5HP7A

Crystal structures of rida in the apo form
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
SQAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLADLADFKTVNEIYAKYFPAPSPARSTYQVAALPLNAKIEIECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reactive Intermediate Deaminase A, chloroplastic
publication title Crystal structures of RidA, an important enzyme for the prevention of toxic side products
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 33
structure length 108
sequence length 108
ec nomenclature ec 3.5.99.10: 2-iminobutanoate/2-iminopropanoate deaminase.
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 5hp7A00
3I3FA 1UFYA 1XHOA 2UYKA 3K0TA 3R0PA 2CSLA 1ONIA 2DYYA 2OTMA 5HP7A 3MQWA 3L7QA 1PF5A 2UYNA 3M4SA 1COMA 3M1XA 1JD1A 3ZP4A 1DBFA 3ZOPA 4NWOB 2UYJA 1QU9A 2CVLA 1ODEA 1QD9A 3KJJA 3I7TA 1XRGA 2CHTA 3K12A 2EWCA 2CWJA 2IG8A 3VCZA 3KJKA 3LYBA 1J7HA 5HP8A 2B33A 2UYNB 2CW4A 3LMEA 3GTZA 2UYPA 1NQ3A 3V4DA 1FNJA 1X25A 1UI9A 1QAHA 1FNKA 2CHSA 3QUWA 4ZK7A 3ZO8A 3D01A 3ZP7A
chains in the Genus database with same CATH superfamily
1M90H 3VYTC 2YYEA 2VGNA 1VQ5F 2CZWA 4R40B 4C81A 5HXZA 5EAZA 2LBTA 1Q82H 1COMA 2HRUA 4X20B 1W41A 2ZVYA 3RYIA 2P6YA 3F0DA 4X1YB 2HQSC 3ELCA 3HKEA 4X1KA 5EYPB 1ODEA 1QD9A 3JASA 3JATB 5HY2A 2NMUA 4WBNA 3I56F 4O2BA 1VH8A 3S06A 3C9RA 4C82A 4X3LA 2Q1XA 1FNKA 1U40A 4ZK7A 3QTYA 1JJ2F 1ONIA 3RYHB 5G4UC 3J7AR 3M1XA 3I55F 2HVYD 2AIZP 1S72F 4ZHYB 4BVRA 2RB9A 4O4HB 5LXTA 3JARA 4BT7A 1W3EX 5CA1A 5FJ4C 4I4TA 3N4ZA 3JALB 3V3TA 3VMFB 1RQ2A 2I6RA 5JVDB 1VQ7F 3VTIC 4IHJB 3AGKA 2CSLA 3HKBB 4G4VA 3BYQA 5GANK 4LNUB 3SIUA 2HRYA 2RHHA 2GLZA 3JAWB 1VQMF 5HY0A 1FSZA 3Q8HA 1FFXB 3P10A 2CHTA 5CB4A 5CA0B 3CC7F 5EZYB 1CK2A 5ITZB 3B6NA 4BVTA 4YJ2B 1E7KA 4C8EA 3CD6F 3S02A 5LP6B 5IJ0B 1K8AH 5LP6C 1YITF 3JVHA 2OTLF 3M4SA 4YJ3A 2AMTA 1JD1A 3G4SF 4IIJB 4B45A 5LOVB 5JH7A 4TV9A 3VOBA 3ZOPA 4C8GA 1PXWA 2R751 1K9MH 3JAKB 5C8YA 3CXCF 1XRGA 4F6RB 2YXZA 1U3LA 4BY9D 1W59A 5HP8A 1RQ7A 5KX5A 3GTZA 4B62A 4O4LB 3HTNA 1VQNF 2LBWA 2FGYA 3PAFA 1SA0A 3CCJF 3F6MA 1JN1A 3OBWA 4BT6A 1W57A 4O4JB 1VQPF 2RHOA 3P0ZA 4I55A 2MQEA 3RA5A 2OHWA 4ZHQA 1GX1A 1VQVA 1QVFF 3S0YA 