5HP1A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and foscarnet, a pyrophosphate analog
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/inhibitor/dna
total genus 152
structure length 553
sequence length 553
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hp1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hp1A05
3NBPA 3DYAB 4C8NA 3L3UA 3V81B 2C2DA 3SI8A 2HHVA 1SV5B 1D5AA 1RT5A 4CJ3A 4NLUA 4FJ8A 5DK5A 4J9QA 4CF2A 1ASUA 1HPZA 2IJNA 1IKVB 1JLAB 2P5OA 3QZ7A 4FZYA 4CGJA 4BDPA 1C0UB 4O3PA 4BWMA 2XGQA 1S0OA 4IBNA 3OY9A 1FXXA 4FZXC 3WNFA 4KHYA 2B5JB 4M3YA 4M3RA 3SNNA 3VQCA 4IKFA 2IBKA 5D3GA 2X6SA 4CJKA 3BSCA 3B6OA 2YHBA 4IH7A 2W8KA 1LW0A 5HRRA 4WZMA 5F8GA 4DF8A 1HMVA 3ZSZA 3LALA 3VQDA 1S1TB 3K5MA 3V6DB 3I5CA 1YTAA 1A5VA 1S6QA 3KLGA 3TQ1A 2OYQA 1SH3A 4F4YA 4PQUB 1RT2B 2X6NA 4TY8A 1BIZA 2V4RA 4ECTA 4N47A 4I2QB 3OS0A 4GMJB 5F9LA 3QLHA 3UQSA 4EO8A 4W5OA 1S48A 3OYMA 4KTWA 4K50A 4DFJA 5KRTA 2FLNA 4ECYA 1NJXA 2W9AA 4E7JA 1S0NA 1XR5A 2ETJA 4U7CA 4C8LA 2WOMB 3I0SB 3K58A 2R2RA 4ECWA 3H5YA 3GV8B 5KFGA 4DL6A 3FDSA 2FVSA 1RYRA 4OGCA 5HROA 2RKIB 3AA3A 3C6TA 3RAQA 3NGYA 3QERA 3M8PB 5FDLA 3TAQA 4J9RA 1GOAA 4CJEA 2YNGB 3VQPA 4KB1A 5DQGA 4YR3A 5F9NA 3QETA 3QIPB 3T3FA 1SH2A 3OJUA 4O4GA 3O3HA 2KZMA 4I7FB 3RB0A 3I5BA 1JLQA 3BSAA 4FK0A 4FM1A 3AVLA 3BGRB 1ASWA 1ZTTA 4E7KA 3KK3A 3QESA 3VQSA 5C25A 2Z1IA 5DG7A 3T1AA 1S9EA 3KK1A 5KI6A 4KHWA 1FKPA 4RW9B 4KI6A 2W42A 4DQPA 2PYJA 4Q0BA 2AU0A 1TV6A 1ITGA 4QWEA 4GC6A 1TL3B 3LP0B 1BQNA 4LD0A 4NCAA 3DLGA 5J2MA 4IFYB 1LWEA 5KGWA 3CFPA 1JLCB 3S3NA 1BCMA 3NKYA 1C2PA 3IGNA 3ZSVA 3BSOA 3SJJA 1O1WA 3T5KA 1KVCA 3GILA 1NOZA 3KOAA 5JS2A 4J9MA 4OLBA 1DLOA 1KSPA 5DLGA 3HP9A 4FK4A 1RBRA 3V6KA 1SL2A 3TAMB 3N6NA 5KFCA 1N4LA 3RMBA 1D0EA 3P5JA 4W5NA 2BQ3A 3DRRB 5KFIA 2BDPA 1JXBA 2G8KA 2HNZB 1J54A 3NF9A 4DU4A 3KLEA 3QNOA 5KG0A 1JLGA 2JGUA 3CVKA 4F4ZA 1K6YA 4JRQA 5KFRA 4WFZA 4IG0B 3M9OB 3MEGA 2DY4A 1HRHA 2YNHB 1LAWA 3OL7A 3DOKB 4MK9A 4DL7A 4Z4HA 5F8NA 3DRPA 1BHLA 3AVAA 4DFPA 4I2PA 2R2TA 1QAJA 2IM1A 4YMEA 1XHZA 1RILA 4QWAA 4KHRA 4F3TA 2JLEA 4PUOB 4C8OA 1JLEA 3IG1B 5FROA 1SKWA 3V1QA 3NHGA 4EBDA 1TVRA 3V4IB 2O5DA 4WXWA 4JV1A 2XY8A 3H4DA 4ZPCA 2G8IA 5DQIA 2W7OA 2ATLA 5EUHA 3ALYA 3ISNC 3ZSYA 1K1SA 4CIGA 5C5JA 2OPSA 5L1IA 4IFVA 3QGGA 3UDLA 4Q5VA 4ICLB 5J2NA 3I5AA 2D3ZA 2W9CA 5EU7A 3BQ2A 3HM9A 4CJWA 2DFEA 2JEIA 1HQEB 4URSA 3RB6A 3FQKA 3AO2A 4M3XA 1ZBUA 3WNGA 3SUQA 1FK9A 5HBMB 4CJTA 1RT5B 3LZJA 5KFTA 2XY6A 4RUCA 2YKMA 1WSFA 1RYSA 1HPZB 1TKXA 3OYBA 4RW7A 1WNEA 4RW4A 3OJSA 3D5MA 4CFBA 4CHQA 3TAEA 1QHTA 4MIAA 5KFPA 3P1GA 1QS4A 2AGQA 4NLGA 1RDBA 1NK7A 3AVFA 2ZQBA 4ED6A 1LW0B 1SL0A 3MR3A 3KK2A 4FLWA 3NGIA 4O44A 1GX5A 3SV3A 4FLVA 4YP3A 3M8QB 4RNHA 4O0JA 2O4GA 4IR9A 4BE0A 1IKVA 3K5LA 3PR5B 4Z4CA 2R8GA 1S6QB 4KSEB 3KLGB 3QEIA 4B8AB 1MU2A 5KT2A 4AHCA 4RU9A 2R8KA 3NH1A 1VSKA 5C42B 3DLHA 4Z0UA 4NLSA 1BI4B 4FLUA 4WXOA 3NAEA 1NK9A 1J53A 3QLHB 4NRUA 1BCOA 4CK2A 3KKSA 4DLGA 3V6DA 3DLRA 1A5WA 3DRSA 4EZ6A 2E9TA 4CHPA 5CYMB 5DGAA 4CGIA 2NUBA 3OL6A 4E1NA 2KFZA 2R2UA 4Z4IA 5HROB 4I9LA 4F2RA 3C6TB 4FVMA 2FJVA 2C22A 2J6TA 1WSJA 3OYNA 3HP6A 5KFEA 1KHWA 4CIEA 3DDKA 4QWDA 4CGGA 4O4GB 4XO0A 4N76A 4QCLA 2CKWA 3DLEA 5DLFA 4CF9A 1JLQB 1S4FA 5KFMA 3ZSXA 2XY5A 3S3OA 4FJNA 3MXIA 2WOMA 1RTDA 3I0SA 4J9OA 2R8JA 1XR6A 3KK3B 1JXLA 5DGBA 1HNVA 2HWIA 4HYKA 4BE1A 5C25B 3DLBA 4M3WA 1S9EB 3KK1B 1S10A 1FKPB 1HYVA 4DL3A 3V6JA 4CEFA 1JX4A 1NKBA 4ZTFA 4Q0BB 3O4QA 1TV6B 3MR5A 1JL2A 4DSIA 4ZP7A 1BQNB 4CESA 5KG4A 3AVBA 3DLGB 5J2MB 3S9HA 1LWEB 3RB3A 4ZHRA 4EEYA 4I7FA 5KFHA 1RDCA 3KLVA 1D9DA 4MIBA 3TANA 2HHUA 3E01A 1SH0A 2B43A 4HKQA 4MKBA 2F8EX 1CXUA 1JL1A 4OGEA 2F96A 4LQ3A 3ZT0A 4QAGA 5JUMA 4KKOA 3D28A 1LW2A 2AGOA 3AVIA 4RW9A 2HVIA 5HLFA 4F4KA 4UQGA 4YNQA 1Q8IA 1IG9A 1T3NA 4MFBB 1KTQA 4KB0A 3LP0A 4DTPA 1KLMA 1IKWA 4TQRA 3S3MA 1QUVA 4IRCA 4IH5A 3TAGA 1JLGB 1TK8A 4MK7A 1U04A 4NYFA 3LWMA 4O3SA 4AILC 4TQSA 2EHGA 3DRPB 3TI0A 3MAQA 4CE9A 4J9SA 2F8TA 3HYFA 3GIMA 2FVQA 1NHVA 3QO9B 4CJQA 3HXMA 3SUNA 1JLEB 3RBDA 4Q8FA 4FXDA 1BIUA 3MXJA 3SQ4A 4O4RA 2VA2A 1N56A 1EX4A 1K1QA 5T14A 4DLEA 1TVRB 1EETA 2HW3A 2IAJB 3T19A 3E51A 4R0EA 2YNHA 3OSNA 3BJYA 1BISA 1ZBLA 5KG1A 2XO7A 2AX1A 4J9PA 4AHRA 4G1QA 3CG7A 4Y3CA 4FS1A 3L2VA 2OPSB 3NL0A 4IFVB 1KLNA 5J2NB 5F8HA 1S6PA 1JKHA 4X2BA 4NZ0A 3I0RB 3AVKA 1OS5A 3VQAA 5J2QB 3ZT3A 2BANA 4DFKA 1LAVA 2EX3A 1N48A 1HJRA 5DG9A 3RWUA 1FK9B 1YVFA 4FJ5A 1NK5A 1QSSA 4YR0A 4FW1A 1C1BA 5JS1A 3AVJA 1VRTA 4JUZA 2LSNA 1QAIA 3OL8A 4BE2A 1ZETA 2IDOA 4CHZA 2ASLA 2AGPA 3ICLA 1TKXB 4H54A 4ICLA 2YKNA 4RW4B 1DTTA 1U48A 1HQEA 3NH2A 5KFBA 5KT5A 1WSHA 2OPQA 2X78A 4DTJA 4DTOA 3MECB 5HBMA 1S1XA 4WYWA 5EWEA 3L2UA 4DU3A 3KK2B 4CJLA 4HCCA 4HUEA 2V9WA 2Y1JA 4O44B 2AWZA 1D9FA 4Z4EA 3DMJB 4O0IA 4H4OA 3PX6A 4FJ9A 1C0MA 5L1JA 4CGFA 3OYGA 4F2SA 3M9NB 4GVMA 4JRPA 2BQUA 1EKEA 1RTJB 1MU2B 2Y1IA 4CEQA 3BDPA 3KNAA 1LWFA 3QIOA 4J9LA 4IG3B 3CM6A 3HO1A 5CYQA 3VQ4A 3TAPA 5EWGA 4TYBA 4MK8A 4FBTA 3M8QA 2XHBA 1YTUA 3SQ1A 1WSGA 2W9BA 4E19A 1B9FA 5KG6A 3DI6B 