5HP7A

Crystal structures of rida in the apo form
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
SQAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLADLADFKTVNEIYAKYFPAPSPARSTYQVAALPLNAKIEIECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of RidA, an important enzyme for the prevention of toxic side products
pubmed doi rcsb
molecule keywords Reactive Intermediate Deaminase A, chloroplastic
molecule tags Hydrolase
source organism Arabidopsis thaliana
total genus 33
structure length 108
sequence length 108
ec nomenclature ec 3.5.99.10: 2-iminobutanoate/2-iminopropanoate deaminase.
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 5hp7A00
4NWOB 1QU9A 2UYNA 3R0PA 2CHSA 2CVLA 3D01A 1FNJA 2UYNB 1NQ3A 1XHOA 1ONIA 1DBFA 1PF5A 3VCZA 4ZK7A 2DYYA 1UFYA 3LMEA 3ZP7A 3M1XA 2CHTA 2EWCA 3LYBA 1X25A 2UYJA 3ZO8A 3L7QA 2CWJA 3V4DA 5HP7A 3K12A 1ODEA 2CSLA 3KJKA 2IG8A 2CW4A 3I3FA 1QAHA 3M4SA 3MQWA 2UYKA 1UI9A 1COMA 3K0TA 3QUWA 2B33A 3I7TA 3ZP4A 5HP8A 3ZOPA 2UYPA 3KJJA 2OTMA 1JD1A 1XRGA 1J7HA 3GTZA 1FNKA 1QD9A
chains in the Genus database with same CATH superfamily
4BT6A 2I6RA 4C8EA 2LBXA 5EIBC 2Z1UA 2RHHA 2ZOVA 4LNUB 1YJWF 3VOBA 4BT2A 5IYZA 1VQ5F 3HKEA 2Z1FA 1VQLF 3JARA 3Q8HA 3CC7F 3RYIA 2H8EA 4RHAA 3RYHB 3C9SA 2AIZP 2BTOA 1VQMF 5JH7A 4ZI7A 1Q7YH 3FD5A 5JVDB 3CMEF 1JFFA 3BYQA 3RA5A 3S0WA 5GONB 2KTVA 2ALEA 2L26A 3VMFB 1ONIA 1VQ9F 2EWCA 1W3EX 5LXTB 2HX0A 1RLGA 4I4TA 1IPAA 1TUBB 4O4HA 1VQ7F 3HKDA 5G4UC 5GAPK 1IV1A 3E1YA 5J2UB 2HP0B 3IEQA 3B6NA 3E22B 1PXWA 2IQQA 3E20B 4IIJA 3WPWA 4X3LA 1E7KA 3CPQA 1W581 3JVHA 4YJ2A 5CA0A 4NWOB 4LCKA 1VQNF 4HNAB 4ZK7A 5CA1A 2ZVZA 5CB4A 1K9MH 3IR9A 4WBNB 4R40B 5KMGA 3WJPA 4TV9A 2LCAA 2YYEA 5HWEA 1X7PA 1ZWZA 2CWJA 1H48A 3N4YA 3F6MA 5IYZB 3HKEB 1Z5WA 3SIVA 3JARB 4TV8A 4B62A 1M1KH 3IEWA 1QVFF 1GX1A 5BMVA 3JAKA 1VQOF 3P4EA 5JH7B 1J7HA 1DT9A 4ZI7B 1QD9A 4G4ZA 4X20A 1GO0A 2KGWA 1JY8A 5IT9M 1VQ6F 3VIUA 3CXCF 3P0ZA 4B46A 5IJ9A 5EYPB 3ZO8A 3WGKA 5EZYA 2VGMA 3HKDB 2P6YA 2R751 3IMPA 3AGKA 3D00A 5GIPC 3LWQC 3CD6F 4NQ3A 1YITF 4XCQA 5LYJB 1SDSA 4X1IA 5HY1A 3GYQA 1NQ3A 3TD3A 3CMAF 5MN5A 3NVKE 3KHNA 5CA1B 5DCVA 1JJ2F 5KMGB 3MCAB 5FNVA 2OTLF 