5HP1A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and foscarnet, a pyrophosphate analog
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/inhibitor/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 152
structure length 553
sequence length 553
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hp1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hp1A05
4ZPDA 2WTFA 4DU3A 2KZZA 4WXWA 3GIJA 4BE1A 4DTSA 2KTQA 2IA6A 4BACA 4I7FB 4MFBA 2YKNA 3DM2B 3RB4A 4DQQA 3MEGB 1N6QB 2AQ4A 4FLWA 4DL7A 1OS5A 1NJZA 4IR9A 3NH0A 1SKWA 4TQRA 3AVHA 4TYBA 4K8ZA 4JS4A 4EP5A 2QXFA 4OKJA 2YNHA 1I6JA 3L2QA 1NKBA 3HVRA 4FZXC 3HPOA 3MTKA 1TKDA 4CFCA 1LWCB 1WAFA 3SQ2A 3OSPA 3VQAA 3RMDA 3MEDA 3LP2B 4J2BA 2E6MA 1QQCA 2BE2A 3QGIA 3M8QB 3CFRA 4RG8A 4FBUA 4HUFA 4CIFA 4WFZA 3Q8PB 3DLKB 3VQPA 3KLHA 4NLUA 3OYHA 2XCAA 3RB0A 1XHXA 2F8TA 2HAIA 4MIBA 3V9XA 4DS5A 3AVJA 2JEJA 3PW7A 5L1LA 3SYZA 3JSMA 1RTHB 4IRDA 4IFYA 5KFRA 4F4XA 3KKSA 1KRPA 4FJKA 4PUOA 3M8PB 4CJRA 3QNOA 4CJVA 3KMQA 3OLBA 4NLGA 5DG9A 1S6PA 2HWHA 1BQMA 1N56A 2ATLA 4C8LA 2QKBA 3ZSYA 2DY4A 1XWLA 4NYFA 5KG0A 1TVRB 4J9SA 3TAMA 1X9SA 3N6LA 4FJMA 5HP1B 2YNGA 2R8KA 2IM1A 3OYKA 2R2TA 3AO1A 3NDKA 4PWDB 4BE2A 3TAEA 3FQKA 2P5OA 1YT3A 3OYLA 4RW4A 4DSIA 1TAUA 5K14A 3I8DA 3PR5B 1YTAA 4J9NA 4LD0A 4Z0UA 4CHOA 3I0SB 3MFHA 1S97A 3ZSRA 3ULDA 1SKRA 2AWZA 3TQ1A 2EC0A 3RMBA 1VRUB 4CJ3A 1RBUA 3IS9B 4RW8B 1IKYB 3DMJA 2OZSA 2OPRA 4O0JA 3HVTB 2ALZA 4H54A 1NK4A 1EP4A 3HL8A 1DTTA 4U7CA 3F73A 3CJ5A 3LZJA 4R8UB 1HJRA 2X74A 2HMIA 1TK5A 1TP7A 2ZD1A 1QSYA 3TWHA 4E1NA 3MF5A 3D45A 4KHQA 3VQCA 1KLMA 4Q0BA 4ECWA 4BDYA 3VA3A 1WSEA 4HYKA 3HK2A 2C2EA 3PUFA 1RT3B 3U3GA 4OLAA 2ETJA 3LWMA 2VA3A 3AVCA 4DSFA 5DQHA 4HUEA 4FLTA 4E0DA 3DOKB 2NUBA 1BQNB 3S3NA 1QAJA 3VQ5A 4QWBA 1BIZA 3H59A 4G3IA 3O4NA 3V1RA 2PY5A 1W0HA 1X9WA 2HB5A 1JXBA 3HP9A 4E89A 1R0AB 5T14A 1VSMA 4R0EA 3MR2A 1DTQA 3UIQA 3H4DA 3DOKA 3MECB 2FBVA 3THVA 2R2SA 4NRTA 1NK8A 4NLTA 4B9SA 4ID5B 1T05B 1KTQA 3QEPA 4DTNA 3MR6A 3V6JA 3V81A 4O55A 2YKNB 2A1SA 3H98A 5HLFB 1U4BA 1S1XA 1HYSA 4IG0A 4NLYA 1D1UA 2VWKA 2DFHA 4O3OA 3DRPA 3OLAA 2ILYA 4M3TA 3VQDA 1RT1A 1JXEA 2E4LA 3MR5A 3G6VA 5C42B 1NHVA 4Q8FA 3NGIA 3KJVB 4WXOA 4IR1A 3RRHA 4KB1A 4I2PB 5C25A 3QZ7A 4J2DA 2BANA 3ITHA 4GC7A 5KG6A 4O3PA 1S1VA 3C6UB 1ASUA 4CEZA 3T5HA 2W9AA 1T03A 1JLBB 2HNZB 3O4QA 5KRTA 1ZYQA 1HNIB 4YP3A 3NKYA 4J2AA 4O0IA 4M42A 5DK5A 1S1WB 1WSIA 4IH5A 4CHNA 4JRQA 4NLWA 1JLFB 2XI2A 3SFGA 3SI8A 4IBNA 1X9MA 4H4MB 4MFBB 4I7FA 2IJNA 3T5KA 4GMJB 4C8KA 3E01A 4MH8A 2KW4A 3MEGA 3SQ0A 3RTVA 1RTDA 3TAGA 1UWBA 1WN7A 5L9XA 3FQLA 4FS1A 1DLOA 3TVKA 4DTJA 1IM4A 3LAKA 1RBRA 4FLVA 3HM9A 5HRPA 4KI4A 1JLEB 5KT7A 3QIPA 1KSPA 4GVMA 4MQ3A 5KFXA 4ED6A 2YNHB 3AVIA 5HRRA 1LWFA 3V6DB 1MU2B 2UVRA 2O5DA 3AVBA 3SJJA 5E41A 1S1TB 3L8BA 3T5JA 3WNGA 1KHVA 3UR0A 2FVRA 3L2RA 5C5JA 4KV8A 4J2EA 1TK0A 3V6KA 4ICLB 1XR7A 1TKXB 5T7BA 5JS2A 4IG3A 3WNFA 1K6YA 1REVB 3T1AA 4KO0B 4K4VA 1S1UB 4CJQA 1D0EA 4TXSA 5CYMB 2FVSA 4M41A 3PZPA 5KFAA 3NHGA 1FK9A 2VG6A 3T5LA 1U09A 2WB4A 1WSGA 2QK9A 3Q8QB 4DF4A 3K57A 1BQMB 5EWFA 1TL3B 1C1BB 1CXQA 3K58A 3M9NB 4OPJA 4IRCA 4CFDA 4CEFA 3C94A 4DL3A 3QLHA 4FJHA 3LP0A 5KI6A 4PQUB 3RWUA 4KFBA 5K14B 5KG4A 1N6QA 1S48A 4M3ZA 4IH7A 3VN5A 4WZQA 3HPGA 4F2RA 2UVUA 4M94A 4R5PB 2RDIA 5F8NA 3TAPA 4CJ4A 4CIGA 1UAXA 4DG1B 3SQ4A 1LAVA 3Q8RB 1DTTB 4MK8A 4O5BA 4ZHRA 3WNHA 3NF8A 4ZP8A 4Q45A 3DI6B 3H5SA 4KPYA 4DSJA 2W42A 1NJWA 2GIQA 2OPSB 4YR0A 1VK0A 2W9BB 3RB6A 1HYSB 3CIZA 5L1IA 4QW8A 5KFKA 4NLXA 1BL3A 2OPQB 3KNAA 3AVLA 3TR8A 3PJWA 1RDAA 1EETA 4AHVA 4H4OA 4NCGB 2R8IA 1J9AA 2XCPA 4CF2A 3HYFA 1BQNA 4AHCA 3DLGB 4O3SA 3QEXA 3LP3A 3RMAA 2HHUA 1KVAA 4RZRA 3K5OA 4M3YA 1S6QB 3PO5A 5KG5A 3CJ0A 3AVFA 1VSFA 3N6NA 4DSLA 3IGNA 4WFXA 3AV9A 4DU4A 3PO4A 2B4JA 3G86A 1S0MA 5KT5A 1BISA 3C6TA 1S6QA 3SQ1A 3SFUA 4K4UA 1T05A 4DFPA 1HQEB 3NF6A 3LALA 1L3TA 4DMNA 3CM5A 3ZSWA 2PYJA 4E19A 3I0SA 3H08A 3V9ZA 4M3RA 1S9GA 4E3SA 4FJJA 1G15A 1S1XB 4IG0B 3IS9A 4RW8A 4CF1A 4CK3A 3SNNA 2J6TA 4G1QB 4CEEA 3QIPB 3LPTA 1S9GB 3LP2A 4IDKA 3P83D 4C8MA 4ED3A 1UA0A 3UPFA 2RN2A 2Q3SA 1RT7A 4Z4HA 2XY6A 3DOLB 4K50A 5KTQA 3ZT0A 5J2PA 1ZBLA 4DTXA 3TABA 3TI0A 1S1TA 1JLBA 2HNZA 4O4GB 1CLQA 2ATQA 3NF7A 3SZ2A 3ZSOA 4BWMA 4Z4CA 3AVGA 2DPIA 4EBEA 2UVVA 5EDWA 2WRMA 4QWDA 2XGQA 5C24B 3CJ4A 3CM6A 2BRKA 1S0NA 3ZCMA 3VQSA 1F21A 5I3UB 1LW2B 1RBVA 3BQ0A 3AO3A 2QV6A 4IFVB 4KB0A 1QHTA 5KFYA 4FW1A 1IKXB 3ISNC 2KZMA 1RT6A 1R0AA 2YNGB 1Z25A 2D3ZA 4KI6A 3NMAA 4KRFA 2XY8A 4OPKA 4NLDA 4KAZA 1LW2A 4QWAA 3NBPA 3VQ9A 3MR3A 4Q5VA 4RNHA 4FJ9A 1T7PA 2BR0A 1RDBA 4DWIA 3V9SA 4Q44A 3QLHB 4KE5A 3RBEA 2R7YA 3M9MB 3IRXB 1VRUA 1BI4A 5J2MB 2F8EX 3KHHA 3KKRA 2RKIB 1XR6A 4AH9A 4FK0A 4ID1A 3NF9A 3PJXA 1IG9A 1I39A 1C1AA 2VG7A 4QPXA 2RKIA 2FJVA 1Z26A 5HBMB 3KK3B 3LDSA 4JS5A 1SKSA 4CGFA 2YNIB 4HTUA 4QWCA 4C8OA 3H5YA 4WZMA 1S1VB 4CHPA 5KFUA 4E1MA 3QINA 3CWJA 1KVBA 1XR5A 3KK3A 4KHYA 3HJFA 3DRSB 4JV2A 4IFYB 4NLQA 2FBXA 5F8MA 4CECA 4HKQA 5KG3A 4ED0A 1FXXA 3L2WA 1VRTB 5KT2A 2CKWA 4ZP7A 4ECUA 3OYAA 3GYNA 2ASJA 