1OAPA 3RA6A 3E22A 3JAMM 3CPWF 4EB6B 3HKDB 3NVIB 5KMGA 3K12A 3QHDA 1TVKB 2UZHA 5BMVB 3SIVA 3LYBA 5JQGB 3LMEA 3KHNA 2QEXF 3TD3A 1YJ9F 3C8LA 1GO1A 2QI2A 2PMPA 1Z5WA 2VAWA 3MDOA 2QTPA 5IJ9B 1W2BF 1Q8RA 1KQSF 1U3PA 3NK6A 1DBFA 3CG6A 2K1SA 2QA4F 1QU9A 4DRXA 4LCKA 2BTQB 2KTVA 1K73H 1Q7YH 1RLUA 4X20A 3G71F 4ZI7B 2ZF8A 3CYPB 2IQQA 1KNKA 2F9ZC 1DT9A 2CHSA 2Z1FA 5EYPA 3RYIB 5IT9M 1U43A 3N2KA 3LWQC 2HS3A 3MCQA 2ZAUA 3VO8A 3ERNA 5HP7A 4WBNB 4O2BB 4C4WC 3G6EF 1T0AA 2BTOA 1W5AA 5IYZB 2AIFA 3D00A 3WPWA 1SZQA 1X7OA 1TUBA 4XCQA 3KJJA 1VQOF 3RYHA 1IV4A 3CPQA 1OFUA 2OTJF 1YI2F 3F0GA 3S0HA 4TZZA 1Q86H 3UT5A 4BT4A 2Q1YA 4FFBA 3GHZA 4B46A 2WALA 1H7MA 3RYCA 3HWUA 3ZO8A 4TV8B 3CCQF 3WGNA 4M8IA 3RYFB 3CCSF 4BW0B 3HKCA 4ZOLA 2UYNA 5CA1B 4I4TB 3LDTA 2OZBA 2ALEA 4O4IB 2JNBA 5FNVA 3VIUA 4KWEA 5LA6A 2KG4A 1YIJF 2RHLA 1GZ0A 1NJIH 4O2AA 2UYPA 5HY4A 1X25A 5J2UA 5EIBC 2N48A 2HS4A 2R6R1 1FFXA 2HS0A 5EB0A 5JCOA 5HXUA 4TUYB 1W5FA 3K0TA 5CA0A 5HY1A 5EZYA 2L26A 3MBMA 2DYYA 4HNAB 3IR9A 5CB4B 5ITZA 3N2GB 3TD5A 1PF5A 3E20B 3KE1A 4C8IA 5FLXM 3EORA 1JFFA 5EO3A 3CYQA 5IJ0A 1X52A 3RE3A 3WJRA 3OONA 1GO0A 2B33A 1ZWZA 2GVIA 1KNJA 4YJ3B 3N4YA 4IIJA 4U39A 4DXDA 5J2TA 3QUWA 3D54A 3HJWC 1VQ9F 5EB1B 4EI7A 5C8YB 4G88A 3R0PA 3JCMM 4ERHA 4I50A 5GONA 3CMAF 1VQ4F 5KX5B 3LWRC 3VYUC 2HX0A 3WGKA 3S03A 1SA0B 5GIOC 4O4JA 4U3JB 2RHJA 4I55B 1W5BA 4X1IA 2BO1A 3F0FA 4ZHQB 3TD4A 1YJNF 3IKFA 1FNJA 2LBXA 1QAHA 3CB2A 4EB6A 3HKDA 5LYJA 2W8BC 2Z1EA 1TVKA 1YGYA 3IKEA 4BT3A 2HP0B 5KMGB 2OTMA 5JQGA 1IV3A 1Q81H 3L7QA 3ESJA 5GINC 1VHAA 1X7PA 3WJPA 4NWOB 5MN5A 3WGMA 1XBIA 3V7EA 5AVMA 3K14A 3VI6A 3V4DA 3CMEF 3IEQA 1W5EA 4RQOA 4X1YA 2BTUA 1YHQF 3M84A 4E6EA 4DRXB 3I3FA 1UFYA 4X1KB 3HKEB 2PHNA 2V9YA 3JATA 2H8CA 3JASB 4ZHWA 1VQKF 4BT2A 4ZI7A 2VXYA 2Z1TA 3DC2A 3DDNA 3C9UA 4NQ3A 4BVSA 3N2KB 3IEWA 1W42A 2DT4A 1VQ8F 4G4XA 5IYZA 4G4ZA 1SDSA 3NK7A 5MN6A 1KD1H 3J81M 3NMUC 1TUBB 4O4HA 4BVQA 3FBAA 1W40A 3OBYA 5LXTB 3JARB 1YJWF 3V7QA 2ZVZA 3UT5B 3CCLF 2LCAA 1VQ6F 3JALA 3CC2F 3KIZA 4FFBB 1W55A 4TV8A 5JVDA 4X3MA 3RYCB 3T80A 2CVLA 4IHJA 3RYFA 2KGWA 5B8FA 3I7TA 2EWCA 3HKBA 4LNUA 3PLAC 3HKCB 4ZOLB 3MCAB 2UYNB 5EIBD 4O4IA 1NQ3A 2Z01A 3FPIA 3JAWA 3NVKE 