5HP1A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and foscarnet, a pyrophosphate analog
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/inhibitor/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 152
structure length 553
sequence length 553
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hp1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hp1A05
2JEJA 3KLFA 3T3FA 4Q8FA 1UA0A 3DDKA 4H54A 1SV5B 5E41A 1G15A 4XIUA 3VQ6A 4EYHB 3KD5E 2RPIA 4C8KA 4ZVFA 4ED7A 2QKKA 2ASDA 3V1OA 1RT5A 4KI4A 5L1KA 3QINA 2R8GA 4FBUA 4J9MA 3SFUA 1RT4A 1LV5A 3DLBA 3BSOA 1JLEB 4F2SA 1K1QA 5KFXA 1XC9A 2D0CA 2QKBA 4Z4FA 3OYDA 1CXQA 4IRCA 1QS4A 4MIAA 2B43A 1GX5A 5C25A 1R0AA 4CEOA 3Q8PB 1T7PA 1Q9YA 4M95A 5KT6A 2RN2A 4CK3A 2X74A 4Y1DA 3OS1A 4K4ZA 4MKAA 4NLGA 3NH1A 3AVCA 2XY8A 3K5LA 4TY9A 4LH5A 4B9TA 3DLHA 1JKHB 2R2UA 3H4BA 4DTNA 3OSNA 1WAFA 4B8AB 4EEYA 2FJVA 4TLRA 2FLPA 2ZE2A 1SUQA 1F21A 1RT2A 4EO6A 1B9DA 3DM2A 3CG7A 2F8EX 3LWMA 2CJQA 4CECA 2BRLA 4DSIA 3GIMA 4ECXA 1S0OA 2IOCA 2OPPA 3HKWA 3BR9A 3VQPA 5KT5A 4CJLA 4ZTJA 4M3UA 1RT3B 4KV8B 2BE2B 4M3YA 3QGHA 2YKNB 2IM3A 4BDZA 3M9NB 3KLHA 4RNFA 5I3UA 1S48A 3DOLA 2Y1JA 2O5DA 3N6NA 3RB4A 4EBDA 2HW3A 4O44A 2UVWA 3CJ0A 2R8KA 4DFMA 4AHVA 3DYAB 3AVFA 4ZP6A 4C8LA 4IH7A 4X2BA 4RNMA 4F4KA 1J53A 1RTDB 2GV9A 2DTUA 1X9SA 3NDKA 2W8LA 4KB7A 4YMEA 4ZHRA 2KTQA 4Y2AA 4ZP9A 2V9WA 4O3OA 3RRHA 2R2RA 5KRSA 4CGIA 4CEAA 1RA7A 2FBTA 2WB4A 3VQCA 2VWKA 1QE1A 3PX6A 3NF6A 2UVUA 3MEDA 3GIJA 1C0UB 4FJJA 3L8BA 4HYKA 3C6TB 4CJ3A 3C6UB 1RT1B 4O0IA 3G6VA 1A5WA 3KK3B 1TKZA 4RNOA 3SQ2A 2PYJA 1S1UA 3ZSRA 3QESA 1RT1A 3QEIA 3MR2A 3BDPA 4H4OB 4NRTA 1UWBB 3I5BA 4CF1A 4IH5A 1C1AA 3AO4A 3SQ4A 3VQEA 1RDDA 3KHHA 3DI6A 5KFHA 3LPTA 1NK0A 1KCFA 3ZSQA 4ZPAA 4F4YA 3C95A 4DG1B 3KKRA 5KFJA 3ALYA 4AH9A 4FJIA 4FJHA 1TAQA 2Z1HA 2W9AA 4M41A 3DRRB 4DTJA 4G1QB 3JYTB 1HQUB 5KFEA 1LAWA 4C8MA 4O3PA 2D0AA 2FLLA 1TKXA 3IG1B 4R5PA 3I0RB 4KTZA 3VQ5A 5DQHA 2HMIB 4I7FB 3SQ0A 1HMVA 3PVXA 5C24B 2ZD1A 3E01A 4KHQA 4BWJA 2O4GA 1EXQA 3OYNA 1SKSA 4I9QA 4CF8A 3HSTB 4NZ0A 2IA6A 3H5UA 5EWEA 1WLJA 1KTQA 5J2NB 2R8JA 3QO9B 4M94A 4NLDA 5KFOA 1FK9A 3KLIA 2HHTA 4TY8B 3HM9A 4FM2A 5KRTA 2OA8A 3VQBA 1J54A 5CY4A 3S3OA 5EU7A 3VQQA 4QPXA 5KGWA 5F8LA 1SH0A 3L2VA 4TXSA 4WFYA 3NF7A 2KQ2A 2OYQA 2D3UA 1JXLA 1T05A 1EETB 4ZVGA 2YNFA 2E9RX 3HPHA 4CHZA 4CJUA 3PJWA 3MEDB 3DMJA 4KBIA 2FVRA 3ASMA 2CKWA 4YQWA 1U09A 1IO2A 2GC8A 1TL3A 2I5JA 1JL2A 4OGEA 1S9FA 3NGDA 3SI6A 3JSMB 5EUHA 4IKFA 4O3QA 4CE9A 3BQ1A 1ITGA 5HRRA 4DSEA 1JLGB 3MECB 4WXWA 3O3FA 4AHTA 5CYQB 1N5YA 3WNHA 2KW4A 4F8RA 5FDLB 4AILC 1L3UA 5KFWA 4CF2A 2X6SA 4Z4GA 5F8IA 3K2PA 4IG3A 3HK2A 3QZ8A 1CZBA 3CFRA 1FKOB 4RUCA 3HP6A 3OYLA 2E4LA 1TL1B 3L2WA 3CVKA 3KK1B 2XC9A 3I0RA 2EHGA 3HVTB 3D0PA 3VQSA 1QAIA 2XWYA 1NHUA 5KG5A 4PWDB 3L2UA 2DPIA 1VRTB 3NFAA 1ASWA 3WNFA 2B5JB 3DM2B 4DL7A 3DLEA 1KHWA 2OPSA 1VK0A 2ALZA 4CGJA 1TGOA 3EZ5A 1N6QA 4MKBA 5KFMA 4RW9B 3OYHA 3SUPA 2ZE2B 1NK9A 1LW2A 3TVKA 2ATLA 5HBMB 4ED8A 4L8RB 4NCBA 1EP4B 4PUOB 1EX4A 3RAXA 5D3GB 4RUAA 3V9UA 4H8KA 3IN5A 3ICLA 4OVLA 3NKYA 4WZMA 2G8IA 4WFZA 4I2QB 2KFZA 5JXSA 3DYAA 3NHGA 4M3ZA 1ZTWA 2FVCA 1REVB 4N47A 2IS3A 4PQUA 3IGNA 4DL2A 1ZBIA 2X78A 4ECVA 3M9OB 3HT3A 3RTVA 4CF0A 1WSGA 3CJ4A 4CFCA 3CDWA 2QE5A 5F9LA 1BGXT 5K14A 3AO3A 1HYSA 4KTQA 4FS2A 3QZ7A 3BGRB 3OL9A 2XY7A 2XY5A 2E9ZA 2HHQA 4Q0BA 4MFBA 3V6JA 4CHPA 4CFBA 1A5VA 2LSNA 5KFAA 2Z1GA 5KFQA 3ISNC 3OYIA 2ASLA 4UQGA 4ED3A 2AX1A 3DLGB 3QIDA 4J9LA 5KFLA 4CEQA 1SL1A 1IKYB 1B92A 1NK4A 4OLBA 4KAIA 3GQCA 2R8IA 4BWMA 3HHKA 3H5SA 4IRDA 1GX6A 2RKIA 4LSLB 5J2MB 1BI4A 2OPSB 5KFBA 4ID5A 5KFKA 2WONA 1NK8A 1DTTB 1LWEB 4ELVA 4KPYA 5DMRA 4IH6A 5HRNA 4DSJA 4KO0A 2WONB 1NJXA 4DL5A 3RWUA 4FJ8A 2VG7A 3EPGA 1KLNA 1D9FA 1YTAA 4IRKA 4O4RA 1NOYA 3MXJA 3O4NA 2YHBA 1GOCA 4KI6A 4K8XA 2XGPA 3LZJA 3CFPA 4Y1CA 1HNVA 1HQEA 2AU0A 3HXMA 1C0MA 3C6TA 2WOMB 3ZSXA 1C2PA 3E01B 1ZBHA 4CF9A 2OZMA 4QWDA 5KT4A 4OJRA 3L2RA 4BE0A 4QWAA 3NMAA 2RF2A 2WOMA 4CJEA 3P5JA 3TI0A 5JS1A 4IFYA 1KRPA 4MQ3A 1KVBA 4ED0A 5KG4A 3AO1A 1UWBA 2BQRA 4NLYA 3H40A 3ZSZA 5KG7A 1YVFA 2RDJA 4F3OA 3KTQA 1S49A 1S1XA 4M3WA 4B9UA 1C0TB 4RW6A 1MU2A 2AX0A 4DL6A 4N5SA 3HVWA 5KFPA 3PO4A 3T5KA 3N6MA 5DQGA 4FZYA 3G6XA 3DRRA 4TQRA 3M9MB 1T3NA 4C8NA 3HVAA 4FJ9A 3IAYA 5DLGA 2HWIA 1I3AA 1KLMA 2WTFA 1J5OA 3SPZA 5C42B 2IM0A 3PX0A 3OY9A 4IDKA 3NGIA 1LAVA 3AV9A 2G8VA 4HCBA 1JLCB 1BQMA 2YKMA 2VG5B 3B6PA 4DQQA 4LSLA 3IS9A 4Q5VA 1DTQB 3DLKA 2XRIA 3M8SA 3H98A 3OHAA 1FK9B 1RAJA 2DFFA 2XGQA 4ECZA 3AA5X 4J9PA 5L1LA 4DF8A 3UIQA 4CJ5A 4FLWA 1S97A 5KFFA 2VG7B 4URQU 2D0BA 3PR5B 3C94A 2D7SA 3HPGA 5HLFB 2ZD1B 2VA3A 5HROB 2IM1A 3EY1A 4EYIB 3OLAA 3PW4A 4B8CA 3K5OA 2YNHA 1IKXB 2PYLA 4N56A 2IJNA 3TARA 4DL3A 4W5TA 4E19A 1QAJA 5J2QA 1JKHA 1BQNB 1J9AA 4LD0A 1YTUA 4YR3A 1HQEB 3UPFA 2W8KA 1IKXA 3NH0A 3QIPA 3KK2A 3WNGA 3M8QA 1T8EA 1TL3B 4ZTFA 2XI3A 4ZVHA 4FJMA 1Q8IA 4QWBA 3DLEB 4W5RA 1TL1A 2RDIA 4FBTA 4EP5A 1KFDA 5EWFA 4KHWA 4NLVA 1VSKA 3ZT1A 1JLAA 4Y2CA 2YNIA 2A1SA 3TAMB 3SPYA 2F96A 1TKXB 5KFRA 1HJRA 5F8JA 