3DRSB 1C1AA 3V1OA 4DS4A 3AVMA 1HYSA 4TXSA 2DPIA 5T7BA 2YNIA 1IKYA 3C6UB 3I8DA 1L3VA 2ASJA 5C42A 4NLOA 3KHHA 4RG8A 3G6VA 2C28A 1BI4A 4GW6A 4CJPA 3OL9A 5KFOA 1RT4A 3CJ4A 3PW0A 2IJFA 3M8SA 1VRUA 3LWLA 2W7PA 3CJ3A 2FJWA 2HWHA 2HNYB 4FLXA 2ZE2A 4ZMMA 2E6MA 3OSPA 4TN2A 4FYDA 4ZP9A 3SPZA 3DLEB 3KTQA 4F3OA 4ZP8A 5CYMA 1RTDB 5KT6A 4QW9A 2IC3B 4K4WA 2FC0A 1JXEA 4CEAA 4BACA 5KT7A 1HNVB 3Q8RB 1RT6B 3PX4A 4Z4GA 1I3AA 2GUIA 3SUPA 4HCBA 4ED2A 3VQBA 4EYIB 3OYEA 4ZHRB 4ZPBA 5KGXA 1ZYQA 2B6AB 1X9WA 4NLYA 2XWYA 1TQLA 4OPJA 4PWDB 3E01B 5J2PB 2WB4A 4MQ3A 2R7YA 1U49A 3HL8A 3JSMA 3VA3A 5SWMA 2J6UA 3QGHA 4KKOB 4FJJA 3U6FA 1LW2B 4NLRA 5HLFB 1XR7A 3IGVA 4K4UA 1D1UA 2E9RX 1KLMB 3LAMA 1IKWB 4M95A 1W0HA 3KHLA 4DSKA 1RAJA 4MKAA 3OYFA 1IH7A 4M3TA 3KLHA 4URGA 3NDKA 4DSFA 1GX6A 4CJFA 4B08A 4C8MA 2A1SA 1L3UA 4RW8B 2XGPA 4MFBA 2UVVA 2WTFA 5CZ1A 3F9KA 4F50A 2F8SA 1T03A 5CY4A 2XI3A 1RDRA 3RBEA 3VQ6A 4QOZB 3LP3A 1EETB 2XCPA 4CEBA 3AO4A 4GC7A 5KFFA 3A2FA 3SFGA 4CGDA 4KBIA 5KFKA 4CECA 4ZVGA 1UWBA 5KFYA 2EC0A 3SI6A 4G1QB 5KTQA 4CFCA 2HVHA 4LH5A 3VQ7A 3MR2A 2OZSA 4Z4FA 3PX0A 3GIIA 1S6PB 3QO9A 1JKHB 4K4YA 1WAJA 2G8VA 5HRPA 3TABA 5DG8A 2BANB 3AA4A 2HNDA 2VG6B 1VSFA 3BR9A 3ASMA 3PJWA 3SQ0A 2WRMA 4RNOA 5KFAA 2IAJA 3OYHA 3ZSOA 1C1BB 4RNNA 3KKRA 1CXQA 2W8LA 2JEFA 1VRTB 4CJSA 1NJYA 4Q43A 4ZTJA 1KVBA 2IOCA 4RNFA 3K5OA 2ALZA 3T5HA 3Q8SB 1EXQA 2YKNB 3KJVB 3I0RA 1DTTB 4NCGB 2ATQA 1LWCA 5J2QA 1HNIB 1B92A 1BQMB 3ZSWA 1S1UA 1G15A 4WYLA 2OPQB 4RUAA 2ILZA 1KCFA 4HHTA 1NOYA 4J2EA 3CO9A 2PYLA 4YFUA 3GQCA 4FJLA 4B9UA 1T94A 2OPRA 1S1XB 5F8JA 4DTUA 4OVLA 4OPKA 3H5SA 4H4OB 2UVUA 4ED1A 3K59A 3OHBA 2RF2A 4U6PA 5SZTA 3IN5A 4CK3A 4FJGA 3LPUA 1VSJA 3ZSRA 4OLAA 4KRFA 2ITGA 3OYJA 4CJ4A 4N5SA 5F8IA 4NLDA 1S97A 1N5YA 4DTXA 1LWFB 2D7SA 1SKRA 4ECZA 4FJIA 3DOLB 4ZVHA 4AHVA 3MECA 5CYQB 3ZT1A 3LZIA 3TWHA 4CJRA 1RTHA 3MTKA 3DMJA 4M45A 3HSTB 4E1MA 3QZ8A 4ZVEA 4E7LA 2W9BB 1UA1A 1CZBA 3C94A 4OKEA 4CF8A 3DLKA 5KFJA 3OLBA 4WE1A 4ECXA 4FJMA 4KB7A 2XC9A 1TKTA 2DPJA 1HYSB 1RTJA 2YNIB 1IKYB 4OJRA 3GV5B 3DM2A 3FSIA 2I5JA 4R8UB 4Y2AA 3NF6A 1TAQA 4IG3A 2IM0A 4ZPDA 1RT4B 1B9DA 3M9MB 3F73A 1VRUB 3T5LA 1RT3A 4IR1A 4CJVA 1X9SA 1JLFA 4ECRA 4TSXA 2ZE2B 3ZT2A 3H5XA 3LAKA 4FJKA 3KLIA 4AHTA 3SPYA 5K14A 3MFIA 3DI6A 3ISND 2Z1HA 4K8ZA 4FLZA 2IS3A 2AJQA 3IRXA 3C6UA 3RAXA 2KTQA 1Z4UA 3MR6A 1S9GA 1W25A 2AX0A 1EP4A 3N6LA 4CF1A 4EP5A 5KG2A 3CJ5A 1KFSA 3CQ8A 2HNYA 4CFAA 3AVGA 1WAFA 4AHSA 4O3OA 4KHQA 4ZVFA 2X74A 4IDKA 2D41A 3RB4A 5KFWA 1RT1B 5KFXA 3IS9A 4W5QA 5KFUA 3QNNA 3NH0A 2IC3A 3SZ2A 4RW6A 4IQXA 4NCBA 3OLAA 1I39A 3JSMB 3RMCA 1RT6A 3PW5A 4DTNA 2GBZA 3ZSQA 1NKCA 2WK4A 3HK2A 1L3SA 2UUTA 1L3TA 5KFDA 4AH9A 1TGOA 4NLVA 3G6YA 1F21A 1NJWA 2B6AA 3KLHB 4BDYA 3V1RA 2Z1JA 4KE5A 4ID5B 4PWDA 4Q8EA 5J2PA 3HHKA 1QQCA 3G0ZA 3PR4A 2ASDA 4DTMA 3FRZA 4R5PA 3OHAA 1T8EA 5HRSA 3ULDA 4EO6A 2DTUA 1T03B 1KFDA 4CGHA 1WNSA 4NYNA 5E41A 3MEDA 3LP1B 1VSEA 2G8WA 1N6QA 3HT3A 2HB5A 4BWJA 4DQSA 1U4BA 4EBEA 4KTQA 5HP1A 4J9KA 2KQ2A 5HRNA 1UWBB 2HHXA 4NLPA 4CFDA 4CK1A 4O5BA 3RRHA 2XCAA 4RW8A 3AO1A 3MEEB 4QPXA 2HNDB 4XPEA 1DTQA 3VQ9A 4NLXA 3H59A 1RDAA 2WHOA 2ZD1A 3HJFA 3OYCA 1IO2A 2FVRA 3Q8QB 3BQ0A 4DG1A 2OPPA 3HVRA 3KIOA 1TKZB 4DL5A 1ZTWA 3QINA 1REVA 3K2PA 3OS1A 3HKWA 1KVAA 2XY7A 1TKDA 1LWCB 3NF7A 3KHGA 2VG6A 4Y1CA 1A5XA 4B9TA 2JC0A 3K57A 3QEPA 3U3GA 4E3SA 2G8HA 1S1UB 5CZ2A 2OPRB 4LSLB 3JYTB 2ZKUA 1S9FA 4E7IA 4JS5A 5EWFA 4LSNA 1U47A 3RR7A 4JV0A 2RF2B 3L2QA 3RTVA 3LDSA 3PVXA 3KJVA 4KREA 1TAUA 1QTMA 4NCGA 3PZPA 1HNIA 1FKOA 1QE1A 3HVTB 1N5YB 5FRMA 1BQMA 4L8RB 3U3YA 2FLPA 1MMLA 3PW2A 1TL1A 3UR0A 1U45A 3MFHA 3V6HA 4F4WA 1RTHB 4I9QA 2FVCA 4EZ9A 1GOCA 2R8HA 4FW2A 4J2AA 3ZT4A 3DLKB 4WFXA 5KT3A 1ZBIA 4WE1B 2G8UA 3VQQA 1TKTB 4E0DA 4W5RA 3BSNA 4Q44A 3NFAA 4DQIA 2D0AA 3DM2B 2QK9A 2HAIA 2I5JB 2IMWP 4TY9A 3DOLA 1J5OB 2HHWA 1Q9XA 4KI4A 3H5UA 1VSHA 1RT3B 1NNDA 1JLFB 1C1CA 1SUQB 4FK2A 4N41A 2J6SA 3PY8A 3KLIB 5C24B 3UPFA 2YNFB 4B3OA 5K14B 4QWBA 4DSEA 2HMIA 1QSYA 4FZZA 1Z26A 3CWJA 3IRXB 2FBXA 3D0PA 4J2BA 4CIFA 3SV4A 3LP2B 2C2EA 2HHTA 2FJXA 4HUGA 3KMQA 3KMSA 1S9GB 3L2WA 3IAYA 4CHNA 3LPTA 4R8UA 1EP4B 5I42B 1NK6A 1D8YA 4DU1A 3QGIA 1RBSA 3GV7B 4IDKB 1T05A 2V0NA 1HYZA 4K4ZA 2C2RA 3IS9B 3EY1A 4RW6B 4DF4A 4CEOA 4B9NA 1YVUA 1VSIA 1Y97A 3L2RA 3NAHA 2YHAA 1W9HA 2BE2B 5JXSA 4HVJA 3L3VA 3CYMA 3KLFA 4LY7A 3TAFA 4DMNA 2D0CA 4M3ZA 4DTSA 1RT1A 1HQUB 1RNHA 2O4IA 5KFQA 4ID1A 1BL3A 1C0TB 1CLQA 2KW4A 4HTUA 1RT7A 4NRTA 1XHXA 4KV8A 2VG5A 1NJZA 4R5PB 1ZBFA 3PJXA 3NCIA 2RDIA 2RDJA 1VSLA 4OKKA 3GIKA 3BQ1A 4O3QA 3N6MA 4NLTA 5EDWA 3ZCMA 3EPIA 3MEDB 3MXMA 3VQ5A 1RBVA 2BQRA 1N6QB 3HVAA 4K4SA 3H98A 4IH6A 3H40A 3PW4A 3HPOA 3V9ZA 2UVWA 4ID5A 5HP1B 4ECUA 1L5UA 3HPHA 4C8KA 3OVNA 4URQU 1NK4A 3CJ0A 4M41A 2BR0A 3SCXA 4DSLA 4K4TA 3QEWA 2G8FA 4DQRA 4K8XA 1RTIB 3V9XA 4LQ9A 1DTQB 4ECSA 4K4VA 2VG7A 2KFNA 2FVPA 4FS2A 5F8LA 3LP1A 3VN5A 4DSJA 3L8BA 3NGZA 2ZD1B 1TK5A 5KFNA 1R0AB 1X1PA 1XWLA 4DG1B 2OZMA 2OPPB 4LH4A 1QSLA 3H08A 2WONA 1REVB 3FFIB 1WSIA 3HPGA 3PV8A 4ED0A 1NKEA 4OKJA 2XI2A 2UUWA 