7UA 2XO7A 4HDGA 4AM7A 2HFSA 3KJQB 4DV5K 3DGPA 1HBUB 3G4SN 3MXHP 1RT3B 4QWCA 4JI6K 1S1TA 2V8HA 2QA4S 2FF3B 4MO4A 4KB7A 3KKFA 4CECA 1L3SA 3D67A 1FVSA 4A8MP 1TKTB 2IJFA 4M5DA 2DXEA 4YFUA 4FSVA 5CZ1A 2C3OA 3DMJB 2VQEK 4DR2K 1TKXB 4O0NA 4CHQA 5IWAF 4B3SK 2YWWA 1FRJA 2EFOA 1RP5A 3K5MA 3MWPA 4OJGA 5F8NA 2B9XA 2C2DA 3WZ0A 4AHSA 3KLIA 3TZZA 1NGFA 5LT5A 1ZPWX 3FFKB 4EMDA 2M8HA 1VSLA 5A2QY 2MB0B 4JKGB 1QHTA 2DY4A 3Q8SB 5MAOA 2QXFA 3CD5A 2ZH6A 4DEZA 4ZPCA 5L1IA 4DR4K 2P9UA 2CQ3A 2MHNA 2NXEA 2W2PP 2G8KA 1LWFA 3OTOJ 2G8FA 3UVJB 4XH1A 3C2PA 3LWLA 4CZIA 3C6TA 3QFPA 2ZC3A 3DGPB 5F8JA 4YHHJ 2OPPB 2HHHK 2V8PA 2FBXA 1HNWJ 1FRHA 4ELTA 1FKOB 2HSTA 3EMTA 4FW1A 3WNFA 4JI0K 3CSKA 4B3SF 4NLGA 4QW8A 2VJVA 2H3GX 4LF6J 2XMMA 4H8KA 3IBCB 1RWXB 2VBWA 2IBOA 2LXIA 4FZVA 3Q0AA 2ASJA 1UVNA 2IC3A 5KFQA 3V6DA 4JI0J 2GUPA 4P2MA 5HBMA 1KLNA 1VQKN 4DV1F 4DU4A 1WC6A 2D3O1 1NK9A 4AQYJ 3ZNJ1 4YR0A 3SMZA 3TR5A 4CO4A 3D7SB 3I8DA 4HWIA 4C2MA 3T1HK 1RAOA 4Z7CA 3PRVA 4DR7J 1S3XA 1DARA 1NAQA 5A0YA 2E7VA 3QT6A 4LF1A 5BYSA 3M2RB 1NNDA 3ISNC 1N52B 3IRWP 3M8PB 3QBWA 3QFUA 5EOYA 2A1BA 5H1SV 5KRTA 1WTBA 4DTOA 1IKYB 4J9QA 1G1XA 3MN7A 4OGEA 1Q8IA 2AGQA 1NSQA 3OUYA 1M90O 2YJEA 3GONA 3AODA 3D2WA 5ITHA 2V2KA 3G87A 4FCYA 2OH2A 3RW7A 4FM2A 3CCVS 1QSYA 1NGHA 5A8WA 2DHSA 3W2VA 4LVOP 4KHRA 5IV4A 4M5MA 5HAOA 2MJNA 4LRFA 4XDDA 4X65F 3QFHA 3DLKB 5JUMA 1ZBUA 3AVBA 3FBCA 3PW2A 3AVMA 4AE5A 3VZHA 2P9LA 1YTUA 3H3OB 4F4KA 3ZT1A 4EHTA 1FHTA 4NLSA 5DETA 2JWLA 3U9DA 3IAM9 3V9UA 4PG6A 2I1RA 3MPWA 1Q81O 1S0OA 4KB0A 3I32A 3M8QB 2NRXA 1VHIA 3HHLB 3WEEA 4IEEA 1W2BM 3BN4A 3HHLA 3WEEB 1R6VA 2HZAA 5CYQA 2V8GA 2DXDA 3NGDA 4UQTA 3GJRB 1E3MA 2OSRA 2QRRA 1MU2B 1Z05A 1HARA 1RKJA 1Y64A 1S1TB 3NNCA 3GLJA 2O01C 2NQPA 5F8LA 1YHQS 3AVJA 3UKRB 3EZOA 5CZXA 4LF7J 4IOBA 2WAQD 3LDSA 3A0IX 1NK0A 2Q0UA 2YHXA 4JV1A 1IBKK 4IOAL 1UFLA 4OLOA 1YVNA 1FXDA 2CQHA 5IWAJ 1TYQB 3ZEUA 2FD2A 3UDCA 1I94J 3DLKA 2ATQA 1WB9A 3U4LA 1LV5A 2JL9A 1LQ9A 4ID5B 3M8SA 1JL1A 3R1LA 2DFEA 1U2VB 1IBMJ 1HWJA 3CJRA 3PTWA 2HS4A 1FNOA 4OKKA 1F60B 3N6LA 4O44A 1RB0A 2AWZA 4EFAC 1BLUA 5FJ4A 2CPFA 1RDCA 4YOTA 3P8BB 3ZSVA 4A5AA 2YNIA 2JFDA 