4JS5A 1S10A 2IAJA 1TP7A 4DLEA 3CM6A 4EZ6A 1S6PA 1RBTA 3A2FA 2FVPA 3CFOA 4E3SA 1IG9A 3TAGA 1FKOA 3MECA 4B9SA 5FROA 3ZT0A 4Z4HA 1D5AA 1SV5A 3UDLA 2HHWA 4CGFA 4IFVB 1Z26A 3QEWA 4WFXA 4DQPA 2D5RA 2PY5A 3KHGA 1L3TA 1S6QA 1RT2B 4E7JA 4J2BA 4ECQA 4CGDA 3OYKA 3OYEA 2ZQBA 1VRTA 4HTUA 3QGGA 4EZ9A 3O3GA 1SL0A 1HYSB 3Q8RB 4W5OA 4PY5A 3VQ4A 4Y34A 4B9MA 4HUGA 4FJ5A 2AGOA 4JUZA 4OKKA 3KLFB 1RTJB 3DOLB 1IKWA 4OPJA 4FJGA 1BL3A 3BJYA 3V6HA 4CK2A 4DSKA 3GV7B 2B5JA 1RT4B 2IC3B 2W9BB 4NCGA 3FFIB 5T7BA 1JLEA 1WSEA 4CJVA 5K14B 3SFGA 3LP2A 3KD1E 4CHQA 4FXDA 3FRZA 1RDRA 4KKOB 5KFGA 2ITGA 4FS1A 1BIUA 1RTDA 4F4WA 2DFEA 2EX3A 1NKEA 1ZETA 1JIHA 1JLQB 4C8OA 3DOKA 1LWEA 4DFPA 3LP1B 3OJUA 4QOZB 3OS0A 5HRPA 4RNNA 4E1NA 4H4MA 1IKWB 4KSEB 3F9KA 2UUWA 3DOKB 2VG6A 4NLXA 4WE1A 1ZYQA 3QETA 2IAJB 4CJRA 2WHOA 3AVIA 4I2PA 2V4RA 4DWIA 4WZQA 4KFBA 3T5JA 2Y1IA 1R0AB 4DL4A 3TQ1A 3I8DA 3AVKA 3S3NA 5FRNA 5DGBA 1Z25A 3AA3A 1TKTA 3AVAA 4ED6A 1JXBA 1L3SA 1JLFA 5FRMA 4E7KA 1VRUA 2BRKA 1TK5A 3RR7A 1W25A 3BSCA 4FLYA 3KLGA 1TKTB 3BGRA 1S1TB 3HP9A 3SZ2A 5JS2A 4Q0BB 3LP1A 2GUIA 1UOCA 2FBVA 1S1XB 3V9WA 1N56A 3LZIA 3KOAA 2E6MA 2HB5A 3D45A 4CEBA 3PW7A 4BDPA 5SZTA 1TAUA 3PW0A 3IGVA 3RBEA 1X9WA 1RBRA 4YR0A 1RT3A 3H5XA 1XHZA 4ZPDA 3OL6A 3VQAA 3DRSB 1ZTTA 4IFYB 4E7IA 2XY6A 4KAZA 4MK9A 4ZHRB 5J2NA 1JLFB 3D28A 1HNVB 2P51A 4DFJA 1NJYA 4NCAA 4NLTA 4KHMA 5KFTA 1T94A 1DTQA 3MR3A 4GC6A 4F2RA 5KG3A 2OPPB 2QK9A 3SUQA 3IS9B 2JEFA 3KLEB 4FK4A 4TN2A 5KT7A 1WN7A 1S1UB 3MFHA 2FJWA 4ZP7A 4RW7A 2G8UA 4BACA 3KK1A 4CJPA 4ED2A 3NH2A 4HVJA 1K6YA 2AJQA 4O0JA 4TYBA 1C0TA 1D1UA 3OVNA 3OS2A 3AVNA 1RCHA 4GC7A 4JRPA 4J9RA 1UAXA 5C24A 2YNGB 4FZZA 1C1CA 1QTMA 5KFIA 4BE2A 5KI6A 4CJ4A 2VWJA 2AWZA 5KG0A 4I9LA 2ZKUA 3K57A 3V81B 4FLXA 3Q8QB 3QO9A 1U4BA 3I5AA 1N4LA 1S9GA 5F8NA 4MK7A 3EZUA 3LAKA 1LW0B 1C1BA 3DRPA 4Q44A 1JLAB 2JC0A 3NGZA 4QCLA 1RT6A 4FVMA 2C22A 3RMAA 4EP4A 4MK8A 1I39A 4LQ9A 3T5LA 4FZXC 1KFSA 1S1WA 1RT6B 5I42A 1N48A 3PUFA 4IOBA 3M8QB 5L9XA 4B3OB 2IGIA 4G1QA 3JYTA 1BISA 4IDKB 4N76A 2AGQA 1RDAA 3MTKA 2W7OA 4LH4A 4NYNA 5DQIA 1TVRB 1IM4A 3SQ1A 3BREA 1VSHA 4KREA 4KTWA 4IQXA 4CEFA 5SWMA 2YNHB 1SKWA 2P1JA 1S1VB 4MH8A 3NAIA 2RF2B 2HNZB 3V6KA 4IFVA 5F8MA 3PHEA 4AHUA 1D0EA 4DTSA 2OZSA 3ZT3A 4U7CA 4M3TA 3LAMA 3VQ9A 1GOAA 1VSMA 4FW1A 4DLGA 3AVBA 3KHRA 4RW6B 3TAEA 4TQSA 3OYGA 1EP4A 5I42B 1RT5B 4PUOA 4DSLA 3NAHA 1BQNA 3V9ZA 2HVIA 4NRUA 2ILZA 3GV5B 5KFYA 4GVMA 1S6QB 4R8UA 2P5GA 2WK4A 2W9BA 4DTRA 2HHUA 3NAEA 3RMCA 4HCCA 3CJ3A 4O3NA 3V6DB 3H59A 1SUQB 3AVMA 3UQSA 3D5MA 4EO8A 3OL8A 2JC1A 4K4UA 4BE1A 2BR0A 1IKVB 3PY8A 3PW2A 3ZSWA 4KKOA 3BSAA 4JRQA 1O1WA 4E89A 5KFVA 4ZVEA 1ZBUA 3RAQA 2UUTA 4ECSA 5HBMA 1HYVA 3ZCMA 2IC3A 3NBPA 3MEGB 4JV2A 1RBVA 4WE1B 3TAQA 4H4MB 5DLFA 4WYWA 3TAFA 1RTHA 2BQ3A 3NBPB 1HNIB 4QWEA 5EDWA 3VA3A 3NF9A 4QWCA 3KK2B 4NLSA 2G8KA 1ASUA 3H2LA 4KFBB 3KJVA 1IKYA 4O3SA 1IKVA 5CYQA 2J6TA 4YFUA 4FJXA 4DSFA 1RTIA 1LWCA 3LP3A 4XPEA 1WNSA 3V1RA 3G6YA 1VSIA 2Q3SA 4HHTA 4N41A 3AVHA 1CLQA 1S0MA 4JV0A 4F4XA 5KGXA 1NKBA 4DTXA 3CIZA 3AO5A 3G86A 3CDEA 1VSDA 1S1TA 4O55A 4DTUA 4OGCA 2YHAA 3BQ0A 4CJFA 4E0DA 3KMQA 4OKJA 3MEEB 3SUNA 1JLQA 3UR0A 3V1QA 4DU4A 4GMJB 4Q43A 4CIGA 2UVVA 3AVLA 3ISND 5C25B 3LP2B 1KHVA 1U45A 4FJKA 4PWDA 1HYZA 5J1EA 4ECYA 4QW8A 1WNEA 4M45A 3MXIA 4ELUA 2UVRA 2GIRA 3V6DA 2QV6A 1S4FA 3ITHA 1NKCA 2WRMA 1SKRA 3NCIA 1KVAA 2W9CB 4MFBB 5DK5A 2G8WA 1VSFA 3QLHB 1C6VA 1BI4B 4LSNA 4URSA 4B9LA 3ULDA 3HVRA 3QEXA 3KK3A 5KG1A 4OKEA 5KFSA 4FJLA 2BANA 3DRSA 2FVQA 3L2QA 4E7LA 5F8HA 1U47A 5CYMB 3M8PA 3LP0A 3SI8A 2C2DA 2AGPA 3RR8A 2OPQB 4DEZA 1TKDA 3FSIA 5DGAA 1NNDA 2WCXA 4KB0A 5HRSA 4ZP8A 4YP3A 3SNNA 3DI6B 3DLGA 4MIBA 3O4QA 4DS5A 4CIFA 2HVHA 3GIIA 1RYSA 1JLBB 5F9NA 4YNQA 3K58A 1ZBFA 3K59A 1BIZA 5HP1B 1KLMB 2FJXA 4DS4A 5C5JA 5J2PA 3CM5A 3KJVB 1NK5A 1XR5A 3I0SB 4FK0A 2YKMB 1WSIA 4FW2A 5KFUA 3PR4A 4J9OA 2QXFA 4R5PB 3Q8SB 4KO0B 4NLPA 2YV0X 2YNIB 2GBZA 2R8HA 3NL0A 4ID1A 1DLOB 4J9NA 3SJJA 3C6UA 2R2TA 3VQ8A 3THVA 4CJWA 4ECRA 4FLTA 4Z4IA 4CHNA 3KLVA 1S1WB 4JLHA 4IR9A 4DG1A 2VG6B 1YVUA 3G10A 4RW8A 1WSJA 5HROA 2IJFA 2AQ4A 4ED1A 1XWLA 3ZSVA 2HHXA 1HMVB 1SL2A 4FLVA 4RW7B 3AA2A 1TK8A 1TVRA 3F73A 4CJKA 1N5YB 1S0NA 4NLRA 3EPIA 1SH3A 4O4GA 3TWHA 3CJ2A 1JL1A 3I0SA 2FC0A 1WSFA 3H4DA 4TY8A 2A1RA 3DLRA 4JV1A 4J9SA 4Z4EA 4RW4A 4NLUA 1WAJA 5L1IA 4AHRA 4FM0A 4LSNB 1QE1B 3RRGA 1HARA 2BE2A 3DLKB 2D3ZA 3PW5A 2HMIA 3SV3A 2D41A 4WYLA 4R0EA 2IDOA 5CYMA 1SH2A 2DPJA 1EKEA 1JXEA 3HYFA 1FKPB 2XO7A 1XR7A 1T05B 1XR6A 2XCAA 4URGA 3TR8A 4H4OA 5C42A 2VG5A 4O3RA 4CEEA 2OPRB 3S9HA 4GW6A 5J2QB 5HP1A 1KVCA 1BCOA 3PO5A 2HNDB 4K4SA 5DG9A 1NOZA 1NJZA 3T1AA 3AO2A 4RW4B 3SCXA 3OYAA 3NGYA 3MFIA 2HNDA 1EETA 1S9EB 2BDPA 1Q9XA 4KHUA 5FDLA 4TYAA 2C2EA 2BQUA 3KHLA 3H5YA 2R2SA 2B6AA 1A5XA 2EC0A 1U49A 3MAQA 2OH2A 3LWLA 4ICLA 2VA2A 1S9EA 3MXMA 1B9FA 2FBXA 4CHOA 5CZ1A 3CYMA 2B6AB 3E51A 4OPKA 5KFDA 1D8YA 4NYZA 1N6QB 3OSPA 3I5CA 4DTMA 2F8TA 1RYRA 3VA0A 4ZPCA 1RTHB 4QW9A 5F8GA 1NJWA 3LPUA 3SV4A 3U6FA 3LANA 4ELTA 1RTIB 3O3HA 4O4GB 1JLCA 4DMNA 5DG8A 