1BGXT 5J1EA 2BGGA 3ITHA 3MEEA 1SL1A 3SFUA 3D45A 2JEGA 4B9MA 2E9ZA 1IKXB 4ED8A 2I1RA 3M8RA 5KG3A 2IA6A 3NGDA 4IKAA 2QV6A 4CCHA 3V9UA 5L9XA 1S1VB 1Z25A 3VQEA 2P5GA 4LSNB 3AVCA 3AVNA 3VQ8A 1TKZA 3TARA 3G6XA 4ELTA 3AO3A 1JLBA 2HHQA 1S1WA 2B4JA 4DEZA 2IM2A 4KO0B 1FKOB 4H4MB 1UAXA 1QE1B 1YT3A 4M3UA 2ILYA 2E6LA 4NLWA 2BRLA 4LSLA 1S5JA 4Y2CA 1TL1B 4IOBA 4DTRA 3JYTA 1LV5A 4KHSA 3PW7A 1VSMA 4FLYA 3SQ2A 2DFFA 5I3UA 3OYIA 4DS5A 4B9LA 3GYNA 1NK8A 3H4BA 4IRDA 3V9WA 3NBPB 3WNHA 2WCXA 1Q9YA 3HVTA 3CIZA 3EPGA 5L1KA 2OA8A 3O3GA 3C95A 4EBCA 2GIQA 4CEZA 4FJ7A 4N56A 1C1CB 5KFSA 4CF0A 3QEVA 4EYHB 2OH2A 1WN7A 4FCYA 4H8KA 3AO5A 3P83D 5FRNA 4J9NA 2PY5A 2GIRA 1CSJA 4KFBA 4DQQA 4B3OB 4EP4A 5KRSA 5D3GB 3RR8A 3OYAA 2HMIB 2HHSA 3DYAA 3V81A 4QW8A 3NAIA 1SV5A 4Y34A 4ZP6A 4OL8A 1HMVB 4FJXA 1C6VA 2V4QA 1J5OA 3EZ5A 4W5TA 1JLAA 4O3RA 1C0UA 1SUQA 3OYKA 4CJ5A 4FM0A 4KHUA 4IRKA 2B5JA 3KD5E 1T05B 3G10A 5C24A 4CERA 2YNFA 1GOBA 4TY8B 5DQHA 4KHMA 3QEXA 3RMDA 3HVWA 1VSDA 3O3FA 4CEEA 2QXFA 3SUOA 3LP2A 3OS2A 1T7PA 1RBTA 3UIQA 3AA2A 4E7HA 3G86A 4CHOA 3OYLA 3WNEA 4B9VA 4JS4A 1S1TA 4YR2A 4ECQA 2DFHA 5I42A 3QIDA 3PO4A 3MF5A 3AV9A 5KFVA 4XIUA 4ED7A 3KLFB 4PQUA 1RT2A 4DFMA 2XRIA 5FDLB 5DMRA 4AHUA 4KHNA 4XPCA 4I2QA 3V9SA 4PA1A 4CEDA 4KAIA 1XC9A 1RT7B 4HUFA 3SYZA 4KV8B 2VG5B 2QE5A 3T5JA 2JC1A 2UVRA 1UOCA 4RNMA 2BE2A 2IGIA 2E4LA 4E89A 3B6PA 4B9SA 3CDWA 5L1LA 3RMAA 2IM3A 3CDUA 2QKBA 3CDEA 2JEJA 4FBUA 4ECVA 4TYAA 4M42A 2FBTA 4ED3A 1HQUA 2RKIA 3M8PA 3NF8A 3KD1E 2P51A 2YV0X 1XI1A 2YNGA 1RA6A 1C0TA 3PUFA 3QIPA 1WLJA 2A1RA 2Z1GA 5KFLA 3CJ2A 4DL4A 3EZUA 3KHRA 4O3NA 2RN2A 4F4XA 3NMAA 3BREA 3BGRA 2P1JA 2VG7B 1TP7A 1I6JA 1DLOB 2KZZA 3CFRA 2VWJA 4WZQA 1RCHA 3AVHA 1KRPA 1J9AA 2RPIA 3OYDA 1TL3A 3GIJA 4KAZA 2FBYA 2FBVA 4RZRA 1RDDA 2WONB 3KLEB 5F8MA 3O4NA 4IFYA 3FQLA 4WFYA 1JLCA 3K5NA 4MH8A 5KT4A 4K4XA 4O55A 2Q3SA 1UA0A 3RRGA 3CM5A 1ZBHA 4TLRA 3MEGB 5J1EB 1RTIA 3ITHB 3AA5X 4Y1DA 1RA7A 4I2PB 3PO5A 1U09A 4G3IA 2D3UA 1CZ9A 1R0AA 3TAMA 2VWKA 4ZPAA 4KTZA 3DRRA 5KG7A 4B8CA 1SKSA 2HNZA 1ASVA 3FFIA 2VA3A 2D0BA 1JLBB 3VA0A 1JIHA 3QYYA 2GV9A 1X9MA 3THVA 1S1WB 4IG0A 3LANA 4QWCA 1NK0A 2GC8A 2QKKA 1IM4A 3DOKA 4Q45A 4KPYA 4FM2A 1VK0A 1IKXA 1HARA 3PHEA 4DL2A 3H2LA 3CFOA 4JLHA 4PY5A 3TVKA 3NE6A 4YQWA 2BRKA 2W9CB 1S1VA 4ELUA 4PUOA 3IG1A 5I3UB 3Q8PB 1TK0A 3V4IA 4NYZA 3EYZA 4BDZA 2FLLA 4KO0A 4NLQA 4H4MA 4JV2A 4J2DA 1S0MA 1RBUA 4CHYA 4FJHA 2YKMB 2CJQA 1S49A 1NHUA 2AQ4A 4DWIA 2PZSA 4M94A 3TR8A 4RW7B 1KHVA 4CJUA 5KG5A 4ELVA 5KFZA 2R8IA 1WSEA 2R2SA 2D5RA 4F8RA 4KFBB 4FLTA
chains in the Genus database with same CATH superfamily
3DXBA 2FHJA 4CLFA 3L3UA 1FVSA 2C2DA 1D5AA 3CJ1A 2N3LA 2M52A 2V8PA 2IVOA 5DK5A 2CQ1A 4CF2A 4EHTA 1HPZA 2XMWA 4DX5A 4OZLA 1IKVB 4U7BA 2P5OA 3QZ7A 4BLGA 4CGJA 1C0UB 4O23A 2B5JB 2CYYA 2IBKA 2Q6CA 4AD6A 2X6SA 5F0XA 1RGIA 3BSCA 2YHBA 1LW0A 3M3ZA 5HRRA 1HNXJ 3EKSA 3UCUP 1U2FA 2C2OB 3Q8UA 1HBUA 5GADI 3QWUA 5D0RA 1FKAF 1S1TB 2GGPB 3VZHA 3UN5A 1IV0A 3I5CA 1YTAA 1HNWF 5ETVA 4R25A 1SH3A 3R5DA 2UUCJ 3CI5A 4LF6K 4KH6A 4PR6A 1PIEA 3OS0A 4U7UK 1RXOB 3JSRA 5E84A 3UQSA 3OYMA 3DNCA 1KWMA 2RRAA 4YOYA 1VLOA 4DFJA 4WFAL 3J7AP 3CUNA 1NJXA 2ZH7A 3RW6A 2YJEA 1XR5A 3MURP 2A18A 2ETJA 4U7CA 3C46A 3BDEA 1KNZA 3E9PA 2V8HA 4Q2LA 3GV8B 5KFGA 1F9FA 2B51A 2V94A 3AA3A 3C6TA 3RAQA 3D0IE 1TL7B 3QERA 4LF7J 4PRFA 4CJEA 2YNGB 5DQGA 4PWUA 2A6AA 2J9EA 3R5JB 2F4VF 2AV5A 3QETA 3HZEA 1H7XA 1KAZA 3R5BA 4I7FB 3RB0A 1BO5O 1NDCA 3BSAA 3D66A 1ASWA 2X3DA 1IWGA 2WSFC 3PXGa 1VQON 4KH1B 3BYPA 3QFWA 2Z1IA 2W2PP 1KQFB 5DG7A 2IVPA 3KK1A 3QFUA 3OUYA 2PYJA 1TV6A 1ITGA 2FF6A 4QWEA 1RHKB 2QN6B 1NGIA 2XS2A 3M2VA 2ZDOA 2DR7A 1VQMN 4NCAA 2NLWA 2ZZTA 3CFPA 1JLCB 3S3NA 3NKYA 1CJKB 3BSOA 5AQNA 3W5XA 2DITA 1FWKA 4ILLA 2IYIA 1NOZA 5MLCV 2OO4A 3CCRS 2A3ZA 3NNCA 2CZ9A 3RMBA 5DDPC 2BQ3A 3OXFA 5FJ4A 1JXBA 2G8KA 1J54A 4DU4A 3KLEA 4WCEQ 4Y0FA 2DHGA 1KN6A 5CCMA 2JGUA 4ES1A 5AE2A 3ETOA 3R9PA 1RUSA 1HRHA 4CJ7A 2HLUA 4MK9A 4DL7A 1ZPVA 3JS9A 4I2PA 1QAJA 4LF4J 3Q7BA 4QWAA 4LFCF 5BR8K 4DV5J 1P8ZA 2ZOGA 1Y7PA 2IPOB 5FROA 3DLLL 3D2FA 2Z8QA 4EBDA 2BXJA 3V4IB 2XY8A 4CLTA 3OVSA 4C2MA 2W7OA 2ATLA 2DNOA 2VPWB 5EUHA 3ALYA 3ZSYA 5E2QA 6FDRA 1S12A 5L1IA 3UDLA 5IT9O 3CCUS 2XLJA 3MPUB 4USUA 1SC4B 2VPYB 5L9NA 2GO8A 1SZ2A 2XMJA 3CXCM 4H03B 2W2MP 4K0KF 3MZIA 4P10A 4M3XA 2QGFB 3WNGA 2B4UA 1N34F 1EARA 4AF1A 4CJTA 2YKPA 2IBOA 3LZJA 2YKMA 4LC9B 1WSFA 3O8WA 1HWLA 2VD3A 1WNEA 4RW4A 1IUJA 3PYDA 1HR0K 7FD1A 3W9IA 3FZ2A 3TAEA 1R0CB 3P1GA 1ROFA 2BW2A 4Y65A 1EWQA 3JQKA 1NK7A 3AVFA 2B9WA 1SL0A 4B3RK 4OI4A 3UKRA 3NGIA 4O44A 2WW4A 1HX1A 3FVYA 2U1AA 3K0JA 4BE0A 3K5LA 1M1GA 3BEGB 3J81Y 2PBDA 2UU9J 1UFKA 4CZHA 3QEIA 1B4SA 2F40A 5KT2A 3R8EA 4PXDA 1VSKA 5IQQA 5GIPA 1X3MA 3MM9A 3ET6A 5HJYA 3CC2N 3O5BA 1NK9A 2UXDK 2ZZMA 2AP1A 1GTHA 3W3SA 1J53A 1YIJS 2QMXA 2MLXA 1W2BM 2CNOB 1FI4A 5FD1A 2E5LJ 3D4JA 3LQVA 3L0QA 1A5WA 3I56S 3D6HB 5DGAA 3C14A 1FJCA 2KFZA 3D1HA 1U6BA 2FHKA 5HROB 3R6LB 2FJVA 3HP6A 1Y3KA 3C7NA 1X60A 4MMOA 2OTLS 4B1UB 1U0HB 1G4CA 2QRRA 4QWDA 3GSIA 3M32A 5EY4A 