1VK3A 3CCEF 5FNVB 1XV2A 5LA6B 5GAPK 2GZLA 5EWRA 3LWPC 1RLGA 2VAPA 4O2AB 5J2UB 4YJ2A 3VYSC 3VOAA 1QVGF 4TUYA 2UYJA 4EI9A 5LP6A 3U0OA 3C9SA 5MN4A 4HNAA 5JCOC 4ZHVA 3WPXA 2CWJA 3N2GA 1J7HA 3KJKA 3CCRF 3CC4F 2FC3A 2ZOVA 1JY8A 1Z5VA 3FD6A 1W581 3C9TA 1JFFB 1CLIA 4EI8A 5LOVA 1N8RH 1M1KH 3HAXD 2H6LA 3VCZA 5G4VC 3D01A 5JH7B 4TV9B 1VQLF 3JAKA 1XHOA 1YQNA 4F6RA 4G4YA 3WJQA 3MQWA 4O4LA 2I6DA 3FD5A 3P4EA 3IMPA 5J2TB 3F0EA 4BT5A 1H47A 3LFOA 3LWVC 3OW2F 2VAMA 2HP3A 2IG8A 4B5CA 3WXMB 4I50B 5GONB 3WGJA 1IV1A 2Z1UA 3CCVF 4PWTA 1NMUB 3O85A 1CN7A 1UI9A 1RA4A 3J80M 4U3JA 3GYQA 4NUTA 3E22B 5HWEA 1R1MA 4RHAA 2UYKA 3K2XA 5BMVA 3LWOC 5A2QM 4X1IB 2VGMA 1T0KB 3ON1A 1IV2A 3CCUF 3CCMF 3S0WA 2KTUA 3FFMA 3ZP4A 3WGLA 5LYJB 2HP0A 2ZODA 1H48A 5GIPC 2IAFA 2H8EA 5DCVA 5IJ9A 2CW4A 4G4WA 2G9IA 1KC8H 1IPAA 3E1YA 3ZP7A
chains in the Genus database with same CATH topology
3I3FA 1UFYA 1XHOA 2UYKA 3K0TA 3R0PA 2CSLA 1ONIA 2DYYA 2OTMA 5HP7A 3MQWA 3L7QA 1PF5A 2UYNA 3M4SA 1COMA 3M1XA 1JD1A 3ZP4A 1DBFA 3ZOPA 4NWOB 2UYJA 1QU9A 2CVLA 1ODEA 1QD9A 3KJJA 3I7TA 1XRGA 2CHTA 3K12A 2EWCA 2CWJA 2IG8A 3VCZA 3KJKA 3LYBA 1J7HA 5HP8A 2B33A 2UYNB 2CW4A 3LMEA 3GTZA 2UYPA 1NQ3A 3V4DA 1FNJA 1X25A 1UI9A 1QAHA 1FNKA 2CHSA 3QUWA 4ZK7A 3ZO8A 3D01A 3ZP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3F A;  1UFY A;  1XHO A;  2UYK A;  3K0T A;  3R0P A;  2CSL A;  1ONI A;  2DYY A;  2OTM A;  5HP7 A;  3MQW A;  3L7Q A;  1PF5 A;  2UYN A;  3M4S A;  1COM A;  3M1X A;  1JD1 A;  3ZP4 A;  1DBF A;  3ZOP A;  4NWO B;  2UYJ A;  1QU9 A;  2CVL A;  1ODE A;  1QD9 A;  3KJJ A;  3I7T A;  1XRG A;  2CHT A;  3K12 A;  2EWC A;  2CWJ A;  2IG8 A;  3VCZ A;  3KJK A;  3LYB A;  1J7H A;  5HP8 A;  2B33 A;  2UYN B;  2CW4 A;  3LME A;  3GTZ A;  2UYP A;  1NQ3 A;  3V4D A;  1FNJ A;  1X25 A;  1UI9 A;  1QAH A;  1FNK A;  2CHS A;  3QUW A;  4ZK7 A;  3ZO8 A;  3D01 A;  3ZP7 A; 
#chains in the Genus database with same CATH topology