3MAQA 1XI1A 3BDPA 4KHUA 4H4OB 1RTIA 5EUHA 3V4IA 3RAXA 3PW4A 2IDOA 1LW0B 3AA5X 3DLGA 2FLPA 3SUNA 3H40A 1SH0A 4JV0A 4E7LA 4HCCA 4AHUA 4FLUA 3KD1E 4OLBA 3I0RB 4DTRA 1HPZA 3HVAA 3QYYA 2ZKUA 3BR9A 1QS4A 4DFJA 4F3OA 4RW9A 3QEVA 5HLFA 4URGA 4OKKA 3S3MA 1UA1A 2IC3B 3V6DA 3KLEA 1S4FA 4TN2A 3VQBA 1Q9XA 4OKEA 2YHBA 2YKMA 3I0RA 3HVTA 3G6YA 2G8VA 1UOCA 2P1JA 1SH2A 1IO2A 1RYRA 4FK2A 5DMRA 2VG5A 1U49A 4I2PA 3QO9B 5C25B 4AILC 1U48A 3LAMA 4RNFA 2G8HA 4FJGA 4YQWA 2OPQA 4EBDA 3V9UA 3ZSXA 1GOAA 4CJEA 2GV9A 5KRSA 4CF9A 2OPPB 1KLMB 4IOBA 2P51A 3ZSVA 3NAHA 4K4YA 4QAGA 4KKOB 4KHSA 1HMVA 3OYEA 1QUVA 3KIOA 3AVAA 5J2NA 5FRMA 2W7PA 3EPIA 3ZSQA 4E7JA 5J2QA 3QNNA 2V0NA 2I5JB 2IMWP 4Y34A 3ZT1A 1RA6A 4MKAA 4TYAA 4W5QA 1C0MA 4WFYA 3GV5B 2V9WA 2RF2A 4CHQA 2HHVA 3SI6A 3QGHA 4FYDA 4Z4IA 1RA7A 4K4ZA 1RT5A 3AO2A 4B8CA 2DPJA 2C2RA 3HT3A 4EP4A 3PX0A 1T3NA 4Q43A 4FLXA 1IKVB 1U45A 1HQUB 1IKXA 4FCYA 3B6PA 4R8UA 3Q8SB 3GIMA 5F8HA 1WAJA 4ECRA 3TARA 4CJWA 2HMIB 1TV6B 2JC1A 3HKWA 1ZBFA 2WK4A 2J6SA 1LWFB 5DLFA 4B9UA 4DQPA 3UDLA 4DFKA 1IKVA 3CO9A 5JS1A 3BGRA 3OSNA 3V6HA 1TKZA 1JXLA 5EWGA 1RT3A 2G8UA 4DTMA 1HYVA 2XC9A 4B3OB 4WE1A 5KG1A 5EWEA 3LP1A 3BSNA 2W7OA 5CYMA 2W9CA 3KMSA 1SV5A 3MXJA 2FLNA 3TANA 1HNIA 2OH2A 2I1RA 4CGGA 3RR8A 4DS4A 1WSFA 4CGHA 3AO4A 5KFOA 3BSOA 4IQXA 3OS0A 2AGPA 5KFHA 3RB3A 4EO6A 4B9VA 4CK1A 3OVNA 4EO8A 3ZT2A 3K2PA 4FXDA 4CEDA 3K5MA 1WLJA 4AHRA 1EX4A 1VRTA 4DLEA 3T3FA 4R5PA 5J1EA 4J9LA 2ILZA 4FBTA 1Q8IA 3RBDA 2W8KA 3IRXA 2Z1JA 1HARA 1D8YA 2AU0A 1WNEA 2X6NA 2XY7A 2AX1A 1L5UA 5KFFA 1C1CA 3DRRA 2ITGA 3LZIA 4DTUA 4OVLA 4RW7A 4O3RA 4OGEA 4G1QA 4W5TA 1L3UA 4N5SA 1NOYA 2UVWA 4ZP6A 1N48A 4EYHB 4CJTA 4CIEA 4WYLA 4RW9B 3DLRA 2F96A 3DLEB 2IOCA 4CJSA 3V1QA 4XPEA 2FVCA 3DRRB 2W9BA 1SL2A 2IAJA 4F4YA 3NCIA 3PVXA 2VWJA 4O4RA 3NL0A 2Z1HA 3OYBA 3QZ8A 3MEDB 5F9LA 3GV7B 2AX0A 1JLFA 4K4WA 4ZVFA 3FFIB 2G8FA 2IAJB 3OYIA 1NK9A 4ELTA 3VQ8A 3DRSA 4CEOA 1IKWA 2FBTA 2IGIA 4K4TA 1UWBB 3BQ2A 3EYZA 4ZVEA 2EX3A 1JLEA 4BDPA 2B6AA 1WNSA 3KLFB 3KTQA 3RAQA 4FJXA 4FJ8A 4LQ3A 3CDUA 2FVQA 4FJIA 4FLZA 1BGXT 1NNDA 4FZZA 4KBIA 5CYQB 4EEYA 4Q8EA 4KSEB 2X78A 2A1RA 3DYAB 3C95A 1NK5A 2XO7A 4F2SA 5KFLA 5KT4A 1ZETA 3OL9A 3RRGA 3KLGB 2XHBA 3HP6A 1JKHB 3GIKA 1KVCA 4CHZA 2YKMB 2R8GA 3QEIA 4ZTFA 1ZTTA 1WSHA 5CYQA 2ZD1B 1REVA 3DYAA 4ZHRB 4MKBA 3LPUA 3OS1A 1JX4A 3PW2A 4DF8A 3QO9A 5KGXA 4E7HA 4RNMA 4LQ9A 1JKHA 3K59A 1ITGA 1IKYA 4F8RA 3NAIA 3U6FA 4Z4EA 1EP4B 4M3XA 5KFBA 3ISND 4J9OA 3U3YA 4F50A 4DSKA 3H5UA 3HVWA 1S9EB 2VA2A 3BGRB 4FJ7A 3MEEA 2V4QA 2HHQA 1X1PA 1C0TA 2YNFA 2ASLA 1D9FA 4DL4A 4ZPCA 1NOZA 2DFEA 3PR4A 2I5JA 3LWLA 1HNVA 4ZVHA 3H4BA 1RILA 4OGCA 4DTPA 1SL0A 1L3VA 4WYWA 1VSJA 4LSLB 4DFMA 4LSNA 4IH6A 1RTJB 4NLOA 4J9KA 4UQGA 4OL8A 2D3UA 4ECYA 3K5NA 3AVNA 1W9HA 3VQ6A 3QESA 1LW0A 4LSLA 3AVKA 4O44A 4KHNA 4NCBA 4LSNB 3C6TB 4IRKA 3PX6A 3P1GA 3E51A 1N5YB 1HPZB 3M8SA 2BQUA 2FBYA 1TV6A 5KFIA 1RDRA 1VSLA 3BREA 2HHTA 4F4WA 1TL1A 4O3QA 4KHWA 3KLEB 3IN5A 2HNDB 2R2RA 1SH3A 4DEZA 2O4GA 1NK6A 3OYDA 4EBCA 1LV5A 3V81B 2FJWA 3PV8A 4DSEA 4QW9A 2BRLA 2VG5B 4F3TA 1RT4B 5KFVA 3CDWA 2CJQA 3KHLA 1JL1A 4NCGA 3FSIA 4FW2A 3NE6A 2R8HA 3LP1B 4RW7B 2AGQA 2KQ2A 1RT1B 1L3SA 1JLGB 3VQEA 2Y1IA 1VSDA 2AGOA 3KJVA 1CSJA 5F9NA 1RDCA 2JLEA 2BE2B 4I2QA 4LY7A 3JYTB 1QAIA 3D5MA 4CJUA 3BJYA 1S9FA 4HCBA 4NYZA 1RT2A 3HXMA 4DQSA 4DL5A 3MXMA 2HVHA 1QSLA 2XI3A 1EKEA 4YMEA 5C24A 2PZSA 2HHXA 1T03B 1SUQA 4DL2A 5D3GA 2JEIA 3OYCA 1BCMA 5DGBA 4CHYA 1QE1A 4KTQA 3L2UA 2G8KA 1RT5B 4HVJA 2X6SA 2WOMA 3KK2B 3QIOA 4JLHA 4XO0A 4ED1A 4Y2AA 4ECSA 1FKPA 3D28A 3QGGA 1RBSA 4IDKB 1ZTWA 2B5JB 5I42A 4FJNA 4ELVA 2F8SA 1Z4UA 2DFFA 4TY8A 4CJ5A 5FRNA 4ECTA 5J2MA 5KFEA 3H2LA 3AVMA 4PY5A 1XC9A 4W5OA 3D0PA 3M8QA 2HHSA 2O4IA 2ZE2A 4DQIA 4CJFA 3KHGA 1J5OB 3CDEA 4ZPAA 4XPCA 4J9PA 3P5JA 1IH7A 3DMJB 2D7SA 5DLGA 1TK8A 1BCOA 1JLCB 3NGZA 5JUMA 3FRZA 4KREA 5KFTA 4K8XA 2YHAA 1TL3A 2ZE2B 1NJXA 1BIUA 1YVFA 1RDDA 4YFUA 1HMVB 2W9CB 1RYSA 1SV5B 4PUOB 2J6UA 2HHWA 1C0UA 3LP0B 1EXQA 3NBPB 2Z1IA 2E9TA 4BDZA 3FDSA 4DTOA 4CCHA 5KFGA 4B9NA 3KK1B 3MEEB 2HWIA 2E6LA 3T19A 3L3VA 2IBKA 5KFSA 4RU9A 2IM3A 4I9LA 4B9MA 1C0UB 4FJLA 1A5WA 5DG8A 1BI4B 1C1BA 1JL2A 3KK1A 1RNHA 5F8IA 4K4SA 4CK2A 2WONA 4YR2A 3QETA 5HRNA 4L8RB 1D5AA 5KFCA 4CJLA 3HHKA 3K5LA 1Q9YA 4DLGA 4MIAA 3RR7A 1CZBA 4M95A 3GIIA 5KFJA 2VG7B 3PW5A 4MK7A 4ECVA 1C1CB 5FROA 3V1OA 4ELUA 3CQ8A 5HROB 1TKTB 3GQCA 2RPIA 3NH1A 4TQSA 4NZ0A 5DQGA 5CY4A 1QSSA 5KGWA 4KB7A 4ED7A 1TAQA 4EZ6A 4H8KA 4W5NA 3GILA 4AHSA 5F8JA 3BQ1A 4QWEA 5CZ2A 4Y1DA 3DRPB 2EHGA 1LWEA 4NRUA 4CE9A 1KFSA 3IGVA 1J53A 5C42A 4X2BA 1VSEA 2D0BA 5KT3A 1NK7A 3FFIA 3SPZA 2BANB 3ITHB 4KKOA 3V4IB 4URQU 1HNVB 4CJKA 4FM1A 4O3NA 1YTUA 4CEAA 4NLSA 3A2FA 1JLQA 1T8EA 1T94A 3C6UA 2G8IA 5J2QB 5KFWA 5F8LA 4CF0A 4J9QA 4B9LA 1VSKA 4F4ZA 1KCFA 2RF2B 4ZMMA 4RUCA 4RUAA 4CGIA 2DTUA 4CFBA 2D0AA 3IAYA 1GX5A 2C22A 3ALYA 1S1WA 4TLRA 4ID5A 4ECQA 3AA2A 5KT6A 4FLYA 5J1EB 3CFPA 4ED8A 4PA1A 4E7KA 5KG2A 3E01B 3PW0A 1TL1B 4URSA 3EZUA 4CJPA 1A5XA 1NKEA 2ZQBA 4U6PA 3DOLA 5KFMA 3ZSZA 3VQQA 