5F3TA 4HL9A 3MDFA 4QCLA 1ITPA 3D1QA 5DLFA 3CC4S 3J80U 2XY5A 3OTEA 3ZSXA 3S3OA 3NGKA 4FJNA 4YY3K 3I0SA 2J0QD 4J9OA 2BJ3A 2HHPA 3CHWA 1A7GE 3HCXA 2KHCA 4NXMJ 1S9EB 4DL3A 1UW4A 1JX4A 1NKBA 4Q0BB 1FXDA 4CI6A 4P2SA 5KG4A 2ADCA 3AVBA 5J2MB 4EEYA 2BVZA 2HFZA 2YWKA 3ZTSA 1PAEX 1QDUB 4B3TK 5B7WA 4MKBA 2MZ1A 4WF9L 4OGEA 4OFZA 1I3OB 3AVIA 1LW2A 5BYQA 2HVIA 4YN3B 5A76A 3OBYA 1T3NA 1H2UX 3W2VA 4KB0A 3LP0A 1FRHA 4DTPA 3S3MA 1QUVA 4IRCA 3IM8A 1M90O 1JLGB 1Q8KA 3M8WA 2C2ZB 3LWMA 4AILC 2EHGA 5EXWA 3DRPB 3TI0A 3AY9A 4Z37A 5AE1A 3MAQA 4RBUA 3HYFA 3QSIA 4JI3K 1ZBTA 3QO9B 2CPIA 4C4WA 4IXCA 4FXDA 3SJHA 1R7IA 2ZUAA 4BR7A 3K89A 3QAEA 2QEXN 2EG2A 2ZGYA 4IJAA 4R0EA 2YNHA 4NYOA 2D3OR 3VGSA 5M2RA 1MWYA 3R7NB 4G1QA 1HD0A 1IBMJ 2DGUA 4CZFA 3ULEB 3L2VA 3C16A 4IFVB 2MZJA 5A8WA 2BE7D 4OV6A 3AVKA 2BBEA 3I31A 3ZT3A 3J7AN 1LAVA 1CPZA 3TYTA 3EN9A 1HJRA 3RWUA 1T9WA 5T7LB 1C1BA 5KQDA 4JHDA 1NLVA 2YQ1A 1VRTA 1NCLA 4JUZA 3H0PA 2LSNA 2F4FA 4BE2A 2LECA 3HBTA 3G4SS 4CHZA 4JOUA 1TKXB 2DEJA 3GJSB 3TUPA 4LRCA 2BUNA 4ILMA 4YOWA 2RB7A 4DDFA 1HQEA 4NMXA 5KT5A 4JI5F 2OPQA 2CAJA 1GH8A 1IJJA 1RAOA 5F0UA 3BGOP 4WYWA 4BC2A 3KK2B 4NXNF 1D9FA 3Q89A 1VQKS 3DMJB 1ATNA 4O0IA 4MKVA 3MCNA 4JI7F 1C0MA 1X4DA 3QGPA 1KQKA 3ISZA 2IDEA 4GVMA 2BQUA 4PG5A 2XMMA 1VQ4S 4CEQA 1R8PA 3QIOA 5DM7Q 5I9EB 3FFKB 5CYQA 1VBYA 3NNHA 4RR5A 3VQ4A 1HNXK 5HK4A 4I68A 3OW2R 2W9BA 1TUWA 1IBLJ 1YLXA 4DS4A 2KG0A 2QA4N 4TXSA 4ZVSB 2GVDA 2YNIA 1O51A 1BG3A 3I8DA 1L3VA 4BRPA 3RSEB 4B02A 5C42A 1NZAA 4X84A 4QR1A 4RG8A 2F3JA 4C1NI 1Y5IB 3M8SA 3LWLA 3PKYA 4CT8A 1NGEA 1R43A 2ZE2A 3ZNJ1 5GAEU 4TN2A 2PI4A 4FYDA 1R31A 4CO4A 2R7UA 3DLEB 2DHAA 8RUCA 4DR3J 1HBMB 5KPZA 5E26A 5CYMA 2H5EA 1RTDB 4X4QA 3P39A 5KT6A 4JYAK 1JXEA 4BVOA 2HBMA 3Q8RB 2BX6A 4DCJB 2KT5A 2PA3A 3PX4A 3WHIA 3VAGA 4Z4GA 3SUPA 2M0GB 3H3OB 1CULB 4LF7K 3OYEA 4ZHRB 1X9WA 2XWYA 2XMUA 4RX6A 4PWDB 3E01B 5J2PB 3KKFA 2WB4A 4MQ3A 1U49A 3VGKA 3VEZA 3VF4A 1ZAVA 2O8BA 4EFHA 4KKOB 1T3VA 5AQOA 5C0YA 2AZ3A 3K9KA 1IWAA 2P9LA 1KLMB 3L9ZA 1IKWB 1FNOA 4DSKA 2KXHA 1RAJA 2XG8A 4MKAA 1N54B 2YPZA 4X4SA 4CZIA 3Q2SC 2V34A 2KL8A 5A6WA 4C8MA 1HBOB 4DUZF 2A1SA 4FWQA 4TNOA 5KPTA 4MFBA 3F9KA 1DQ8A 1HKBA 2F8SA 3TZWA 1U7LA 1VQ5N 1VDHA 2JFDA 3RBEA 5CQGA 2OJ3A 3VQ6A 3LUYA 2ASYA 2XCPA 3EDRB 4CEBA 3VGVA 1Q95G 4CGDA 4KBIA 5KFKA 4KIAA 4AT1B 5KFYA 3IBFB 2HVHA 2DNHA 3OHRA 4LH5A 2CPYA 3GIIA 4U67Q 2ABYA 3DHXA 2Z57B 3A0IX 2G8VA 3W66A 3DJCA 4DV5K 3EUNA 1AYEA 3CF5L 3THWB 4GNIA 3OYHA 4HH0A 1ATRA 4CJSA 4C48A 3EGNA 3R8YA 4GV3A 3K5OA 2LDYA 3Q8SB 1UJ5A 3KJVB 3TX8A 2IIRA 4I6MA 5HSPA 4MAKA 4LVOP 5J2QA 1QQOA 5B0DA 1HNIB 2CWXA 1B92A 3G82A 3G2XA 3SBMA 4GMKA 3ILJA 4WYLA 2ILZA 1KCFA 4J2EA 3CO9A 1HW9A 3OR2B 1T9UA 5F8JA 4NEYA 4DTUA 2APOA 2F8HA 3CCSN 3O5TB 2UVUA 1RBOB 3C6HA 4PXEA 3Q7CA 2M7SA 3OHBA 2QLBB 3AA9A 4U6PA 4K42A 2ATCB 4ANEA 3IN5A 4WKYA 4BR4A 4FJGA 3LPUA 1VSJA 3ZSRA 4OLAA 2W2QP 4N5SA 5F8IA 4HTLA 1N5YA 4DR5K 4DTXA 2D7SA 4FJIA 3CJQA 2Y1LB 2B4OA 4CLUA 1S5ZA 5BRDA 3VWSA 4A5AA 4B3SF 3KJQB 5DZ6A 4WP9A 3LZIA 2DNLA 3S8SA 4ISFA 1V3RA 1RTHA 1S77D 4WFAQ 2HFUA 2PEBA 1UZDA 4E1MA 2W4PA 5A6PA 5K9FA 3MEKA 4CWBA 4CF8A 4OZ0A 1U24A 2QWMA 4WE1A 4FJMA 3PRDA 2DPJA 1HYSB 2CPJA 4J5OA 1JCGA 3OV7A 1IKYB 2UU9K 2Z2ZA 1HHSA 1NSPA 3GV5B 3DM2A 4BQZA 3FSIA 4GKJJ 2Y9HA 2IM0A 1B9DA 2BJ1A 5AZIA 2H54B 4IR1A 4NE9C 1SS6A 4ECRA 2X7IA 3ZT2A 3LAKA 4FJKA 4NASA 5KAKA 2E5LK 4JK9A 3GZ7A 1CVJA 3SPYA 1RHUB 2Z1HA 4K8ZA 5GAGP 3TVZA 1F3FA 2IS3A 5A8RB 2Y0BB 2EFOA 3C6UA 4X66K 3KG1A 2KTQA 3S7RA 4UOGA 2AX0A 2QMWA 2R7VA 5A2QO 1EP4A 2MQNA 2EBEA 1FWPA 3CQ8A 2HNYA 2KG1A 2KH9A 2P9NB 3MMAB 3AVGA 4O3OA 3ZZUA 4CIOA 2X74A 3CD6N 1PCAA 2ZBPA 3RB4A 1YXQA 5KFUA 3SZ2A 1TTHB 1WDTA 2FC8A 4DTNA 2GBZA 3HK2A 1TFYA 3ZSQA 1I5OB 2LLZA 4NXMK 5B0CA 1FERA 2JH3A 3BH7B 4AH9A 4CLSA 1I94K 1X5TA 2HGNA 4KE5A 5MAOA 5HL7L 3SQGA 4EAHD 1CJUB 3VVUA 3PR4A 2E1ZA 4H4KC 2FC9A 2KHOA 5HRSA 4EO6A 3DLLQ 1KFDA 4CGHA 1FEHA 3M4XA 3EVOA 3MEDA 4BS2A 3KDNA 4BWJA 4DQSA 2W6LA 3NY0A 2W41A 3FMBA 1RAIB 2KQ2A 2DKOB 4RWTA 1RWWB 4PKIA 5M1PA 1ZM3A 4CFDA 2ROPA 2V2ZA 3DWLA 2A5XA 4GVLA 3CETA 1A6LA 1P8GA 3WXKA 3PSFA 3DOMB 3T1HJ 1RDAA 3OYCA 3IFEA 1WHVA 2NRZA 1MLAA 2A3JA 1GXTA 2MKKA 3HVRA 3KIOA 3ULHA 4DL5A 1ZTWA 3JTNA 4J8FA 1REVA 1KOOA 1KVAA 3PSIA 4YUDA 1DGKN 2K2PA 3M05A 3LGHA 4USVA 2CJ9A 1J5EF 4B1WB 2Y8WA 1EKSA 4AYBD 2VG6A 1IJEB 2JC0A 1YRXA 1JCFA 1H3DA 2W7AA 4P7VA 1UVNA 3O80A 1B7FA 4WU3A 3JYTB 2ZKUA 1WTBA 5EWFA 5H9EJ 1OSCA 4LSNA 1U47A 1NMNA 2LXFA 4HH1A 3RR7A 2RF2B 4JI2F 3LDSA 4C0BA 2RHKA 5C15A 3AFGA 4NCGA 3A8IA 3PNIA 5FRMA 3J7ZO 3CMAN 4FNHA 1MSWD 3O9SA 4WBFA 4PWWA 1UVJA 3CEDA 2HZVA 1U45A 4CLZA 2GS8A 3V6HA 3NWRA 1RDWX 2FVCA 1NB7A 3R5AA 1GOCA 5CE3A 4FW2A 5LJ5Y 4WFXA 2C42A 4LF8K 2CNLB 3FRYA 1S57A 1TKTB 3MX5A 2A2DA 4DQIA 2D0AA 2ZH9A 3OR1A 3WXIA 1RT3B 1S99A 1C1CA 1SUQB 4QPTA 2HMPA 2KXFA 3PY8A 5HN0A 2PD1A 3BKUA 4QWBA 2Q6BA 2DIUA 1NJIO 2HMIA 1JJ2R 3IDHA 1IBLK 3CWJA 1KXPA 2RRBA 3D0PA 2C2EA 5B0FA 2V67A 4ZKAA 3BO2A 4CHNA 3OFHA 1OJ4A 3H6EA 5CZVA 5D4LA 1ESVA 2X1FA 2PGCA 1SI9A 4AXJA 1FDNA 1RBSA 3GV7B 1VQPN 