4CJSA 1BQMB 5CZ2A 4YR2A 3OHBA 4W5QA 1BCMA 2FVSA 3QNOA 2F8SA 1RBUA 4OL8A 4B08A 4RW9A 4K4TA 4I2QA 3DMJB 1U04A 1NHVA 3QIOA 4J2EA 1CXUA 4F3TA 1T03B 5KG2A 5KFZA 3KNAA 1ZBLA 4JS4A 1YT3A 3KIOA 2C2RA 4B9NA 2HNYB 2HHVA 3NE6A 1T03A 4CGHA 2HAIA 4ECWA 1HPZA 4KRFA 4NCGB 3L3UA 3PZPA 4DF4A 2R7YA 3HL8A 4PQUB 1HNIA 4CHYA 1TK0A 3ITHB 4CEDA 2G8FA 4DQIA 5KFCA 1REVA 3IRXB 4KHSA 2DY4A 2FBYA 3OJSA 4Z4CA 4DTOA 4ZMMA 4RZRA 5D3GA 1VSLA 1LWCB 1RTJA 3LP0B 4RG8A 3RB3A 1UA1A 2FLNA 4KV8A 2YKNA 3ZT4A 3V4IA 4CK1A 4NYFA 2BANB 3RMBA 3TANA 3T19A 4FCYA 3HVTA 4CESA 1TQLA 3CQ8A 5I3UB 4DTPA 2J6SA 3RB0A 1QUVA 4DU3A 4QAGA 1D9DA 5EWGA 1IH7A 2HNYA 2I5JB 4K4YA 4CIEA 4HUFA 4TSXA 3MEEA 3CJ5A 4NLOA 3V9XA 3CDUA 4F4ZA 2KFNA 3H08A 2IBKA 1JX4A 4E1MA 3RBDA 4CFAA 2E6LA 2HHSA 5KT2A 4ID5B 2OPQA 1KSPA 1S5JA 1QSSA 1QSLA 5T14A 3AVGA 3OL7A 1CSJA 2KZMA 4O44B 4EBEA 3CWJA 3RMDA 2ETJA 3V4IB 5DG7A 3PV8A 4FLZA 3GV8B 4K4XA 4AHSA 3QEVA 3OYFA 1X9MA 4RU9A 5J2PB 3OYJA 4G3IA 2JLEA 2XHBA 2G8HA 3KLHB 2P5OA 4RW8B 2E9TA 1VRUB 5KFNA 4HKQA 1RNHA 4FYDA 2RKIB 5J2MA 4J9QA 2Z1JA 3QYYA 3TAPA 1DTTA 2HNZA 3QGIA 2BGGA 4I2PB 4CEZA 3MR5A 1I6JA 3V9SA 3LDSA 1XI1A 1NK7A 1Y97A 2ILYA 2C28A 3ZSOA 4EBCA 4F50A 3BQ2A 1XHXA 3SUOA 4K8ZA 4U6PA 3GIKA 3T5HA 4DU1A 3IRXA 2JEGA 3QEPA 3U3YA 1C1BB 3DRPB 2XCPA 1NK6A 4W5NA 4K4WA 4CERA 4LQ3A 3AVJA 4K50A 1TV6A 3GILA 3VQ7A 4J2AA 3MR6A 1VSJA 4IBNA 3RB6A 3HPOA 1FXXA 4B9VA 1BHLA 1Z4UA 3PJXA 1MU2B 2KZZA 3P1GA 3OYMA 2ATQA 4WXOA 2IMWP 3FQKA 3JSMA 4M42A 4DQRA 3ZSYA 1JLGA 4FM1A 2W9CA 2NUBA 2YNGA 3QNNA 4ECUA 2HWHA 5KT3A 5HLFA 3KLGB 1QQCA 3LALA 2O4IA 4IG0B 2JEIA 3KKSA 3VQDA 4NLWA 1ASVA 2IM2A 4DQSA 4FJNA 4I7FA 3ZT2A 2DFHA 3FQLA 3M8PB 1RT7B 3VN5A 4IKAA 1C0UA 1RA6A 4DFKA 4HUEA 2GIQA 4FK2A 3QIPB 1X1PA 2W7PA 4XO0A 3G0ZA 3HO1A 1C1CB 3KLEA 3KLIB 2JGUA 4KE5A 4Q8EA 1TKZB 4O5BA 4FLUA 1JLBA 3OYCA 5KTQA 1CZ9A 3HJFA 4CFDA 3NF8A 1U48A 1S9GB 5JUMA 1GOBA 4CGGA 3K5MA 3K5NA 3EYZA 2ASJA 4ICLB 4KHYA 1QSYA 3L3VA 1LWFB 2J6UA 2OPRA 1LW0A 4RNHA 4Q45A 2B4JA 4M3XA 5KG6A 1HQUA 1HRHA 1MMLA 1QHTA 1DLOA 3B6OA 4J9KA 3P83D 3BSNA 1K1SA 3IG1A 1W0HA 1RILA 1LWFA 3WNEA 1RT7A 3PX4A 1L3VA 3KMSA 1FKPA 3QERA 2V0NA 3TAMA 4BDYA 2PZSA 3M8RA 4OLAA 4PA1A 4J2DA 3SYZA 3MEGA 4E7HA 1TV6B 4Y3CA 2XI2A 2W42A 3N6LA 4ECTA 1S1VA 3OYBA 3U3GA 3AA4A 3FFIA 3CO9A 5J1EB 1RBSA 1J5OB 2I1RA 4LY7A 1L5UA 1RDBA 4KHNA 3FDSA 3GYNA 1HPZB 1RDCA 3TABA 5L1JA 4M3RA 2Z1IA 4B3OA 2V4QA 4XPCA 3OLBA 3V81A 4CJTA 3QLHA 4Z0UA 4AHCA 4K4VA 4ZPBA 1WSHA 1OS5A 4CJQA 4IG0A 4NLQA 1LW2B 4KB1A 1W9HA 3S3MA 4CCHA 4R8UB 4IG3B 4FJ7A 1VSEA 2YNFB 1S6PB 4KHRA 3MF5A 2X6NA 4IR1A
chains in the Genus database with same CATH superfamily
2QX0A 2JEJA 3T3FA 3GG0A 4L3QA 4H54A 3ELHA 1SV5B 3TZWA 4LF8F 3VQ6A 5AQJA 3GU0A 2NZTA 1UEKA 2IVNA 4ED7A 1BY9A 4DBQA 1RT5A 2FJAB 3HDSA 1FRIA 2PMWA 3TR5A 2GELA 1X5TA 4ZJOA 1LV5A 3JQJA 3BSOA 2PSZA 2PN6A 1JLEB 1HL6A 5H9FJ 3NOGA 1XC9A 3W65A 2O8BA 1QS4A 2K1RB 4MIAA 1FJCA 4ISEA 4OZ2A 2MKHA 1R0AA 2VD3A 4CEOA 4G1IA 1CZAN 3G4SN 2Z8QA 4M95A 5G0RB 1X5PA 3OS1A 3LOUA 4K4ZA 3AVCA 3FVYA 1WC1A 4B9TA 1JKHB 4DR4J 1Z6RA 3BKFA 1TL5A 3KG1A 3OSNA 4EEYA 4O8KA 1SUQA 1QQNA 4EO6A 2OANA 3CG7A 4X65J 2F8EX 2VDHA 4DSIA 4OYMA 3GIMA 4YOWA 2OPPA 1U1LA 5KT5A 4DU8A 1OQ3A 4M3UA 2D1KA 1RT3B 4LF7K 2QWRA 1N32K 2FUG9 3TUZC 4DUYF 2VQFK 4OI3A 3CB4A 3KLHA 3UE2A 4JI1F 1S48A 4DR7J 3MHYA 1MWQA 1DGKN 1NGAA 3N6NA 2VFUA 4BHQA 2EW9A 2OUGA 4KPCA 1VFJA 1Y7PA 2UVWA 3TZYA 2R8KA 4AUKA 3DYAB 5JICA 2HBMA 3FZBA 4C8LA 1PYTA 3HHLC 4ISGA 1R8BA 3KG0A 4BR9A 2EWHA 1Q86O 3U4LA 3EVWA 2W8LA 4ZPTR 2KTQA 2R2RA 3R2DJ 5KRSA 2YQ3A 4CEAA 4Z94A 4NX9A 4DV5F 1DQ8A 2WB4A 3T41A 3VR1A 1VBXA 3VQCA 1VQ6N 2DO4A 3ZTSA 4FJJA 1HR0J 2GX8A 1FNMA 2YPYA 1P1TA 4NA3A 3QESA 1N33K 4H4OB 2M3DA 2YXLA 1N8RT 1RE1B 4BR2A 4Y00A 1HHQA 3VQEA 2HFVA 2DGWA 4ZPAA 3M8YA 4K0KK 1HKAA 3W5ZA 3QBXA 4AH9A 4FJHA 5LSOA 3CMAS 3CTRA 5GIOA 1N0VC 5KFEA 3R5GA 4GO5X 4C0BA 2D0AA 2FLLA 4OZ1A 5F3ZA 4R5PA 1B7YB 5BR8J 4I7FB 4OX7A 2XM3A 4DR6J 4KHQA 3FZ2A 4BWJA 1EXQA 1SKSA 4I9QA 4XAKA 2CDQA 1ATNA 2KHOA 2IA6A 3H5UA 4USVA 1WLJA 1VHIA 3CCLS 5BRHA 1TUVA 5J2NB 5KQ8A 1S6UA 3HHDA 5FLXY 2YJEA 3TA0A 2R8JA 1FFWB 1FK9A 1M0SA 4V19X 3PIOQ 3DAWA 3OA9A 3VQBA 3MMVA 5AQTA 3R5AA 4LBIA 3BGLA 1DHMA 3VQQA 2MQQA 3L2VA 4WFYA 2MHEA 3NF7A 2KQ2A 1T9XA 2X1AA 4CLPA 1EETB 4YUDA 3PYFA 4CHZA 1GLAG 3D0GE 4CJUA 4B1VA 2XSJB 3ASMA 4GKJJ 3Q83A 3G8TA 3CCQN 2GC8A 2I38A 1TL3A 3D68A 3SCLE 2IVMA 3AAWB 2LXUA 3NGDA 3SI6A 5EUHA 1N5VA 4CE9A 4OMFG 4M63A 3OT9A 4WXWA 2MZJA 4BRMA 3O2IA 1RACB 5FDLB 3VCDA 3BR8A 4M5GA 3QICA 4CF2A 2X6SA 4Z4GA 1DFDA 1Y00A 2DHHA 4PG4A 3C46A 3NS7B 1PGZA 1Y4ZB 1ZBTA 3TVZA 4RR5A 4KH0B 3CVKA 1A9NB 4NYPA 2J7KA 2XHCA 4BR0A 3SBGA 3L4IA 2P6TA 1UVLA 4PWDB 2DPIA 2RAQA 2VJUA 2B5JB 3M8WA 1FFGB 1F9HA 3GCWP 4DL7A 1DBDA 1VK0A 2ALZA 3AXKA 4CGJA 5F1XA 5KFMA 3NNAA 2G13A 2E1YA 3HULA 2HHHJ 1LW2A 4WYBA 1XMBA 2CQ4A 3TVKA 2ATLA 2HRYA 5JVHL 4BRIA 1HD1A 1YJ9N 2AEFA 2SXLA 4AM6A 1HBOA 3DCAA 3TYTA 1UEUA 1EX4A 2UXDF 4Y2IA 3DDNA 5D3GB 3NKYA 2UV8A 2G8IA 4WFZA 2XZTB 4I2QB 3P4UB 3BEXA 3G6EN 3NGTA 3LPEA 4WBFA 1GMUA 