3KD5E 2ASDA 2C2DA 1FKOB 4Y1CA 4M45A 5J2PB 1B9FA 4FVMA 5I42B 4CGDA 5DQIA 3ZT4A 5DG7A 3O3HA 1CXUA 3ZT3A 1JLAA 2JEFA 3M8RA 4NYNA 1MU2A 4Q0BB 2WCXA 5L1JA 1S9EA 5I3UA 2IM2A 3JYTA 4YR3A 3B6OA 3S9HA 1RT7B 3KLIA 1RT2B 2GBZA 3OJSA 4RNOA 3GV8B 1JIHA 1S0OA 2JGUA 1TKXA 3IG1B 2UUTA 3BSAA 4O4GA 1S5JA 1S6PB 3OL8A 5HRSA 5D3GB 3G0ZA 4H4MA 2FJXA 2GC8A 4N76A 3KLIB 1RTJA 2B6AB 3KLFA 2E9RX 2FC0A 4B8AB 4CGJA 2Z1GA 3O3FA 1QE1B 5HP1A 3KK2A 1KLNA 2Y1JA 4C8NA 5EU7A 1DLOB 4PWDA 4IFVA 1FKPB 5KG7A 3TAQA 4GW6A 1GX6A 4YNQA 4W5RA 4KTWA 3KOAA 3OHBA 3HO1A 3BSCA 1RT6B 4LH4A 2WHOA 1C6VA 1J54A 4NCAA 1W25A 2LSNA 4KFBB 4M3UA 3KHRA 4CESA 3LANA 4Z4FA 2OZMA 1NHUA 5HBMA 4WE1B 3ASMA 3PHEA 4TSXA 2YNIA 4Y2CA 3OL7A 3I5BA 1GOBA 5SZTA 1J5OA 3ICLA 3N6MA 3OS2A 4ECXA 4IKAA 1CZ9A 1GOCA 4ICLA 1QTMA 3TAFA 2KFZA 5HROA 2D41A 2C28A 3DLKA 4FK4A 1TKTA 3KLHB 4KO0A 3NAEA 3HSTB 1JLGA 4AHTA 3DI6A 5L1KA 1KHWA 4ECZA 4CEQA 1K1SA 3QIDA 4FJ5A 4CF8A 1LAWA 1YVUA 1FK9B 2VG6B 4B08A 3NGYA 2B43A 3QERA 3OYGA 3CJ2A 1A5VA 4CFAA 3SPYA 4M3WA 3L3UA 3OL6A 3M8PA 3EY1A 4IKFA 1RAJA 4BE0A 2HW3A 1SUQB 4FM0A 4RW6A 4ZPBA 3CFOA 4F4KA 4ED2A 5JXSA 3OHAA 4XIUA 3SV4A 2IM0A 4Z4GA 2PYLA 4KTZA 4PQUA 4KHRA 2XWYA 2V4RA 1RTDB 3MECA 5KFPA 1LWCA 3SUOA 1XHZA 4RW6B 2R2UA 2IC3A 3OJUA 4KHMA 3DLBA 4ZP9A 2OA8A 4CERA 3VQ4A 1C2PA 4QCLA 1RTIB 4K4XA 3VA0A 4Y3CA 1HRHA 3L2VA 3SUPA 3OYNA 2B5JA 3DLEA 5DGAA 2JEGA 2P5GA 1MMLA 1Y97A 3EZ5A 3SUQA 4TY8B 2KFNA 2HNDA 3AA4A 3F9KA 2OPRB 4GC6A 1RBTA 1VSHA 1K1QA 2R8JA 3RMCA 3DLHA 3UQSA 2W8LA 4J9RA 2D0CA 2OPSA 2OPPA 1B9DA 1RT4A 2GIRA 4E7IA 2UUWA 3PY8A 3SCXA 3JSMB 5KFQA 1RTHA 4RNNA 3I5AA 4KV8B 3NFAA 1IKWB 2HVIA 2RDJA 4J9MA 4ZVGA 1LWEB 1ASWA 3V9WA 5J2NB 1SL1A 1JLCA 3AA3A 5FDLB 1FKOA 2YV0X 4I2QB 1D9DA 4N41A 3DDKA 1ASVA 1TVRA 3TAMB 2FLLA 3VQ7A 1N4LA 4QOZB 4HUGA 4EZ9A 1NK0A 1C0TB 2YNFB 3WNEA 1JLAB 4JRPA 5FDLA 1TGOA 4JUZA 4RW4B 3NGDA 4N56A 1NKCA 2HNYA 3KLVA 4LH5A 2AJQA 5KFZA 3AO5A 5F8GA 2BDPA 3OY9A 3KLGA 2IS3A 1KFDA 3I5CA 2OYQA 3IG1A 1O1WA 2WOMB 1BHLA 1S10A 5SWMA 3NH2A 4HHTA 3S3OA 1DTQB 2HNYB 4EYIB 1HQEA 4FM2A 5CZ1A 2IJFA 1ZBUA 1U04A 2WONB 4FZYA 1TQLA 2JC0A 2QE5A 1RCHA 3SV3A 1N5YA 3QEWA 1WSJA 2GUIA 1NJYA 4NLVA 2E9ZA 4DG1A 1TKZB 3EPGA 2XGPA 3CVKA 4N47A 4DU1A 4FS2A 4BWJA 1HQUA 3MXIA 1U47A 4B3OA 3OYFA 2D5RA 3G6XA 5KFNA 3MFIA 3OYJA 1S49A 4I9QA 4KAIA 4ZTJA 3OYMA 2BQ3A 2BQRA 4TY9A 3M9OB 4IG3B 2XY5A 1HYZA 1B92A 2FVPA 4DQRA 1ZBHA 1S1UA 4CEBA 3H5XA 2BGGA 2G8WA 3CYMA 4JV1A 3O3GA 3PX4A 1EETB 3CJ3A 3CG7A 1VSIA 1I3AA 2XRIA 4MK9A 3G10A 2QKKA 3DM2A 5KFDA 4NLPA 4O44B 4NLRA 4DL6A 3HPHA 4B9TA 4OJRA 1JLQB 1ZBIA
chains in the Genus database with same CATH superfamily
2WTFA 5E3QA 3VGLA 1UEUA 2HK2A 4JHDB 2UXDK 2IA6A 4BACA 2VJUA 5LSOA 1NZ8A 3RB4A 1K8AO 4ILMA 1N6QB 2ZM6J 4NXNK 4DL7A 2F4VJ 2Z0GA 3IR6B 3KJNB 3M05A 4QYRA 4JS4A 2QXFA 4B1UB 1HBUA 2E7VA 1TKDA 1H2TZ 4IO9Q 3MPUB 1TR0A 1NMNA 3OXLA 1YJWS 3CCMN 5AQVA 3FUYA 3W9IA 1RFQA 4K59A 3CETA 3MEDA 4J2BA 1QQCA 1ATSA 4FBUA 2BBEA 1VCTA 4HUFA 1BOTO 3KXDA 3Q8PB 2YX7A 3VQPA 4ZIVA 5CQGA 5BPNA 4UQTA 2ZHAA 1NGFA 3OYHA 3MM6A 1EWRA 1FHTA 3D6FB 3J80O 3JSMA 2B9XA 1RAEB 5KFRA 3N0VA 4F4XA 1FDNA 1EB0A 3N28A 2HEKA 4PUOA 5HI7A 3EZWA 4JI5F 2AJ2A 1S6PA 4LF6K 2VPYB 3IM9A 1XWLA 3T6BA 1NGHA 2QW9A 1HNWJ 5DDOC 3LOUA 4FJMA 2MKCA 1FESA 1R6YA 3RSEB 2W4PA 5A6PA 3FQKA 1YT3A 3ZTQA 1TAUA 3I8DA 2CPXA 1RAOA 3PR5B 4J9NA 1EQMA 3ZSRA 2IDEA 2ADCA 4KGVB 1FEHA 2KB2A 3IS9B 1WWHA 1WKLA 2ALZA 3WXKA 1HPMA 1NK4A 1EP4A 3TZYA 3QSIA 1Q86T 1VQON 3F73A 5AXKA 1HJRA 2X74A 4Y6IA 2UZAA 4UY85 4Y28C 2H51B 2ZD1A 4CM2A 5JVGL 4E1NA 2DO0A 3M6VA 2O1PA 1RQ0A 5B08A 3PSIA 3SXLA 3DWLA 1KKHA 3CCUS 2QFJA 2FJBB 3MCOA 2C2MB 3PUFA 4A61A 3U3GA 4C9DA 1RDUA 3OT9A 2ZH7A 5DQHA 4HUEA 3A5NC 4FLTA 3DOKB 1UVKA 4J7CA 2H65B 1RHMB 4CO0A 3CEDA 3CXCR 2EVZA 2K3IA 3NGRA 1W0HA 4PZVA 1JXBA 1GTEA 3FZBA 4B02A 1VSMA 2PO4A 4K42A 2P9KB 1SQFA 3DOKA 2A1BA 2RD5C 3DXMA 4AM7A 1K47A 4NLTA 4B9SA 4ID5B 2QTDA 4G6VB 3N01A 3V81A 4UOFA 2MLZA 2A1SA 2ALYB 1FD8A 5HLFB 3F9MA 5AQYA 4FKYA 2NXCA 3W2VB 2VWKA 2Z2ZA 2IBOA 3A8IA 3H1VX 4BR0A 1YAGA 2E4LA 3MR5A 3THYA 5C42B 1DT9A 3NGIA 2EK6A 3OUYA 1NMEB 2FHMA 3QZ7A 2ZJPL 3VMFB 4J2DA 1WKJA 5CCLA 3PJ9A 4DR1F 3PCOB 2F8MA 3R6MA 1RAFB 1S1VA 1T9TA 3T5HA 3MURP 4ZVQB 2HNZB 1ZYQA 3O4QA 1UCNA 1Q1KA 3ZETA 5AQNA 1HNIB 3BB5A 1GLLO 4J2AA 3M6XA 1S0VA 4JI1K 1X0FA 4NZ7A 1HBMB 1S1WB 5E2QA 4NZ6A 4JRQA 2XI2A 4NL5A 4H4MB 4I7FA 1YJRA 5HMYA 4MH8A 5CH7B 3ENQA 1HI1A 1NGEA 4I6WA 1N0VC 1WN7A 4LFCK 3K9KA 2DPNA 3CB4A 3I9V9 4A48A 1RBRA 1WSRA 3HM9A 4FDFA 4KI4A 4C8ZA 3QIPA 5KFXA 3CPEA 4C0BA 2F9DA 3ZNUA 2J76E 1S5ZA 3C19A 5M2RA 2UVRA 4JI2F 3AVBA 1X4CA 4FOEA 3L8BA 2EG1A 3UR0A 4ZPWR 4HHUA 4KV8A 1JJ4A 5B0GA 1N5VA 4A5AA 5EN1A 5JS2A 3UKRA 1OH7A 5M1QA 3WNFA 3CCWA 1K6YA 4OFZA 4MYUA 4K4VA 1P6TA 1D0EA 1IM6A 2X1AA 5B0CA 3M8YA 5LT5A 1XEZA 4M41A 2DO4A 2VG6A 3UKRB 2WB4A 3OW2R 4CRJA 3Q8QB 3R6LB 4DF4A 3K57A 3K58A 2PI5A 5CAAA 3EM1A 4IRCA 2V51B 3C94A 3R9PA 3KG0A 2JJ4D 2GA7A 3LP0A 3RWUA 4H0XB 3G87A 1S48A 5CXTA 4WZQA 4F2RA 3HPGA 1NRKA 4R5PB 1WG1A 2W40A 3MMCA 4CJ4A 1UAXA 4OO1J 