 1M90 H;  3VYT C;  2YYE A;  2VGN A;  1VQ5 F;  2CZW A;  4R40 B;  4C81 A;  5HXZ A;  5EAZ A;  2LBT A;  1Q82 H;  1COM A;  2HRU A;  4X20 B;  1W41 A;  2ZVY A;  3RYI A;  2P6Y A;  3F0D A;  4X1Y B;  2HQS C;  3ELC A;  3HKE A;  4X1K A;  5EYP B;  1ODE A;  1QD9 A;  3JAS A;  3JAT B;  5HY2 A;  2NMU A;  4WBN A;  3I56 F;  4O2B A;  1VH8 A;  3S06 A;  3C9R A;  4C82 A;  4X3L A;  2Q1X A;  1FNK A;  1U40 A;  4ZK7 A;  3QTY A;  1JJ2 F;  1ONI A;  3RYH B;  5G4U C;  3J7A R;  3M1X A;  3I55 F;  2HVY D;  2AIZ P;  1S72 F;  4ZHY B;  4BVR A;  2RB9 A;  4O4H B;  5LXT A;  3JAR A;  4BT7 A;  1W3E X;  5CA1 A;  5FJ4 C;  4I4T A;  3N4Z A;  3JAL B;  3V3T A;  3VMF B;  1RQ2 A;  2I6R A;  5JVD B;  1VQ7 F;  3VTI C;  4IHJ B;  3AGK A;  2CSL A;  3HKB B;  4G4V A;  3BYQ A;  5GAN K;  4LNU B;  3SIU A;  2HRY A;  2RHH A;  2GLZ A;  3JAW B;  1VQM F;  5HY0 A;  1FSZ A;  3Q8H A;  1FFX B;  3P10 A;  2CHT A;  5CB4 A;  5CA0 B;  3CC7 F;  5EZY B;  1CK2 A;  5ITZ B;  3B6N A;  4BVT A;  4YJ2 B;  1E7K A;  4C8E A;  3CD6 F;  3S02 A;  5LP6 B;  5IJ0 B;  1K8A H;  5LP6 C;  1YIT F;  3JVH A;  2OTL F;  3M4S A;  4YJ3 A;  2AMT A;  1JD1 A;  3G4S F;  4IIJ B;  4B45 A;  5LOV B;  5JH7 A;  4TV9 A;  3VOB A;  3ZOP A;  4C8G A;  1PXW A;  2R75 1;  1K9M H;  3JAK B;  5C8Y A;  3CXC F;  1XRG A;  4F6R B;  2YXZ A;  1U3L A;  4BY9 D;  1W59 A;  5HP8 A;  1RQ7 A;  5KX5 A;  3GTZ A;  4B62 A;  4O4L B;  3HTN A;  1VQN F;  2LBW A;  2FGY A;  3PAF A;  1SA0 A;  3CCJ F;  3F6M A;  1JN1 A;  3OBW A;  4BT6 A;  1W57 A;  4O4J B;  1VQP F;  2RHO A;  3P0Z A;  4I55 A;  2MQE A;  3RA5 A;  2OHW A;  4ZHQ A;  1GX1 A;  1VQV A;  1QVF F;  3S0Y A;  1OAP A;  3RA6 A;  3E22 A;  3JAM M;  3CPW F;  4EB6 B;  3HKD B;  3NVI B;  5KMG A;  3K12 A;  3QHD A;  1TVK B;  2UZH A;  5BMV B;  3SIV A;  3LYB A;  5JQG B;  3LME A;  3KHN A;  2QEX F;  3TD3 A;  1YJ9 F;  3C8L A;  1GO1 A;  2QI2 A;  2PMP A;  1Z5W A;  2VAW A;  3MDO A;  2QTP A;  5IJ9 B;  1W2B F;  1Q8R A;  1KQS F;  1U3P A;  3NK6 A;  1DBF A;  3CG6 A;  2K1S A;  2QA4 F;  1QU9 A;  4DRX A;  4LCK A;  2BTQ B;  2KTV A;  1K73 H;  1Q7Y H;  1RLU A;  4X20 A;  3G71 F;  4ZI7 B;  2ZF8 A;  3CYP B;  2IQQ A;  1KNK A;  2F9Z C;  1DT9 A;  2CHS A;  2Z1F A;  5EYP A;  3RYI B;  5IT9 M;  1U43 A;  3N2K A;  3LWQ C;  2HS3 A;  3MCQ A;  2ZAU A;  3VO8 A;  3ERN A;  5HP7 A;  4WBN B;  4O2B B;  4C4W C;  3G6E F;  1T0A A;  2BTO A;  1W5A A;  5IYZ B;  2AIF A;  3D00 A;  3WPW A;  1SZQ A;  1X7O A;  1TUB A;  4XCQ A;  3KJJ A;  1VQO