4PQUA 4CI6A 1J5EF 2X78A 1UVIA 4ECVA 3M9OB 1TR0A 2EPIA 3CJ4A 2E1ZA 4CFCA 1FDDA 3CGIA 1BGXT 5K14A 2DGSA 1UETA 3VEVA 4JV5F 4KTQA 4ZVSB 4FS2A 3R9LA 4GO7X 1QZ5A 2XY5A 4Q0BA 4MFBA 2N3LA 4I6MA 1NO8A 2F4FA 4V19J 1A5VA 5KFAA 3ZZPA 5KFQA 3FC9A 3PSIA 1M5HA 1FXRA 2IPOB 3JTNA 1E3MA 3WX4A 4UQGA 3LH2S 3DLGB 3QIDA 4ZVPB 4J9LA 1HBUB 1B92A 1UP1A 1H98A 2R8IA 3MMBA 1ZPVA 3H5SA 1SQKA 3CCRS 4ID5A 1PAEX 1NB2A 4XDDA 5DMRA 1LOUA 4IH6A 2LECA 4C1NI 4DSJA 2X1FA 2V8GA 3IC1A 4DL5A 4WFAQ 1VQPS 4FJ8A 4W4MA 1KLNA 2UUCF 2W2MP 4AF1A 4DCJB 2PIIA 5D4LA 4DJBA 3VAIA 4OZLA 2YHBA 1GOCA 4C9DA 3I4HX 4K8XA 1MMDA 3LZJA 2X7IA 4Y1CA 1HNVA 2QT7A 1TYQA 4WQ4A 1C0MA 3MCSA 5F3TA 2FJEB 5C7PA 2CQHA 5M1KA 2HS4A 2CQ3A 1XMOK 1D9AA 5KT4A 5HAOA 3L2RA 3TI0A 2MKJA 2GA7A 3P5JA 3L7OA 4Y6IA 1UWBA 2BQRA 1DKGD 5ELZA 1URRA 4DV4J 1RBLA 4KGKA 1S49A 5HO4A 1R8CA 4X84A 4M3WA 1RAAB 2VF3A 1C0TB 4FP9A 2G2OA 3GWCA 4JI7J 3NNHA 3OTBA 1VMBA 2OMLA 4CLLA 3CXCM 4YDDB 4FZYA 1QQMA 5DLGA 1H73A 2G1DA 5K20B 2IM0A 2NQPA 3DXKB 3QJPA 1UW4A 2DNHA 4DXLA 4ERDA 2Q31A 4B3SK 3TOQA 1EKRA 1NGEA 4OYZA 3ENOA 2VG5B 3B6PA 1I94J 3WZ0A 3MMCA 4Q5VA 2VZ9A 1DTQB 5LXYA 2XRIA 3M8SA 1FK9B 1RAJA 2MY8A 3AA5X 3QSYB 3CJSA 4J9PA 1VS3A 4NA1A 4AXIA 3K0SA 4CJ5A 1S97A 4FO0A 4URQU 3M6XA 2D0BA 2HF4A 2W4PA 2D7SA 3AHPA 4RBTA 1HNXJ 2ZD1B 3FBBA 1T9VA 1YJNN 1WACA 3EY1A 1X60A 1HNXK 2UP1A 4RPFA 3K5OA 2YNHA 2PYLA 3TARA 4P2MA 2XMUA 1TUWA 5CD4H 1HQEB 3ILOA 1WEYA 1IWGA 2ZNZA 2Q79A 4C6AA 5ETPA 5HOOA 2O8FB 1NMEB 3VF0B 3UCUP 1SPBP 4XTTA 3ZTRA 2XG8A 2W2NP 4FJMA 1CJVB 2HBYB 3HX9A 1TL1A 3I96A 1X4GA 3ENQA 5EWFA 4KHWA 2QI2A 3W8GA 1JLAA 4CNZA 2YNIA 3OD2A 3S01A 3TAMB 1X5OA 3TNVA 4ES3A 1G99A 1C4AA 4MTPA 3AJ1A 1EWQA 4ZLJA 1TP7A 1IR2A 4LR7A 4MYUA 4DR7K 1BMQB 5M1NA 3CM6A 4OYBA 3C7NB 2NUUG 3CW2C 1IG9A 3W2WB 3MECA 4Y0FA 5AJ3J 1OVQA 2JLFA 5FROA 2A5XA 3SBMA 1UVMA 3UDLA 4HI1A 4CGFA 4IFVB 3O9QA 3ENVA 4DQPA 3KHYA 4XDCA 2R7RA 3F56A 1YXQA 3MK6A 1RT2B 5A8RA 4E7JA 4J2BA 3CCRN 3ZO7A 1ZAWA 5A0YB 4EZ9A 3Q8RB 3E9LA 2P9IB 4ZIVA 5D78A 4ZCIA 3I4PA 5JMVA 4FJ5A 2F40A 1W7WA 4JUZA 4OKKA 5FPNA 1U1OA 1RTJB 1NXIA 4DR4K 3C19A 5IT4A 3SSSA 3KYLA 3MM5A 3BJYA 3V6HA 1RT4B 3JB9k 2GWKA 2IC3B 2W9BB 1OMSA 1ZM9A 2A6OA 2OTLN 1JLEA 5IV3A 3GSIA 1U1NA 2DISA 2W4DA 3WIUA 3KD1E 1I51B 4M5LA 3QDKA 1VDHA 4OYOA 2PFDA 2E5LK 2VH7A 4F4WA 2DFEA 2EX3A 4OYWA 1HLWA 2QMXA 3S6EA 4F0KA 2LFVA 3LP1B 1KKHA 3OJUA 4QOZB 3OS0A 5HRPA 5MAOA 6FDRA 1BG3A 1AT1B 4H4MA 2DNZA 4KSEB 3F9KA 1BA0A 2NS1B 3CQYA 4NLXA 2YQ0A 2B56A 4DWIA 2POKA 4WZQA 1WI8A 3T5JA 4FPBA 4OX9F 3I8DA 3AVKA 1Q16B 1IWAA 3AA3A 2I0XA 2LA4A 2BACA 3AGKA 2XZDB 3CT9A 2O66A 1U25A 2ZOFA 3RR7A 3BSCA 4FLYA 3KLGA 2XO6A 3JAMU 3BGRA 2P8IA 1Q95G 3LP1A 2ACMA 1NLKL 3H8YA 1WBBA 3NOCA 3V9WA 2MB0B 3PFOA 3DGPA 1NDKA 4PPZA 4YEAA 3MOZA 5SZTA 4H03B 5JVGL 2C2MB 3RBEA 1JJ4A 4QPTA 1RBRA 4A8SA 1QHAA 3PIPL 1XHZA 2VBWA 4A8WA 3MUTP 1QDUB 4IFYB 3M7VA 3OVBA 4Y0WA 2BJ7A 1B64A 2XY6A 3H0PA 5GAHU 2H54B 3NWGA 2DHAA 1JNZB 3D28A 1XNQJ 2P9UB 3CJBA 3AY0A 2P51A 3CJ1A 1ELOA 2NPFA 4F2RA 5LMUK 3C65A 3CF5L 3FBCA 3BN7A 3SUQA 2DXDA 4FK4A 1NRKA 1V9OA 4JI4F 5KT7A 1S1UB 1IBKF 5LSLA 2LLZA 4RW7A 4DPOA 4CJPA 1CJUA 2QL7B 4ED2A 2CZ9A 2AJQA 1VAZA 3O08A 2DNGA 4TYBA 2P6SA 5A76A 2MQPA 1W2BR 4JB8B 4JRPA 1HNWJ 1UAXA 5C24A 2RVJA 1NB7A 4BE2A 4CJ4A 2VWJA 1J5EK 2AWZA 4I9LA 4J37A 2Q1NA 3D2FA 5BPLA 1SIWB 4FLXA 2J9DE 4OJHA 3ZX2A 1S9GA 2J7UA 3LM9A 1HWIA 2HYIB 1LW0B 3DRPA 2Q36A 1RT6A 4FVMA 2P9LB 4EP4A 4MK8A 1KQFB 5AT1B 3T1YK 5HVHA 1M5VC 2C3UA 2MKKA 4J9UE 1S1WA 1RT6B 4C97A 2ADBA 4DHYA 5B0CA 3PUFA 2AJ1A 3M8QB 2DNMA 3ZETA 4TU8A 3CCTA 3H25A 4G1QA 2LA6A 1WC3A 1BISA 2WVFA 4ILRA 2IVPA 4AL6A 1TVRB 1IM4A 4U67Q 3D2EA 5CYJA 2CPJA 1VSHA 2YNHB 4AQYJ 2P1JA 1RHJB 5AE2A 2B4OA 3V6KA 3OFEA 4AHUA 1D0EA 4I67A 3ZT3A 4U7CA 5A2QY 3VQ9A 1VSMA 4JI1J 3NCPA 4LR8A 1O6XA 4FVCA 4U96A 1H72C 1EP4A 3UCZP 3ZXWA 4H5RA 5BRFA 2EFPA 2V7ZA 1MW7A 2UXCF 5IS2A 3GV5B 5KFYA 1UVJA 1S6QB 5IQ6A 2CGKA 2O8EA 4DTRA 2HHUA 1F2GA 2FTRA 4HCCA 2LCWA 1J6ZA 3AVMA 2BKNA 4PAAA 1IBMK 2BR0A 2Q66A 3PY8A 1Q53A 3PW2A 3OR2A 3C14B 2PEBA 1U2VB 2A3JA 3W5XA 5E2QA 4RU2A 4JK7A 1VHFA 4ECSA 1AUDA 3W61A 4OI0A 4M63C 1K9MO 4FWRA 2PE8A 2FHMA 4JV2A 3C15B 4MKYA 1LOTB 2XS5A 4H4MB 1ZC6A 4WYWA 1VLYA 3A5NC 2BQ3A 4NO7A 4BRDA 1PG5B 5EDWA 2DT9A 1PYSB 3NF9A 1RWKB 3KK2B 2ZJPL 4NLSA 1RU1A 1ASUA 3JXUA 3CCVN 1BE4A 1IKYA 3WUHA 4JBCA 5CYQA 2HFZA 5GMDA 1YX2A 1D4XA 1RTIA 2DKOB 2FJBB 4DR1K 3V1RA 4N41A 3IR6B 3AVHA 5K8PA 3OXGA 4JV0A 4F4XA 3W3DA 4DTXA 3M32B 3G86A 4O55A 1S1TA 2ZJRL 1MNEA 2YHAA 4E0DA 3SUNA 3UR0A 3V1QA 2UVVA 3ISND 3NRBA 2GCFA 1RWUA 3CCJS 2AHOB 4FOEA 4EGLA 1HYZA 2MEWA 4ELUA 4PXCA 1RAFB 2PC6A 2DTJA 3NXZA 3CHWA 3SCKE 2C2ZB 4CP5A 4O0NA 2Y8YA 3N9UC 1F5CA 4MFBB 2ABYA 2IYIA 3QLHB 3BH6B 4B9LA 3ULDA 4OKEA 4WQ5A 3J81O 2FVQA 1HLUA 3ENHA 1E6VA 4E7LA 5CYMB 3RR8A 2OPQB 2YTCA 4LF7J 3HOSA 1MG7A 2Z2YB 4DEZA 3H20A 5T7LA 2JVRA 1HW9A 3BYRA 3ILIA 5LXRA 5KQDA 3PCOB 3O4QA 3AOCA 4WFBL 3GIIA 1CULA 2K8GA 1FNOA 4J90A 3ZNUA 4ISFA 3KFWX 2E66A 3A5LC 2X51A 2I7NA 2R7TA 4KO0B 1D09B 2YQ1A 2YV0X 3BN4A 3NL0A 2E5GA 4Y65A 