4IDKB 4DV7J 3UVJA 4NOHA 1YHQS 4DR3K 2BEFA 3EY1A 2YI1A 1T11A 2WBMA 4L74A 4WF9Q 1V4TA 1BC6A 4DF4A 1YVUA 3FGUA 2CUYA 4F7VA 4OZ5A 3OQ2A 3L2RA 2N4CA 2Y8YA 1VQ8N 3NS6A 5AE3A 1Y11A 1TELA 4NX9A 1HR0F 4HVJA 2DR9A 2N82B 3I9ZA 3TAFA 2DR8A 5HQLA 3I4PA 4DJBA 1NMEB 2HRTA 4M3ZA 5ETQA 3C2PA 1HQUB 3BN7A 2Q97A 2GQ2A 4WYBA 4ID1A 1HNZK 2KW4A 1GT8A 4U95A 1XHXA 4DZDA 1RADB 4FOIA 4R5PB 1VQ7N 2E29A 1UPMB 2RDIA 4OYBA 1WHYA 2VFTA 1VSLA 1XUPO 4O3QA 3QJPA 3MXMA 2BQRA 1N6QB 3HVAA 3O8MA 4ID5A 1JJHA 3POTB 3ILOA 4K41A 2NZTA 4V19S 2MQQA 2ZWOA 2DY1A 3VTHA 3HJVA 1K8AT 1VQ9N 4ECSA 4K4VA 2ZGZA 2L9DA 4OYAA 3L8BA 3NGZA 3W7BA 3GP9A 3NOCA 3OFFA 3EO3A 1XWLA 3CCZA 4BC9A 1OH6A 1QSLA 2V8VA 3JSYA 3LW5C 1VK3A 3BBFA 3IR6B 3HPGA 3PV8A 1YJNN 4OI2A 3I33A 3U27A 4X64J 2Q43A 3BY5A 1YJWN 1YBUA 3PCOB 2UUWA 1Q81T 1BGXT 2YPYA 5J1EA 3ITHA 2QT7A 2N4DA 3SFUA 1AXQA 3KUGA 3D45A 3J81j 2PMZD 1XC3A 2IA6A 1HWKA 1FT8A 3NGDA 2QV6A 5CD4H 5EVZA 4YDXA 5L9XA 3TUIC 1Z25A 4A4JA 3VQ8A 1TKZA 3G6XA 4ELTA 5FLXU 5IWAF 2B4VA 2ZH6A 4O5FA 4HT7A 5DDQC 2HGMA 4ZIWA 4NA2A 2B4JA 2DYAA 4M3UA 1YGYA 2BKNA 4UW2A 4ZITA 2M70A 1DAXA 5FPNA 1S5JA 4Y2CA 1FFSB 1R8CA 3RAMA 4Y0WA 1V4SA 2V2KA 3PACA 2NXCA 1VSMA 1NH7A 4OPHA 2ZOMA 4MO5A 3FNNA 4FLYA 2DFFA 3HOSA 4BRKA 1HIYA 5AJ3J 3TJ8A 2HHHJ 1LFPA 4PPZA 1VMBA 4DR4J 3MAAB 3CIZA 4PG8A 2OSQA 2GV1A 4LF2A 3C95A 4NZ6A 2HYIB 4EBCA 3W2WA 4HEA9 5CH7B 3OXGA 1T95A 2CPHA 4CEZA 4H0TB 2BM1A 2D9PA 4N56A 5KFSA 3AAPA 4EYHB 3AH6A 1WN7A 2FJAB 1BWEA 4OYXA 1CSJA 2B9YA 1BWFO 2BM0A 4B3OB 1NBEB 5KRSA 5D3GB 3RR8A 3S01A 5L38A 3V81A 1DHMA 1RAHB 4Y34A 4ID8A 2H3EB 1CQMA 1FFWB 4FJXA 1H6KX 2EFVA 4J9VA 3QFPA 3R2DJ 2OD4A 2LFVA 1J5OA 4GKJK 4QS7A 2ERRA 4W92B 2Q1NA 2QLWA 3AAQA 2YHYA 1AA1B 3KJNB 2UXBF 2DY9A 3PRVA 3KD5E 3G10A 2XULA 5HMXA 1T0TV 1LEOA 5DQHA 2JZ5A 3QEXA 3O3FA 3SUOA 1T7PA 3VMFB 2LMIA 2D9OA 2IHR1 1WC4A 2KO1A 4QR0A 4B9VA 4ECQA 4GY2B 3THXA 5I42A 5GADP 3AV9A 5KFVA 5CHIA 1N5TA 3KYLA 2YX1A 4PQUA 1RT2A 3BGUA 4DV2F 3T6BA 2DGWA 1X4HA 2VBZA 1X0FA 4PA1A 1RT7B 2VQFJ 4CZLA 5G0RA 3TSPA 1WOQA 2OANA 2VG5B 3LO3A 2PI5A 2AT1B 4DV3F 1UOCA 4LFAK 4RNMA 2UUAJ 1CJTB 1N52B 1B3TA 1VQMS 5AQFA 2QKBA 3CDUA 3SXLA 5M1FA 3CDEA 5DDRC 4GVBA 1ZAWA 2JWLA 2RKIA 4H4KA 4D3GA 1RA6A 2H4YB 4P52A 3QIPA 1WLJA 3K7RA 4F4XA 3NMAA 5GINA 3BREA 2B0GA 1TMJA 4RL1A 3CF5Q 4LF5J 3EE9A 3CDBA 2UUCF 4G65A 3QRPA 3UR3C 1DLOB 2KJWA 1Q5YA 1YF5L 2DGXA 4Q2MA 1HPMA 2XNRA 3O4WA 1J9AA 3OYDA 1WTFA 5E3QA 1TL3A 3GIJA 4KAZA 2FBYA 2CJXB 5C2FA 4O55A 4EGLA 1UA0A 1NSAA 3KHYA 3VAKA 2RS2A 3ONQA 4CTAA 4JKDA 2AMCB 3BV8A 3CIPA 3PO5A 1SXLA 3CJSA 1U09A 4BCAA 1CZ9A 3T1HK 4JI0J 2WFBA 4ZPAA 4KTZA 4M5JA 4OX8A 1FW6A 4DV1J 1WEZA 3FFIA 2ZC3A 2OAUA 5IOLA 3VA0A 1HWIA 3THVA 3L4BC 2GA7A 4Q45A 3F44A 3SAHA 1YJ9S 4H0YB 3H2LA 3NNAA 3CFOA 2JX2A 3TVKA 4X65J 3MCSA 3B4DA 4YQWA 4CH1A 5HANA 3QATA 4PUOA 5M1OA 3BPDA 5H9EK 3IG1A 4YOEA 3M6VA 5I3UB 2XEXA 1DRZA 2DNQA 4A57A 4QYZK 3NGUA 4NYZA 2G4BA 2VASA 1S6UA 4FO0A 2PO4A 4M63C 4OZ2A 2P9SB 5ETMA 5F3ZA 1SKUB 4LRBA 2PZSA 1M90T 4RW7B 4CJUA 2NXUA 5KG5A 5KFZA 3Q23A 5E3PA 4OYPA 3M2RA 4KFBB 2I7PA 4FLTA 1DKGD 4U9RA 3NBPA 3DYAB 1EQ0A 4C8NA 1N0VC 3SI8A 2D0OA 1RT5A 3QSYB 2V2VA 1NDPA 4CJ3A 4FJ8A 3TQEA 2NQPA 4J9QA 3SSRA 1ASUA 4A47A 1PBUA 4U8YA 2BACA 3PJ9A 4LF4F 2IDLA 3E9OA 4LRDA 4FZYA 4BDPA 3EKUA 1S0OA 4H5VA 4IBNA 1FXXA 3SSSA 2JHEA 4FZXC 3WNFA 3DGPB 4M3RA 3MMJA 3RUBL 4NZ7A 5LJ3Y 1UVKA 1X4FA 4JI6K 2Y1RI 2MZQA 3Q83A 3B6OA 4IH7A 2W8KA 1EQMA 4DF8A 1HMVA 1BWVA 3ZSZA 4CVNE 3VQDA 5AFUA 1KKHA 1S6QA 3TQ1A 2OYQA 4LFBK 3O2IA 3M7VA 2GJ2A 4LBPA 2FPHX 4ANCA 1RSCA 3O9RA 1VQLN 4EI2A 2UV8G 2GNKA 5HL7Q 2RT3A 4BY9C 4YHHJ 4N47A 1TUGB 4OLPA 3U02A 5F9LA 1Y0HA 1GLCG 3CULA 5KRTA 3LDOA 3I82A 2R7QA 5E33A 2W25A 3WEEB 1S0NA 3VGUA 2R9LA 4FWPA 3RBXA 4C8LA 2VB6A 2WOMB 3W60A 3H5YA 2HBKA 4N7TA 4WTOB 2K06A 4FPIA 2XS5A 1WKJA 3FDSA 2FVSA 1RYRA 4OGCA 3NGYA 3VENA 3M8PB 5FDLA 3PDNA 2FGCA 3VESA 3THPA 4MYUA 4KB1A 3L7UA 1GLBG 1D9AA 2E5JA 1QVFR 1SH2A 3O3HA 2KZMA 1NGBA 2KT3A 4WKRA 4BQLA 3A8JA 3IO1A 4FK0A 1EHWA 4GV6A 2UU9F 1N0UA 1WORA 3VR1A 3X3UA 2QWPA 2DIVA 3QESA 1WSVA 1FD2A 3LDPA 4KHWA 5KI6A 4RW9B 2AU0A 4XK8C 1ZH5A 3DLGA 1LWEA 1GMUA 3BM7A 5KGWA 1C2PA 2QLJB 2FZKB 1O1WA 2BTFA 3T5KA 2O8EB 4BRGA 1NBWA 3OTOF 4H5NA 1CS4A 3GILA 4PYDA 3J7YI 3KOAA 2NCKL 4UY8T 1KSPA 2O66A 5DLGA 3N6NA 3QBWA 4W5NA 2WVBA 2K8GA 3DRRB 3T1YF 3L3CA 2AA4A 4OYWA 1QAYA 5KOWA 5KG0A 5LMNJ 3IKMA 4MLHA 1Y10A 4F4ZA 5AXLA 5KFRA 3AA8A 4WFZA 4IG0B 3M9OB 4I1TA 2QTDA 1HWJA 2YX4A 3HFZB 3OL7A 2H51B 3DOKB 1BHLA 1T3OA 4QIVA 1U1KA 3AVAA 4OHYA 3CIMA 4PHTX 5AR0A 2IM1A 4YMEA 3GLJA 4KHRA 4F3TA 3OXLA 1QM9A 2EW9A 3MOJB 3MK6A 4C8OA 4BRHA 2DCLA 2DB1A 3CD5A 4OJHA 2ZH2A 3V1QA 1U1QA 1TVRA 4BG9A 3CCES 1K9MT 3H4DA 1D09B 2CIMA 4ZPCA 4A61A 3KG4A 1WWHA 2HFVA 1F5BA 5C5JA 2OPSA 2VPXB 2E7XA 4ICLB 3EE8A 3ENWA 1VC0A 1GAOA 3BQ2A 5EU7A 2WAQD 3A1YG 3THTA 3RB6A 2VQEK 1FJEB 4IWVA 2ZJQL 3AO2A 2LQ9A 3CCWA 2HHHK 4KGMA 2XY6A 1F2HA 1RKJA 4DR4K 2HRUA 3E2EA 4DCPB 2W24A 3JAMU 3ZZ0A 2A1BA 1RYSA 1HPZB 1YBAA 2P9IA 3TSQA 4DBQA 3AD8C 3A5NC 4J37A 3OJSA 1ZXOA 4CHQA 2AJ2A 