1RQ7A 1YQNA 1U3LA 3PAFA 1W40A 3VO8A 5ITZA 2B33A 4TV8B 4C4WC 3UT5A 2KTUA 3DC2A 5BMVB 2OTMA 3F0EA 3JAKB 3GTZA 3KIZA 1H47A 4X20B 5LP6C 3RYFB 1YI2F 1VH8A 4IHJB 4B5CA 5A2QM 3JALB 2VXYA 4KWEA 4F6RA 3NK7A 4TUYA 4EB6A 5IJ9B 3V4DA 1QVGF 5C8YA 2LBWA 1S72F 3CCVF 1GZ0A 1COMA 3QUWA 2QI2A 4X1KA 3CG6A 3JASA 4O4IA 4C81A 5EB1B 1OAPA 4BT4A 3OBYA 3G4SF 5IJ0A 3KJJA 1JD1A 5LA6A 3FD6A 1FNKA 4O2AA 4X1IB 2RHJA 3HKCA 3V7QA 1CLIA 1VQ8F 1W5AA 1CN7A 3NK6A 1VQKF 1PF5A 2RHLA 1U40A 5HY4A 3CCSF 1FFXA 5EWRA 4ZHVA 5LOVA 2JNBA 5FNVB 3HWUA 3V7EA 5J2TA 1VQVA 1ODEA 3I3FA 3M4SA 4ZOLA 3MQWA 5MN4A 3S03A 2WALA 2GVIA 3CCJF 5ITZB 5MN6A 2ZAUA 1K73H 3V3TA 3UT5B 3FPIA 1XV2A 3FBAA 3JCMM 1T0AA 2UYNA 2QEXF 1U43A 4G4XA 1W59A 3CC2F 3QTYA 3VYTC 2AMTA 1UFYA 3LMEA 3N2KA 4F6RB 4O2BA 4TUYB 4EB6B 3JATA 5HP7A 3K12A 1XBIA 1W42A 1YJ9F 4G4YA 1UI9A 5EO3A 2DT4A 3RYIB 5KX5A 3I7TA 3SIUA 3F0FA 3JASB 4O4IB 5IJ0B 3HJWC 3KJKA 3VCZA 2KG4A 3J7AR 3D01A 4O2AB 2Z01A 1Q81H 1JFFB 3ZP7A 1W2BF 1FFXB 1W5BA 2UYJA 3FFMA 1RQ2A 3K14A 4I4TB 3RYCA 3VYSC 3U0OA 4O4HB 3CCLF 5J2TB 4O4JA 1YGYA 3MCQA 2UZHA 5LP6A 2I6DA 3VTIC 3G71F 4BY9D 2FC3A 4BT7A 5GANK 4IIJB 3KE1A 3WJRA 2HRYA 3TD5A 3QHDA 3OONA 3DDNA 3CCMF 1KC8H 1W55A 3R0PA 3F0GA 4C82A 2UYNB 4YJ2B 5CA0B 3JAWA 4X3MA 2PHNA 4LNUA 3RA6A 3NVIB 1KNKA 1W5EA 2YXZA 3IKFA 1KQSF 3LDTA 5CB4B 3HAXD 2Z1TA 3LFOA 2VAPA 3M84A 3HTNA 5HY2A 4TV9B 3LWRC 2ZVYA 4O2BB 3JATB 2HVYD 2IG8A 3RYHA 1KNJA 1Q82H 2VAMA 1SA0A 5KX5B 2MQEA 2FGYA 1U3PA 3ERNA 5B8FA 4G4WA 3IKEA 1QU9A 2Z1EA 2OZBA 3C9UA 3J81M 1W41A 3VYUC 2RB9A 3G6EF 2QA4F 2HQSC 4BVRA 1R1MA 3O85A 4G88A 1VHAA 2V9YA 1NJIH 1Q8RA 3ELCA 5J2UA 2HP0A 3MBMA 2Q1YA 4RQOA 1YJNF 2CSLA 5EZYB 2K1SA 3RE3A 5JCOC 2GLZA 4O4JB 5LP6B 3EORA 3N2GA 4C8GA 3C9RA 3N4ZA 3I56F 1XRGA 4HNAA 4ERHA 2F9ZC 3GHZA 4FFBA 1VK3A 2RHOA 4BVTA 4U39A 5G4VC 4WBNA 3ESJA 5GINC 3S06A 1YHQF 3JAWB 5EIBD 1GO1A 4YJ3A 4DRXA 3OW2F 4BW0B 5HXUA 2G9IA 1W57A 5FJ4C 2CW4A 1IV2A 1QAHA 5HXZA 4B45A 1K8AH 3K0TA 1CK2A 2CZWA 1SA0B 4G4VA 3WGJA 1TVKA 4BVSA 3OBWA 2CHSA 3D54A 3J80M 5EYPA 3MDOA 3WXMB 3I55F 2H6LA 3LYBA 1X25A 2W8BC 4ZHQA 3C9TA 4X1YA 3S02A 2ZF8A 3P10A 5C8YB 5LYJA 1NMUB 5JQGA 2H8CA 4U3JA 3PLAC 2QTPA 5HP8A 3N2GB 4X1KB 2AIFA 3WJQA 