2KKHA 1XUPO 4OYPA 3LL3A 2MKJA 2PFUA 3KMSA 1N0VC 2AZ3A 4ES3A 4KPCA 2CIMA 1KTQA 4RNHA 3A4TA 4H5NA 2J9CA 4QWDA 1RE1B 3T5HA 4V19X 4F36A 1U0HB 4H5TA 3H3NO 4C11A 3ZO7A 2E29A 1APSA 3S3NA 3RBZA 3CE8A 3Q7CA 3SQGA 4H4OA 3TQ1A 4NOHA 4E1JA 1Y5IB 4MO5A 2W8KA 4AF1A 4NYFA 2ZHAA 2LXUA 3QEPA 1SJFA 5KFKA 2VD3A 4WIQA 1SJ1A 2O67A 3RR7A 1FT8A 2UV8A 4BDPA 3SZ2A 3EZUA 4C48A 3W60A 1IBLJ 4PYAA 1U1OA 3FCWA 4C1NK 2HF4A 3ZX3A 3G6EN 3HFZB 5DDOC 2DO0A 3I0SB 3P4IA 4I7FB 3C66A 1SH0A 1K0VA 5KG6A 2KT3A 1VQPS 3TEGA 3J7Z5 2RT3A 3PYDA 3VVTA 4BS2A 4PYDA 3MWTA 2D1KA 2ZE2B 3BF3A 4ILLA 3D7EO 3DXKB 2CNNB 5KG4A 3W5ZA 1Q16B 1VQ6S 1PYTA 4K59A 2HBZB 1RTJA 3JYTA 1VRTB 4CGHA 4W5TA 4G1PA 4K4TA 5BRFA 5J1EA 3J7YI 3B54A 2SXLA 3OVSA 5IM0A 2D3OR 3TNVA 2FC0A 1HBNB 1GEHA 1RWMB 1CJUB 3KLFB 4X4UA 3IS9B 2XEXA 4B3MJ 2F9TA 2XY8A 2DNGA 3ZT3A 1RDRA 4KQZA 5HVGA 4FYDA 2IM0A 1FEEA 1LEOA 2DNMA 3DOMB 3G8SA 4RTFD 5T7LA 2VDIA 2W2OP 2DR5A 4LFAJ 4GMJB 4X4QA 3KFWX 2I2YA 3K2YA 3A5NC 2VG5B 2EKYA 4YY3J 2P9SB 5KT2A 3BF4A 4LRBA 4XH4A 2DBBA 1QHAA 2RAQA 2VG7A 3PJ9A 4B9LA 1O51A 3T7ZA 5KFUA 1WELA 2NLWA 1IWGA 3OS0A 3MAHA 3R7BB 1OYDA 4JS4A 2RQ4A 3E01B 4DX6A 2FPHX 1B70B 2CAJA 3K5LA 3DXKA 2DITA 3O3FA 4DMNA 1S0MA 4EK2A 3OYJA 3T1YF 1NJIO 2CH6A 1RK8A 4Q7AA 2HWHA 2E44A 3EGWB 4QWBA 2BE2B 3D3CJ 2XMVA 2QA4G 4DFMA 4FJGA 1DY3A 2CG4A 4I7FA 2DB1A 4DR5J 4B1YB 4N77A 2EFGA 2J7KA 2YPYA 3PFEA 3GJSB 5A8KA 1MMLA 1FTRA 2ZOFA 3DN9A 2E5LK 3AD7C 4JI1J 4U67Q 3RGIA 1HQ2A 4OJRA 2V8VA 4FK2A 4Z4IA 3K5NA 2YY3A 3TANA 2E5IA 5T14A 2CQ4A 5JICA 4BRQA 4MKBA 3ZZOA 1AZSB 1BDGA 2N3OA 1RWWB 4Q44A 1T6CA 4LF4K 2UUCJ 4FJHA 1MSWD 3NGZA 4MK7A 2FJBB 1T9WA 2IVYA 5D15A 1VK3A 1NCLA 1LWCB 2YKAA 1UW9A 3HVTB 4ZVUB 1BU6O 3FNNA 3NBPA 4OKJA 3QINA 4X4SA 1PSDA 4WP3A 2QMWA 4F3TA 1EWRA 1HWLA 5LMNJ 2CADA 5LOQA 2GVDB 1IR1A 1Q8LA 5A8KB 1IBKF 2OZSA 2HRUA 2HBYB 3CETA 4UF4A 4J9VA 5JVGL 3T9NA 2B9WA 3KLIB 4JI7K 5HLFA 1RLCL 1WEZA 2B43A 1TFWA 4YNQA 3IDHA 3WC2A 1IQZA 2Q6CA 2E1CA 1RT6A 1MDUB 4KHPJ 1PJ5A 3T69A 4DV4K 4W90B 4CEQA 3NE6A 5AJ3F 4PKIA 3G71N 3QATA 1J5OA 3L4BC 3POTB 3CJ0A 2Z1GA 5CCMA 4NLXA 3AOBA 4DV7J 2HBRB 3PVXA 3W0LA 3EVMA 2LQ8A 1P27B 1UA1A 