5BYSA 3K8VA 3HD2A 5A2QO 3DI6B 4DR7K 3H5SA 1IWGA 1NJWA 1X5PA 3V5RA 1TUWA 3CIZA 3TW0A 4HR2A 4QW8A 4OLPA 3DAWA 5KFKA 2QXLA 5IV4A 1BL3A 3M7VA 2OPQB 1N34J 3G8TA 5K8NA 4DKWA 4K8RA 1Z1ZA 3DRXA 3PJWA 1RDAA 3BO3A 1VQ8N 5ETKA 3Q7BA 2I2YA 1J9AA 2XCPA 3ID8A 3MMJA 2FY8A 4I68A 3HYFA 3VAKA 1BQNA 4HLBA 3TJ9A 3M1VB 3QEXA 3RMAA 2LU1A 4GNIA 3JTNA 2OGUA 1S6QB 2NRXA 1UZDA 3CCJN 2WVCA 4M5IA 4HH0A 3JAMO 4CH7A 4JHDA 2I0XA 5LJWA 3AV9A 4DR6J 3PO4A 4NA1A 4CI0B 3CIPA 3D9BA 2ZEJA 3D0IE 3BDEA 3O9RA 3C6TA 1FFWB 1S6QA 2CQ1A 3SFUA 3HFZB 6AT1B 3SMSA 1RHUB 1N36K 1EO1A 3LALA 2ZJQL 2WZ1A 2FF6A 3ZSWA 2CQ2A 1W2IA 3V9ZA 2DGTA 4JI3J 1S1XB 4DZ6A 3HHNB 4OYZA 2BJ3A 1VQ7N 4G1QB 4CEEA 2OFGX 3FLCO 2HKEA 1I94K 2ZC4A 2HMPA 4IOCQ 2AZ3A 4IDKA 2RRBA 1WOOA 3J81U 3M32B 4DV5K 2J8AA 4C8MA 4ED3A 4DV3J 3GLJA 1VAZA 1RT7A 5C2GA 4FPBA 1EJ7L 5J2PA 3LPYA 5HN0A 3Q24A 4U8VA 3PNIA 2NR0A 3UVJB 4A8OA 2O8CA 1RWOB 2WRMA 4JI8K 3NVKA 3HM8A 4QWDA 1JCGA 2JRSA 2XGQA 3ZX3A 4BRAA 2YWEA 1S0NA 2OJ3A 2OD4A 3WQUA 3ILIA 3D2EA 1RBVA 4QYZK 5LXYA 4ZIWA 3CJBA 3J81j 2M7SA 5KFYA 1BWFO 3IMXA 2JLGA 2W2PP 3AGRA 3VGKA 3FZHA 3ET6A 1R0AA 5BJRA 4KRFA 1CULB 4GKKK 3G82B 1NWKA 2DHAA 2AEMA 4Q5VA 4PWUA 4FJ9A 1UZHA 2BR0A 1EQ0A 4LRCA 2DRDA 5EXWA 3M9MB 1GT8A 1TMJA 4D3HA 2MEWA 2BE9B 3KKRA 2R7XA 3QT8A 1Y3KA 3ZNJ1 4P2XA 2J8SA 2KT2A 5AQHA 1Q8LA 3OTBA 1VFJA 4LFAK 4X4TA 4RO0A 3W1YC 2MMYA 4M7XA 2FJVA 4I6AA 4JS5A 4IJAA 3IWLA 2YNIB 2JHEA 3W8PA 4M5JA 4QWCA 4JAXA 4WZMA 2PFFB 4CHPA 3QINA 1JMTA 4BR7A 5EHHA 2CQCA 3JTOA 4KHYA 4QS7A 4CO2A 2FBXA 4CECA 4O8UA 1YWXA 1K0VA 2APOA 4DCPB 5KG3A 1FXXA 3L2WA 3UDCA 2MKKA 4ZP7A 3GYNA 2ASJA 4BRKA 1OH8A 1XI1A 2E5HA 2L41A 1RBLA 4H4OB 3BGFA 5EUHA 3PW4A 2X7IA 2IDOA 2Z2MA 3AA5X 2XMAA 2J9CA 4Z37A 1D4XA 4JV0A 3H8YA 4E7LA 1WDDA 1RK8A 3MD3A 4QJVA 3NS6A 4JYAJ 3I0RB 1HPZA 1MWQA 2NCKL 2GIFA 5HLFA 4URGA 4OKKA 2YWKA 2RB7A 1RWUA 4X62F 4E2FB 4TN2A 3VQBA 2YHBA 3PTWA 3I0RA 3G6YA 1FI4A 2YI1A 3A8YA 2P1JA 4OYWA 3QO9B 3FZLA 4X4QA 4RNFA 2ZUAA 4JBCA 3DLJA 2FZGB 4BRPA 1GOAA 5GADI 1BMQB 3EUNA 4I6YA 1PJ7A 3D6RA 3O5BA 3W9JA 1PILA 2N3OA 2J7KA 1QUVA 4L3KA 2Y9HA 1W7AA 3SCIE 1XNQK 2W7PA 3US5A 3TVYA 2VDIA 2UXCF 4QQBA 1X3NA 2MTLA 2V0NA 4AXIA 2DY9A 4MKAA 2CJXB 3C7NB 4JI1F 4D3GA 4UOGA 1GK8A 4NE9C 3G25A 2ZJPQ 3FZKA 5JLFA 4ISGA 2P9NB 3HSJA 2C2RA 2MKYA 1J2VA 4XH4A 4BR5A 3DXMB 1IKVB 1U45A 2GMJA 4K0KJ 2BVZA 3B6PA 4R8UA 2YVSA 3AY0A 2KRBA 2H3GX 5F41A 2UXBJ 3OVBA 1TV6B 1ZBFA 5DLFA 4B9UA 3A3PB 1IKVA 3CO0P 3CO9A 3G4SS 1XMOF 2MZTA 1VDHA 2ZOGA 5JS1A 3BGRA 2F9JA 4OPHA 2A0FB 3HHLC 2MQLA 5EWGA 1GFWB 4K41A 3ZX0A 2VYPA 2BX6A 4DTMA 4ZN3A 1ILYA 1HYVA 1YKWA 4OZ3A 4B3OB 2RHSB 2ZC3A 2V52B 1Q82O 1GLBG 2DNYA 3CJKB 2EC2A 3PKYA 4OQJA 3BBFA 2QA2A 3MXJA 4Z94A 1HNIA 1YVNA 1MMNA 3G2XA 2UXCJ 4DMZA 5KFHA 3RB3A 3CJKA 4B9VA 3HMJG 2DT9A 4WBFA 3T7ZA 4HACB 1TUYA 2BJ8A 2ZOMA 4FYWB 3OVNA 2P6SA 3ZT2A 3BO2A 1NGJA 1K73O 3IBWA 3ISZA 1ZAXA 4FXDA 1T44A 4P10A 2C2NA 1NDLA 4AHRA 3GJSB 1EX4A 2KLAA 4ZS6A 4R5PA 4AQYK 1FRJA 4PYDA 2ILZA 4FBTA 2W8KA 2LEPA 1SQKA 1L5UA 4AYBD 3PIOL 1QVFM 4OVLA 2YWWA 3EKSA 4B3RF 2DNRA 4OGEA 1XQSC 4W5TA 2X51A 2DGXA 2ZITA 1ZS6A 1L3UA 9ATCB 1J6ZA 4IO9L 4EYHB 4CJTA 4CIEA 2IRUA 3WQPA 5ETQA 3PEHA 2F96A 3DLEB 1RCOB 2MLXA 4CJSA 1GMVA 4XPEA 2CQIA 1OQ3A 4UZCA 5LL6d 1X5SA 3QFUA 4PQAA 4F4YA 1M5SA 3UN3A 4GKJJ 3PVXA 4O4RA 1SVDA 2Z1HA 3O80A 3EWGA 1IBLF 2Q6CA 2AX0A 5AJ3F 4K4WA 1UVJA 4EWTA 3MMAA 4FZVA 3FFIB 5B0AA 3OYIA 1MROB 4OJGA 4QU7A 5HJXA 3A8KA 3FBFA 5E33A 2IGIA 5AQFA 4JI0J 3CMAS 2KN4A 5AQZA 2WW4A 3BQ2A 2EX3A 5C2FA 3VEWA 4FJXA 1VMBA 2GJ2A 4LR9A 3L7OA 4WK1A 3AH6A 3C8YA 4FJIA 1N88A 1BGXT 3B4DA 2CG8A 2KM8C 2X78A 2A1RA 1HWKA 1T3OA 3QT7A 1NK5A 3C95A 5KQ8A 3QFPA 3EX7B 2B9WA 4ETXA 1S59A 5GMDA 2AT1B 3E9LA 5LM7E 1E4GT 4ERDA 1RAAB 4DPWA 2CQPA 2DXEA 1REVA 1W7WA 2G0IA 2V50A 4YOUA 1UVIA 1RHJB 3PW2A 3P5BP 1IXKA 4LQ9A 2XMMA 1HD1A 3K59A 3H42A 2FHOB 1NH7A 1I94F 1REGX 3ZZPA 1X5OA 4M3XA 4NI2B 1E4FT 2J4RA 2VPXB 4F50A 4DSKA 3H5UA 2CDRB 2EG2A 1L3KA 3OQ2A 4U7UD 3ZEUB 2QIFA 1C0TA 2YNFA 2ASLA 1NOZA 4FNHA 1NO8A 1RILA 4DTPA 3TUJC 4LSLB 3M1VA 1UL3A 4IH6A 2G2ZA 1RTJB 4NLBA 1TYQB 4OL8A 2QMXA 2E1CA 3OBIA 3K5NA 3HOSA 4LSLA 3AVKA 4O44A 4NCBA 3C6TB 4P74A 3GSDA 1V4SA 5DZ6A 3RVCA 3TTDA 2FBYA 2NSCA 3W60A 5L46A 1VSLA 3UR3C 2CUYA 4QU6A 3EGZA 4DEZA 2O4GA 3OYDA 4EBCA 1DHMA 1LV5A 4HI2A 2FJWA 3TZXA 4JI3F 1S7IA 1RSCA 2XM3A 2N7YA 4LRFA 2VG5B 3I96A 5KFVA 5T7LA 3CDWA 5D4OA 5JJBA 2D9PA 2O67A 2R8HA 3UI3A 1BWEA 1IN0A 1T02A 2AGQA 2VQFK 2QA4G 1JLGB 3VEVA 1VSDA 2MQPA 3KJVA 2XMKA 3DDIA 1CSJA 4MTPA 2ATCB 2CPJA 1RDCA 5BR9A 4LY7A 1CQMA 1QAIA 3D5MA 4NYZA 3FBCA 3HXMA 2V6AA 4DQSA 3MXMA 4X65K 1SI9A 1MN9A 1QSLA 3A5MC 3V2UC 3WXLA 2PZSA 2HHXA 1SJ1A 1SUQA 4ZJQA 1S22A 3BV8A 2JEIA 2GEMA 2CQ0A 3C15B 2QMWA 1YJUA 3WXMB 2WOMA 4JKFA 1JNZB 1MDUB 3QIOA 1DQ9A 2KKHA 4XO0A 3WC0A 4KJIA 2W4CA 1FKPA 3QGGA 1RAIB 1UW9A 2CJAA 4HL9A 3KZBA 2W7AA 1NMDA 4A2AA 3CC4S 5FRNA 5A8KA 4WCEL 4OX8A 4ECTA 1U25A 4P2SA 4PY5A 3TYTA 2WVDA 5D6GA 4DQIA 3CXCM 3KHGA 1J5OB 3Q2SC 5A8KB 4I56A 3AQPA 1BCOA 2VU5A 1F3VA 2N7CA 1OIAA 1Y5LB 3FRZA 4K8XA 1NJXA 2YHAA 1RDDA 4CM0A 3TVZA 2VJVA 5E3CA 4YFUA 1SV5B 1WTFA 2DXDA 3X3UA 4YHHK 3M30A 2JSXA 5BN9A 4JI4J 4DX7A 3WEEA 1B99A 3FDSA 2H5EA 4DTOA 5D8HB 1TL4A 3MEEB 3Q2TC 3C0BA 5KFSA 4B1WB 3MM7B 4I9LA 1LOUA 1KOOA 1A5WA 3MDFA 2GGPB 2YPZA 1HWIA 5HVGA 2DK2A 3TR5A 5JMNA 3MM7A 3QETA 5E7OB 4BQLA 3W61A 4A8WA 1D5AA 1FERA 1R7IA 3K5LA 4CO5A 4KH6A 1Q9YA 3RR7A 1FWLA 1CZBA 5GAHP 3GIIA 5KFJA 2VG7B 3CNQP 4P6QA 2HQFA 4LF9J 4UUXA 3TEHB 5TKYA 4OI6A 5FROA 1BD6A 4DR7F 2UUCF 2KHOA 2HVDA 4NZ0A 2DNLA 1PYOB 4ED7A 4H8KA 3GILA 3P96A 2VKRA 3BQ1A 4KIAA 2HRUA 2KH9A 1MG7A 3SBTA 3FEYB 1N8RT 1RP5A 4J9UE 1YGYA 5GAHI 1SJ4P 5AE3A 2VH7A 3O6QA 4PWWA 5C42A 2D0BA 5KT3A 4B1VA 5TKWA 3OUYB 1NK7A 3SPZA 4FPAA 3V4IB 4URQU 1HNVB 2LXIA 5IWAF 4H5TA 2VCPA 1SJFA 1RZMA 3A2FA 1JLQA 1T94A 4NEZA 4UZBA 2CNOB 4CF0A 4J9QA 4B9LA 2ZH9A 3SMPA 2O8BB 4XDDA 1C0FA 4RUCA 4C3KA 1SC4B 3DN9A 2H54B 1RWPB 4EU0A 1S1WA 3BZQA 1TELA 1Q53A 3SQOP 2CGLA 1S12A 3CJCA 4DDFA 4K0KF 2K06A 4E7KA 2EPIA 4LF9K 3W66A 4URSA 1NLKL 1RWMB 1YX2A 2RILA 3DOLA 2Y3YA 4K43A 3KD5E 1F5CA 2ASDA 4NMXA 3DOMA 4Y1CA 3I55N 2RS2A 3LL3A 4CGDA 1OH5A 1IJJA 3O3HA 1YBAA 1UVMA 3ATUA 2B9YA 3D2WA 3NG8A 3AB2B 2GHVC 4EFHA 1S9EA 4YS2A 5I3UA 1W2BR 3WXJA 3J81Y 3GE9A 4JKHA 1JIHA 2O66A 5F0XA 4RKUC 1OO0B 3NGTA 3OL8A 5HRSA 3G0ZA 3PYEA 4JD2B 2ZZNA 2IVPA 4M63A 1UETA 3KK2A 1H73A 5EU7A 2NQPA 1DLOB 1FO1A 2FYXA 5KAKA 5DJBA 2LXFA 4LBIA 3RU0A 4WQ5A 3R5BA 4IFVA 1FRHA 4GW6A 1U1MA 1DQ8A 3OHBA 2J0QD 4USUA 3DGVA 4LH4A 4NCAA 3RW7A 4C8YA 3KHRA 2E20A 2GCFA 1WBBA 5DDPC 3OPKA 1NHUA 3CCES 5HBMA 3E8OA 4ISEA 4KGMA 1LFWA 3DXKB 3ICLA 3O2IA 1GOCA 4WP3A 2QC3A 2KFZA 3L0QA 2G1HA 1CJKA 3GFZA 2D41A 3DLKA 3R1LA 4KO0A 1SJRA 2XLKA 4AHTA 3DXKA 2WC9A 3DI6A 5L1KA 1NAQA 1HJOA 2C3MA 5GAGP 5D0HA 2M5YA 1FK9B 2ZJRL 4B08A 4X65J 3P38A 3IWNC 3CJ2A 3UDVA 1NBWA 2QA4S 4K7QA 2YH0A 3OA9A 3QMQA 3MM5B 5M1OA 2DNOA 3L3UA 3CCVN 5HMWA 3EY1A 1RAJA 2AA4A 4BE0A 2IVOA 2LKZA 4RW6A 4ZPBA 4F4KA 3CFOA 3IBCB 3VAFA 2QL9B 4HTLA 3CCQS 3R5DA 1X0PA 4PQUA 4DCJB 4CLYA 2V4RA 1RTDB 3MECA 3N4WA 2VGMA 2YJEA 1NSKL 3SUOA 2QX0A 4MLHA 3VEOA 4RW6B 4X62J 1TU0B 1E6YB 3B54A 3DLBA 4FO0A 1RTIB 1YZ7A 5CZVA 4Y3CA 1HRHA 4ZVTB 3OYNA 5A2QY 4ALZA 3CD0A 1MMLA 2DJWA 1ZZNA 5M1PA 5DM7L 3F9KA 2HFZA 4GC6A 3R6GB 3HRGA 1VSHA 2R8JA 3UQSA 3JSRA 3W2WB 2OPSA 3C6AA 3NGKA 1B9DA 2UUWA 2IIHA 3JSMB 5KFQA 3AT1B 4RNNA 1IKWB 1QLNA 3GOIA 5J2NB 3W2WA 3U7JA 5IT0A 1FKOA 1F3FA 2DCLA 1T9UA 4FSVA 1NPKA 1SXLA 4ZCLA 3M32A 1SJ3P 2FLLA 3K8WA 1X4DA 1N4LA 1YJ9N 4QOZB 4HUGA 3ZEUA 4PG4A 1B70B 1C0TB 2YNFB 3RSEA 2KI2A 4GVEA 1VK8A 1FX4A 4U9RA 1TGOA 1NKCA 2R9LA 2HNYA 2KHCA 4LH5A 1FJ7A 4TU7A 3AJDA 1RLCL 3ZXWA 3C15A 3SAGA 3OY9A 2NXEA 1KFDA 1KAZA 3IG1A 1O1WA 2WOMB 2B7CB 3LGMA 1DTQB 2HNYB 3OTDA 1HQEA 4FM2A 5CZ1A 1BDGA 1ZBUA 1NB2A 4MLEA 2FJDB 2QE5A 3G9CA 2L9WA 1WSJA 1YF5L 4DG1A 3M8WA 1IBCB 1U6BA 2VL1A 3CVKA 4OZJA 4FS2A 1YJNS 1I1GA 3MN9A 4ENOA 5M1FA 3ZC4A 2ZBCA 2B51A 4C1NI 5G0RB 1HBNA 3OYFA 5H9FJ 3TNVA 4X84A 3BN4A 4YOEA 3LM2A 4X4PA 2A5XA 2XY5A 4IWVA 4EFAC 2D3O1 1F2GA 2FVPA 2QGFB 3D4JA 3I9ZA 4M5GA 4MT1A 5HQ8A 1RU1A 3H5XA 2BGGA 3R5CA 4H4KC 3CYMA 2ZVSA 2PD1A 3O3GA 3PX4A 1A0OB 3CG7A 1VSIA 2LECA 2QKKA 2XMVA 2HSTA 2FGCA 2VD3A 4EHUA 4B9TA 4FWLA 3VQEA 2KZZA 4WXWA 4X65F 4BRMA 4DTSA 2YQ3A 1TL5A 1RAGB 1AFJA 3A13A 3Q22A 4GKJK 1JB0C 5AFUA 2W6KA 4USHA 3MEGB 3PFEA 4FNIA 2QLWA 3AXKA 2E1MC 2I7NA 3CQXA 1C0GA 2F9WA 3MM9B 3P8BB 3GBTA 2YHXA 1SC1B 1SKWA 3HSGA 4TQRA 3AVHA 4R25A 2XS5A 5IV3A 3MMBB 3FNNA 4FWMA 3VGSA 1LWCB 1WAFA 3VQAA 5JICA 1TUUA 1U26A 2QLXA 4WF9L 2GJIA 3QFWA 1U2VB 2E6MA 2BE2A 2XQCA 2KKZA 2EWSA 4KT0C 2W2QP 1HBMA 2E5IA 2YH1A 2OKQA 3AODA 2K1RA 1QTNB 2RUSA 5IQQA 5M2UA 4FJKA 4CJRA 3QNOA 1S76D 1WJ9A 2HWHA 3ENOA 3WEEB 1BQMA 1N56A 4C8LA 1R59O 3ZSYA 4F3QA 4NYFA 4MO4A 4J9SA 1X9SA 2YX1A 3UE5A 2P9LB 4BRHA 2IM1A 1Y9OA 3MMVA 3AO1A 4BE2A 2Y1RI 3OYLA 4RW4A 4J90A 4DSIA 2QLBB 4DPOA 5K14A 3CJQA 4OZ0A 4DPYA 4YHHJ 4CHOA 3I0SB 4OYMA 4DV6K 4M5LA 2AWZA 4CLTA 3JB9k 3TQ1A 3RMBA 3IDHA 3MR7A 4RW8B 4BR4A 1IKYB 3DMJA 5ETTA 2OPRA 5DO2A 1Q81O 4O0JA 4C2MA 4U7CA 3K0JA 4IFEA 5LMUK 4R8UB 2H9ZA 1HI8A 3CCLN 4ILHA 4U96A 2PE8A 1TP7A 3R97A 3MF5A 3DDNA 1HKGA 1D3WA 1WSEA 2GHWA 2EBEA 4IEIA 4OHVA 4ZPTR 2MZJA 2XYPB 2PEHA 2GJFA 1NJIT 2ETJA 3FR0A 3LWMA 2PMHA 2VA3A 4EHTA 3AVCA 2BKNA 3BGLA 5GMKa 5CHCB 4NLCA 1Y7PA 4E0DA 3VR1A 1UTAA 2GZOA 1QAJA 1BIZA 3H59A 3MOZA 2PY5A 2YWHA 1XC3A 2HB5A 3HP9A 3KDOA 4R0EA 3EVOA 3NOGA 3MR2A 3H4DA 3W64A 1FXLA 4H5NA 2A2DA 3THVA 2V8PA 4V19X 4PG5A 1NK8A 3I4PA 3QEPA 1KTQA 4V19S 4QIWD 2MKIA 2N4CA 2HQ3A 2PMZD 3A8JA 4DCOB 3GPAA 3J7ZT 1M1GA 3EGVA 1D1UA 1VGYA 1WD6A 4DU8A 3A5LC 2ILYA 2HS0A 4DV3F 4OYPA 1RT1A 1JXEA 1Z05A 2VV5A 3D7SB 4JI6J 3WIVA 4IR1A 4I2PB 4DV0F 5AQGA 3TOQA 2BANA 1PAUB 4CLUA 4DR4F 3KYLA 5FD1A 5KG6A 3AJ1A 4OX9K 2BE7D 3T1YJ 2QFIA 1ASUA 4O8KA 3BO4A 3IO1A 4CEZA 1S77D 4FVCA 2ZWPA 2W9AA 1RGIA 1OWXA 1JLBB 1PYTA 2CNKB 3TSQA 2VC0A 5AXLA 3BKFA 2ERRA 3MM8B 4DR4J 5DK5A 4AQYF 4ZN1A 1YRUA 4NLWA 1UWAA 3SI8A 2O8EB 1U1KA 3HFKA 4IBNA 1HKBA 2UYTA 1X9MA 4WFBL 2IJNA 5D4LA 3T5KA 1XN9A 4C8KA 3E01A 