4ZHWA 2HRUA 3F0DA 2VAWA 3WGLA 5LA6B 2ZODA 3WGMA 4O4LA 1H7MA 4FFBB 1XHOA 1DBFA 3HKCB 3LWPC 2DYYA 3M1XA 5AVMA 2BTUA 2HS0A 4E6EA 3L7QA 1Z5VA 4YJ3B 1VQ4F 4DRXB 4I50A 2HS4A 3C8LA 2NMUA 3HKBA 4I55A 4BT3A 4EI9A 5LOVB 2OTJF 3WGNA 4EI7A 2UYKA 5HY0A 1SZQA 3CC4F 1JN1A 3CYQA 4ZOLB 1KD1H 2BO1A 3ZP4A 3ZOPA 2UYPA 3LWVC 1Q86H 3WPXA 3RYFA 1FSZA 1X52A 1YIJF 4IHJA 2CVLA 3JALA 1FNJA 1TVKB 1IV4A 3LWOC 4TZZA 2GZLA 5JCOA 4NUTA 2LBTA 4PWTA 3CYPB 4ZHQB 4X1YB 3N2KB 4C8IA 5EB0A 4BT5A 1T0KB 5FLXM 3JAMM 3CPWF 3CB2A 5GIOC 2N48A 5JQGB 2Q1XA 2OHWA 4U3JB 2IAFA 4M8IA 5JVDA 3K2XA 3ON1A 5GONA 4ZHYB 3S0YA 3VI6A 3TD4A 1X7OA 4O4LB 1RLUA 2VGNA 5LXTA 4BVQA 4EI8A 2CHTA 3T80A 1TUBA 2HS3A 1N8RH 1W5FA 3CCRF 3NMUC 2HP3A 2R6R1 1M90H 4I50B 3HKBB 3CCQF 4I55B 3E22A 3CCUF 1VQPF 1RA4A 3RYCB 3S0HA 5EAZA 3VOAA 3CCEF 2PMPA 1OFUA 2BTQB 4DXDA 1IV3A
chains in the Genus database with same CATH topology
4NWOB 1QU9A 2UYNA 3R0PA 2CHSA 2CVLA 3D01A 1FNJA 2UYNB 1NQ3A 1XHOA 1ONIA 1DBFA 1PF5A 3VCZA 4ZK7A 2DYYA 1UFYA 3LMEA 3ZP7A 3M1XA 2CHTA 2EWCA 3LYBA 1X25A 2UYJA 3ZO8A 3L7QA 2CWJA 3V4DA 5HP7A 3K12A 1ODEA 2CSLA 3KJKA 2IG8A 2CW4A 3I3FA 1QAHA 3M4SA 3MQWA 2UYKA 1UI9A 1COMA 3K0TA 3QUWA 2B33A 3I7TA 3ZP4A 5HP8A 3ZOPA 2UYPA 3KJJA 2OTMA 1JD1A 1XRGA 1J7HA 3GTZA 1FNKA 1QD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NWO B;  1QU9 A;  2UYN A;  3R0P A;  2CHS A;  2CVL A;  3D01 A;  1FNJ A;  2UYN B;  1NQ3 A;  1XHO A;  1ONI A;  1DBF A;  1PF5 A;  3VCZ A;  4ZK7 A;  2DYY A;  1UFY A;  3LME A;  3ZP7 A;  3M1X A;  2CHT A;  2EWC A;  3LYB A;  1X25 A;  2UYJ A;  3ZO8 A;  3L7Q A;  2CWJ A;  3V4D A;  5HP7 A;  3K12 A;  1ODE A;  2CSL A;  3KJK A;  2IG8 A;  2CW4 A;  3I3F A;  1QAH A;  3M4S A;  3MQW A;  2UYK A;  1UI9 A;  1COM A;  3K0T A;  3QUW A;  2B33 A;  3I7T A;  3ZP4 A;  5HP8 A;  3ZOP A;  2UYP A;  3KJJ A;  2OTM A;  1JD1 A;  1XRG A;  1J7H A;  3GTZ A;  1FNK A;  1QD9 A; 
#chains in the Genus database with same CATH topology