3FBFA 3HDSA 3A5OC 4MIAA 1QS4A 2AGQA 5AQMA 2ZQBA 2ZEJA 3A3PB 1LW0B 3MR3A 4OHXA 4CBWA 3I96A 4PKDB 1H98A 2NXNA 4FLVA 1FVQA 4RNHA 4O0JA 1WOSA 5HVGA 1UCNA 1IBMF 3HOTA 4WPAA 5ETKA 7AT1B 1IKVA 2DXEA 4O8UA 4FZVA 2YJFA 4NLCA 4CBXA 1WHWA 1AW0A 1MU2A 5HVFA 1S3XA 1FFGB 4RU9A 1RBAA 5C12A 1XMQJ 3CD0A 2FF3B 4UZBA 3O6QA 2L41A 4FLUA 1SQFA 1XBWA 2AW0A 2ZM6K 4QOTA 1BQXA 1DT9A 3TSUA 4CK2A 2NPIA 4ZOSA 3KKSA 2QLFB 3MPYA 4DLGA 4CW7B 1T44A 3DLRA 5G4DA 2GZOA 3DRSA 4AUKA 3KNGA 4FP9A 1FEEA 3OL6A 4E1NA 4CQ1A 1L3KA 4YB1P 4Z4IA 4TKTA 3C6TB 4F2RA 4JI1F 2RU3A 2C22A 1WSJA 5LXRA 3OYNA 2V8GA 3DDKA 5LT5A 2NR0A 2VQFK 2RIJA 4KRWA 2CKWA 1EX8A 4CF9A 4K25A 4WU2A 3QNWB 3CMES 2VODA 2HOEA 1SJ4P 5K8MA 5EHHA 1FE4A 2DISA 5DGBA 1HNVA 3A5MC 4LBIA 3DLBA 3KK1B 1TL7A 2LU1A 1V3SA 3V6JA 2R7XA 3OUYB 2JVRA 4A8XA 1TV6B 3O4QA 5L46A 4RCHA 4DSIA 3LTOA 1UWAA 4CESA 2C1EB 4I7FA 3MHYA 2KM8C 3OVAA 4MIBA 1KS2A 2VOOA 2BV3A 3WXMB 3BP8A 2B43A 1HI8A 3THYB 2F8EX 4LF5K 4GKKJ 5AXNA 4QAGA 4BROA 4UQGA 3GFZA 1YJTA 3TAGA 1TK8A 2NLXA 3C65A 2GMHA 1CJKA 3H8YA 4PKGA 4RUBA 3OW2M 4ZLJA 4M5KA 3MCMA 3UB5A 4CE9A 1E4GT 4B3MK 1RE1B 3JTPA 3LOUA 2QSWA 4BRIA 4CJQA 3QFHA 4Q8FA 5DETA 4O4RA 3D2FB 5GMDA 5HMZA 4DV1K 1QY7A 2COLA 1EETA 4DUYJ 3N5BA 3TNVA 3E51A 5D15A 1RBLA 3BJYA 2RE2A 1W2IA 3MCOA 4ZVOB 2VONA 3B8HA 2XO7A 4AHRA 5CYJA 2O8CB 4C98A 2PFUA 4CD3A 3MTJA 1OS5A 4X65K 3G71S 2BANA 4DFKA 3C6AA 2N7CA 3TP2A 3EZWA 1YJUA 3WQTA 5DG9A 2QA2A 2M9KA 3MM8A 4CT9A 4RLEA 2P8IA 1QSSA 4YR0A 2EKNA 3AVJA 2ZC4A 5ITHA 2HS3A 2FHMA 1ZETA 1HUXA 2G1HA 4KH4A 5F2RA 1N33J 3ICLA 4H54A 5TKWA 4RW4B 2XZTB 2G9OA 3HRGA 3ZTQA 5D4OA 1IM6A 4Y6IA 5BPMA 3B8AX 2X78A 2XS7A 4DTOA 3QT7A 2VV5A 4USIA 5EWEA 1H7WA 4CJLA 3UKRB 2Y1JA 4O44B 5KOXA 1X8DA 2CQPA 4FJ9A 4F2SA 3R7SB 2RNEA 2GAGC 1GNKA 4HACB 5ETPA 3BDPA 3KNAA 1LWFA 4WK1A 3VALA 2QL9B 3MM9B 5GMKa 1S0VA 4J9LA 2K7JA 4JI4F 2OCEA 2OEJA 3TAPA 2MZSA 5EX0A 1MMNA 3MMCB 4MK8A 5LY3A 1TFWA 2XHBA 3FE1A 5BREA 1YTUA 2JWKA 1WSGA 3JXUA 3O1BA 2P9PA 3G8SA 4E19A 1B9FA 5KG6A 3DI6B 4OMFG 3TUJC 4RBTA 1GLJO 4Y28C 2Q2RA 3C14B 1BY9A 3ADAC 2DHSA 2RMLA 3VETA 3CTRA 3KHHA 1QZ5A 3SMPA 2JSXA 3G6VA 4A59A 4GW6A 1K8KB 3OL9A 1RT4A 3CJ4A 1BDGA 3OBIA 3C7NB 1VRUA 2W7PA 2FJWA 2ZFHA 4FLXA 1BU6O 4WTYA 3OSPA 3CB4A 3M32B 3OTDA 4ZP9A 4JP8A 4LREA 3SPZA 1N5QA 4BHQA 4DX7A 2AJ1A 3EGWB 3J7A1 2IC3B 4CEAA 1FHTA 4QS9A 1I3AA 4RBVA 1JJ4A 4HCBA 2E44A 4DV6F 3PFOA 2G2YA 4K43A 4A5BA 3UD5A 3D7EO 3VQBA 5HMYA 1Z2LA 4LF9F 3CERA 1B0TA 2IVMA 2XQCA 5KGXA 2HQIA 4JKEA 4NLYA 4YOTA 2O67A 3P3DA 2QFIA 4I0WA 4PKHA 5LJVA 2E2PA 3HL8A 4M1KA 1KDNA 4WFNL 4MIWA 4ZN3A 1DURA 1U8SA 1LW2B 1JXVA 2BE9B 4ISGA 5LMUF 1XR7A 4DCHA 1NJIT 4LR9A 3LAMA 3ZZOA 3KHLA 1U6ZA 3H45C 5JICA 3QICA 3KLHA 4URGA 2H5JB 4AL7A 1NGGA 3T7ZA 1CBKA 2F65A 4YS2A 4IDHA 1L3UA 3LL3A 4RW8B 2XGPA 1WB9A 2JLFA 3GFXA 2UVVA 3L09A 3TWZA 1HHTP 2DH9A 2GQQA 4F50A 1T03A 2XI3A 1RDRA 4DR7J 4QOZB 4JKFA 1FDAA 4LF1A 4LBHA 5LMNK 1RAGB 2ZVSA 4Z7CA 3SFGA 2NXJA 5AXKA 2NZ4A 4CECA 2NPFA 5AQKA 1UWBA 3SI6A 5CCLA 4G1QB 3HMJG 1H38A 1FJGF 1FA0A 3MR2A 3VQ7A 3QRRA 4Z4FA 3UN2A 3SEOA 2QMUB 3QO9A 1WAJA 5A8WB 1CLFA 1DY3A 3TABA 5DG8A 5KPRA 3ASMA 3PJWA 3SQ0A 5KFAA 1Y9OA 5BR8J 3ZSOA 1C1BB 4ILJA 2JRSA 1VRTB 3U9DA 3AD7C 5A0YA 3CMAS 4ZTJA 2IOCA 2HG4A 5GAGU 1CZAN 3ULEA 2BJDA 3KZBA 1U2CA 4RNFA 5IM0B 5D77A 1VQ6N 3QRQA 2RS8A 2KI2A 4M5DA 2ALZA 1EXQA 3ZEUA 2MGZA 1J6ZA 2FJDB 1LWCA 3BYRA 3DDNA 4IJNA 1FWLA 1SQEA 1VISA 5AQYA 1S1UA 1G15A 2OPQB 1M5HA 4RUAA 4HHTA 1NOYA 3CCLN 2Q66A 4A8WA 4ENOA 5T7LA 2XHCA 2CPEA 3CCQS 3H5SA 2BOAA 4I56A 3DU5A 4ED1A 3K59A 3NLCA 1LK5A 1JJCB 5SZTA 1JCEA 2EI5A 3NMRA 1U1MA 3VZIA 3VERA 4KRFA 3TTCA 2RSQA 2CQ0A 2R7SA 4NLDA 3JXOA 1WC6A 1SKRA 3L7PA 3Q24A 1VQNS 3I32A 3ZZRA 5CYQB 2NRWA 4BRQA 2F4VJ 2CPFA 3DMJA 2KLAA 3HULA 4M45A 3HSTB 1YZ7A 2W9BB 3TOQA 5KFJA 3VF6A 1WACA 4ECXA 4CLKA 2GVDB 2YNIB 4JBCA 4FF2A 2U2FA 4BC3A 3ZZTA 2IRXA 2I5JA 5BRFA 4Y2AA 1XMQK 3CC7S 3AXKA 3T5LA 4CJVA 1JLFA 4IYQA 2ZE2B 6AT1B 2VGMA 2XYGB 1S76D 3GB0A 1VQ8S 3RVCA 2C3PA 2HSTA 2UXDJ 3BS9A 2AJQA 1Q18A 2H1YA 1Z05A 3RSEA 1S9GA 1W25A 2A10A 1F60B 2H5IB 3QWPA 4XDCA 5KG2A 3FZMA 2HLTA 1KFSA 2FSNA 4CFAA 1WAFA 4KHQA 4ZVFA 3NP5A 1UEUA 1LOTB 3SDEA 1HBMA 2I7NA 2XLIA 5KFXA 3M2UB 3UDVA 3IS9A 1LXNA 3NH0A 3DXSX 4F25A 2Z30B 4RW6A 2RUSA 3LGNA 3DFEA 3P45B 4X62J 3FCVA 1WI6A 2WK4A 4H0XB 4LRAA 1L3SA 2OMOA 3QBCA 1UTAA 4FF4A 1CULA 2P9LB 2AYGA 4DR1K 2ZHAA 2FZGB 4YY3J 5KFDA 2C3UA 2HPUA 4BR9A 4NLVA 3G6YA 1JB0C 4P72A 2P9UA 2V4JA 4OV1A 3MN5A 4BDYA 3V1RA 4PWDA 4Q8EA 5J2PA 3HHKA 1VQ9S 3TTFA 3G0ZA 2ASDA 3MCPA 4GKKK 2YQ0A 3LPEA 3QAUA 3BF3A 2DT9A 3Q8YA 3VOVA 2E1PA 1T6DA 4S0MA 3MN7A 2G8WA 3L95X 1F6TA 4DV7F 3JB9k 3R1HA 4KTQA 2NUUG 2RQMA 5HP1A 3GCXP 4J9KA 5HRNA 1JJ2M 2HHXA 1KQSR 1N32J 3ZETA 1URRA 4CK1A 3GMGA 2MSTA 3WDOA 3AODA 2ZJQQ 1S79A 1VHIA 1DTQA 3Q86A 3VQ9A 1VRQC 4PQAA 4JI3J 3CCRN 2UUBF 2WHOA 2HK2A 4DUYK 1IO2A 3Q8QB 5CA5A 1VQSA 4TU8A 4CP5A 1X4EA 3PIOL 2OPPA 2FYXA 3EM1A 1Y5LB 3ZTPA 1I51B 1P1LA 3HKWA 1WI8A 3AAWB 4MYTA 3UW1A 4Y1CA 5HQMA 4LRFA 1A5XA 4UZCA 4B9TA 5BYRA 1VHXA 3U3GA 4E3SA 