4JD2A 3SQ0A 1Q79A 1RTDA 2B4PA 5HVHA 4FS1A 1DLOA 3TVKA 1IM4A 3NRBA 4HTJA 5HRPA 4USJC 3LO3A 1KC8T 3OTEA 3AVIA 3OW2M 1N34F 3HBTA 2NRRA 5HRRA 3V6DB 1F2HA 3PEJA 2UU9J 2HK3A 2FJAB 4DR2F 2ZF5O 1CC7A 1XERA 3T5JA 2CADA 4XEIA 4GKKJ 1I3OB 1TK0A 4WP9A 3FGVA 1TKXB 5HJYA 3FRYA 5T7BA 2Z57B 1J5EK 1REVB 5IT9Y 2B8QA 2I38A 4KO0B 3L4QA 1B7YB 3OFHA 3ZFVA 4TXSA 5CYMB 5ELZA 1VBKA 4ZVRB 2HS3A 3PZPA 2XLJA 1FK9A 1VIOA 2O8FB 5I3PA 3VAJA 3HZEA 1LK7A 1FJGJ 2AW0A 5EWFA 1JJ2R 1C1BB 3EVWA 2GFFA 1U6ZA 4LT6A 1OPZA 4CEFA 3CT9A 1GH8A 4DR5J 1F9EB 2QEXN 2YCHA 2YHYA 2AYGA 4PQUB 1WC4A 3PDNA 4FP9A 4C97A 2YQ0A 4CW7B 4RL1A 4RU2A 4M3ZA 4U95A 3VN5A 1UPMB 2E8AA 2QJ3A 4M94A 1E6YA 3DCAA 4IQMA 4K5RA 4YHHF 4DG1B 5AQTA 2DGOA 1LAVA 2QSWA 4LMZA 2KXNB 3TUPA 3G4SN 1ACMB 4O5BA 3WNHA 5G0RA 4ZP8A 4ES3A 2IRXA 4Q45A 4B3SJ 4U7BA 3DLLL 4ZVSB 2OTLS 2F4VF 4H0YB 4WFAL 2OPSB 3CC7S 1VHIA 1VK0A 1FWPA 2W9BB 3RB6A 5L1IA 1AB8A 1CEZA 1T6CA 5EVZA 1RHKB 4IOAL 3DU5A 5EX3A 2WBMA 3TO8A 4OX9F 3W7BA 4H4OA 3TJ8A 2Z30B 3JAMU 2NYIA 2XSJB 2IYIA 4AQYJ 2DXFA 2BH1A 3WBZA 2HHUA 4DV4F 2PFDA 4RZRA 1SBRA 5AXNA 5KG5A 3CJ0A 3AVFA 5CE3A 1VSFA 2AJ4A 3IGNA 4WFXA 4FVUA 4CZHA 2P9KA 2E44A 5GINA 2LMIA 3G86A 1ZA1B 2HF4A 3TSPA 5KT5A 1U2FA 3SQ1A 5GAEU 4LFBJ 3VENA 4NWBA 2C2ZB 4DFPA 1HQEB 1H38A 5BPLA 1L3TA 3CM5A 4DV2F 2PYJA 3QDKA 3H08A 2XNRA 2EKYA 3QJPA 1WDTA 4G9ZA 1IBKF 2CWXA 2VFUA 3C66A 4CF1A 4CK3A 3LPTA 3TA2A 5C2CA 1RE1B 3U8XA 4K5SA 4WFNL 2Q3SA 3UNYA 2XY6A 2XG8A 2HBJA 2E1YA 5KTQA 1S3XA 2OAUA 2MLYA 3M3ZA 2YJFA 1ZPVA 1ESVA 4DTXA 1ZBLA 3TI0A 4TU9A 2HNZA 4O4GB 1KNZA 3AVGA 1EZZB 2UXBK 3CI5A 2UVVA 1RI7A 4JV5J 3L9ZA 1HNXK 2E7WA 2ASYA 2HSEB 5C24B 2Z58B 5BRDA 3WHIA 2BRKA 4DV6F 1NZAA 2XMTA 3EJMA 1XMQJ 3LDLA 4FW1A 1JJCB 2KZMA 3D67A 2P9SA 1RT6A 1IUJA 1DRZA 2P9LA 2D3ZA 5A0YA 2XY8A 4KAZA 1DBDA 2QM1A 4BRLA 5EOYA 1WOQA 3MR3A 1FRKA 4YORA 1GLCG 2J7UA 4DWIA 1RDBA 4PXDA 3NCPA 4Q44A 3QLHB 4KE5A 2DHXA 3A3NB 1XMQF 2GGPA 3KHHA 2GUPA 2RKIB 1SC3B 3J7AN 1S4EA 2BYCA 3H2UB 3O9QA 3NF9A 1IG9A 3BGUA 3CUNA 2A3ZA 2VG7A 2W2OP 4X66F 2H48B 2RKIA 4QPXA 1HNXJ 1KD1O 1Z26A 3H1QA 2YX6A 3KK3B 3LDSA 4CGFA 5F3ZA 3ZTPA 1FRMA 1KVBA 3CCQN 3IKMA 3KK3A 1NGAA 1RWWB 4BLGA 2E5LF 5E5NA 3PIPL 4HKQA 4HEA9 3BR8A 4ED0A 1TFWA 3VGVA 2X1BA 1IBKK 3OYAA 4LBPA 1YI2N 1KVJA 2RRAA 3G71N 4C6AA 3PM9A 3V4IA 3RAXA 3NWRA 1LW0B 3DLGA 3MEKA 1IBMF 3H40A 4AHUA 4OLBA 4LF8K 2V7YA 2I7PA 4S0MA 4DTRA 3QYYA 2ZKUA 1QUPA 1WF1A 4DFJA 4F3OA 2UUCK 3ULEB 1KR4A 2BXJA 3S3MA 1NUEA 3KLEA 1VQ7S 1Q9XA 4OKEA 5FLXO 3SAHA 2YKMA 2G8VA 2VOOA 1KVIA 1UOCA 3ZLJA 3M2RA 2ZHOA 4ILGB 1GXTA 2H5JB 2DNHA 4FK2A 4I2PA 1X8DA 1Q5YA 1QAXA 4RR5A 3T41A 2CAJA 2OPQA 4EBDA 2ZH4A 3ZSXA 4CJEA 2FSNA 2E2QA 4LR7A 3MDQA 2AEJA 5KRSA 2ZZTA 4CF9A 2OPPB 4BGAA 4IOBA 3VZIA 3N4QA 1Q8KA 2UUBF 4QAGA 4KKOB 4NASA 2OTJS 4JKBA 5AQUA 3NXZA 4I1TA 3OYEA 4JI2J 3KIOA 1VQSA 3AVAA 2ZM6F 1AZSB 2J0XA 1DGKN 4O0NA 3GYXB 3QNNA 2I5JB 2IMWP 3CSKA 4Y34A 1RA6A 3HZGA 3O1BA 4W5QA 3P5TL 3QSYB 4DR2K 2XULA 3SI6A 3TA1A 3QGHA 3N9UC 2DR5A 4FYDA 4LF7J 4KH4A 1QD1A 2XHCA 2KVIA 4P2MA 1EHWA 4Z4IA 1X7VA 4K4ZA 1RT5A 2E2PA 3D2FA 5I3QA 4FPRA 1NSQA 4EP4A 3G8QA 4WU3A 2YPYA 4OZNA 4Q43A 3R2CJ 2B56A 1GMUA 1HQUB 4FCYA 1NGIA 4AL5A 3GIMA 1WAJA 4ECRA 2HMIB 3VTHA 2H1YA 3O08A 2J6SA 3ZTOA 4DQPA 4X64K 2BMBA 4ILLA 2IJRA 2Z2YB 4BRGA 1M5VC 2ZH6A 1XMOK 3FGUA 4WKRA 3I8BA 2CJBA 2Z56B 1M5KC 3B8AX 1I94J 3O6WA 3FSYA 2AIRB 3LP1A 1VK3A 4LF6J 3FE1A 2CJ9A 5CYMA 2W7OA 3KMSA 4JI3K 2CPIA 3TANA 4USMA 2O8FA 1WEYA 3ADAC 4DR2J 2CXEA 3SDEB 3MPWA 3AO4A 1P1LA 5KFOA 4IQXA 2QG9B 2AGPA 3NMRA 1BWVA 1DJ0A 3MN7A 4CK1A 1TTHB 2O8EA 2MKHA 4BRCA 4GV3A 3K2PA 1KQSM 2BEFA 2VFTA 2R7TA 1RBAA 3BBCA 1LOTB 1CVJA 1H7XA 1R6VA 3SEOA 4CO1A 4DLEA 3QT6A 1YHQN 3GWCA 5J1EA 1Q8IA 2Z1JA 3CD5A 4F7VA 3E9OA 4HDGA 3MPYA 2AU0A 5BRFA 2XY7A 2ASPA 1FVQA 3KHYA 3KJQB 1C1CA 3LZIA 2B4UA 5E0OA 5HO4A 1F6TA 4O3RA 4DX5A 4OMFG 2DGQA 2VPZB 1NOYA 2UVWA 3G8SA 1MN7A 1B4SA 5A2QU 5D0EA 2IOCA 3KWMA 1U8SA 3BKUA 3V1QA 2FVCA 2F63A 2W9BA 1SL2A 2ABYA 1YXQA 1DFDA 2VWJA 1K9MO 1S72S 1KBRA 2AJ1A 2G13A 4LF4J 4K25A 2FHJA 4OX9J 4ZVFA 2QI2A 2NZTA 2ZH1A 1XMBA 1IKWA 2FBTA 3ZO7A 5AQPA 4ETZA 2NRVA 1UWBB 2CWKA 3E9PA 1JLEA 4BDPA 3JXUA 3N79A 1NB7A 2M0GB 1DY3A 1CPZA 1EKSA 4FJ8A 1YUWA 1D8ZA 2K3KA 5LOQA 2FVQA 2A2CA 1UW4A 2RQKA 1NNDA 2HLTA 3VALA 5KT4A 1ZETA 3G71S 3RRGA 2DTJA 2P9CA 3HP6A 2QA4N 3GIKA 1KVCA 4DUTA 5BR8F 2R8GA 3VF4A 1ZTTA 2ZD1B 2NNWA 3A0IX 2PFUA 3OXGA 1VQ6S 4Y2MA 4DF8A 3QO9A 4E7HA 3MPDA 5LJ3Y 4FF1A 3UB5A 4F8RA 5GAEP 3LQVA 3QPIA 1XNRK 2DIVA 1WHVA 3BH6B 2VONA 4J9OA 1LK5A 1FJGF 4A4JA 5GADU 1NM1A 2DGUA 3KG1A 4I64A 3ENHA 2QT7A 5ADXH 1N33F 3KWGA 1GQEA 4CD1A 4BG9A 3MEEA 2HHQA 1A6LA 3GP9A 1BUPA 5K8OA 4CP5A 4ZPCA 3R27A 2DFEA 4Q7AA 4H5VA 2XBPA 5LMUF 1VSJA 1XJWB 4K2XA 2EFVA 4DFMA 1NJIO 4OYBA 2GTDA 2BJ7A 3LDOA 4ZPVR 4YB5A 2VFVA 5MLCQ 4TLQA 3QICA 4OJ1A 4ZJOA 2V2ZA 1YZ6A 3QESA 4JK9A 2OMLA 4JKGB 4KHNA 2OSQA 1P8ZA 1R89A 4BREA 1SIZA 3W5ZA 2HHHJ 3PX6A 4CLFA 1HHSA 1N5YB 1Q7LB 2QA1A 4KY3A 4JI1J 1UFWA 4OYIA 1TV6A 1H0HB 5KFIA 4JKGA 5GAGI 1IQZA 4CIOA 1R8HA 3IUCA 3BREA 3HJVA 2HHTA 