1IJEB 3CCMN 3VQ8A 3THVA 3VERA 2VBYA 4CHNA 4IR9A 2EK1A 4YS2A 2XSJA 1OIAA 2EI5A 1HD0A 4R25A 2NRWA 1NGGA 5KPRA 2LYVA 1H6KX 1XN9A 1DURA 1RAEB 3HT0A 4G6VB 3TWHA 3P6YC 5EX3A 3M30A 4ETZA 4KGXB 2ZDOA 2FC0A 1WSFA 2DEIA 4JV1A 4FWPA 2V63A 3KZBA 1FD2A 1T9WA 4FWKA 1FX4A 5L1IA 4OHZA 2P9SB 4DN9A 4CIOA 2E2OA 1FWPA 1BU6O 2D3ZA 3NGUA 4M5MA 3MPDA 2KT5A 2D41A 2DNOA 4R0EA 5CYMA 1EKEA 4IOAL 1XR7A 4URGA 1TFWA 2VOOA 2VFVA 4WU2A 2VG5A 4CEEA 3S9HA 1Q8KA 3Q8YA 3PO5A 5B0GA 1U6BA 2GGPA 2V2QA 3PFEA 1NDCA 1FJ7A 2E1CA 3MFIA 2CZ4A 1EETA 4CJ7A 4KHUA 2C2EA 3AOAA 2R2SA 2B6AA 4K42A 2EC0A 3MAQA 2OH2A 4QYZJ 2AJ4A 1YRXA 1WORA 1M5OC 1B9FA 4CM0A 2ACYA 4EIAA 2K3KA 2VPWB 4OX9K 5K9FA 1AROP 2ZM6F 1N6QB 2BYCA 2VUGA 1KBRA 1B0VA 3VA0A 3A13A 1FW6A 3IAM9 1YZ6A 2FY8A 1FHTA 3LPUA 4PWUA 2V2ZA 3SV4A 3U6FA 4ELTA 1GMVA 2XTJP 2HZAA 3EEQA 1S7IA 1JLCA 1F3FA 4NXMF 4C3KA 4W5QA 3QNOA 5ETNA 2LU2A 2F8MA 2L9NA 4B08A 2P9SA 4K4TA 3C14A 1WHVA 3DMJB 4IOAQ 3NCRA 3CPWR 3QIOA 2J4RA 1NWKA 1QVGR 3MM9B 2CA9A 1RXOB 3GZ7A 5KFZA 1GQEA 1T0TV 4JS4A 1V3SA 1N54B 4B9NA 4KC5A 2HNYB 2HHVA 5DS7A 3G6ES 2J0SD 2GHPA 1WWHA 1S12A 2QIFA 3WEEA 3MOJB 1F9EB 1XTZA 4CRJA 3KKFA 4PCQA 2GQQA 1QJHA 2G8FA 1VC5A 5FD1A 7AT1B 3OJSA 1CPZA 1T6CA 3M6GA 3F0NA 1T11A 4RZRA 2UUAF 4BC2A 2OKQA 1LWCB 3CERA 3LP0B 2FYXA 3RB3A 5GAEU 1UPMB 2FLNA 2O1PA 3ZT4A 4D3HA 3TANA 3T19A 4WTYA 1TQLA 4B3TF 2F9TA 2JH3A 1VR6A 1NDPA 4B1ZA 2C3PA 1VQ4N 3IP0A 4TSXA 4DQ8A 1IUJA 1Q4RA 2LU1A 2N7YA 3V9XA 4I4BA 3CDUA 3M2RA 4F4ZA 2KFNA 3H6EA 5JMNA 4ZCKA 1JX4A 2J8AA 2HHSA 4ID5B 1VI7A 3T1YF 2BJ9A 2G4BA 4USJC 2QFIA 3UB5A 5TKYA 4DR5K 4DKWA 1YK9A 4WF9L 1S4EA 2DH7A 2UXDJ 3CWJA 4C48A 4U7UD 2K1RA 1FNXH 2LKZA 3PKYA 3O9RA 4K4XA 3QEVA 3OYFA 2RQ4A 3W63A 2QWQA 1JQGA 4GV3A 5J2PB 2R9LA 1ZXOA 1S77D 5LMUF 4OLOA 1UWAA 4DV0K 5KFNA 2FDNA 3QYYA 1G6BA 2MHNA 1MDUB 4YN3B 5TKWA 1F1BB 4TNOA 4CTAA 3MR5A 1I6JA 3LDSA 2ATCB 4IDHA 5GMKa 4IO8A 2ILYA 2XMWA 1KOHA 3MMAA 4F50A 2APOA 3OTCA 1YF5L 3GIKA 2Z2MA 4P75A 3T5HA 3FEYB 1YJVA 5ADXH 3U3YA 2DNQA 2XCPA 2DH8A 1NDLA 1HNZF 1NJIT 3AVJA 2E1AA 2ROEA 3GL1A 1TV6A 4O5FA 2DYAA 4ZPVR 4DCPB 1VSJA 4M5HA 4IBNA 1YRTA 1Z4UA 1GXTA 2IVYA 2FZKB 1H2VZ 1BO5O 2FGCA 4WXOA 1UW9A 1VQ6S 3FQKA 1JCFA 3JSMA 4M42A 4QZVB 3CCLN 1NGHA 1B0TA 1ZS6A 4CTAB 1GLDG 1XMOJ 2W9CA 3ID8A 4WQ4C 1U8WA 5EN1A 3HFVA 1B99A 2E7WA 1RFQA 2GEMA 2VJVA 5H9FK 3ZT2A 4LFAK 2A2DA 4UY85 2F9DA 1RT7B 4CZIA 3VN5A 4B3MK 1OH8A 4P2SA 2GIQA 2W7PA 3G0ZA 4K2XA 4ILLA 3DC2A 5BYSA 1S79A 2O8FA 3IBCB 2H3GX 4Q8EA 4FPIA 5D0HA 3KXDA 3CJCA 5E26A 2ZBRA 2OFHX 4DPTA 4Q7AA 4A8YA 3NF8A 5JUMA 4CT8A 1FRLA 3K5NA 3M6WA 2VQFF 3UN2A 4K5RA 3MCMA 2JNJA 3PSFA 4RWXA 3L3VA 2J6UA 1Y5NB 3RU0A 4Q45A 2B4JA 4M3XA 2BZ2A 5M2UA 1HQUA 1MMLA 3UWTA 2DGUA 3B6OA 4J9KA 1W0HA 1RILA 3PX4A 3WNEA 3KMSA 3I31A 1FKPA 4OZ3A 1FRHA 1N5QA 4J5OA 3M8RA 1HNWF 4PA1A 3SYZA 3GYXB 4E7HA 1TV6B 4CO0A 1BWVA 5RUBA 1QVFR 4L72B 4DN0A 1K44A 4LY7A 1L5UA 2BH1A 3K8WA 3O9TA 1RDBA 5HQ8A 4BRCA 3MM7A 1X0FA 5HMZA 2ZVIA 1G2EA 2W7AA 1JWWA 5A8RB 1B70B 3MAAB 5THWA 5L46A 1SB6A 1PAUB 2J9EA 2VL1A 2NR0A 2BUNA 4IG0A 1F6TA 1WC5A 2IJRA 2O8CB 2BE7D 2CJAA 5FPMA 2B9EA 2MJNA 1GMWA 3P38A 3N0VA 3KJNB 4FPAA 3CD6N 5C25B 3MN9A 3KLFA 2LVWA 1PBAA 5BREA 5JVHQ 4GV9A 3VTHA 2L3MA 2R7WA 1G15A 3CPEA 3KD5E 1XK8A 2EG1A 2RPIA 3BZKA 3W9IA 3JTPA 1KWMA 2DGVA 3OR2B 5IWAJ 3VETA 5AJ3K 4CVNE 5L1KA 4ZDNA 3WXJA 3A8YA 3QINA 1RAHB 5HN0A 3IWXA 4J9MA 1IBMF 1UZDA 4PKDB 2NYIA 1FXDA 5IZHA 4WCEL 2AMCB 4F2SA 1SQEA 2ZZMA 1RU2A 1RSCA 1IQZA 2MKCA 3AGRA 1VBKA 4DX8H 4NMXA 4DR3K 2EFVA 5C25A 3H46O 2EFQA 2E2PA 4BVOA 3B54A 5KT6A 2RN2A 1RAGB 3D3CJ 3MWBA 4CK3A 2X74A 2RDDA 4NLGA 3NH1A 2XY8A 4TY9A 2XZWA 3ZTPA 1DZ5A 1OPIA 3DLHA 5K8MA 2BBEA 4C8ZA 2E88A 3QGPA 4YOXA 5H1SV 2VICA 1RT2A 2WBRA 1HQ2A 1PC5A 1X31C 4ZCLA 1HBUA 3UDVA 2CJQA 4CECA 3R6GB 4UW2A 4ECXA 1S0OA 2WW4A 3BR9A 4CJLA 4DUYK 4ZTJA 3R1HA 5D15A 2ZJRQ 1WHYA 2ZC4A 2IM3A 3QGHA 4BDZA 4ZN3A 2AJ0A 5I3UA 1RWNB 3DOLA 2Y1JA 2O5DA 3GMGA 4CM2A 3D0HE 3OBWA 3TTDA 3G82B 4WFAL 3CJ0A 3HOTA 1X4FA 4AHVA 1DAXA 3CD5A 2YX4A 4BLGA 2I6WA 1ZM2A 3O4WA 1JJHA 2WC9A 4ZHRA 1RCOB 3RRHA 4O3OA 2V9WA 1RA7A 1U1MA 2FBTA 3K9KA 4PL8A 1JK9B 3NF6A 3L8BA 4YY3F 2MQNA 4HYKA 2KYXA 3ENBA 3C6UB 1RT1B 4I6MB 1SVDA 2HK2A 1HKBA 2FSKA 1RISA 2ZEJA 3CC2S 2FXUA 2MZ1A 1TKZA 4RNOA 3SQ2A 3ZSRA 3VGLA 2OTJN 1RT1A 3MR2A 3BDPA 1NNEA 2NXCA 4BGAA 1WD6A 3I5BA 1SJ4P 4CF1A 3T1HK 3S7RA 1C1AA 3AO4A 3SQ4A 4ZPWR 2ZDPA 3DI6A 3LPTA 1NK0A 1KCFA 4JI4K 3SEOA 3UKRA 3I8BA 2MSSA 5M1QA 1RKJA 4HDHA 4B3RF 4GKJF 5D4OA 2HHHK 1WEZA 5F2RA 2GAGC 3THYA 1P6TA 3ALYA 5K8OA 1BC6A 1VQSA 3DRRB 4RBVA 4G1QB 4C1NK 1HQUB 1BLUA 1LAWA 4C8MA 3GOIA 1GTHA 3OW2M 4AYBD 1HI1A 5DQHA 2OP5A 5IFMA 5JLHA 2HMIB 4QQBA 2AEJA 3PVXA 1VQ5N 3WQTA 3W8PA 2ZD1A 3E01A 9RUBA 2BXJA 3OYNA 3NGSA 4EWTA 1YUWA 3FEZA 4NLDA 2HOEA 3AB2B 1WB9A 3KLIA 2HHTA 4TY8B 4FM2A 2OA8A 1J54A 1TUUA 3KWMA 1HUXA 3R8EA 3CPWM 2ZM6K 3ID6A 2VIHA 1T05A 4ANDA 3M2VA 4QIVA 5C2DA 4ZVGA 2E9RX 4I0WA 3TX8A 2DK2A 5BPMA 5M1FA 3PJWA 3FNNA 3MEDB 4KBIA 3J7AP 5GVQA 1IBLK 2R7VA 3P45B 4BC9A 4CLYA 4CYUA 4YQWA 2RQCA 1U09A 3ZX3A 