3P38A 1GLCG 3BYRA 4N7TA 4HTLA 4F04B 4OHXA 4CBWA 2J8AA 1D3WA 1F3FA 4JOUA 2OI2A 1YKWA 3MM5A 3PX6A 3AO2A 2KN4A 2NUBA 3HD2A 4GC6A 4H54A 5KGWA 4E7HA 1XWLA 4LIRA 3QRRA 4Y28C 3DRPB 1CJTB 2IJRA 4DS4A 3V9WA 2Y3YA 2GVZA 2MHEA 1CJTA 2F4FA 2NPIA 4EO8A 2BUPA 1KCFA 2HSEB 1W25A 3Q89A 1N48A 4DR7F 2UU9K 3ZT2A 5C0YA 3ZZPA 4ECVA 1CVJA 4H5VA 4B3TJ 1W2IA 1T9XA 5EX3A 1TKXA 4Y0WA 4EBEA 2XRIA 4C8NA 4KR0B 1BMQB 2ZBPA 3AVIA 2OEJA 4OI4A 2HK2A 2UXCK 3THWB 2PC6A 4KHWA 1NGIA 4CZKA 1NK4A 1FDNA 1K44A 3BEGB 1JLGB 4WTOB 4LF8F 4BDZA 2RQMA 3MTKA 2BGGA 3T1YJ 4FXVA 1I94K 1VC5A 3M8YA 4N76A 3T5LA 2QGFB 3W9IA 1JX4A 3ENOA 3AFGA 1HNXF 3AVHA 3IR7B 3LGMA 1FRXA 3SAFA 2FVQA 3MEKA 4W5QA 4H4KA 2ZFHA 2HQFA 1SC1B 4BBYA 2ZBQA 4NCAA 5F8IA 2IPOB 1K47A 4OV1A 2CVEA 5LSOA 4ZTJA 1R6YA 1JNRB 3WHIA 4JI1F 1C4CA 1KS2A 3BSNA 2JH3A 2C2MB 4J9RA 3DLHA 2IS3A 4NLWA 3EWGA 2IVNA 1A6LA 2X1GA 3FZHA 1TP7A 2OFGX 5HBMB 2B4OA 4HACB 2DVIA 4FK4A 4G65A 2W9CB 3IG1B 1EB0A 4JN4A 4JI6F 1WSVA 2VPZB 2FJDB 3LDQA 4NO7A 5FPEA 1VBKA 3DLLQ 1XEZA 4C8MA 4FM1A 4JYAF 2PEHA 1YBUA 1U6ZA 3TW0A 1D5AA 2RNEA 1N6QB 3EKSA 3ICLA 3H7HB 3UCGA 3QSYB 2E9ZA 5ETSA 3OYKA 3M8PA 2HBLA 4BROA 1UJ5A 2HMPA 3LALA 1IO2A 4USHA 2KH9A 3GIIA 1WHWA 3KNGA 4OPAA 3FMWA 3M1VB 4X66F 4JV5J 5KFDA 1Q82T 3UR0A 3CJ7A 1WEYA 2ZUAA 2V9WA 1N5TA 3FRYA 5AQJA 1VQ7S 1CLFA 1WKKA 3V5RA 3L09A 1YBTA 3D1QA 3RRKA 3EXCX 1YIJN 2QLWA 2F4VK 3SFGA 2D69A 1VHFA 3F41A 1X3NA 4AHVA 4CF2A 5F9LA 2LU2A 1NJWA 4O3RA 3C94A 1NWKA 2C2ZB 3MXMA 3TU5A 3C15A 4WFBQ 1SKUB 2W2MP 4GMKA 3OBIA 2ZH5A 4Z4CA 4W92B 2NNWA 5KFYA 3NCQA 1Y3JA 2MZJA 3NS7B 3J8AA 3THXB 3MHYA 1WSRA 1N5SA 4FWPA 3TUPA 1IM6A 2UXCF 4X62F 1EHWA 2HW3A 2MY8A 2B7CB 2KXHA 3D0GE 1U04A 1VGYA 2R8IA 4B9QA 2M70A 4BQZA 4KRFA 5HATA 4GKKK 4CK3A 1FK9A 3D68A 2WVEA 6AT1B 2AHOB 3ZSYA 3D6TB 2YPZA 3LTOA 4C4WA 2EVZA 5K8OA 1PAEX 2BE2A 3BR9A 2FXUA 4ECQA 2MKSA 3MEGA 4DR4J 2OD4A 1NBWA 2RHKA 4H0TB 2DNPA 3KJVA 3HX9A 2GJFA 4K8RA 1RBOB 4CH1A 4KH6A 3BN7A 4JS5A 4DTRA 4CJUA 4M3TA 1VQLS 1K8KB 1XR6A 3PLAA 2V4RA 4AYBD 3I5BA 4DSFA 1J2VA 4K2XA 2V4QA 2VG6A 4W4MA 4L73A 4EO6A 2MGZA 2R2TA 4DTPA 1B7FA 5AZJB 1GMUA 1MWKA 1U6BA 3TZYA 4P2SA 1YJ9S 2F8MA 