 4BT6 A;  2I6R A;  4C8E A;  2LBX A;  5EIB C;  2Z1U A;  2RHH A;  2ZOV A;  4LNU B;  1YJW F;  3VOB A;  4BT2 A;  5IYZ A;  1VQ5 F;  3HKE A;  2Z1F A;  1VQL F;  3JAR A;  3Q8H A;  3CC7 F;  3RYI A;  2H8E A;  4RHA A;  3RYH B;  3C9S A;  2AIZ P;  2BTO A;  1VQM F;  5JH7 A;  4ZI7 A;  1Q7Y H;  3FD5 A;  5JVD B;  3CME F;  1JFF A;  3BYQ A;  3RA5 A;  3S0W A;  5GON B;  2KTV A;  2ALE A;  2L26 A;  3VMF B;  1ONI A;  1VQ9 F;  2EWC A;  1W3E X;  5LXT B;  2HX0 A;  1RLG A;  4I4T A;  1IPA A;  1TUB B;  4O4H A;  1VQ7 F;  3HKD A;  5G4U C;  5GAP K;  1IV1 A;  3E1Y A;  5J2U B;  2HP0 B;  3IEQ A;  3B6N A;  3E22 B;  1PXW A;  2IQQ A;  3E20 B;  4IIJ A;  3WPW A;  4X3L A;  1E7K A;  3CPQ A;  1W58 1;  3JVH A;  4YJ2 A;  5CA0 A;  4NWO B;  4LCK A;  1VQN F;  4HNA B;  4ZK7 A;  5CA1 A;  2ZVZ A;  5CB4 A;  1K9M H;  3IR9 A;  4WBN B;  4R40 B;  5KMG A;  3WJP A;  4TV9 A;  2LCA A;  2YYE A;  5HWE A;  1X7P A;  1ZWZ A;  2CWJ A;  1H48 A;  3N4Y A;  3F6M A;  5IYZ B;  3HKE B;  1Z5W A;  3SIV A;  3JAR B;  4TV8 A;  4B62 A;  1M1K H;  3IEW A;  1QVF F;  1GX1 A;  5BMV A;  3JAK A;  1VQO F;  3P4E A;  5JH7 B;  1J7H A;  1DT9 A;  4ZI7 B;  1QD9 A;  4G4Z A;  4X20 A;  1GO0 A;  2KGW A;  1JY8 A;  5IT9 M;  1VQ6 F;  3VIU A;  3CXC F;  3P0Z A;  4B46 A;  5IJ9 A;  5EYP B;  3ZO8 A;  3WGK A;  5EZY A;  2VGM A;  3HKD B;  2P6Y A;  2R75 1;  3IMP A;  3AGK A;  3D00 A;  5GIP C;  3LWQ C;  3CD6 F;  4NQ3 A;  1YIT F;  4XCQ A;  5LYJ B;  1SDS A;  4X1I A;  5HY1 A;  3GYQ A;  1NQ3 A;  3TD3 A;  3CMA F;  5MN5 A;  3NVK E;  3KHN A;  5CA1 B;  5DCV A;  1JJ2 F;  5KMG B;  3MCA B;  5FNV A;  2OTL F;  1RQ7 A;  1YQN A;  1U3L A;  3PAF A;  1W40 A;  3VO8 A;  5ITZ A;  2B33 A;  4TV8 B;  4C4W C;  3UT5 A;  2KTU A;  3DC2 A;  5BMV B;  2OTM A;  3F0E A;  3JAK B;  3GTZ A;  3KIZ A;  1H47 A;  4X20 B;  5LP6 C;  3RYF B;  1YI2 F;  1VH8 A;  4IHJ B;  4B5C A;  5A2Q M;  3JAL B;  2VXY A;  4KWE A;  4F6R A;  3NK7 A;  4TUY A;  4EB6 A;  5IJ9 B;  3V4D A;  1QVG F;  5C8Y A;  2LBW A;  1S72 F;  3CCV F;  1GZ0 A;  1COM A;  3QUW A;  2QI2 A;  4X1K A;  3CG6 A;  3JAS A;  4O4I A;  4C81 A;  5EB1 B;  1OAP A;  4BT4 A;  3OBY A;  3G4S F;  5IJ0 A;  3KJJ A;  1JD1 A;  5LA6 A;  3FD6 A;  1FNK A;  4O2A A;  4X1I B;  2RHJ A;  3HKC A;  3V7Q A;  1CLI A;  1VQ8 F;  1W5A A;  1CN7 A;  3NK6 A;  1VQK F;  1PF5 A;  2RHL A;  1U40 A;  5HY4 A;  3CCS F;  1FFX A;  5EWR A;  4ZHV A;  5LOV A;  2JNB A;  5FNV B;  3HWU A;  3V7E A;  5J2T A;  1VQV A;  1ODE A;  3I3F A;  