2I5JA 5KOXA 4OGEA 4NYOA 2F9WA 5AQRA 5IQQA 2DIUA 2CPXA 5IT9Y 2PA8D 4JV5K 2N82B 3BQ1A 4DSEA 1SIZA 1NH8A 1IN0A 3OQ2A 5DM6L 4AHTA 3CJ9A 4JI6F 5CYQB 2Y0BB 3IFRA 2KW4A 1L3UA 5KFWA 5D0RA 1GEHA 2M7SA 4HEA9 4IG3A 1VYAA 3AFGA 3GSDA 3HK2A 3W2VB 4PG7A 3CCEN 3P3DA 1VIXA 4JI0K 3O5TB 1Y3KA 1NZ8A 1HWLA 4MLEA 2IFXA 3RBZA 3HP6A 3TPQA 3K8VA 4LFBJ 1CEZA 3FCWA 3KK1B 4F4AA 2E5JA 5A8KA 2G2YA 2R7OA 4IUFA 2FIUA 2EKYA 2GJ2A 3D0PA 1B0PA 4PQAA 2XWYA 1NHUA 2LXIA 1KOOA 1UPPA 3L2UA 1HBNB 1AUSL 3TJAA 1OY8A 1P27B 3RBXA 3NFAA 3WNFA 3M6UA 3PJ9A 1TL7A 3DM2B 2OPSA 2MQ8A 2ZBQA 2UXCK 3OYHA 2ZE2B 5AQPA 2ZGYA 4DR1F 2HGNA 2EG2A 2ZUGA 3CIPA 2KHDA 1VK3A 2RU3A 2AT1B 4ED8A 3WXMB 4CNYA 4L8RB 4NCBA 1EP4B 5A0YA 4U95A 3RAXA 3UDEA 1FDNA 1RAIB 3V9UA 2WSCC 2QA4G 1TMJA 4CYUB 1HBMA 3JAMO 3AT1B 3DYAA 2V8HA 3THPA 2KFYA 2H5EA 3NHGA 2FVCA 1X4AA 2IS3A 5HVFA 3MXHP 4DR5J 2Z0GA 2UU9K 4OV1A 3MURP 1AZSB 1WSGA 4HT7A 2F3JA 3CDWA 2CWXA 1UVKA 2ERRA 4CO2A 2K2PA 3QZ7A 5GADU 2CQPA 3A12A 2E9ZA 1WBDA 1YAGA 4CHPA 3PYEA 3CJKB 4BR5A 2Z1GA 4PL7A 3O80A 5AQMA 3LF0A 4B3TK 2HURA 5DETA 1RWOB 2AX1A 1O0PA 3ZTQA 3ZEUB 5KFLA 2OSQA 2UUCJ 1OVYA 2YH0A 4X66F 5FLXO 3B6BA 4LF6J 4OLBA 4CLUA 3HHKA 2KVQE 3U1MA 3EZWA 3VAJA 1GX6A 2RKIA 4LSLB 1H1VA 5KFBA 1W2BM 2WONA 1DTTB 2V2KA 2KJWA 1K8KB 1YWXA 5HRNA 2GQCA 2PAVA 4JKBA 4KO0A 3IR5B 2WONB 3RWUA 2VG7A 2D1CA 3EPGA 4B3SF 1FERA 4JD2B 1YTAA 4IRKA 3A0IX 3M1FA 4KI6A 3EZOA 3CFPA 3H7HB 4WIIA 5D0GA 3THWB 2A3ZA 3HXMA 4NZ7A 3BO3A 2H51B 2MTLA 3ZSXA 1C2PA 3OV7A 1XBWA 4CF9A 4FYYB 3X3UA 2BJDA 1VQ9S 4OJRA 2RF2A 3OTOF 2UUBK 5JS1A 4IFYA 4MQ3A 4ED0A 4P9SA 2DGOA 5KG4A 4NLYA 5KG7A 1YVFA 5BN9A 2QW9A 2DXFA 2H5IB 2BEFA 3SSQA 3QT5A 3EXCX 1MU2A 3J81U 2AX0A 2CRLA 5KFPA 2HRUA 3BEGB 3NNCA 2KKHA 5DQGA 1QM9A 1RJJA 3OTOJ 2BOPA 3M9MB 1VBYA 1T3NA 3UD5A 2DH9A 2RRNA 3PTWA 4QOTA 1O8BA 4K0KF 2HFUA 5CXTA 2W01A 4LF4K 3UFCX 2B8QA 2X3GA 1HJOA 2G8VA 1JLCB 4F9OA 4FZVA 3T9ZA 3M05A 4H5TA 3IS9A 4IYQA 1U2VA 1KQSR 3GJQB 4Z37A 4ECZA 4E98A 1WUUA 2WVEA 3AJDA 5KFFA 2VG7B 5ETSA 3C94A 4CBWA 4EYIB 3TW0A 2NZ4A 2FHOB 1KTVA 2HFNA 4B8CA 4RJVA 1HPMA 2JSXA 2YHWA 5FPEA 2IJNA 1JKHA 3O6WA 3C6AA 1J9AA 4YDXA 1YTUA 1U0HB 4YR3A 1IQTA 3UPFA 1ZH5A 3NH0A 1IKXA 2LDYA 2E7XA 3M8QA 1T8EA 1OQ6A 3TUJC 2JX2A 3MAHA 2XI3A 3QFWA 3LQVA 1Q8IA 3DLEB 2OO4A 4H0XB 1HR0F 4EP5A 4XH4A 3ZT1A 3A8KA 2MLXA 4Y2CA 4YY3K 3CCWA 3SPYA 2LP4A 5DDOC 1RI7A 3D7SB 4BC4A 3HZ6A 1HJRA 1XNQF 1P8GA 5F8JA 1R6YA 5GADP 3B78A 3GR1A 2ZF5O 2KRBA 4EZ6A 1RBTA 2IY5B 1LK7A 2V67A 3EM1A 3L4BC 4B9SA 3TTCA 3CO0P 4RO0A 4BY9C 2KDOA 1SV5A 4K25A 3W60A 4LREA 4MO5A 2XMAA 3WEEB 3OYKA 1SC3B 1AYEA 2N4DA 3OYEA 1EQMA 3PIOL 3V5RA 1XIQA 4W5OA 1WI6A 3VQ4A 4EU0A 1Q81O 3L0QA 1KVJA 2N3OA 2LMIA 1T44A 1GAOA 2C3OA 3K17A 1TZ0A 2HFOA 3I87A 1BL3A 3GONA 2M2BA 3M1VA 5A2QO 4CK2A 4C11A 4DSKA 3GV7B 2B5JA 3AOBA 4AD6A 2BMBA 3BBFA 4CJVA 4G65A 3SFGA 3GCXP 4DHVA 3LP2A 3CC7N 3B8HA 3FRZA 5LJVA 1RDRA 4KKOB 2AD9A 2ITGA 1BIUA 3A1YG 3CEDA 3QBCA 1RTDA 3A5OC 3SAGA 3OXFA 4DV2K 2NSBA 2DNYA 1JLQB 3DOKA 4DFPA 2R42A 2L08A 2PGCA 4E1NA 1T3OA 1ZAXA 3UDCA 1DRZA 2CJ9A 2VG6A 2V34A 1ZYQA 3C15A 4CJRA 4C7QA 2WHOA 5GIPA 2J0XA 4I2PA 3AVIA 3FLCO 3B4MA 1X7VA 3UD4P 5AQXA 4RBUA 4BG9A 2GVDA 1NSKL 5EOYA 2WUSA 3BF3A 3S3NA 5FRNA 5DGBA 1KS2A 3R9PA 3AB4B 3U27A 4CI0B 2BVZA 4JKGB 2HSEB 1VRUA 4B02A 1WF0A 1VQKS 2O3DA 3BP8A 2P9GA 2GHWA 3G9CA 4A57A 1XERA 4B1YB 3N4QA 5JS2A 4Q0BB 3FMWA 2GUIA 2VODA 1S1XB 3HSCA 3LM2A 4PHTX 4LRFA 1N56A 3LZIA 3HCXA 5GAHI 2E6MA 1KQKA 3PW0A 2XYGB 4PXEA 2K7JA 3MDQA 2UXDK 2CQBA 2FC9A 3OL6A 2GVDB 4BRNA 1ZTTA 4MLHA 3G25A 1YHQN 2DR6A 5AXKA 1NEEA 4JKGA 1JNRB 2DXEA 4DV0J 2AYEA 4DFJA 1NJYA 2F4VK 4NCAA 4NLTA 2DNLA 3MEKA 4DV2F 3DU6A 3MR3A 2C2NA 2L41A 2HQDA 1HNXF 2OPPB 3IS9B 1KDNA 4M5JA 2QC3A 3L7PA 3R5BA 2UXBF 2QFJA 2G8UA 4BACA 2FZCB 1NHKL 3NH2A 3LGHA 5AFUA 4YDUA 1U1RA 1F0XA 2QLJB 2WSEC 3CULA 1NM1A 3OS2A 1RCHA 2MLZA 4BRAA 2YNGB 2AF6A 1C1CA 2HS3A 1QTMA 4JI5J 5KG0A 2M8HA 2XMMA 5DDPC 3Q24A 4PWWA 3MCPA 3V81B 1NU0A 4R79A 1PYOB 3QO9A 3P96A 3EZUA 2V9KA 1JLAB 2JC0A 3NGZA 3CMAN 3AXMA 5DO2A 3WQPA 2O8CA 3WC0A 3RMAA 1IM6A 2FQQB 4YORA 3T5LA 4FZXC 1KFSA 1WKLA 5E3RA 2MQOA 4YDUC 3HHLB 5AZIA 5L9XA 1IVZA 4ED5A 4RX6A 2IA0A 5C0YA 1RDAA 3MTKA 4LH4A 2KT3A 1VQLN 1AA1B 3AD9C 4KTWA 1ROFA 4MH8A 4JI1K 3PG9A 2HNZB 4PXDA 3PHEA 3D6HB 2VQEK 1RTZA 4M3TA 2IRUA 3LAMA 3JS6A 1RABB 4DLGA 4FW1A 1KAYA 3KHRA 3SDEB 3TAEA 4TQSA 5I42B 3CC4S 4DSLA 3NAHA 1V5VA 1FA0A 1AFJA 4E1JA 4NZ6A 2A18A 4PR6A 5CAAA 4U67L 2ILZA 4X62F 3D0IE 3QRRA 4R8UA 2P5GA 2HLTA 3NAEA 3RMCA 4DR1J 4RTFD 4O3NA 5AQIA 3CD0A 3U1NA 5CE3A 3OL8A 4K43A 4BE1A 1R27B 3HHLD 1YITN 4USWA 2KM8C 4KKOA 3D6MB 2QTWA 2F8HA 3AA9A 3H45C 2N7CA 2COLA 4DR3J 1HYVA 4HH0A 2GZOA 1S22A 3NBPA 1RHMB 2ALYB 4LF5K 3OUYA 3S8SA 3MDFA 4LFAF 1NGCA 1T9TA 5DLFA 4NOHA 3NBPB 3UN5A 1I94K 3FE1A 2QG9B 4HACA 3VA3A 4QWCA 3UW1A 1URNA 3LGNA 2KHCA 3BV8A 2HHPA 3D6TB 3KJVA 1IKVA 1QLNA 2CVIA 2XMKA 2QTDA 1PBUA 1NGFA 4DSFA 1XEZA 4OHXA 2CPEA 1EQYA 2C2OB 4UY8O 3F9MA 3G6YA 1VSIA 3PEJA 4LIRA 4E2FB 4C2MA 3AO5A 3CDEA 2RE2A 4OGCA 3C16B 4LBHA 3VESA 4X4UA 2OLWA 