4W5NA 5AFUH 2YKNA 2VKRA 4OYZA 3G6YA 4EAHD 3R5CA 2UUCF 2XB2D 4PG4A 5A8RA 1FJEB 1PJ6A 4CJEA 1NGGA 3E9OA 1UZDA 4DR5F 3M6XA 1JXVA 5KG5A 2NUUG 2V68A 3MCAB 1I3OB 3TAMB 2CPZA 3TVYA 4DSLA 4C1NI 1VRUA 1VI7A 2VJUA 1HMVA 4CGIA 2OYQA 1RU2A 3AD9C 5JS2A 1UWBA 2PI4A 3D2FB 4EYHB 4NPOA 1ESVA 1VQ9N 4Q2LA 1Y00A 4DPXA 4DPYA 4JKAA 1IM4A 2HB5A 1DQAA 4NZ0A 4PG8A 5GIPA 4DPOA 4LFCF 1IJEB 3Q83A 3MM6A 3VF2A 3OL7A 4FPBA 2E88A 5RUBA 1EX8A 2R7TA 2EBGA 1RT5B 1H7WA 2W40A 5JS1A 3MEEB 1H0HB 1ILYA 2YBVA 4XDCA 4M5NA 4M7YA 5M1OA 4DFKA 1ZBIA 3G4SS 3L2VA 3F44A 2PYLA 1YJNS 3MFHA 4LIWA 4P7VA 1A5VA 3DXMB 3OA9A 4KHQA 1RFQA 4PABA 5AQXA 2XHBA 3L2UA 3DXMA 1XHXA 2DYAA 4C3LA 4DU7A 2EFQA 4QU6A 4HHTA 1VFJA 4HLBA 1XQSC 4NWBA 1GXUA 3G8QA 1Q7YO 5A76A 3AVLA 4LF7K 1NB2A 5LJ5Y 1HKCA 4GRSA 4LFCJ 1S76D 3VQ9A 1KD1T 1TL7B 4ED5A 1CZ9A 3RJMB 5C2FA 3ZX2A 4K2JA 3KDOA 4FJXA 1M1KT 4EEYA 2XHWA 1YITN 2JEIA 4YOYA 4WF9L 3ALYA 3BYPA 3QPIA 2B3TB 3ZZZA 5KFZA 3O08A 1RT7B 1U1RA 1OO0B 4KYZA 3L2RA 3VMFB 3TZXA 3R9PA 3L3VA 5F0XA 4O5BA 4IOAQ 5CHIA 5DDQC 1DGKN 3C14A 4U7BA 2K3IA 1U0SA 4DZ6A 2RF2A 3A8IA 1DTTA 2XO6A 4QOTA 3DC2A 2EW9A 2GWJA 5KTQA 2MXYA 2HPUA 4O44B 4WBFA 3W2VB 4B9VA 5E3QA 1R43A 4KO0A 4B08A 5C12A 2GS8A 4FOEA 1WWHA 2GFFA 4B1XB 2WBRA 4A46A 3CNQP 3KUHA 5ETNA 3BS9A 4Q2MA 1DZ5A 3FCHA 4C3KA 4DUYF 2FBYA 4CD1A 1KQSR 1XERA 2YWHA 4FJLA 4OX8A 2HHPA 3SAGA 4Y00A 2A6MA 4DX5A 1RDAA 1BHLA 4N56A 4PXBA 3QWPA 3AXMA 1Z1ZA 3OYFA 4BG8A 1KXPA 2ABYA 3VQ7A 1KHWA 2F5GA 2CQGA 1WC0A 3QGPA 2GGPB 4R0JA 2HQDA 4H5RA 4OHYA 2AGPA 2DY9A 2W4PA 3GV5B 2RKIA 3ISZA 2K7KA 4CLTA 1VQ4N 5L39A 2C1EB 1NSKL 2R9LA 2HMIA 1G2EA 1KVKA 1RWKB 2ROGA 3MK6A 3I33A 2KHDA 4PEOA 3O3HA 5KFVA 3ZZUA 2P9LB 3IGNA 2HIQA 3SLCA 3BQ0A 4E98A 2D0OA 5AQPA 2UXCJ 1U1QA 1ZM3A 3NH2A 1RLDA 5EN1A 4ZCKA 2A10A 2W2QP 1I94F 1N4LA 3W63A 4ZVFA 2UUAF 2UUWA 4F0MA 4U96A 3WIUA 2NCKL 3PHEA 3ZNUA 1KVBA 3ZEUB 4DV6J 1YRXA 2W6LA 3U6FA 1OVQA 3CYMA 4RBVA 1R7IA 3FUYA 2FLLA 4IH6A 2ZUGA 1EXQA 3BP8A 4WU2A 4F25A 2E6LA 4I6MB 1G15A 2E5LJ 1U7LA 2KRBA 5DG7A 4OZNA 4ED8A 4GKJF 4PQAA 4LR8A 1Q81T 4C8YA 4OX7A 3G96A 3AGKA 2DPJA 2GHVC 3FKBA 4JK7A 4EBDA 4ATNA 2DRDA 2DCLA 2KLAA 