F;  3RYH A;  1IV4 A;  3CPQ A;  1OFU A;  2OTJ F;  1YI2 F;  3F0G A;  3S0H A;  4TZZ A;  1Q86 H;  3UT5 A;  4BT4 A;  2Q1Y A;  4FFB A;  3GHZ A;  4B46 A;  2WAL A;  1H7M A;  3RYC A;  3HWU A;  3ZO8 A;  4TV8 B;  3CCQ F;  3WGN A;  4M8I A;  3RYF B;  3CCS F;  4BW0 B;  3HKC A;  4ZOL A;  2UYN A;  5CA1 B;  4I4T B;  3LDT A;  2OZB A;  2ALE A;  4O4I B;  2JNB A;  5FNV A;  3VIU A;  4KWE A;  5LA6 A;  2KG4 A;  1YIJ F;  2RHL A;  1GZ0 A;  1NJI H;  4O2A A;  2UYP A;  5HY4 A;  1X25 A;  5J2U A;  5EIB C;  2N48 A;  2HS4 A;  2R6R 1;  1FFX A;  2HS0 A;  5EB0 A;  5JCO A;  5HXU A;  4TUY B;  1W5F A;  3K0T A;  5CA0 A;  5HY1 A;  5EZY A;  2L26 A;  3MBM A;  2DYY A;  4HNA B;  3IR9 A;  5CB4 B;  5ITZ A;  3N2G B;  3TD5 A;  1PF5 A;  3E20 B;  3KE1 A;  4C8I A;  5FLX M;  3EOR A;  1JFF A;  5EO3 A;  3CYQ A;  5IJ0 A;  1X52 A;  3RE3 A;  3WJR A;  3OON A;  1GO0 A;  2B33 A;  1ZWZ A;  2GVI A;  1KNJ A;  4YJ3 B;  3N4Y A;  4IIJ A;  4U39 A;  4DXD A;  5J2T A;  3QUW A;  3D54 A;  3HJW C;  1VQ9 F;  5EB1 B;  4EI7 A;  5C8Y B;  4G88 A;  3R0P A;  3JCM M;  4ERH A;  4I50 A;  5GON A;  3CMA F;  1VQ4 F;  5KX5 B;  3LWR C;  3VYU C;  2HX0 A;  3WGK A;  3S03 A;  1SA0 B;  5GIO C;  4O4J A;  4U3J B;  2RHJ A;  4I55 B;  1W5B A;  4X1I A;  2BO1 A;  3F0F A;  4ZHQ B;  3TD4 A;  1YJN F;  3IKF A;  1FNJ A;  2LBX A;  1QAH A;  3CB2 A;  4EB6 A;  3HKD A;  5LYJ A;  2W8B C;  2Z1E A;  1TVK A;  1YGY A;  3IKE A;  4BT3 A;  2HP0 B;  5KMG B;  2OTM A;  5JQG A;  1IV3 A;  1Q81 H;  3L7Q A;  3ESJ A;  5GIN C;  1VHA A;  1X7P A;  3WJP A;  4NWO B;  5MN5 A;  3WGM A;  1XBI A;  3V7E A;  5AVM A;  3K14 A;  3VI6 A;  3V4D A;  3CME F;  3IEQ A;  1W5E A;  4RQO A;  4X1Y A;  2BTU A;  1YHQ F;  3M84 A;  4E6E A;  4DRX B;  3I3F A;  1UFY A;  4X1K B;  3HKE B;  2PHN A;  2V9Y A;  3JAT A;  2H8C A;  3JAS B;  4ZHW A;  1VQK F;  4BT2 A;  4ZI7 A;  2VXY A;  2Z1T A;  3DC2 A;  3DDN A;  3C9U A;  4NQ3 A;  4BVS A;  3N2K B;  3IEW A;  1W42 A;  2DT4 A;  1VQ8 F;  4G4X A;  5IYZ A;  4G4Z A;  1SDS A;  3NK7 A;  5MN6 A;  1KD1 H;  3J81 M;  3NMU C;  1TUB B;  4O4H A;  4BVQ A;  3FBA A;  1W40 A;  3OBY A;  5LXT B;  3JAR B;  1YJW F;  3V7Q A;  2ZVZ A;  3UT5 B;  3CCL F;  2LCA A;  1VQ6 F;  3JAL A;  3CC2 F;  3KIZ A;  4FFB B;  1W55 A;  4TV8 A;  5JVD A;  4X3M A;  3RYC B;  3T80 A;  2CVL A;  4IHJ A;  3RYF A;  2KGW A;  5B8F A;  3I7T A;  2EWC A;  3HKB A;  4LNU A;  3PLA C;  3HKC B;  4ZOL B;  3MCA B;  2UYN B;  5EIB D;  4O4I A;  1NQ3 A;  2Z01 A;  3FPI A;  3JAW A;  3NVK E;  1VK3 A;  3CCE F;  5FNV B;  1XV2 A;  5LA6 B;  5GAP K;  2GZL A;  5EWR A;  3LWP C;  1RLG A;  2VAP A;  4O2A B;  5J2U B;  4YJ2 A;  3VYS C;  3VOA A;  1QVG F;  4TUY A;  2UYJ A;  4EI9 A;  5LP6 A;  3U0O A;  3C9S A;  5MN4 A;  4HNA A;  5JCO C;  4ZHV A;  3WPX A;  2CWJ A;  3N2G A;  1J7H A;  3KJK A;  3CCR F;  3CC4 F;  2FC3 A;  2ZOV A;  1JY8 A;  1Z5V A;  3FD6 A;  1W58 1;  3C9T A;  1JFF B;  1CLI A;  4EI8 A;  5LOV A;  1N8R H;  1M1K H;  3HAX D;  2H6L A;  3VCZ A;  5G4V C;  3D01 A;  5JH7 B;  4TV9 B;  1VQL F;  3JAK A;  1XHO A;  1YQN A;  4F6R A;  4G4Y A;  3WJQ A;  3MQW A;  4O4L A;  2I6D A;  3FD5 A;  3P4E A;  3IMP A;  5J2T B;  3F0E A;  4BT5 A;  1H47 A;  3LFO A;  3LWV C;  3OW2 F;  2VAM A;  2HP3 A;  2IG8 A;  4B5C A;  3WXM B;  4I50 B;  5GON B;  3WGJ A;  1IV1 A;  2Z1U A;  3CCV F;  4PWT A;  1NMU B;  3O85 A;  1CN7 A;  1UI9 A;  1RA4 A;  3J80 M;  4U3J A;  3GYQ A;  4NUT A;  3E22 B;  5HWE A;  1R1M A;  4RHA A;  2UYK A;  3K2X A;  5BMV A;  3LWO C;  5A2Q M;  4X1I B;  2VGM A;  1T0K B;  3ON1 A;  1IV2 A;  3CCU F;  3CCM F;  3S0W A;  2KTU A;  3FFM A;  3ZP4 A;  3WGL A;  5LYJ B;  2HP0 A;  2ZOD A;  1H48 A;  5GIP C;  2IAF A;  2H8E A;  5DCV A;  5IJ9 A;  2CW4 A;  4G4W A;  2G9I A;  1KC8 H;  1IPA A;  3E1Y A;  3ZP7 A; 
#chains in the Genus database with same CATH homology
 3I3F A;  1UFY A;  1XHO A;  2UYK A;  3K0T A;  3R0P A;  2CSL A;  1ONI A;  2DYY A;  2OTM A;  5HP7 A;  3MQW A;  3L7Q A;  1PF5 A;  2UYN A;  3M4S A;  1COM A;  3M1X A;  1JD1 A;  3ZP4 A;  1DBF A;  3ZOP A;  4NWO B;  2UYJ A;  1QU9 A;  2CVL A;  1ODE A;  1QD9 A;  3KJJ A;  3I7T A;  1XRG A;  2CHT A;  3K12 A;  2EWC A;  2CWJ A;  2IG8 A;  3VCZ A;  3KJK A;  3LYB A;  1J7H A;  5HP8 A;  2B33 A;  2UYN B;  2CW4 A;  3LME A;  3GTZ A;  2UYP A;  1NQ3 A;  3V4D A;  1FNJ A;  1X25 A;  1UI9 A;  1QAH A;  1FNK A;  2CHS A;  3QUW A;  4ZK7 A;  3ZO8 A;  3D01 A;  3ZP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...