1N36K 2G8HA 3GR0A 4Z2XA 3CJTA 3THWA 5CZ2A 2VJUA 4LSLB 2FY8A 4ED4A 2B9XA 4DMZA 1RHMB 4AQYJ 5ADXH 4JV0A 1KVKA 5HVHA 3AT1B 1HA1A 3KJVA 2MQ8A 1N33K 4KREA 2YWWA 3IAS9 3BBCA 1HNIA 1IBKF 1QE1A 3HVTB 1N5YB 4ETXA 3A5LC 5F41A 1GFWB 3DXKA 2FLPA 3VV2B 3OR2A 3CCUN 1TL1A 3UR0A 1RTHB 4HHUA 4EU0A 2L9WA 3R6GB 4J2AA 3ZT4A 1UAWA 1ZBIA 4WE1B 4X64F 3W5ZA 1OY9A 3FEZA 1D3WA 1YZ6A 1EAYC 5AQLA 3NFAA 5JVHL 3DM2B 2QTWA 2QK9A 1CG2A 3WZ0A 4P73A 2B4PA 1EWRA 5AZIB 2J9DE 2HS0A 5D8HB 5HO4A 2FZCB 2MY7A 1G6BA 2P9KA 3P49B 4OZ3A 2CVIA 3K9JA 5C24B 1Z1ZA 4DSEA 1Z26A 4CIFA 3SV4A 2HHTA 1UFWA 3VF2A 4A8FA 5CHCB 4X4RA 3RBZA 1IR2A 1EP4B 5CXTA 2VICA 3D6RA 2VKRA 3MX2A 2BJ8A 4ES3A 2XWXA 3ENAA 1K8AO 2D0PA 5AJ3F 2HHHF 3MR7A 4PL8A 1U2RA 1VSIA 1Y97A 3IR5B 1AB8A 3NAHA 1IJFB 4KGZB 2BE2B 4DCOB 5JXSA 4JYAJ 3L3VA 3CYMA 1Q81O 2JDJA 5FPDA 4DTSA 1FRXA 1RNHA 1X31C 2VFRA 1BL3A 1C0TB 7FDRA 5LOQA 1NPKA 4OZ1A 2A0FB 3PKMA 2PMHA 2GWJA 3PJXA 3CC4N 1WEXA 1RKIA 2DGSA 2FHJD 4CO3A 3C19A 3N6MA 4RWXA 3MEDB 4ZLPA 4K4SA 3HFKA 3H40A 3V9ZA 4OX9F 3CJKA 1WC3A 4ZDNA 3J81O 4C8KA 4DR6K 5HMWA 4RJVA 2BR0A 3NWGA 3OVBA 2YX6A 3SCXA 5JMVA 5AZJB 1RTIB 4LQ9A 3X1LB 3OFEA 2CXEA 2KFNA 2FVPA 4C3KA 4JI5J 1IR1A 4JV5J 2GHPA 3CCMS 4DR7K 3BEXA 1R0AB 4NXNJ 1MNEA 4JI7J 3H08A 2Q36A 5AQXA 1REVB 4KH5A 4A46A 4ED0A 4K7QA 1WOPA 2UUAF 2BGGA 1SL1A 2VGNA 3F41A 1H2VZ 4B9MA 4H5TA 4ED8A 3CCJS 1O5JA 2M8DB 4IKAA 2ZBIA 4HVZA 1NAQA 4F3MA 3B82A 4L3NA 1S1VB 4NL5A 2YTCA 4LSNB 3AVCA 3G6ES 1N8RT 3UCZP 3TARA 3RG6A 2R4FA 1GLLO 2VHGA 3AO3A 2OGUA 4Q7AA 3LPYA 5E0OA 1QZ6A 1VCTA 1OQ3A 2HHQA 1HNWK 4DEZA 2IM2A 4KO0B 5EOYA 3U9ZA 1UAXA 3CJ8A 4LF5F 5GADU 1YT3A 2ILYA 2VBWA 4YOVA 3EICA 3RYLA 3SIPB 2BRLA 1XTZA 1Y00A 4IOBA 1KTVA 2FTRA 3SBGA 3JYTA 4KHSA 3PW7A 4USHA 4JK7A 3LDNA 4C97A 4ZPVR 3SQ2A 3OYIA 4IO8A 1U26A 2QJ3A 3MN9A 4OPAA 1VR6A 4L6V3 1Y5NB 3EPGA 5EX5A 3TUZC 3G4SN 1XNRF 2LKZA 3IA0A 3F0NA 4CZKA 4K2XA 4JI0F 2EWHA 4DR2J 3QMLA 1C1CB 2F4VK 3H7HB 4FCYA 4DR5J 2J0SD 4EK2A 2FSKA 2GIRA 4ZJLA 4WQ5C 3MM6A 3QB0A 4ZIVA 2CDRB 3OYAA 2HMIB 4XTTA 2F5GA 3NAIA 1SV5A 3U7JA 4KR0B 1VQKN 4OL8A 2LQJA 2V4QA 1ZA2B 4ZK7M 4FSVA 1JLAA 3VQTA 3MGJA 1SUQA 2HKEA 2E1CA 3BZCA 1VQ4N 1PSDA 2OIHA 3GONA 4CERA 1PILA 3UVJB 4UOCA 4TY8B 2FDNA 1G99A 1VSDA 3FLCO 4WFNQ 4MT1A 2QXFA 3TRGA 4E7HA 3A3OB 3I55N 4DUZJ 3CJCA 3OYLA 4EWTA 2DFHA 2K1RA 2XNQA 1WEYA 4PG6A 1PC4A 3MF5A 2KFYA 4QIGA 4ED7A 2CADA 4X66J 2RD5C 2O3DA 5AQWA 1KC8T 2R7TA 2OP5A 2XRIA 1OVQA 1K47A 4PCQA 3TJ9A 1RZMA 4I2QA 3V9SA 5HI7A 3RRKA 4M5GA 4X62K 4UUWA 2JC1A 5BPNA 2UVRA 4LFCK 1YJ7A 2IGIA 2I8EA 2E4LA 2DK2A 2HURA 1SB6A 4ILGB 2RUGA 3DLJA 4B9SA 3CDWA 5L1LA 3RMAA 2IM3A 1EIYB 4FBUA 4ECVA 4M42A 1PJ7A 2FBTA 4FYYB 2FJBB 1HQUA 1YX2A 1ZPWX 3MWTA 1XI1A 1B99A 1VQYA 5FIIA 2Z1GA 2MXYA 1WG5A 1VLYA 1I94J 3EZUA 3TTDA 3MPDA 2J4RA 1G2EA 1BUXA 3BGRA 2MHEA 2VH7A 4YOXA 4HTJA 2BJ7A 1XQSC 1TP7A 2MYFA 4K0KK 5IC6B 3GL1A 4HWIA 1N34K 1RCHA 1KRPA 1R6VA 3D6FB 4YHHF 2V69A 2RPIA 2NRVA 3POTA 1P1TA 4RZRA 4H0OA 5F8MA 5DDOC 4IFYA 3FQLA 1N32K 4MH8A 2Y3YA 3O08A 3RRGA 3HT0A 3CM5A 2DHXA 4KGKA 3MEGB 5J1EB 4TLRA 3ITHB 3MI7X 2VKZG 2UXCF 4P6QA 3BPSP 1UPPA 1RA7A 4B3SJ 3ENBA 1YQHA 2D3UA 4OHVA 3TAMA 4H5WA 4I4BA 3J7YP 1AFIA 3P8BB 5KG7A 2O8FA 3FBCA 2HNZA 1NO8A 2MLZA 2VA3A 1OWXA 3LANA 3K8WA 5LSOA 1TYQB 4FM2A 5J1NA 3BBBA 4QR2A 3FEYB 3CQXA 3DXMA 1P6TA 3NE6A 1RLDA 2W9CB 2WSEC 2E5IA 2VIHA 3KXDA 2E20A 1NDLA 4AQYK 2L08A 1TK0A 3SK3A 1QVFM 2FIUA 3VTIA 1NU4A 4BDZA 3QQCD 3MWBA 2GAHC 2FLLA 1VGYA 4NLQA 2HBYB 3T69A 2G1DA 3GG1A 2D1CA 2XSJA 1WBDA 3EE3A 3W2WB 3WIUA 2NUHA 4KHPF 1N5VA 4OX6A 2R2SA 3H1VX 2VOPA 3FCHA 3TO8A 4A8YA 1WF1A 3FZBA 2XHWA 3VPZA 3V81B 2HHVA 1XNQJ 3MM5A 4DV4J 4F04B 4LF8J 2KJVA 2V5HG 3TZXA 2CNKB 2XGQA 2QC3A 1G3OA 2HIQA 4IKFA 2EBGA 5D3GA 4CJKA 3MXHP 1APSA 4WZMA 5F8GA 3GFHA 3BGLA 1ILYA 3LALA 2OD6A 3K5MA 3CSKA 3LF0A 3V6DB 3THXB 3J80O 3GJTB 2KKZA 3KLGA 2E66A 2MKCA 5IT4A 3O1WA 4PQUB 1RT2B 2X6NA 4HHJA 4Y2MA 3W62A 1BIZA 2V4RA 4ECTA 4MLEA 2DNRA 1SC6A 5GAHI 1Q1KA 3NEKA 1PBAA 4UY8O 1A9NB 3QLHA 4W5OA 1S48A 3O9QA 5G0RB 4KTWA 1KBRA 4K50A 3D54A 5K5MA 2M8HA 2FLNA 4ECYA 4F0MA 1RJJA 2BJEA 2WBNA 4V1Ak 3K58A 2R2RA 4ECWA 4GVBB 1K73T 3W0LA 2XO6A 4OO1J 2ZJRL 2RKIB 1UVLA 3VQPA 4E1JA 4CM0A 5F9NA 2XYHB 3QIPB 3T3FA 4O4GA 3KUEA 3C15A 2E5HA 4NEZA 2EFGA 4F02A 1JLQA 4JB8B 4FM1A 3AVLA 1HNZJ 3N4QA 2VC0A 3KK3A 1PC5A 1U25A 1K9MO 3ZZYA 5C25A 5SUHA 4C3LA 1NGJA 3T1AA 3PIOQ 1FKPA 4KI6A 1IBCB 4BG8A 2W42A 4DQPA 4HR2A 4JKGB 4GC6A 1VOMA 1TL3B 1TMMA 2YHXA 1BQNA 1BCMA 3IGNA 3ZSVA 2AEFA 3DKDA 1UFLA 1VJQA 4KBOA 4FOEA 4CTAB 1KVCA 1M1KT 4OLBA 1DLOA 4BC5A 2AIRB 4F3QA 4JI5K 3HP9A 4FK4A 1RBRA 4JV5K 2F1FA 3V6KA 1SL2A 1O0PA 5KFCA 4FWKA 3FZKA 1N4LA 1P9YA 2DJWA 1YRTA 3HF5A 1QQMA 4NXNK 1GXLA 2BDPA 3GG0A 3H42A 3NF9A 2R7OA 1HQ2A 4JI7K 3QNOA 1FDDA 4CZJA 1BXNA 1K6YA 4JRQA 1OY8A 5AQIA 2KKHA 2C3OA 1NEEA 3W61A 1LAWA 1O6XA 1XMBA 4Z4HA 4ZLLA 1NZ8A 4QJVA 4DFPA 1YTYA 5ETSA 4FL9A 1XERA 1XHZA 2KXNB 1B7YB 1RILA 3MMBB 1FRJA 2JLEA 2GW8A 5LJWA 3HD2A 2IYGA 4PUOB 1JLEA 3IG1B 1KEKA 2OSRA 4BRNA 3EDQB 3W8GA 2EFNA 5AXMA 4WXWA 3ZYYX 