4CJFA 1Z05A 1OY9A 4A59A 2MGZB 4GMJB 4CIGA 2B7CB 3IA0A 2CPFA 2OFGX 3W2WA 3UKUA 4CWBA 2HWTA 1TELA 2GS8A 2QXLA 3MM8B 2GIRA 2QV6A 1KQGB 4AFFA 5DRKA 2W9CB 4UOFA 3F44A 4LFCK 2H4WB 5DK5A 3U02A 4BS2A 1S5ZA 1BI4B 4N7TA 4GKKK 1H2UX 5KFSA 3KUHA 1Z1ZA 1VCTA 2CNNB 3SI8A 3M8PA 1FRKA 2C2DA 2NXJA 3VQTA 1A0OB 1TKDA 3LA0A 1NNDA 5HRSA 4JEPA 3ZZOA 1VQ7N 2NRVA 3DI6B 3DLGA 3R5CA 4MIBA 4DS5A 2KN4A 2BW2A 1NGIA 3CCUS 2HVHA 1NPPA 1JLBB 2HS0A 3GJTB 1YTYA 1ZBFA 3K59A 1ZM3A 2B51A 1BIZA 4YB5A 4LIWA 4GVBB 2CFXA 4GKJK 4DS4A 5C5JA 5J2PA 1KQSM 1SJ1A 2VC1A 1XR5A 2CJXB 5DM6Q 3MZIA 3P39A 1WSIA 2JFDA 1NBEB 4J9OA 2QXFA 5BR8K 1FEEA 4NLPA 2YKOA 4JI6K 2YNIB 4OFZA 3MN5A 5ETOA 3WDOA 1DLOB 4J9NA 3OTOK 2R2TA 3NVKA 4UTGA 4PZVA 4CJWA 4Z4IA 3KLVA 1VK8A 1H3DA 3UO0A 1YVUA 5LM7E 3G10A 1WSJA 4WP8A 2AQ4A 4ED1A 2Z57B 1XWLA 1HMVB 3D54A 3VALA 4FLVA 4MJKA 5JLFA 2DRDA 2IIRA 5AQYA 1N5YB 2E5LJ 3FKBA 1U02A 4NASA 3EPIA 5DM7Q 1CC8A 1SH3A 1EARA 4OZJA 1JL1A 2CNOB 1LXJA 5HK4A 2Q97A 3H4DA 2A1RA 2R7UA 5ETMA 3RUBL 1AB8A 4J9SA 4RW4A 3HJVA 1WAJA 1RLDA 2HBKA 5A2QU 3VF4A 4AHRA 4FM0A 4LSNB 3QFUA 3AQPA 1QD1A 3RRGA 1S99A 3SV3A 3FUYA 2LQ5A 3PRBA 1QQOA 2DPJA 5C2FA 1FKPB 1XR6A 4ALZA 2FJDB 3TR8A 4DU7A 4IOXA 4JI5F 3RZAA 1R89A 2B4UA 3HHLA 2BKPA 3H3OB 3M6VA 2RH3A 1BCOA 4JKDA 3HHEA 2AYMA 1UL3A 5AQSA 4JI0F 2JWKA 1U24A 3AO2A 2MY7A 4RW4B 3SCXA 3R6MA 1F5BA 1BWEA 3IBFB 3OHRA 1VQ4S 4NLBA 2BDPA 1AW0A 5H1SQ 4USIA 1U2FA 4L74A 4TYAA 8ATCB 3R8YA 3C3LA 2C3MA 3POTB 4I6WA 2EK6A 3FEXB 3G96A 1S9EA 5ADZA 4CZMA 2FBXA 3MM6A 2QJ3A 1K73O 2ZFHA 1GTEA 4JAXA 5M1PA 1D8YA 3Q2SC 4KHPK 4F0MA 2V5HG 4DR7F 3I5CA 4QIGA 4DTMA 1XNQK 2F8TA 1RYRA 1RTHB 2H65B 4FYWB 1GLEG 4V1Ak 4LFBF 4PPDA 1RTIB 3O3HA 3NCQA 4K41A 4B1UB 4DMNA 1BQMB 4UUXA 2H3EB 4OZNA 1SJQA 5B8HA 4HHJA 4DR2F 4YR2A 4CD3A 3VENA 1RBUA 3SMZA 2XULA 4RW9A 4WPAA 3HI0A 4LRDA 1NHVA 4J2EA 2CGLA 2MSTA 1NUEA 1CXUA 4IXCA 3HF5A 4OI2A 4F3TA 1Z2LA 3EXYA 1HBOB 3KNAA 1ZBLA 2C2RA 1L3KA 2FC8A 3NE6A 4CGHA 1W26A 2ZWPA 4ZK7M 4ECWA 1HPZA 2R7YA 2HSTA 2QL9B 4CHYA 1T9UA 1SCJB 3FGUA 2HHHF 3CJKA 4DQIA 4CZGA 4KHSA 3VAFA 2NSCA 3SQGB 1XMQJ 1Q0NA 5AQGA 4ZMMA 4WTOB 2KO1A 3Q23A 1NSAA 2QMUB 4RG8A 2NRTA 2HBZB 1QTNB 2YKNA 2CH5A 3V4IA 4NYFA 2BANB 3ZZYA 1X4EA 4FCYA 5I3UB 4AQYK 2A40A 2EXUA 5F0XA 3QRQA 5IT0A 4DU3A 3PHTA 1D9DA 5EWGA 4CO3A 4BGBA 5AQOA 3DHXA 4K4YA 5IM0A 1NPKA 1M1KO 3CJ5A 4KH4A 2MZQA 2HQGA 4X64F 3HD2A 4JI2F 4E1MA 5KPTA 2H48B 1FWLA 3TTFA 2FSJA 3EN9A 4S0MA 2ADCA 2OPQA 1KSPA 4M5NA 3CXCR 3H2UB 1QSLA 4X65K 4ZJLA 2HGLA 3QNWB 3IUCA 3A3OB 3RSEB 2XLJA 3KK7A 3RMDA 2ETJA 2G0CA 1HKCA 4FLZA 3GV8B 2ZH9A 1MSWD 2MZRA 3Q7CA 4JN4A 3SSRA 1S0VA 2L9DA 4G3IA 2P5OA 5E5NA 2F63A 1UCNA 1VRUB 4FDFA 4LF8J 3J7ZT 2RKIB 4J9QA 2Z1JA 3NGKA 1TMMA 1G3OA 2Z2ZA 2BGGA 2FPHX 4DV4K 5CZVA 3V9SA 4F26A 5EXWA 2C28A 4LF6K 4EBCA 3SUOA 2X1BA 3LDNA 1E6VB 4JI3K 2VWBA 5AQNA 1RADB 3QEPA 4IWVA 1C1BB 1RZMA 2QEXN 3M32A 4BRQA 1WKKA 4FF3A 4L3NA 2UU9F 3GILA 4K50A 3SLCA 1Q79A 3MR6A 1ZM4A 3DU5A 1X4BA 2KVIA 3J7YU 3RB6A 3G2XA 3HPOA 1UJ6A 1YRUA 1MWKA 3PJXA 3GFYA 4DV6J 3OR1A 4P10A 3P1GA 1R43A 3MN7A 1VISA 1RAOA 3BY5A 1N32J 4FM1A 1CC7A 5E33A 2NUBA 1X0PA 2YKPA 3CMES 5KT3A 2XB2D 3LGMA 4HVZA 3KLGB 2O4IA 4EHTA 4WFNL 2YCHA 2JEIA 4NLWA 1ASVA 3MX5A 4JK8A 2D0OA 4B3MJ 3FQLA 3VAKA 4OZ5A 2JZ5A 4IKAA 1C0UA 4DFKA 1F3VA 4FK2A 3QIPB 1NGDA 1X1PA 2UUAK 4XO0A 2IHR1 4GRSA 2J0WA 3VGVA 1C1CB 2XS2A 1KVIA 3KLEA 1C4CA 4JI8F 4FLUA 4PKGA 4JI8J 3OYCA 2O8EB 3UVJB 3HJFA 4JI8K 2QZ8A 1U48A 4WFBQ 1GOBA 3D6FB 4CGGA 2LEBA 1ATSA 4ZJQA 1IBKK 2DY9A 5DM7L 3JSYA 1KD1T 4KHYA 4QU6A 1LWFB 4U7BA 1CVJA 4RNHA 4DV6F 1CS4B 5KG6A 1HRHA 2QWOA 1QHTA 1RHRB 4H4KA 3US5A 2U1AA 3T6BA 3P83D 4U8VA 4LF9F 1LWFA 2VPYB 2IVFB 4CDIA 4CZFA 4U7UK 2AV5A 1EJ7L 2A1BA 2AP6A 2AYBA 4OLAA 2J8SA 4OHVA 3M2UA 1NAQA 3MEGA 2KJVA 3GFZA 2XI2A 4A8KA 2MDAA 4ECTA 1S1VA 3OYBA 4H5VA 4F04B 3P5BP 3CO9A 5J1EB 1RBSA 3DLLL 3OBIA 2I1RA 4GNIA 4UUWA 4NXNF 3H1QA 1SQGA 1RDCA 2G2ZA 3TABA 4I6YA 4M3RA 2V4QA 2B4PA 2C1EB 3A3PB 3DXSX 4DUZF 4ZS6A 1P8ZA 2CVEA 4K4VA 1OS5A 3LDLA 1RBAA 3JAMY 3MN6A 4K8RA 4CJQA 1YQHA 1MROA 2MJUA 3DOMA 5IOLA 1RDUA 4A2AA 5KPZA 4B9QA 4R8UB 4QBUA 4DV3J 4YHHK 1VSEA 2A41A 2D74B 3MWTA 1EWRA 1FCAA 2X1GA 4Q8FA 3D67A 2L48A 5E41A 3EWGA 2IMOA 2MZSA 4ZVFA 2MXYA 2PEHA 2ASDA 3V1OA 4HTJA 4NLCA 5HL7Q 2YPZA 2CJKA 4UOGA 4NI2A 2QGFB 1RT4A 2GJFA 2JDJA 4QIWD 1FDBA 4OX8A 1H0HB 4XH1A 3WT0A 4X4SA 1CG2A 4JK9A 1K1QA 5KFXA 2A42A 2D0CA 2QKBA 4JI4J 3OUYB 1WF1A 4Z4FA 1FE0A 3TQEA 3OYDA 4IRCA 5B0EA 2EC2A 2B43A 1PIEA 1UVNA 4BQLA 1GX5A 2M52A 2AKWB 3Q8PB 2E2QA 1T7PA 1Q9YA 3T1HF 4C23A 4Y1DA 4MKAA 2EFGA 1SJ3P 3K5LA 2VBXA 4LH5A 1TTHB 2R2UA 4DTNA 4M8LA 4B8AB 2NREA 2KG1A 4TLRA 2FLPA 2V4JB 4H5NA 4UZBA 3BO4A 1H38A 1B9DA 3DM2A 4H0OA 5L39A 1QVFM 1LEOA 5EVZA 2IYGA 2Y1RI 3J81j 2BRLA 4I1TA 2BUPA 1VQ5S 5HJYA 2IOCA 4OX9J 5CZXA 4KV8B 2ZJQQ 4M3YA 3M9NB 1ZBSA 3IWNC 1KVKA 4EK2A 1FTRA 3BF4A 3E66A 2CJYB 4WQ5C 5MLCV 2JLGA 3RB4A 4EBDA 1YHQS 4E8UA 2DNPA 3A5MC 4X4PA 3IAS9 1NG9A 2DD8S 3BO2A 1SJFA 3VGUA 4FYXB 4DFMA 3AVFA 3SJHA 1IBCB 1NM2A 4ZP6A 4JNEA 4IH7A 4X2BA 1R59O 