3UCZP 4MFBB 4GNIA 4J91A 1V4SA 4BRKA 1Y0HA 2NLXA 5EWGA 3OFHA 3Q8YA 3IWXA 4TY8B 2F8TA 5AXNA 4PKHA 4JBCA 3IGVA 5IWAK 2GHPA 1NMNA 1EWQA 3G25A 5KFSA 4GV9A 1K1QA 2VWJA 3MN6A 2GVDA 4IRCA 4TYBA 4BLGA 3CJKA 3C46A 4RWTA 3SNNA 1JQGA 2GWKA 4OO1J 1U8WA 5J2NB 1ZS6A 3GJQB 4WF9Q 3EM1A 2FHMA 4K4SA 2VA2A 3JAMU 1Y4ZB 4N8OA 4JEPA 3VQAA 3L9ZA 1S1VB 2HWTA 1BOTO 2ADBA 2KZZA 5KFRA 1G3OA 1PGZA 4YOXA 4XK8C 5E84A 4HHUA 3M6WA 2Y1LB 2M5YA 5C25A 2I6WA 3EY1A 1KC8T 2UYTA 3ATUA 1VC0A 1NBEB 1NHKL 3VQCA 4CE9A 3CCJN 4DV1K 3OTEA 2KI2A 3X1LB 3CG7A 3MOZA 4ZP7A 2RS2A 2IY5B 4F67A 1NGDA 4K25A 4DV1J 4OI2A 2V7ZA 3I0RB 2VQFK 3D1HA 3MX2A 4JI0F 3PW5A 4TQRA 3U3GA 3V1RA 4Z4FA 3CEDA 3FQKA 2VONA 3VOVA 1L3UA 4DPWA 2KG0A 3F73A 1E6VB 1BCMA 2GVZB 4JI4K 2V69A 3DYAB 2BACA 2NXJA 3G6XA 5L1LA 1XR5A 3GYXB 3ZT4A 3K0JA 1NPRA 2G13A 3B8AX 1S1UB 2QT7A 2P1JA 2A6AA 5CAAA 1N5YB 4LF7F 4F0KA 1TL5A 2KO1A 4DL0C 1DKGD 2YI1A 3Q8UA 4CF1A 2QLFB 1HKAA 2O5DA 1YJWS 4ZVEA 3KMQA 4QIFA 4E7JA 4ZP8A 4LFBJ 3AJDA 3M32B 3O2IA 4ZVHA 2ZH7A 3GL1A 4M7XA 2R8HA 2MQMA 4ZLLA 4ZLJA 3ET6B 5CYMA 2BX6A 4HL9A 2HFOA 5IT9O 1K9MT 1BUXA 3RUBL 2CNOB 3NCPA 2N3LA 2CQIA 2DNNA 1Z25A 5D6GA 2CQ0A 5GAGP 2MQQA 2ZWPA 2R7OA 3W61A 3PX4A 2IHR1 3NCIA 2QEXS 2HLTA 3RBDA 3VQ5A 1CPZA 4A4JA 1NJXA 1VOMA 1M5VC 4F4XA 4F8RA 1T9UA 3CQXA 2P51A 1NRKA 4WP9A 1CJUA 4C8KA 2FLOA 3BO3A 2YQ0A 2A18A 4LFCK 5F8HA 2Q97A 2IYGA 5B0FA 5G0RB 4ZVPB 4JI5K 4OGCA 2UUBJ 5L1KA 2G0IA 3JSBA 3HD1A 4ZCMA 3KKRA 3OHBA 2HGLA 2ZNYA 1YXQA 2GMLA 1IBMK 4ETXA 1NK7A 2CNLB 3BGRB 3ELHA 2WOMA 4B17A 3DDNA 2ZH2A 3U02A 1Q7LB 3FFIB 2VKZG 3ILJA 4UUWA 4F50A 3DOKB 4ELVA 3K5PA 3KUEA 4L74A 2RB7A 3B8HA 4HDHA 3MMVA 3WUHA 2E1YA 1ZAXA 4C98A 2BANB 3PJWA 1WC3A 5I3PA 1MG7A 1GOCA 2JLGA 1NDCA 1S9EB 1HBMB 3I56N 3CXCR 1PBAA 4FWQA 2QKKA 2VYPA 5EDWA 4I68A 2JNJA 1LW2A 2ZF5O 4RW4A 3FLCO 1Q5VA 3VVUA 5GAGU 4NE9C 1HKBA 1VQNS 3MUVP 4ZVGA 2IDOA 4DSEA 4BRAA 1E4GT 5EWFA 4N5SA 3OXLA 2A42A 4FZXC 1R0BG 5BN8A 2CKWA 4JV5K 1UETA 3GG1A 5FIIA 2O4GA 1HW9A 2VQEJ 1ZBFA 1N34K 2HVIA 1IBLK 4OHVA 5AQTA 3SQ2A 1C0TB 3IC1A 3JTOA 4ZLNA 1YDLA 3K8VA 2Z2ZA 1TFYA 1WC5A 2GGPA 2PN6A 1EETA 2ITGA 4JKCA 4MLHA 4KBIA 2YX6A 4WWSA 