3BY5A 3VERA 4DUYK 1TL1A 1FEEA 3IN5A 2R2RA 1NK6A 4UY8O 1HL6A 3CF5L 1JK9B 4FPIA 4QW9A 2BRLA 3FJ2A 3HZ6A 4F3TA 4USIA 2YHWA 3KUHA 2VB6A 1HD0A 3NE6A 4RW7B 2DNQA 2E1RA 3W5YA 3I56N 3AQOA 5F9NA 2BE2B 3KKFA 3JYTB 5AZJB 2BABA 4CJUA 1S9FA 4HCBA 1HKCA 1RT2A 1EKEA 3K2YA 4KQZA 1DZ5A 5C24A 3GE1A 1T03B 5AZJA 4DL2A 4BRNA 4FXVA 4CHYA 2B0GA 1N54B 1Z2LA 1M1KT 2Q79A 3ETOA 5MAOA 1WOSA 5LMNJ 4WIQA 3H7HB 4AL6A 1NEEA 3D28A 1UVNA 4OV6A 1YRXA 2GMLA 2CJYB 3U1NA 1ZTWA 1T6DA 1A7GE 2Q6BA 2C3PA 4BC9A 3R7BB 1RWVB 2ZH3A 2KXHA 2F8SA 3A4TA 4TY8A 2BJDA 4ED5A 2XTJP 3ZTSA 3CDBA 4YOWA 1M5OC 3AVMA 1XC9A 4W5OA 3D0PA 5CA5A 3CTRA 2O4IA 3FCWA 2ZE2A 3CDEA 1B0PA 4ZPAA 3P5JA 3DMJB 1O8BA 4DV2K 4Y2IA 1SC6A 3DGPA 1JLCB 3CF5Q 4NX9A 4CO4A 5JUMA 2OSRA 3HFVA 5KFTA 3QMLA 2ZE2B 1BIUA 3CCSS 3CC7N 2XEXA 2W9CB 1CG2A 1IBLJ 1ATNA 5LMNF 2CVIA 2HHWA 4A62A 3J7AP 1NU4A 3LP0B 1EXQA 3NBPB 2E9TA 1MWYA 4IO8A 3LA0A 5KFGA 2J5AA 3MZIA 2MHNA 4B9NA 1FJGK 2E6LA 2HWIA 3T19A 3QWUA 3L3VA 2IBKA 4RU9A 2IM3A 2KM8B 3VCDA 4X64F 3C6HA 3TTFA 2N82B 1BI4B 2ZGYA 1JL2A 3LUYA 4B3MJ 2WONA 4YR2A 4J37A 4TU8A 3OR1B 1FTCA 4QR2A 2VQEF 4DV1K 4CJLA 3RBZA 4DLGA 3D6MB 4M95A 3PW5A 2GVDB 4MK7A 5IQ6A 1KAXA 1YJNN 3OR1A 2VFRA 4QIVA 3GQCA 5ITHA 1ZM2A 2V68A 1VQMN 4KB7A 1TAQA 2L08A 4EZ6A 2PBDA 1NGCA 3BN7A 4OJHA 1RXOB 4AHSA 5F8JA 4NI2A 2W2MP 2V8GA 4Y1DA 4DHVA 1HBOA 2ZJRQ 2HZVA 4IYQA 1T9WA 2DNMA 1NHKL 1U0HA 1J53A 3W0LA 3O8MA 1WF2A 1X5TA 2CGJA 2BANB 1FD2A 4FWPA 4KKOA 4O3NA 4IOAQ 2ZM6K 2MQQA 4DR4K 2KG1A 4ZMMA 3MUMP 2LLZA 2IMOA 3HULA 1YTYA 2DTUA 1YI2S 2D0AA 3IAYA 1YJVA 3WDOA 4TLRA 4ECQA 1Y3JA 4DR6F 5J1EB 4FLYA 2E5LK 4ED8A 4PA1A 2MKSA 3IAS9 1GXLA 1NDKA 3K0SA 2EW9A 3E01B 2XYHB 3OTOK 3RZAA 4JI6K 1X31C 3CCRS 5C0YA 2GO9A 4BVOA 4WQ5C 2C2DA 1VQNS 3D7EO 1FKOB 5J2PB 3CCUN 1OY9A 4FVMA 3FBEA 5I42B 2YWGA 5DG7A 1ZBSA 3IA0A 1CXUA 2DRBA 4JK8A 3M8RA 3KNGA 4JK7A 3S6EA 2L48A 1QHAA 1SQGA 4N8OA 2WCXA 3F56A 5L1JA 4U7UK 3BS9A 1K8KB 2LVWA 2P2CB 2GBZA 2V5HG 4CJ7A 1TKXA 3IG1B 4C11A 1S6PB 2GC8A 1K8KA 4N76A 1RKIA 4OIXA 2QRRA 4B8AB 2M8HA 4CGJA 3B82A 1KLNA 2Y1JA 3F41A 1Q95G 3UD3P 1YIJS 5DM7Q 4NEYA 1KDNA 3MAAA 4FOIA 1FKPB 5KG7A 1GX6A 4YNQA 3VETA 4ZVPB 3KOAA 4F36A 1PBUA 4LVNP 4NYOA 2DNZA 1J27A 2MQOA 2GQCA 1W25A 4QIGA 1RDWX 4CESA 4A47A 1SS6A 2HHHK 4WE1B 1VLOA 1WG5A 2IVMA 3PHEA 2YNIA 4G1PA 4BY9C 3OL7A 4LREA 1J5OA 1B0VA 3L7PA 3N6MA 3RAMA 4ECXA 5BXIA 1C4AA 4ICLA 4B1XB 3TAFA 2DIUA 2VODA 1HHTP 2Q43A 5HROA 3J7Z5 1TKTA 3KLHB 2C3OA 1K1SA 4FJ5A 1ZM3A 3HI9A 3IR5B 5HOOA 3CCLS 2A6OA 3G6ES 2FHJD 1LAWA 3FZ2A 3NNHA 2J9DE 2VDHA 3ILOA 1OQ6A 2B43A 3QERA 1A9NB 3SPYA 2OELA 2YWFA 3O1LA 3M8PA 2E2NA 4IKFA 3ONQA 4QIEA 3NWGA 3OHAA 4XIUA 2AYBA 1FRLA 4LF6F 4KTZA 4LJMA 4KHRA 3SQGB 5A8WA 5KFPA 2MQ8A 4H5RA 1LWCA 1XHZA 2R2UA 4KHMA 2V8HA 1C2PA 4QCLA 1F60B 3VA0A 2DB1A 2HOEA 4PG6A 3L2VA 3SUPA 3EE8A 2B5JA 2COLA 5DGAA 4P52A 4RJVA 4LRBA 4NPOA 4DPTA 2P5GA 1M5HA 3CJTA 1N32F 3AA4A 3EXYA 1RBTA 3MCPA 1X4AA 2VASA 1K1QA 1V3SA 4PHTX 3RMCA 4YY3J 4X4UA 2RQMA 4J9RA 3CPWR 4CZCA 4RWXA 2V67A 2FSJA 3SCXA 2WUSA 1O51A 4J9MA 2ZBPA 4ZVGA 1GMWA 1ASWA 3V9WA 2P9GA 3AA3A 2VBZA 1UVLA 3U4LA 3VQ7A 3KFWX 5BRHA 1NK0A 3WNEA 1JLAB 2UUBK 4N77A 4GY2B 1SB6A 3PYDA 3A1YG 4JUZA 3LTOA 2ZZMA 4RW4B 4N56A 2V4JA 1VQ8S 2OEKA 1M1KO 3S41A 4IEEA 5LY3A 3CMES 3AO5A 1X4BA 5F8GA 2O8BA 4H4KA 3KLGA 2FZKB 2OYQA 3NY0A 3CC2N 3GIRA 3ZYYX 4XK8C 4USVA 2IJFA 4UT4A 4FZYA 1TQLA 1RCHA 3HSDA 2HQDA 3J80U 1N5YA 3QEWA 1NJYA 5J1PA 3TZZA 1LCUA 2B9EA 1KQKA 4OZLA 2R7SA 3EPGA 2ZGZA 1XTZA 4N47A 2RU3A 3QGPA 4BS2A 1NBEB 4B3OA 2NPIA 4Y00A 2A40A 2D5RA 4MDBA 5ETSA 5KFNA 3MFIA 2CNLB 1NGDA 3O4WA 1S49A 2RAQA 2N3LA 4KAIA 4P71A 4ZTJA 3OYMA 1U1NA 5KPRA 5FPEA 3M9OB 1VBYA 2Q97A 2X1GA 4DQRA 1ZBHA 2A42A 4CEBA 3HHEA 1RABB 4Z7YA 4Y0FA 1YK9A 2F4FA 1VBZA 3ENAA 1ZZFA 1J5EF 1I3AA 4MK9A 3DM2A 5KFDA 4NLPA 4NLRA 4CH1A 3HPHA 4OJRA 3VTIA 3GL1A 4L6V3 4YDDB 2P9PA 3GIJA 4YOVA 1Q5VA 1KXPA 4JNEA 3E1YA 2KTQA 4MFBA 4XTTA 3DM2B 5E3AA 4CT9A 3CCEN 2AQ4A 3W62A 4FLWA 2KO1A 1OS5A 3FZFA 1NU0A 3NH0A 3PSFA 1ZAVA 4F0HA 4TYBA 4K8ZA 4EP5A 2CRLA 1X60A 2YNHA 1I6JA 3L2QA 4L75A 1NKBA 2OTLN 4FZXC 3OR2A 3MTKA 4CFCA 3GJTB 3SQ2A 3WZ0A 2MGZB 3ZX2A 1LEOA 2FXUA 3WXIA 3ILJA 3PIOQ 1VQ6N 4LSZB 3QRPA 3QGIA 1XK8A 4NA3A 4LF7K 3BKTA 4RG8A 4U8YA 4OPAA 4CIFA 3L3CA 3DLKB 1HUXA 2MGZA 1HBOB 3HD1A 1BO5O 1MWZA 5CYJA 2F8TA 4DS5A 4X62K 3V9XA 1U0HB 2EFPA 3AVJA 2JEJA 3PW7A 4EUVA 1VBXA 4JI2K 2LYVA 1V3ZA 2VOPA 2F7TA 3F5TA 3HOTA 1RTHB 4USWA 2XZWA 1V9OA 2KU7A 3KKSA 2WVFA 4WFBQ 2FPHX 4CJVA 4KC5A 3OLBA 1UKUA 4NOHA 1BUXA 5DG9A 2A3JA 2ATLA 2HBRB 2QKBA 5K8PA 2NRHA 3TAMA 3ZZZA 1SQEA 5HP1B 2YNGA 2R8KA 1IR1A 1NLVA 3OYKA 2J7WA 1HKAA 2ROGA 2R2TA 1G4CA 2FUG9 3NDKA 4PWDB 4TKTA 3TAEA 1ZXOA 4ITSA 1Q18A 5IT9O 3JQKA 4HVZA 5ETRA 3MFHA 3LF0A 1N33K 1SKRA 3VEYA 6FD1A 5DS7A 4UY8T 2IIRA 3IWXA 2MJNA 2EC0A 5G4DA 4CJ3A 2OCEA 4G65A 5AJ3K 3TP2A 1NG9A 4H54A 1CZAN 3HL8A 1DTTA 3OTCA 5BR8K 4PAAA 2X3GA 3LZJA 2NSBA 5HATA 2HMIA 1EQYA 3BEGB 3TWHA 1IBKJ 2DH7A 3HSZA 5GIPA 3D45A 2UV8G 1OMSA 2A6MA 1KLMA 4ECWA 1HLUA 2K7JA 4BDYA 3VA3A 1LKZA 4W98A 4HYKA 