5AQVA 4RNMA 4F4KA 2OD6A 3IM9A 4HL9A 1J53A 1RTDB 4LC9B 1ZA2B 3ET6A 1GMWD 3VMFB 1NJIO 3OTEA 4YMEA 4Y2AA 4CGIA 3N01A 2VWKA 3PX6A 4PG8A 1SQFA 3GIJA 4NEYA 3KWIA 4BR7A 3C6TB 3KDNA 2AZ3A 4O0IA 5E3CA 2VONA 1A5WA 3KK3B 2PYJA 1S1UA 3PYDA 5F0UA 4NRTA 1UWBB 3UCGA 1YI2N 1HNZK 1M5PC 4IH5A 3I56N 2XYPB 3D1QA 2CUYA 1RDDA 1WSVA 3MPUB 4K2JA 2X3DA 2UXBK 4YB7A 3ZSQA 2HBQB 3OVSA 3NS5A 2ZJQL 3C95A 5EHHA 3KKRA 2XYHB 2LQJA 4W98A 5KFJA 3RYLA 3EE9A 4FJIA 2CIMA 2NXEA 2VOPA 4AM7A 1EQ0A 3TU5A 3JYTB 4CLTA 4KH6A 2J76E 2KRRA 2A6AA 4O3PA 2DJWA 4LFAJ 1TKXA 4A5AA 3IG1B 3EX7B 3BDEA 4LF6F 5CCMA 2ASMA 1U7LA 4LT6A 4HT5A 2DHGA 1UJ4A 3VZHA 1BHNA 2HKEA 1K8AT 2O4GA 1N32F 4CF8A 4CLKA 3WC2A 4DPYA 1KTQA 3BGUA 1U2CA 3QO9B 4M94A 1OO0B 1RWWB 5C2GA 5KFOA 3SAFA 3HM9A 4UZCA 2YWHA 4P2FA 3G71N 3IMQJ 2W41A 2V52B 2WW8A 5CY4A 2DCUB 1WKJA 3ENAA 5KGWA 3BYPA 5J1NA 4TXSA 3MPYA 5IC6B 2D3UA 1RHKB 3HPHA 2HBLA 4Q2LA 3TJ9A 3DMJA 2FVRA 3IR7B 2HGMA 1NSQA 5GAGI 1ZZNA 1JL2A 3GPAA 4HHUA 2D0PA 3JSMB 5B09A 4OJGA 3EE8A 1JLGB 3M4XA 3O3FA 2XNRA 4OZ0A 2YKQA 3ZTOA 1KP6A 4L6V3 2OEJA 4TU7A 5F8IA 3IWLA 3K2PA 2P9NB 3CE8A 1FWKA 2G9OA 3WHIA 2OI2A 4FNHA 5D0EA 2ZKTA 5G4DA 3MX2A 1RHQB 4FL9A 4XH5A 3PDNA 3CFRA 1FKOB 4RUCA 1ITPA 2E4LA 4F36A 3L2WA 4KH5A 4CZCA 1XC3A 4DB3A 3DJCA 2EHGA 4NXNJ 1GFWB 3HVTB 2ZITA 5AXNA 3VQSA 3F2KA 3TWZA 2PBDA 4DV4F 1WC0A 1VRTB 1X4CA 4JI2J 1U0HA 2IDLA 4C11B 1N36K 4F3MA 5T41A 4AXJA 1EO1A 2KXNB 3O8WA 1TGOA 3EZ5A 4TVAB 1N6QA 4MKBA 2IIHA 4RW9B 2V4JA 4F7VA 4DR5F 1CBKA 2W2QP 1PC4A 1PJ7A 1QAXA 4USHA 4AT1B 1KONA 3W9HA 1IJJA 3SDEA 4X66K 4B17A 2Y0SD 3J80U 3IKMA 1U0SA 1YJNS 1OH6A 4ZCMA 3ICLA 3G82A 3MCAB 3J7YP 2ZVSA 2GMJA 4BQZA 3BH7B 4IO9L 5JXSA 3FSYA 2UUBF 1CQNA 4M3ZA 3CETA 1REVB 4N47A 5BPNA 4I6AA 5K5MA 2Y9HA 3HT3A 1PJ6A 3MAAA 2OCEA 4FWMA 2QE5A 4C8YA 1M90O 2DNNA 4DPUA 2ROGA 4WFNQ 3W3SA 2XY7A 1BUPA 5CR4A 4Z7CA 3N28A 2HHQA 4QS8A 3V6JA 3BBCA 3ISNC 2BE9B 3TJ8A 1NU4A 4GY2B 4FVUA 3MMBB 4ED3A 3O44A 4B3RK 2W25A 1V3ZA 1SL1A 1N0UA 4BWMA 1YGYA 2DGXA 2J9DA 1N34F 1BI4A 1AXQA 2O01C 5LMNF 2RUSA 5KFKA 1NK8A 4P52A 2FHJA 3QFPA 4FNIA 3W7BA 1E6YA 5HANA 1NJXA 3QJJA 3G8QA 1SC1B 1NPRA 1S72N 5ETVA 2HRTA 5HMWA 2CNLB 3ZX0A 2LQBA 3MXJA 5CABA 2XLKA 4OI6A 4L73A 5AZIB 1HQEA 1MWZA 2AU0A 2PT0A 2ZJPQ 4BVPA 5ITHA 2IDEA 1FJGK 3C6TA 1YVNA 3J7AN 2WOMB 5KAKA 3T1HJ 1VQKN 1ZBHA 2OD4A 2W24A 3AH6A 2OZMA 4ITSA 4QWAA 4CJEA 2WOMA 5ADXA 2P5VA 1KRPA 3AO1A 3H40A 3O5BA 2QA4S 2GNKA 4LMZA 1GLJO 3KTQA 1S1XA 4TU9A 2LEAA 3MI7X 4RW6A 4N5SA 3C16A 2DO0A 2D3O1 3T5KA 3N6MA 1X3NA 1S3XA 4P2XA 3M5RA 1OYEA 4C8NA 2ZNYA 1JCEA 1YKWA 1I3AA 1J5OA 3CJ7A 3SPZA 1T95A 4JKAA 3PX0A 4CW7B 4P6QA 5LSRA 1LAVA 1Y3JA 2IVOA 4WKYA 2BJ3A 3CCSN 2CQIA 1BQMA 3POTA 2YKMA 4XK8C 3MR7A 1XMQF 2NXUA 2CZVC 3DLKA 4CZHA 3H98A 2DFFA 1WG5A 4IJNA 1IJFB 4OIXA 4FLWA 2PA3A 5GAEI 3PR5B 4OLPA 4KR0B 3HPGA 1JJ2R 4GVLA 5HROB 2IM1A 5B0AA 2HLUA 3OLAA 3PW4A 4A62A 4KHPJ 2QA1A 5C15A 3I82A 4N56A 5LL6Z 3ILJA 4DL3A 4W5TA 1QAJA 5J2QA 5GAHP 1BQNB 1HI0P 4LD0A 1BWFO 1O13A 5H9EJ 4HLBA 3L95X 2W8KA 2VPZB 1TL3B 4ZTFA 5ETTA 1K0VA 5BN8A 4G9ZA 2NCKL 2RDIA 4YY3J 4FBTA 3BM7A 1KFDA 2QYGA 4NLVA 1VSKA 4V19S 4ED4A 3TRGA 1CJVA 2DBBA 2PMHA 3R7NB 1DEJA 4C4WA 2EBGA 5KFRA 4JS5A 2OELA 3MUVP 1S6PA 2FVPA 3CFOA 1CJKA 4ZOSA 3TAGA 1FKOA 1Q78A 1IBLJ 3ZT0A 2GFFA 3RG6A 3QMLA 3NG8A 2HHWA 3NMRA 1HNZJ 2YWEA 1Z26A 4WFXA 1GLBG 3SQGA 2DR7A 3N4WA 4L76A 5LT5A 3P49B 5M2RA 1L3TA 2E1PA 1LNQA 2PO4A 5CD4A 4QR1A 1VRTA 5LMUJ 1RWXB 1X4HA 1T02A 1MLAA 3O3GA 5EX5A 1HYSB 4U9RA 3KJFB 4PY5A 1WOPA 5U47A 4B9MA 4HUGA 4M5DA 4KT0C 2AGOA 1WTFA 3IMXA 3KLFB 3DOLB 1IKWA 1FO1A 1RUSA 4FJGA 1U1KA 2MYFA 4RCHA 1OH7A 1VQYA 2OEKA 5AZJA 2CH6A 3FFIB 1UFWA 2ZH7A 2XEXA 1BD6A 4CHQA 2QL5B 3O1LA 3SK3A 2E5IA 3R27A 4FS1A 4DV2J 1OSDA 4H0PA 4M1KA 4DV0F 2ITMA 4FWOA 2AP1A 5M2PA 4ZN1A 2CYYA 1JIHA 4FXVA 1UZHA 1Q1KA 1FDAA 4RNNA 2CQCA 2VQFJ 3R1XA 1IKWB 1XMQK 2UUWA 4NA2A 3B8AX 3DDIA 4KGZB 3QETA 2HBJA 4QS7A 2MKYA 5E3AA 3C7NA 2P9EA 2Y1IA 3GIRA 3TQ1A 2DR8A 3KJQB 2E7VA 5LL6d 1N33F 4ED6A 1JXBA 1L3SA 2DB1A 2JVOA 5FRMA 3ISZA 3I55N 1I1GA 4ZLPA 1OJ4A 1TK5A 3EDRB 3C66A 5D77A 2DY1A 3QBWA 4X62J 3MM8A 1S1TB 3SZ2A 1QVGM 2CPYA 3CD6S 1UOCA 3RW6A 4CEBA 4CBXA 1FT8A 3G87A 3D45A 2WFBA 1I94F 2BX6A 1YJRA 1TAUA 2QA2A 1FEHA 1X9WA 4YR0A 3EE3A 1CJTB 2CG8A 4HI2A 3CJAA 3VQAA 1XUPO 3RVCA 3A4TA 4PKHA 3FZLA 4ZVUB 1UTAA 4E7IA 2GW8A 4KAZA 4OJ1A 3ULHA 4DV1J 3QAUA 1QUPA 1HW8A 3TZZA 4ES2A 1HNVB 3JS9A 2ZH2A 4KHMA 1Y11A 2DR9A 4CT9A 3D2FB 3R1LA 2G0JA 5KG3A 3QJLA 4LRBA 2QK9A 3G4SS 3GR0A 4LR9A 3KLEB 4WWSA 2YWWA 4TN2A 3K2YA 3MFHA 4KRWA 3KK1A 4HTIA 5ETRA 3WX8A 2AJ2A 1E4GT 3HTVA 1CULB 1RWPB 1ZA1B 4O0JA 1C0TA 1D1UA 3AVNA 4X4TA 2VU5A 3GTYX 2BOAA 3GJRB 2MQMA 3D1HA 5KFIA 2P9PA 5KI6A 3HD1A 3KG4A 4MT1A 2Z58B 3K57A 1U1PA 3Q8QB 3I5AA 2VPXB 5F8NA 4N8OA 4MK7A 1O51A 2E20A 1W97L 3LAKA 1ZZFA 1C1BA 4KYZA 4DI6A 8AT1B 1I39A 2Q0UA 1OYDA 4ILGB 2H5JB 1LK5A 1WTBA 4HDGA 1GH8A 2GO8A 2XS7A 4LF2A 3GYGA 2IGIA 4IDKB 4N76A 2RU9A 4A61A 2ZGZA 2K06A 2CXEA 5DQIA 4DOZA 3BREA 5LMNK 1SKWA 2RF2B 2A2CA 1LFWA 4IFVA 5F8MA 6AT1B 4DR6K 4IO9Q 1CLFA