2I7NA 2D5RA 3HVTA 2F4VF 4RG8A 3DLGA 2V50A 2QLXA 5IT0A 2KU7A 3DNCA 1XIQA 1CQNA 4Y1CA 4AUKA 1RBAA 4FZYA 5AJ3J 3C16A 1M5KC 2LCWA 8AT1B 3VENA 2GJ2A 1WKJA 3UPFA 3C65A 3D2EB 4XPEA 1P9YA 1X0PA 3HI0A 1Q8BA 3SEOA 4TNOA 1HJOA 1HR0K 1BIUA 4HTUA 5KFPA 1U49A 4CJ3A 1FD8A 1IR0A 3O8WA 2RKIB 1FDBA 1TVRB 4DJBA 1S1WB 5M2RA 1XI1A 3MZIA 1MMNA 1NLVA 4PUOB 5BR8F 1XMQF 3QSIA 5HO4A 5KG7A 3SK3A 2Y8WA 3RSEA 3ID8A 4D3GA 3HXMA 2BJ1A 4UY8O 2QV6A 3QESA 1T0TV 4USJC 4FLYA 2H4WB 4C0OC 1NZ8A 4BY9C 4UOHA 4UT4A 1KAXA 4J9PA 1YJ9N 2Q6BA 3KNAA 4KTWA 1HUXA 3D1OA 2W7OA 1ATNA 1LWEA 2H5JB 1NU0A 4OYWA 3RB0A 2ASDA 4PL7A 4U67L 3CCES 1P9QC 2ROPA 2PT0A 3KYLA 5C2CA 3B78A 1TL3A 4AXIA 4M1KA 4DR2F 2XYGB 3HSGA 1J5EF 2CJQA 1XBWA 4IBNA 1S5JA 1RQ0A 3H20A 1SKWA 2YWGA 4PUOA 2HLUA 4FNHA 2OMLA 4K0KJ 3D2FA 2MSTA 3H40A 2IMOA 3SV3A 4DUYK 1WTFA 1WG4A 3AA2A 1DTTB 1FDAA 3DOLB 4TQSA 2YHYA 2R2RA 1IXKA 2XHCA 1NSPA 3RRHA 1KONA 2L9WA 4O8UA 4B9UA 1WLJA 4CK1A 2OPSA 2JJ4D 3THXA 4ED6A 1JLQA 4ILHA 2XGQA 2VFTA 4OLAA 1R3NA 4WIIA 4IO9Q 1HA1A 3MGJA 1CULB 2QC3A 4MKAA 5GAEU 5D0HA 5HRNA 4MDAA 5KPTA 2E2PA 4K41A 4YUDA 4RR5A 2MKIA 3CJ1A 2QTWA 2XLKA 1I51B 3W7BA 4ZN1A 4NZ6A 3GIMA 2UXBF 4ENOA 1C1AA 4DG1A 2HIYA 5C42A 1RTHB 4Z4HA 5AQVA 2G0CA 3TUZC 3PY8A 4BGAA 5H1SQ 3HP9A 4JKFA 3TAGA 5DK5A 6FDRA 5FLXU 2VASA 3QAEA 4KTQA 2A2DA 1CJVA 2LDYA 2H3EB 2GJIA 3ENHA 1VLOA 5AJ3K 1WEXA 2M3DA 4DR4F 1I1GA 4DF8A 3OTDA 4HVJA 5MLCV 3THTA 1YHQN 5LXRA 7FDRA 3VAFA 4P75A 4RW9B 3A5OC 2CH5A 3O1WA 2Z56B 2V4JB 4H0YB 3HM8A 4DSIA 2VGMA 3VQ8A 2ITMA 1ATSA 4WCEQ 1MWZA 1Q86O 3SQGB 3C6UA 3S8SA 4YOEA 4KGVB 1GOAA 3H6EA 1SH2A 3TSUA 3LP1A 4TN2A 2R3VA 1F9HA 3C95A 3AV9A 2O4IA 3CCTA 4HACA 2RDDA 4IH5A 1H1VA 4K43A 4ZK7M 2LQBA 3T5JA 3HTVA 3DLBA 2YX4A 4AQYK 2O8EB 3VEYA 3BQ1A 2JGUA 4DCPB 3PZPA 1QUVA 3MDFA 3UVJA 2RPIA 4DKWA 4CT9A 4KKOB 2V0NA 4C8LA 4B3RJ 1F3VA 2PD1A 3JB9k 4E3SA 1MROA 3AARA 5IZHA 5GAEI 5HMWA 3KG1A 4Z2XA 3UN5A 5IOLA 3O9QA 4Q43A 4IDKA 3BGUA 2CQDA 3C8YA 2YQ3A 2OELA 4IFEA 4CP5A 3V81A 5J2QB 1R8AA 4ECTA 2NXUA 3RZAA 4JAXA 3CC7N 2BA9A 2E1ZA 1KKHA 2YH1A 1SJRA 2LMIA 3M30A 1KAZA 3OS2A 3SSSA 3WQTA 4A8XA 5H9FK 1IBKJ 1JLBA 4I6WA 3V1QA 