2O8CB 2C2EA 4OLAA 4DL0C 2CGKA 4ZVOB 2DHHA 2LA4A 1H7WA 5D15A 2CQHA 3MX5A 4ID8A 3B6BA 2AD9A 1FE4A 3D2EB 4L74A 3S3NA 2ZUGA 4HH1A 2V9KA 3CMEN 3O4NA 3WX8A 2F3JA 5IFMA 3EEQA 1X9WA 5AR0A 1R0AB 2BUPA 5T14A 2E1ZA 1DTQA 3UIQA 1Y00A 4UF4A 3LM9A 4P2FA 4CBWA 1QQOA 4YDXA 2FBVA 2R2SA 1O0PA 3G82A 1T05B 4DTNA 5AQKA 4O55A 2YKNB 4DI6A 5F2RA 1U4BA 5T7LB 4IG0A 4NLYA 2R7OA 3Q89A 4O3OA 1P9QC 4M3TA 3CDAA 2KRRA 3G6VA 1NHVA 4Q8FA 3KJVB 4NXNF 3RRHA 4KB1A 4DV2J 2RUGA 1R8BA 1IV0A 1EAYC 3VVTA 4LFBF 4GC7A 4O3PA 2V7ZA 1VQMS 4DXLA 3J8AA 4X4NA 3BPDA 5KRTA 2L9NA 3AA8A 3I55S 3AOAA 3ZZYA 4O0IA 4HT5A 2P6TA 4C11B 1WSIA 4IH5A 4C3LA 2FIUA 3CC2S 3U27A 2BOPA 3P6YC 5ETLA 1CS4B 3DC2A 3AHPA 4JYAF 4KGZB 4CNYA 2KW4A 3MEGA 4QS9A 3RTVA 1K9MT 3TAGA 1UWBA 5L9XA 5FPMA 3FQLA 1U6FA 5T41A 3LAKA 4FLVA 2B8PA 1JLEB 5KT7A 3HDSA 1P90A 4MQ3A 4DV7J 5D77A 1O6XA 4ED6A 2O01C 3BYRA 4WFAQ 5C12A 1IR2A 2ZDPA 1LWFA 3M2VB 4IDHA 4WFNQ 3IRWP 3GG1A 2DHSA 5E41A 4NA2A 1I51B 1AUSL 3WNGA 1KHVA 2UXCK 5C5JA 3CIMA 5AQJA 5L39A 3M2VA 2X3DA 3V6KA 4ICLB 1XR7A 1YITN 3C65A 1BHNA 5D4PA 4IG3A 2BOAA 2M2BA 1KAYA 2Q1LA 2K1RB 3M30B 3T1AA 3W3DA 2AF6A 1K73T 1S1UB 2QWOA 5L38A 1Y0HA 4MDAA 1KP6A 1LXJA 3EDQB 2M8DB 4PKDB 3RUBL 4DUYJ 4BG8A 4IUFA 3T5LA 2W4DA 2OFHX 1WSGA 2QK9A 4Y2KA 5GVQA 2RMLA 1BQMB 5J1NA 1TL3B 1RAHB 4JI4K 3O9UA 2XMJA 4C48A 3NS5A 4ATNA 3QLHA 6FDRA 5KI6A 2JWKA 4KFBA 5K14B 5KG4A 4JI7J 4B3SK 1N6QA 2J0WA 3EE3A 2Q31A 1R3NA 3CJ7A 1RISA 4IH7A 1KQGB 2XMWA 3F0NA 2RDIA 5F8NA 3D6TB 3TAPA 3O44A 2V2KA 4P7TA 3TU5A 1WI8A 4USTA 3N4PA 1FVSA 3L09A 3VAGA 3Q8RB 2F1FA 3MAHA 3EXCX 1D9AA 4KPYA 4X4RA 2W42A 1VQNN 2DH9A 2GIQA 1JJ2M 5AXMA 2YTCA 3NNCA 1YJTA 4YR0A 1U24A 1WUUA 1HYSB 4ER8A 3ULHA 4NLXA 4DZDA 1CQNA 1WC5A 1HI0P 3RRKA 3KNAA 5KQDA 3TR8A 3GG0A 4JI5K 4P72A 3PIPQ 1VQ4N 4AHVA 2U1AA 2D1KA 4CF2A 1F0XA 4K2JA 3DLGB 2BA9A 5LL6Z 3CPWM 1J5EJ 2Y0BB 4M3YA 3PO5A 2MPUA 1RUSA 4X4OA 4ZDNA 4HACA 4DSLA 4PABA 2KJWA 3P4UB 2CG4A 3D1OA 5A76A 2A6AA 3CCVS 5HL7Q 3NF6A 4LIWA 3OBYA 5DM6L 2VQFJ 3M2RB 2WSCC 4DUZJ 2V2VA 5CZXA 1S9GA 4M3RA 4FJJA 5HQLA 1G15A 1Y4ZB 4OI2A 4IO1A 3IS9A 4KH1B 3W5XA 2HS4A 1K0TA 2BM0A 1F9HA 2J6TA 3GR0A 1UAWA 5D78A 1S9GB 4NMLA 1CJTA 2FD2A 1HW8A 1FDAA 2MB0B 4K50A 2ROPA 1OH6A 2MY8A 3ZT0A 3M5RA 2U2FA 5FIIA 2VIHA 1S1TA 1JLBA 1Q4RA 2ATQA 3SZ2A 3ZSOA 4BWMA 3NS7B 2DPIA 2G4BA 2UP1A 3SCKE 3AD7C 5EDWA 4RBVA 2OEMA 4RUHA 2YY3A 3CM6A 5K5MA 3D2FB 3VQSA 3R8YA 1ICEB 1LW2B 3BQ0A 2GO8A 2QV6A 4BRFA 4IFVB 4KB0A 3ISNC 2P9PB 3ENVA 2CPDA 4LIRA 4H0PA 2YNGB 3P45B 4KI6A 4DUZK 3NMAA 3UNGC 1LW2A 3NBPA 5FJ4A 1KD1T 5SUHA 3VQ9A 1VQ4S 1TUGB 4RNHA 1T7PA 2HIYA 3VV2B 3RBEA 2R7YA 5IC6B 3FC9A 3IRXB 2F65A 2FB0A 3SMZA 2XMUA 1BI4A 2C42A 5J2MB 2F8EX 1WTBA 2DR9A 4AH9A 4FK0A 4PKHA 3FCVA 3UO0A 4QYZJ 3R9LA 4AT1B 1FJCA 8ATCB 5BREA 2HQIA 1I39A 4BC2A 4KGKA 1SKSA 3UW1A 4C8OA 1GTHA 3MM5A 1S1VB 4YN3B 1NPPA 3GJQB 4HDHA 4UTGA 3MI7X 1UJ6A 2FY1A 3DRSB 3B78A 4JV2A 3JSYA 1LWXA 2C2OB 4R0JA 5KT2A 5B0EA 1R0CB 4JI0K 3BM7A 4WQ4C 2OD6A 4GO5X 4IOXA 1RTIA 1TL7B 2FJEB 5LMUJ 1SH0A 4YOTA 4FLUA 3KD1E 1JJHA 3VOVA 4CZJA 5D0RA 3AARA 1ROFA 1KWMA 1N36J 3BR9A 5AQSA 3QEVA 2GS8A 1RCXB 1VQ9S 4JKCA 2OEJA 3UCZP 2RVJA 2IC3B 4BGBA 4AD6A 4CZKA 2OMOA 2VPWB 2B3TB 3TSUA 3NGSA 2Q1NA 1MWKA 1IO2A 1RYRA 4X4SA 2VG5A 1VJWA 1U49A 1KQSR 2QLFB 5IWAK 3ETMA 3M4XA 4FJGA 4YOYA 1URNA 4IOCL 2DNGA 3V9UA 4CYUA 2GV9A 3CGIA 4M1KA 1RHRB 3UN5A 1KLMB 2ZWHA 2P51A 3NAHA 1XIQA 3B8HA 1KOHA 1HMVA 2MZRA 4M7YA 3I33A 3JS6A 2UUCJ 3ZSQA 4E7JA 2CQDA 1IVZA 3R2DJ 5A6WA 1HNXF 4WFYA 2Q0RA 2V9WA 2RF2A 2FLOA 4CLKA 4CHQA 2HHVA 3D6HB 3BF1A 4CBUA 1RA7A 3AO2A 2VUGA 4A5BA 2W2NP 3HHLD 4PL7A 1PGZA 1EARA 3OBWA 1N5SA 3PX0A 1T3NA 1F9FA 1IKXA 3CJRA 2NXJA 3Q8SB 2JWNA 3H3NO 3K5PA 4A8KA 1VC0A 1DAXA 1PC4A 1LWFB 4F02A 1ELOA 4IXCA 2EKNA 4LUBA 2BTFA 3OSNA 3V6HA 3CD6N 2J0SD 1TKZA 1JXLA 2XWXA 3CHWA 1RT3A 2ZBRA 1FWKA 3M6GA 1QVGM 1NH8A 2XC9A 2DD8S 4WE1A 3HT0A 3MX2A 5KG1A 2YQ1A 4WP8A 2LEAA 1H2VZ 4MMOA 1RJJA 4ILJA 1SV5A 2LA6A 2FLNA 8RUCA 2M9KA 3T6JA 2I1RA 3U1LA 2OH2A 4FXWA 4CGGA 3RR8A 2D0OA 4DS4A 5AQXA 3QFHA 2M3DA 5AQIA 3BSOA 3OS0A 4EO6A 4EI2A 1GLJO 2CH6A 3CCSN 5DZ7A 3AAPA 3NP5A 1M5PC 5A0YB 1WOPA 3TEGA 3GFHA 3H2VE 4C7QA 1WLJA 3VHQA 1VRTA 5B0DA 3T3FA 1XMQK 1H3DA 2GQ2A 2GVZB 3RBDA 1X9JA 4LFCJ 1HARA 3I87A 1WNEA 3SQGA 2X6NA 3GJRB 2AX1A 3BH7B 3DRRA 2XS7A 1S6UA 4JKDA 4RW7A 1PO6A 4G1QA 5ETMA 4N5SA 5CR4A 3AXMA 4ES1A 2I9SA 1KC8O 1T0TV 4ZP6A 1U1OA 1N48A 1M0SA 3SSQA 3TPQA 2YKPA 4RW9B 3DLRA 2CQBA 4ZK7M 1RADB 3IFRA 4HI1A 3DRRB 2QWMA 3HSCA 4JYAK 4E1JA 2MJUA 1Q81T 3GFYA 3QZ8A 3OYBA 3MEDB 1WKKA 4DR5F 2R7WA 5F9LA 2RNEA 3O8WA 2E2OA 3GV7B 8AT1B 1JLFA 2HBKA 1NK9A 5E3PA 5K9FA 4ZCIA 2R7QA 1NDPA 2OLWA 4C23A 4P73A 1FW6A 4M5DA 1S7HA 4NO7A 5BR8J 3EYZA 4LFCF 3AD9C 3QB0A 2JFDA 1WNSA 2DVIA 4LFBK 5H9EJ 3O3LA 1IG8A 4O23A 4CLWA 2E88A 1RHQB 2DISA 2NXUA 1LNQA 2V4JB 1HHQA 4FZZA 4KBIA 4KH0B 1ZOTA 4PPZA 1K44A 2CPFA 4Q8EA 5I9EB 3VAIA 4WCEQ 5KFLA 4WU2A 3P39A 3KLGB 1IJFB 1HWJA 4CHZA 2NLWA 1VQKS 2YKMB 2HBMA 1WSHA 1JQGA 4ANDA 3CD6S 3VGMA 4MJKA 4JEPA 3LPUA 1YIJN 1JX4A 5KGXA 1ITGA 2V2QA 4UOCA