3M4S A;  4ZOL A;  3MQW A;  5MN4 A;  3S03 A;  2WAL A;  2GVI A;  3CCJ F;  5ITZ B;  5MN6 A;  2ZAU A;  1K73 H;  3V3T A;  3UT5 B;  3FPI A;  1XV2 A;  3FBA A;  3JCM M;  1T0A A;  2UYN A;  2QEX F;  1U43 A;  4G4X A;  1W59 A;  3CC2 F;  3QTY A;  3VYT C;  2AMT A;  1UFY A;  3LME A;  3N2K A;  4F6R B;  4O2B A;  4TUY B;  4EB6 B;  3JAT A;  5HP7 A;  3K12 A;  1XBI A;  1W42 A;  1YJ9 F;  4G4Y A;  1UI9 A;  5EO3 A;  2DT4 A;  3RYI B;  5KX5 A;  3I7T A;  3SIU A;  3F0F A;  3JAS B;  4O4I B;  5IJ0 B;  3HJW C;  3KJK A;  3VCZ A;  2KG4 A;  3J7A R;  3D01 A;  4O2A B;  2Z01 A;  1Q81 H;  1JFF B;  3ZP7 A;  1W2B F;  1FFX B;  1W5B A;  2UYJ A;  3FFM A;  1RQ2 A;  3K14 A;  4I4T B;  3RYC A;  3VYS C;  3U0O A;  4O4H B;  3CCL F;  5J2T B;  4O4J A;  1YGY A;  3MCQ A;  2UZH A;  5LP6 A;  2I6D A;  3VTI C;  3G71 F;  4BY9 D;  2FC3 A;  4BT7 A;  5GAN K;  4IIJ B;  3KE1 A;  3WJR A;  2HRY A;  3TD5 A;  3QHD A;  3OON A;  3DDN A;  3CCM F;  1KC8 H;  1W55 A;  3R0P A;  3F0G A;  4C82 A;  2UYN B;  4YJ2 B;  5CA0 B;  3JAW A;  4X3M A;  2PHN A;  4LNU A;  3RA6 A;  3NVI B;  1KNK A;  1W5E A;  2YXZ A;  3IKF A;  1KQS F;  3LDT A;  5CB4 B;  3HAX D;  2Z1T A;  3LFO A;  2VAP A;  3M84 A;  3HTN A;  5HY2 A;  4TV9 B;  3LWR C;  2ZVY A;  4O2B B;  3JAT B;  2HVY D;  2IG8 A;  3RYH A;  1KNJ A;  1Q82 H;  2VAM A;  1SA0 A;  5KX5 B;  2MQE A;  2FGY A;  1U3P A;  3ERN A;  5B8F A;  4G4W A;  3IKE A;  1QU9 A;  2Z1E A;  2OZB A;  3C9U A;  3J81 M;  1W41 A;  3VYU C;  2RB9 A;  3G6E F;  2QA4 F;  2HQS C;  4BVR A;  1R1M A;  3O85 A;  4G88 A;  1VHA A;  2V9Y A;  1NJI H;  1Q8R A;  3ELC A;  5J2U A;  2HP0 A;  3MBM A;  2Q1Y A;  4RQO A;  1YJN F;  2CSL A;  5EZY B;  2K1S A;  3RE3 A;  5JCO C;  2GLZ A;  4O4J B;  5LP6 B;  3EOR A;  3N2G A;  4C8G A;  3C9R A;  3N4Z A;  3I56 F;  1XRG A;  4HNA A;  4ERH A;  2F9Z C;  3GHZ A;  4FFB A;  1VK3 A;  2RHO A;  4BVT A;  4U39 A;  5G4V C;  4WBN A;  3ESJ A;  5GIN C;  3S06 A;  1YHQ F;  3JAW B;  5EIB D;  1GO1 A;  4YJ3 A;  4DRX A;  3OW2 F;  4BW0 B;  5HXU A;  2G9I A;  1W57 A;  5FJ4 C;  2CW4 A;  1IV2 A;  1QAH A;  5HXZ A;  4B45 A;  1K8A H;  3K0T A;  1CK2 A;  2CZW A;  1SA0 B;  4G4V A;  3WGJ A;  1TVK A;  4BVS A;  3OBW A;  2CHS A;  3D54 A;  3J80 M;  5EYP