1YI2N 2P6TA 2HVEA 2UXDK 1KFDA 2KT2A 4B3TK 4OLBA 2HQIA 2W24A 1DT9A 5FDLB 2JVRA 2XBPA 3UO0A 3QMQA 3R7SB 1W7AA 1QQNA 1KRPA 2YKQA 4CM2A 1Q18A 4G9ZA 3SUQA 4A8YA 1C0UA 4C8ZA 3FE1A 3A5MC 3W9HA 4HT7A 1ZPVA 3OFFA 2IRXA 4PG5A 4CHOA 3AGRA 3O80A 4XH5A 3S3OA 4HVZA 3H45C 1DFDA 1I39A 3VQBA 2VV5A 2E2OA 3MCPA 3NMUA 1JK9B 3FZLA 1ZXOA 5DDRC 4EZ9A 4DV6F 4PZVA 2EC2A 2XYPB 1RISA 1T05A 2KHCA 4CO3A 2WBMA 4OYXA 1R8BA 4O5FA 2V2ZA 1KVIA 3J81U 3CC4S 1B64A 3BZKA 2YKNB 4KKOA 4B3TF 1OIAA 2HQCA 4N41A 4RWWA 4Q0BB 3ZYYX 1VQMN 3MD1A 3MDQA 2M2BA 4IWVA 3RW6A 1RWOB 4QAGA 1ICEB 4FJMA 4HEA9 1NHVA 2DNYA 4FM0A 2RRNA 2NRHA 5A6PA 4X2BA 4KREA 5FDLA 2BOPA 1K8KA 2CPJA 1T03A 1BY9A 2ZBCA 3HPOA 2JC0A 5HMYA 5ETPA 3FEXB 5IC4B 1AFIA 1NM1A 4O8KA 1VQSA 1HNZF 2IRUA 5C2DA 3KLVA 2MZQA 5DRKA 4QIVA 4X4TA 2E4LA 3D5MA 3TZWA 3PXGa 1X4EA 2NRRA 3R7NB 3A1YG 3J7ZT 4KHPF 3QQCD 3EZWA 3W1YC 2CJKA 2A1RA 3T6BA 1QSLA 3MAAA 4AQYF 1EJ7L 3SCLE 4HUFA 3PEJA 4FO0A 4LQ3A 4B3MF 4EUVA 2QZ8A 2PI5A 3HPGA 1AW0A 2KT5A 5AQNA 3ETMA 1N8RT 5G4DA 4IRKA 1CS4A 3W5XA 4MFBA 4MYUA 2RUSA 4ZKAA 2PYJA 1QE1A 4NRUA 5ADZA 4KSEB 2OTJS 4DV3F 4IG0A 2XZDB 1TGOA 5CZVA 2J6SA 2XSFA 4A8KA 1HNIA 3CJBA 1F5AA 1FX2A 3ENQA 3KK2B 3D4JA 5CQGA 1NJYA 3K9JA 2G8IA 1C2PA 1XNQK 1TUYA 2MQOA 4YHHK 3JAMY 3VF6A 3LPYA 4BRCA 3CW2C 5F8GA 4B9NA 4NMLA 1N36K 1VSEA 4U7UK 3LP2A 1FJ7A 4YDUC 3HKZD 2DT9A 1HQUB 2FDNA 4J9NA 1FXLA 1RBLA 4U7UD 3O5BA 3OYLA 1U26A 2OHDA 2FGOA 3IRXA 2M7SA 4ES1A 2ASPA 2BJDA 2HGMA 2AYGA 3KLEB 1N34F 3ZETA 1J53A 3M1VA 3R3TA 4OZ1A 4PCQA 1RAFB 3LA0A 4BC9A 3ZSWA 4ED1A 1O13A 4ZJOA 5KQ8A 3GV7B 3NL0A 2PFDA 4KAZA 2DEIA 4LF6F 1JNZB 1YGYA 2ZH3A 2HBMA 2OA8A 1X1PA 3VEXA 2KG1A 4Q8EA 2V67A 2GV9A 3QMLA 2KFYA 2XI2A 3E01A 1WG5A 3AY0A 3N6NA 4QYRA 4X4OA 2XLIA 3AO3A 2OEKA 2ACMA 4YB7A 3KWGA 1Q9YA 3DKDA 5IV3A 2Z57B 5LL6d 3MM9B 4ANEA 3H5XA 4NA2A 1Q4RA 3W65A 2DO4A 3EEQA 1HHQA 4EBCA 5K14A 3HHKA 5ETMA 4TY9A 3CERA 1LFWA 4J2BA 2CGJA 1U47A 4BVOA 4PXEA 1JCEA 1A0OB 3NGIA 4NLBA 1RKIA 5BPNA 2YHAA 2ZZMA 2XWYA 5BREA 4FOIA 3MURP 1F2HA 1S99A 3OR2A 4JI8J 2V2VA 3FVYA 2A1SA 2XNQA 1VJQA 2DJWA 2IVFB 2E5HA 4IG3B 1NGAA 4LBIA 1WI6A 1ZETA 3KHHA 5BR8J 3T9ZA 