5EN1A 5JVHQ 2RHQB 1OH7A 2G8IA 5DQIA 2PT0A 3FZHA 4ANDA 3ISNC 1K1SA 1T02A 3VGMA 3VAIA 4M7YA 1X4GA 5J2NA 3I5AA 5BJRA 1DQAA 2L48A 1NGAA 3HM9A 3N4WA 2JEIA 3M2RB 1WOOA 1WG4A 3FQKA 1UZHA 1GLEG 2VC1A 4P2FA 1ZBUA 3SUQA 1FK9A 1SC3B 1FE0A 3OA9A 3MUTP 5HBMB 4FXVA 4QZVB 1RT5B 5KFTA 2NSBA 4RUCA 3TU5A 2A2CA 3HFVA 3FUYA 1B0VA 3MWPA 1Q79A 2X1GA 1P27B 5L8RC 1JNRB 4WQ5A 4FPBA 4DB3A 4RW7A 1GTEA 3NGSA 4DR2K 3D5MA 3M30B 1R3NA 1YITN 4M5IA 3ID8A 4MO4A 4DN9A 2B3TB 4NLGA 1OH8A 1TUUA 4DUYF 4IO9L 4ED6A 1RAFB 3RZAA 3ATVA 1DFDA 4FLWA 1NM2A 1GX5A 3SV3A 4QU6A 3M8QB 5ETTA 5AQPA 1M5OC 3CJ9A 2YHWA 2O4GA 4IR9A 3EVMA 2F9DA 3PR5B 1E4FT 4NI2A 4Z4CA 3BKTA 2BKOA 2Z0GA 1MN9A 1S6QB 4KSEB 3G25A 3DGPA 1PGZA 2VFUA 4Z0UA 4NLSA 2LA6A 3GIRA 2MTLA 5U47A 1BI4B 4WXOA 4DPOA 3IUCA 3NAEA 3BO4A 2DH8A 2KN4A 1TU0B 2JWNA 4NRUA 1BCOA 1S4EA 4DUZK 1RHQB 1N33F 1RLCL 4CHPA 4USTA 1FESA 1FRIA 4JI8F 4CGIA 3IBCB 2NUBA 2Z4PA 2VUGA 2R2UA 1CJVA 4I9LA 4FVMA 4CNZA 4EMDA 3QDKA 2J6TA 3VAJA 3UNGC 4FNIA 2YX7A 5KFEA 1KHWA 1P90A 2WW8A 4LVNP 3D68A 2E2QA 2EWSA 4UQTA 1T9YA 4XO0A 5CR4A 4N76A 1RU1A 3ENVA 5KFMA 2OI2A 3MXIA 2WOMA 1SIZA 1R8AA 3WC0A 2R8JA 1XR6A 2BYCA 1JXLA 2HWIA 4HYKA 4M3WA 1MROB 4LFAJ 1HYVA 4CEFA 4FVUA 4ZTFA 3S6EA 3MR5A 3CCVS 1MG7A 3DLGB 5IWAJ 2FUG9 1LWEB 1VI7A 5KFHA 5J1PA 3CJ7A 3HSGA 3UNYA 2E1AA 1SH0A 4HKQA 1CXUA 2FJEB 4LQ3A 1RWXB 5JUMA 3D28A 3QBXA 4RW9A 5HLFA 3N4PA 2HEKA 1KTQA 1GLAG 4X4UA 2DR6A 4DU7A 4IH5A 2HFSA 4MK7A 4LF6F 2OEKA 4NYFA 4IUFA 2ZWHA 1QUPA 3N9UC 2LU2A 1KOHA 2MZTA 3DAWA 4J9SA 2F8TA 2WVEA 2QIFA 4OHWA 3OPKA 4B3SK 2FVQA 1NHVA 5D6GA 1MDUB 2HF3A 2ZH8A 4QYRA 2YH0A 3RBDA 3R3LA 2HBRB 4BVPA 4CD1A 3SQ4A 2JNJA 3H90A 1Q8LA 1N56A 1K1QA 5T14A 4DLEA 1TVRB 2A6MA 2HW3A 2IAJB 2CPXA 4JAXA 1VHFA 1ZBLA 2AX1A 4J9PA 2OPSB 1O8BA 3H3NO 2IRUA 3RW7A 4YB6A 1EQYA 5B0AA 1KLNA 1S6PA 1JKHA 2YKOA 4L76A 3I0RB 4X2BA 3VQAA 4ZJQA 2HS4A 2UXBJ 2BOPA 3ID6A 4AM7A 2E7WA 2EFPA 3M1VB 4FYXB 4X4PA 1HL6A 3J7Z5 3P5BP 3V4MA 2O8DB 4FW1A 2F9WA 2CVEA 1RAEB 2PMWA 1QAIA 1LQ9A 4RTFD 2P6SA 2IDOA 2P9IB 2ASLA 4QYZJ 3EVWA 3QJJA 1U6FA 4XAKA 4ICLA 2CQBA 2YKNA 1H0HB 1DTTA 1KAYA 4CO2A 4DPTA 1U48A 3H2VE 4DV2J 4DTJA 5AQTA 3MECB 1S1XA 2CJAA 4DU3A 5B0EA 4HUEA 2V9WA 3ZXWA 5AQVA 4H4OA 3PX6A 1XNQK 5L1JA 4CGFA 4DV4K 4DV3J 2A6OA 3M9NB 5IT9U 2AEMA 1EKEA 1NUEA 4JD2A 3KJFB 1RTJB 1MU2B 2C2MB 3ZX3A 3K5PA 2HIYA 2CG8A 3AOBA 2RU9A 4IG3B 3D6MB 3CM6A 3LDQA 5BR8F 2VYPA 5EWGA 5BR9A 2LP4A 2XB2D 1T9VA 1PG5B 2DNPA 1TUVA 4JI6J 2E1RA 3DRSB 3D0GE 4I64A 1C1AA 1VYAA 4IFEA 3Q8VA 3BGFA 2DPIA 5T7BA 2NNWA 1OIAA 3GPAA 1BOTO 3HHEA 4NLOA 2F8MA 2C28A 4CJPA 1VIXA 1RWVB 3SSQA 2IJFA 3SQOP 2B7CB 3CJ3A 4KQZA 4LFBJ 4RUHA 4RPFA 4ZMMA 4W90B 5D4PA 2E6MA 2F63A 3CNQP 3HSCA 1DZ5A 3IP0A 5K20B 2PA8D 4F3OA 4FKXA 5IQ6A 3D2WA 5LSLA 4QW9A 3TA2A 3H46O 5KT7A 3NOGA 1HNVB 4AFFA 1RT6B 1WELA 3BR8A 3SCIE 3TR5A 2GVZB 3IRWP 4DX8H 2R7WA 4EYIB 2CFXA 4ZPBA 1ZYQA 2B6AB 1Q53A 1TQLA 2JL9A 3TJAA 2L9NA 3VF0B 2Q31A 2CJYB 4N8NA 4B3RF 4B17A 4CYUB 1J5EK 3EWGA 1ZM9A 2R7YA 3JSMA 5SWMA 3EL2A 2J6UA 4YDUA 4FJJA 4NLRA 2AKWB 3P96A 1D1UA 2OLWA 2V50A 2E9RX 2CQGA 1W0HA 2CQHA 3R9LA 3GR1A 4JI2K 2I9SA 3OYFA 1IH7A 2GX9A 1Q86T 3UO0A 4LIWA 3M1FA 2UXDF 3NDKA 2QI2A 4IQMA 3ZFVA 3THYA 4DSFA 4BGBA 5LL6d 1KVJA 2M4MA 3O9TA 2WTFA 4DL0C 4JKBA 1RQ0A 2CDQA 3UKUA 1X4AA 4J9UE 3LP3A 4NA3A 1EETB 3K17A 1NLKL 5KFFA 1RP5A 3B54A 4ZVGA 2BA9A 1U2VB 2EC0A 4OYZA 5KTQA 4CFCA 4X62F 1NSKL 2B8PA 2OZSA 3PX0A 2E2OA 2DBBA 4X4OA 1UMJA 5HRPA 4YY3F 2ZH4A 2BANB 1TUYA 3AA4A 3VVTA 2HNDA 2BZ2A 4CZMA 5FPEA 5IV3A 3L6QA 1LFWA 2WUSA 1KQGB 2WRMA 2DNMA 3MM8B 2O1PA 1XMOJ 4RNNA 3KKRA 3AOAA 1CXQA 3HZ6A 1T9TA 4YB5A 1NJYA 1M0SA 4Q43A 2VCPA 2NRTA 2Z2YB 2WBRA 2O8CA 1XK8A 3CDAA 3T5HA 2WTUA 2HVEA 4AXIA 4B3TF 2ATQA 1YI2S 3HHLC 9RUBA 2R42A 2QW9A 1BQMB 4X4VA 1YJ9N 3GJRB 4YFUA 3GQCA 1MWKA 4B9UA 4KC5A 2OPRA 2E2NA 2FQQB 4IOXA 1REGX 1LKZA 3G87A 3EGZA 4OPKA 2VQEJ 1E6YB 2VWBA 2KYZA 1N32F 2P9EA 5L39A 3J8AA 2ZH1A 3CQYA 1WHXA 5C2GA 3O3LA 5K8PA 3JQMA 1OYEA 4C7QA 3OYJA 4CJ4A 3ZO7A 4WQ4C 1U1LA 2HBLA 1LWFB 3G8QA 4ECZA 1SJRA 2ROGA 3DOLB 4ZVHA 4JI3F 4AHVA 1EJ7L 4D3HA 1N88A 2WVDA 3ZT1A 3CPWM 2ZUGA 3QMQA 2X3GA 3MTKA 4ZVEA 4E7LA 3PYFA 4OKEA 3FSYA 3DLKA 2P9PB 2RE1A 3ZX0A 1KQSM 4KB7A 4HACA 1QQNA 5DO2A 2J0XA 2DNZA 4OJRA 2P5VA 1VC5A 2ZJRQ 2XMVA 4R8UB 3Q0AA 1ATSA 1TAQA 3RJMB 1HLUA 1RT4B 3M9MB 2QL7B 5BN8A 3WQPA 1VRUB 1PJ5A 1BA0A 4HI1A 3MMCA 1S22A 5AQHA 4TSXA 2WB1D 3H5XA 2GWKA 4AQYF 2BW7A 2QWOA 4K5RA 3KLIA 1YJRA 5ADZA 4AHTA 5K14A 3MFIA 3DI6A 3ISND 3OTOJ 2DO4A 2QG9B 4FLZA 2ZM6J 3IRXA 3T6JA 3HLUA 2E1MC 2QSFA 4OQJA 2GTDA 3VEOA 1Z4UA 3MR6A 2AD9A 5BXIA 1RU2A 1K8KA 2KHDA 3OBWA 3T1YJ 2QWQA 4K2JA 2EKYA 4JKCA 1YJVA 3IMQJ 3PYEA 1LWXA 4BRMA 2QZ8A 3BH6B 2D41A 5KFWA 1RT1B 3VEXA 4W5QA 3QNNA 2IC3A 2MQOA 3OLAA 1I39A 2N3OA 3D7SB 1VQOS 3RMCA 4OJ1A 3PW5A 1YWXA 3MM7B 3BN4A 1MWZA 2UUTA 3A8KA 3DRYA 4FKYA 1TGOA 2ZZNA 1F21A 1NJWA 5IWAK 5IT9Y 3KLHB 4KY3A 2Z1JA 2LQ8A 1QQCA 1X9JA 1HNXF 4C8YA 2H65B 4DTMA 3HSDA 3MD1A 5GIOA 3I4HX 3OHAA 1T8EA 3TX0A 4DU8A 2DTUA 1T03B 3AGRA 3WBZA 3PLAA 2Z2LA 1WNSA 1PAUB