A;  3MDO A;  3WXM B;  3I55 F;  2H6L A;  3LYB A;  1X25 A;  2W8B C;  4ZHQ A;  3C9T A;  4X1Y A;  3S02 A;  2ZF8 A;  3P10 A;  5C8Y B;  5LYJ A;  1NMU B;  5JQG A;  2H8C A;  4U3J A;  3PLA C;  2QTP A;  5HP8 A;  3N2G B;  4X1K B;  2AIF A;  3WJQ A;  4ZHW A;  2HRU A;  3F0D A;  2VAW A;  3WGL A;  5LA6 B;  2ZOD A;  3WGM A;  4O4L A;  1H7M A;  4FFB B;  1XHO A;  1DBF A;  3HKC B;  3LWP C;  2DYY A;  3M1X A;  5AVM A;  2BTU A;  2HS0 A;  4E6E A;  3L7Q A;  1Z5V A;  4YJ3 B;  1VQ4 F;  4DRX B;  4I50 A;  2HS4 A;  3C8L A;  2NMU A;  3HKB A;  4I55 A;  4BT3 A;  4EI9 A;  5LOV B;  2OTJ F;  3WGN A;  4EI7 A;  2UYK A;  5HY0 A;  1SZQ A;  3CC4 F;  1JN1 A;  3CYQ A;  4ZOL B;  1KD1 H;  2BO1 A;  3ZP4 A;  3ZOP A;  2UYP A;  3LWV C;  1Q86 H;  3WPX A;  3RYF A;  1FSZ A;  1X52 A;  1YIJ F;  4IHJ A;  2CVL A;  3JAL A;  1FNJ A;  1TVK B;  1IV4 A;  3LWO C;  4TZZ A;  2GZL A;  5JCO A;  4NUT A;  2LBT A;  4PWT A;  3CYP B;  4ZHQ B;  4X1Y B;  3N2K B;  4C8I A;  5EB0 A;  4BT5 A;  1T0K B;  5FLX M;  3JAM M;  3CPW F;  3CB2 A;  5GIO C;  2N48 A;  5JQG B;  2Q1X A;  2OHW A;  4U3J B;  2IAF A;  4M8I A;  5JVD A;  3K2X A;  3ON1 A;  5GON A;  4ZHY B;  3S0Y A;  3VI6 A;  3TD4 A;  1X7O A;  4O4L B;  1RLU A;  2VGN A;  5LXT A;  4BVQ A;  4EI8 A;  2CHT A;  3T80 A;  1TUB A;  2HS3 A;  1N8R H;  1W5F A;  3CCR F;  3NMU C;  2HP3 A;  2R6R 1;  1M90 H;  4I50 B;  3HKB B;  3CCQ F;  4I55 B;  3E22 A;  3CCU F;  1VQP F;  1RA4 A;  3RYC B;  3S0H A;  5EAZ A;  3VOA A;  3CCE F;  2PMP A;  1OFU A;  2BTQ B;  4DXD A;  1IV3 A; 
#chains in the Genus database with same CATH homology
 4NWO B;  1QU9 A;  2UYN A;  3R0P A;  2CHS A;  2CVL A;  3D01 A;  1FNJ A;  2UYN B;  1NQ3 A;  1XHO A;  1ONI A;  1DBF A;  1PF5 A;  3VCZ A;  4ZK7 A;  2DYY A;  1UFY A;  3LME A;  3ZP7 A;  3M1X A;  2CHT A;  2EWC A;  3LYB A;  1X25 A;  2UYJ A;  3ZO8 A;  3L7Q A;  2CWJ A;  3V4D A;  5HP7 A;  3K12 A;  1ODE A;  2CSL A;  3KJK A;  2IG8 A;  2CW4 A;  3I3F A;  1QAH A;  3M4S A;  3MQW A;  2UYK A;  1UI9 A;  1COM A;  3K0T A;  3QUW A;  2B33 A;  3I7T A;  3ZP4 A;  5HP8 A;  3ZOP A;  2UYP A;  3KJJ A;  2OTM A;  1JD1 A;  1XRG A;  1J7H A;  3GTZ A;  1FNK A;  1QD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...