5A2QO 5DMRA 3CFPA 2AA4A 3TWZA 2KFZA 3LM9A 3I9V9 3U9ZA 4U8VA 4X65J 4NCBA 4RU9A 3LM2A 4NLDA 4KJIA 4QW9A 2PMZD 3SSQA 3UKRA 4LF4F 2O8DB 3CIMA 1U48A 3KOAA 2FJEB 2GX8A 1TAQA 4CQ1A 2W8LA 1FKAF 1YBAA 5HL7L 4LFAF 1NGJA 2GX9A 2ZZTA 2ZNZA 2BW2A 2BR0A 2ZHOA 3HHEA 2G8WA 1RYSA 3LANA 1UWBB 3VGSA 4ECSA 1TK8A 3L0QA 3TR8A 1UAWA 3BDPA 2M88A 1KNZA 4RNMA 1VSMA 3VQTA 3BBFA 4L72B 3FMBA 3M6VA 1WUAA 3PG9A 3EGZA 3QO9B 2K1RB 3GV8B 3B82A 5A0YB 1EQYA 4Q0BA 4RW7B 3EN9A 2DD8S 3I55N 4BE1A 2WRMA 4I67A 3CJCA 3BGOP 2GO8A 1LFPA 1BQNA 3DLGB 2CZ4A 5J1PA 4DR1K 1PAUB 2VG6B 5M2UA 1IKVA 3PFOA 4DG1B 4OX9K 5AFUA 4ED7A 3M3ZA 2RSQA 1RT1A 4FN5A 4Y2MA 4ZPTR 4ZOSA 3MPUB 3TPQA 3KXDA 4BRNA 5EY4A 3PHTA 2PIIA 3ZTPA 3MMBA 1NPPA 2D74B 5KFNA 4DV4J 1Q0NA 3ZTQA 4PWWA 3UB5A 3O6WA 4I9LA 2WW8A 4KY3A 2MKCA 1YUWA 2ZKUA 1S12A 1SIZA 1KR4A 4YOVA 1D8ZA 2FLPA 3CCMN 1JL2A 1O0PA 3PM9A 4CJRA 1RT4A 1RACB 1ASUA 4B1ZA 2P5OA 4ZPVR 4DR2J 2KKZA 5LMNK 3SJJA 3VAHA 1REVB 4YP3A 1K73T 1VSKA 2KXNB 3ETOA 4ILGB 3SUNA 4K50A 3MD3A 5DS7A 4LH5A 2E1MC 2BANA 3HLUA 1BXNA 4YHHF 3CC7S 1R0AB 3V6JA 3MECA 1X8DA 3SQ1A 2EFNA 2ZH9A 3L4QA 5HJXA 4JRPA 1Q9XA 2BJ8A 3RR8A 1IKWB 4FPRA 3KVGA 2R2UA 2DK2A 2O8EA 2FHOB 4ILRA 3FZKA 2VU5A 4ZTFA 1GTHA 1MMDA 4DV2K 3ATVA 1SC3B 2ZGZA 3EYZA 1KC8O 2HHQA 2FGCA 2JVOA 2VQFF 3BO2A 4NASA 2MLZA 3V9SA 3WXIA 2W1BA 4GVBA 4FWRA 3PV8A 4EFHA 1S6QA 1VRTA 3SDEA 4KV8A 2BKNA 4C7QA 1BI4B 1HI0P 3C6AA 1H74A 4HH0A 3UKUA 3CM5A 1PO6A 5J2MA 4W5RA 1HBMA 4BRPA 1VQ7N 3LAMA 3CDUA 4F3OA 1S1UA 4KGMA 4CZEA 1NNEA 1MA9B 1VSHA 3JQKA 2OTLN 3O6QA 4NA3A 3CQ8A 4DTMA 4WZQA 5KFIA 4M3ZA 3DDKA 1SPBP 3I82A 2FBTA 3CCSS 2P9GA 2DHXA 3CJQA 2LA6A 4LH4A 5AZIA 1NDPA 2HAFA 4TY8A 1GLLO 3A8KA 1VQOS 2FJWA 1V3SA 1UTAA 4CF8A 2WSCC 3OJUA 1KDNA 1WDDA 4HTJA 1ACMB 2M9KA 4CO5A 4Z94A 1JMTA 2OSQA 4CLWA 4ISEA 3TA0A 4CBXA 3MM7A 3THPA 2DIUA 2HVDA 2GC8A 1NMDA 3QEIA 3E1YA 3HBTA 2IM1A 3VALA 1QJHA 3AO1A 2UUTA 4NYNA 3VR1A 5HQMA 3BB5A 4BR0A 4AT1B 4QS7A 1YJRA 4BACA 1KQSM 1KEKA 3OTCA 3BPSP 1DQ9A 1SJ4P 1UVLA 2CQCA 2RU9A 3QJPA 2CFXA 1JJ4A 2FY8A 2Q1LA 1ZTWA 4CI6A 4DL5A 4MIBA 3GR0A 2QKBA 3MN9A 5HI7A 3KHLA 1KTVA 4L76A 2W9BA 1BA0A 4GKJJ 1VQ5N 3VEOA